F486818
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 959 | 387 | 944 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100008282|Ga0068863_1000082825 |
| Length | 196 |
| Sequence | MRLPRYACRSYSARGESIVAQHQDTILPSELVEAARRVVDANRAAGRKVAVAESCTGGLVSAALTEIAGSSDVVGACFVTYSNDAKISMLGVSMELIETFGAVSIAVAWAMARGALEHSGADTAVAITGVAGPGGGTDKKPVGTVVFGRARKGRDAEDIVADKRHFGDLGRGGVRLQAALCALELLMPGATLSGDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 5 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 6 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 7 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 8 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 9 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 10 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 11 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 12 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 13 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 14 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 15 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 16 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 17 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 18 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 19 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 20 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 21 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 22 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 25 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 241 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 242 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 245 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 248 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 249 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 250 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 255 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 318 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 328 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 330 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 335 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 336 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 338 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 340 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 342 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 343 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 344 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 352 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 354 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 355 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 358 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 359 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 362 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 363 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 375 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 376 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 377 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 378 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 380 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 381 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 383 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 385 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 386 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 387 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 0.1 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 13.24 |
| Nodule | 0.21 |
| Rhizoplane | 2.29 |
| Rhizosphere | 74.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1180352 | 2162886007 | Bacteria | 6701 |
| 2 | ARcpr5yngRDRAFT_c001224 | 3300000043 | Bacteria | 2887 |
| 3 | LJQas_1013961 | 3300000549 | Bacteria | 944 |
| 4 | ARCol0yngRDRAFT_1002626 | 3300000652 | Bacteria | 1347 |
| 5 | JGI24736J21556_1005436 | 3300001904 | Bacteria | 2152 |
| 6 | JGI24736J21556_1010100 | 3300001904 | Bacteria | 1547 |
| 7 | JGI24741J21665_1000043 | 3300001915 | Bacteria | 30255 |
| 8 | JGI24752J21851_1006306 | 3300001976 | Bacteria | 1550 |
| 9 | JGI24739J22299_10001086 | 3300001989 | Bacteria | 10126 |
| 10 | JGI24739J22299_10008251 | 3300001989 | Bacteria | 3886 |
| 11 | JGI24739J22299_10008868 | 3300001989 | Bacteria | 3750 |
| 12 | JGI24739J22299_10032344 | 3300001989 | Bacteria | 1800 |
| 13 | JGI24739J22299_10103781 | 3300001989 | Bacteria | 857 |
| 14 | JGI24739J22299_10150961 | 3300001989 | Bacteria | 687 |
| 15 | JGI24737J22298_10008114 | 3300001990 | Bacteria | 3529 |
| 16 | JGI24737J22298_10008735 | 3300001990 | Bacteria | 3383 |
| 17 | JGI24737J22298_10018638 | 3300001990 | Bacteria | 2226 |
| 18 | JGI24737J22298_10059028 | 3300001990 | Bacteria | 1156 |
| 19 | JGI24735J21928_10000815 | 3300002067 | Bacteria | 11084 |
| 20 | JGI24735J21928_10013121 | 3300002067 | Bacteria | 2610 |
| 21 | JGI24735J21928_10025174 | 3300002067 | Bacteria | 1797 |
| 22 | JGI24735J21928_10031019 | 3300002067 | Bacteria | 1585 |
| 23 | JGI24735J21928_10045121 | 3300002067 | Bacteria | 1280 |
| 24 | JGI24735J21928_10046323 | 3300002067 | Bacteria | 1261 |
| 25 | JGI24738J21930_10001110 | 3300002075 | Bacteria | 7590 |
| 26 | JGI24738J21930_10003415 | 3300002075 | Bacteria | 4008 |
| 27 | JGI24749J21850_1000111 | 3300002076 | Bacteria | 13544 |
| 28 | JGI24751J29686_10000002 | 3300002459 | Bacteria | 160619 |
| 29 | JGI24751J29686_10004995 | 3300002459 | Bacteria | 2704 |
| 30 | JGI24751J29686_10020488 | 3300002459 | Bacteria | 1369 |
| 31 | JGI25151J46595_10009635 | 3300003187 | Bacteria | 4558 |
| 32 | JGI25165J46597_1000032 | 3300003214 | Bacteria | 294371 |
| 33 | JGI25153J46596_10000002 | 3300003215 | Bacteria | 653569 |
| 34 | JGI25153J46596_10000044 | 3300003215 | Bacteria | 154263 |
| 35 | JGI25153J46596_10011927 | 3300003215 | Bacteria | 3802 |
| 36 | rootH1_10122630 | 3300003316 | Bacteria | 1248 |
| 37 | rootL2_10010215 | 3300003322 | Bacteria | 2561 |
| 38 | rootL2_10033985 | 3300003322 | Bacteria | 3181 |
| 39 | rootH1_10098301 | 3300003323 | Bacteria | 3703 |
| 40 | Ga0055542_1000046 | 3300003762 | Bacteria | 201922 |
| 41 | Ga0055542_1004873 | 3300003762 | Bacteria | 3139 |
| 42 | Ga0055529_1000007 | 3300003763 | Bacteria | 403604 |
| 43 | Ga0055526_1011554 | 3300003771 | Bacteria | 3960 |
| 44 | Ga0055537_1000874 | 3300003773 | Bacteria | 14424 |
| 45 | Ga0055537_1001004 | 3300003773 | Bacteria | 12769 |
| 46 | Ga0055524_1000088 | 3300003775 | Bacteria | 116065 |
| 47 | Ga0055536_1021354 | 3300003781 | Bacteria | 1968 |
| 48 | Ga0055528_1038469 | 3300003790 | Bacteria | 1108 |
| 49 | Ga0055540_1000717 | 3300003792 | Bacteria | 22584 |
| 50 | Ga0055531_10000016 | 3300003794 | Bacteria | 181898 |
| 51 | Ga0055531_10008252 | 3300003794 | Bacteria | 5537 |
| 52 | Ga0055543_1037273 | 3300004625 | Bacteria | 831 |
| 53 | Ga0065165_1003585 | 3300005262 | Bacteria | 10701 |
| 54 | Ga0065165_1004738 | 3300005262 | Bacteria | 8160 |
| 55 | Ga0065165_1013352 | 3300005262 | Bacteria | 3272 |
| 56 | Ga0065165_1075133 | 3300005262 | Bacteria | 889 |
| 57 | Ga0065165_1085341 | 3300005262 | Bacteria | 813 |
| 58 | Ga0065704_10003859 | 3300005289 | Bacteria | 6264 |
| 59 | Ga0065707_10084130 | 3300005295 | Bacteria | 7653 |
| 60 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 61 | Ga0070658_10000082 | 3300005327 | Bacteria | 89656 |
| 62 | Ga0070658_10001506 | 3300005327 | Bacteria | 19773 |
| 63 | Ga0070658_10042620 | 3300005327 | Bacteria | 3666 |
| 64 | Ga0070658_10117346 | 3300005327 | Bacteria | 2209 |
| 65 | Ga0070658_10320973 | 3300005327 | Bacteria | 1322 |
| 66 | Ga0070658_10401678 | 3300005327 | Bacteria | 1177 |
| 67 | Ga0070670_100000012 | 3300005331 | Bacteria | 256314 |
| 68 | Ga0070670_100002503 | 3300005331 | Bacteria | 15155 |
| 69 | Ga0070670_100004838 | 3300005331 | Bacteria | 11321 |
| 70 | Ga0070677_10001096 | 3300005333 | Bacteria | 8710 |
| 71 | Ga0070666_10000092 | 3300005335 | Bacteria | 62551 |
| 72 | Ga0070666_10024022 | 3300005335 | Bacteria | 3969 |
| 73 | Ga0070666_10156997 | 3300005335 | Bacteria | 1589 |
| 74 | Ga0070680_100000534 | 3300005336 | Bacteria | 25964 |
| 75 | Ga0070680_100205486 | 3300005336 | Bacteria | 1661 |
| 76 | Ga0070680_100630651 | 3300005336 | Bacteria | 921 |
| 77 | Ga0070682_100818374 | 3300005337 | Bacteria | 758 |
| 78 | Ga0070660_100000401 | 3300005339 | Bacteria | 28844 |
| 79 | Ga0070660_100001071 | 3300005339 | Bacteria | 18386 |
| 80 | Ga0070660_100056240 | 3300005339 | Bacteria | 3043 |
| 81 | Ga0070660_100097373 | 3300005339 | Bacteria | 2327 |
| 82 | Ga0070660_100126231 | 3300005339 | Bacteria | 2044 |
| 83 | Ga0070660_100141166 | 3300005339 | Bacteria | 1933 |
| 84 | Ga0070660_100380542 | 3300005339 | Bacteria | 1165 |
| 85 | Ga0070661_100043250 | 3300005344 | Bacteria | 3290 |
| 86 | Ga0070661_100093676 | 3300005344 | Bacteria | 2225 |
| 87 | Ga0070661_100282428 | 3300005344 | Bacteria | 1288 |
| 88 | Ga0070661_100804456 | 3300005344 | Bacteria | 771 |
| 89 | Ga0070692_10038481 | 3300005345 | Bacteria | 2438 |
| 90 | Ga0070668_100000004 | 3300005347 | Bacteria | 189408 |
| 91 | Ga0070668_100000330 | 3300005347 | Bacteria | 31137 |
| 92 | Ga0070668_100046239 | 3300005347 | Bacteria | 3341 |
| 93 | Ga0070668_100102263 | 3300005347 | Bacteria | 2272 |
| 94 | Ga0070669_100000018 | 3300005353 | Bacteria | 195789 |
| 95 | Ga0070669_100000041 | 3300005353 | Bacteria | 127426 |
| 96 | Ga0070669_100073089 | 3300005353 | Bacteria | 2540 |
| 97 | Ga0070669_100098905 | 3300005353 | Bacteria | 2198 |
| 98 | Ga0070669_100304443 | 3300005353 | Bacteria | 1283 |
| 99 | Ga0070669_100584863 | 3300005353 | Bacteria | 934 |
| 100 | Ga0070675_100836220 | 3300005354 | Bacteria | 842 |
| 101 | Ga0070675_101016432 | 3300005354 | Bacteria | 761 |
| 102 | Ga0070671_100000011 | 3300005355 | Bacteria | 202057 |
| 103 | Ga0070671_100000014 | 3300005355 | Bacteria | 167986 |
| 104 | Ga0070671_100000136 | 3300005355 | Bacteria | 47367 |
| 105 | Ga0070671_100015156 | 3300005355 | Bacteria | 6227 |
| 106 | Ga0070674_100000639 | 3300005356 | Bacteria | 17624 |
| 107 | Ga0070674_100066686 | 3300005356 | Bacteria | 2530 |
| 108 | Ga0070673_100250069 | 3300005364 | Bacteria | 1545 |
| 109 | Ga0070673_100320001 | 3300005364 | Bacteria | 1370 |
| 110 | Ga0070659_100007571 | 3300005366 | Bacteria | 7892 |
| 111 | Ga0070659_100035817 | 3300005366 | Bacteria | 3866 |
| 112 | Ga0070659_100349090 | 3300005366 | Bacteria | 1241 |
| 113 | Ga0070659_100671783 | 3300005366 | Bacteria | 894 |
| 114 | Ga0070667_100000037 | 3300005367 | Bacteria | 172343 |
| 115 | Ga0070667_100000089 | 3300005367 | Bacteria | 113661 |
| 116 | Ga0070667_100070948 | 3300005367 | Bacteria | 2966 |
| 117 | Ga0070705_100006873 | 3300005440 | Bacteria | 5591 |
| 118 | Ga0070708_100460602 | 3300005445 | Bacteria | 1199 |
| 119 | Ga0070663_100042668 | 3300005455 | Bacteria | 3188 |
| 120 | Ga0070663_100285767 | 3300005455 | Bacteria | 1316 |
| 121 | Ga0070663_100304553 | 3300005455 | Bacteria | 1277 |
| 122 | Ga0070678_100000104 | 3300005456 | Bacteria | 32585 |
| 123 | Ga0070662_100252622 | 3300005457 | Bacteria | 1418 |
| 124 | Ga0070662_100392669 | 3300005457 | Bacteria | 1144 |
| 125 | Ga0070662_100418223 | 3300005457 | Bacteria | 1108 |
| 126 | Ga0070679_100000005 | 3300005530 | Bacteria | 263201 |
| 127 | Ga0070679_100349033 | 3300005530 | Bacteria | 1427 |
| 128 | Ga0070679_100372060 | 3300005530 | Bacteria | 1376 |
| 129 | Ga0070684_100713447 | 3300005535 | Bacteria | 935 |
| 130 | Ga0068853_100001346 | 3300005539 | Bacteria | 17708 |
| 131 | Ga0068853_100052401 | 3300005539 | Bacteria | 3515 |
| 132 | Ga0068853_100090889 | 3300005539 | Bacteria | 2684 |
| 133 | Ga0068853_100145477 | 3300005539 | Bacteria | 2130 |
| 134 | Ga0068853_100166348 | 3300005539 | Bacteria | 1993 |
| 135 | Ga0068853_100741180 | 3300005539 | Bacteria | 939 |
| 136 | Ga0068853_100849593 | 3300005539 | Bacteria | 875 |
| 137 | Ga0068853_100923997 | 3300005539 | Bacteria | 838 |
| 138 | Ga0070672_100081453 | 3300005543 | Bacteria | 2595 |
| 139 | Ga0070686_100600100 | 3300005544 | Bacteria | 867 |
| 140 | Ga0070693_100215646 | 3300005547 | Bacteria | 1255 |
| 141 | Ga0070665_100030492 | 3300005548 | Bacteria | 5425 |
| 142 | Ga0070665_100600288 | 3300005548 | Bacteria | 1114 |
| 143 | Ga0068855_100000416 | 3300005563 | Bacteria | 52868 |
| 144 | Ga0068855_100001528 | 3300005563 | Bacteria | 29013 |
| 145 | Ga0068855_100068705 | 3300005563 | Bacteria | 4124 |
| 146 | Ga0068855_100078020 | 3300005563 | Bacteria | 3843 |
| 147 | Ga0068855_100345800 | 3300005563 | Bacteria | 1639 |
| 148 | Ga0070664_100255042 | 3300005564 | Bacteria | 1577 |
| 149 | Ga0068857_100028662 | 3300005577 | Bacteria | 4913 |
| 150 | Ga0068857_100062712 | 3300005577 | Bacteria | 3305 |
| 151 | Ga0068857_100667034 | 3300005577 | Bacteria | 986 |
| 152 | Ga0068857_100830344 | 3300005577 | Bacteria | 883 |
| 153 | Ga0068854_100005589 | 3300005578 | Bacteria | 7943 |
| 154 | Ga0068854_100176021 | 3300005578 | Bacteria | 1668 |
| 155 | Ga0068854_100346967 | 3300005578 | Bacteria | 1214 |
| 156 | Ga0068856_100004201 | 3300005614 | Bacteria | 14383 |
| 157 | Ga0068856_100023608 | 3300005614 | Bacteria | 5980 |
| 158 | Ga0068856_100863271 | 3300005614 | Bacteria | 924 |
| 159 | Ga0068852_100005250 | 3300005616 | Bacteria | 9241 |
| 160 | Ga0068852_100318295 | 3300005616 | Bacteria | 1510 |
| 161 | Ga0068852_100333498 | 3300005616 | Bacteria | 1476 |
| 162 | Ga0068852_100764919 | 3300005616 | Bacteria | 979 |
| 163 | Ga0068852_100900870 | 3300005616 | Bacteria | 901 |
| 164 | Ga0068852_101139348 | 3300005616 | Bacteria | 801 |
| 165 | Ga0068859_100000805 | 3300005617 | Bacteria | 31840 |
| 166 | Ga0068859_100005780 | 3300005617 | Bacteria | 12567 |
| 167 | Ga0068859_100007191 | 3300005617 | Bacteria | 11298 |
| 168 | Ga0068859_100356626 | 3300005617 | Bacteria | 1557 |
| 169 | Ga0068859_100435092 | 3300005617 | Bacteria | 1408 |
| 170 | Ga0068859_100552363 | 3300005617 | Bacteria | 1246 |
| 171 | Ga0068859_100766840 | 3300005617 | Bacteria | 1053 |
| 172 | Ga0068859_100955834 | 3300005617 | Bacteria | 940 |
| 173 | Ga0068859_101112497 | 3300005617 | Bacteria | 869 |
| 174 | Ga0068859_101742347 | 3300005617 | Bacteria | 688 |
| 175 | Ga0068864_100000010 | 3300005618 | Bacteria | 358723 |
| 176 | Ga0068864_100000403 | 3300005618 | Bacteria | 37462 |
| 177 | Ga0068864_100002670 | 3300005618 | Bacteria | 14735 |
| 178 | Ga0068864_100008484 | 3300005618 | Bacteria | 8478 |
| 179 | Ga0068864_100284186 | 3300005618 | Bacteria | 1545 |
| 180 | Ga0068861_100000086 | 3300005719 | Bacteria | 44879 |
| 181 | Ga0068861_100001727 | 3300005719 | Bacteria | 14012 |
| 182 | Ga0068861_100045012 | 3300005719 | Bacteria | 3321 |
| 183 | Ga0068861_100861142 | 3300005719 | Bacteria | 855 |
| 184 | Ga0068861_101002577 | 3300005719 | Bacteria | 797 |
| 185 | Ga0068851_10017503 | 3300005834 | Bacteria | 3443 |
| 186 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 187 | Ga0068863_100004589 | 3300005841 | Bacteria | 13621 |
| 188 | Ga0068863_100005416 | 3300005841 | Bacteria | 12576 |
| 189 | Ga0068863_100008282 | 3300005841 | Bacteria | 10159 |
| 190 | Ga0068863_100654350 | 3300005841 | Bacteria | 1042 |
| 191 | Ga0068858_100001988 | 3300005842 | Bacteria | 20899 |
| 192 | Ga0068858_100002719 | 3300005842 | Bacteria | 17826 |
| 193 | Ga0068858_100006177 | 3300005842 | Bacteria | 11684 |
| 194 | Ga0068858_100006359 | 3300005842 | Bacteria | 11503 |
| 195 | Ga0068858_100045893 | 3300005842 | Bacteria | 4051 |
| 196 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 197 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 198 | Ga0068860_100012019 | 3300005843 | Bacteria | 8528 |
| 199 | Ga0068860_100050733 | 3300005843 | Bacteria | 3949 |
| 200 | Ga0068860_100234850 | 3300005843 | Bacteria | 1782 |
| 201 | Ga0068860_100400906 | 3300005843 | Bacteria | 1357 |
| 202 | Ga0068862_100000016 | 3300005844 | Bacteria | 250031 |
| 203 | Ga0068862_100000280 | 3300005844 | Bacteria | 56780 |
| 204 | Ga0068862_100002391 | 3300005844 | Bacteria | 16687 |
| 205 | Ga0075367_10000022 | 3300006178 | Bacteria | 33901 |
| 206 | Ga0097621_100088459 | 3300006237 | Bacteria | 2588 |
| 207 | Ga0075370_10033771 | 3300006353 | Bacteria | 2865 |
| 208 | Ga0068871_100088693 | 3300006358 | Bacteria | 2574 |
| 209 | Ga0068865_100572666 | 3300006881 | Bacteria | 951 |
| 210 | Ga0097620_100000805 | 3300006931 | Bacteria | 31840 |
| 211 | Ga0097620_100005780 | 3300006931 | Bacteria | 12567 |
| 212 | Ga0097620_100007191 | 3300006931 | Bacteria | 11298 |
| 213 | Ga0097620_100007340 | 3300006931 | Bacteria | 11181 |
| 214 | Ga0097620_100356601 | 3300006931 | Bacteria | 1557 |
| 215 | Ga0097620_100435110 | 3300006931 | Bacteria | 1408 |
| 216 | Ga0097620_100552350 | 3300006931 | Bacteria | 1246 |
| 217 | Ga0097620_100766891 | 3300006931 | Bacteria | 1053 |
| 218 | Ga0097620_101112457 | 3300006931 | Bacteria | 869 |
| 219 | Ga0097620_101741797 | 3300006931 | Bacteria | 688 |
| 220 | Ga0079104_1030896 | 3300006946 | Bacteria | 1333 |
| 221 | Ga0105251_10053937 | 3300009011 | Bacteria | 1910 |
| 222 | Ga0105240_10034553 | 3300009093 | Bacteria | 6520 |
| 223 | Ga0105240_10178147 | 3300009093 | Bacteria | 2511 |
| 224 | Ga0105240_10188479 | 3300009093 | Bacteria | 2427 |
| 225 | Ga0105240_10891679 | 3300009093 | Bacteria | 957 |
| 226 | Ga0105247_10004644 | 3300009101 | Bacteria | 8755 |
| 227 | Ga0114129_10314289 | 3300009147 | Bacteria | 2084 |
| 228 | Ga0105243_10002588 | 3300009148 | Bacteria | 15095 |
| 229 | Ga0105241_10007217 | 3300009174 | Bacteria | 8180 |
| 230 | Ga0105242_10497526 | 3300009176 | Bacteria | 1159 |
| 231 | Ga0105248_10000053 | 3300009177 | Bacteria | 143972 |
| 232 | Ga0105248_10043510 | 3300009177 | Bacteria | 5035 |
| 233 | Ga0105248_10150901 | 3300009177 | Bacteria | 2622 |
| 234 | Ga0105248_10557854 | 3300009177 | Bacteria | 1292 |
| 235 | Ga0105237_10047102 | 3300009545 | Bacteria | 4335 |
| 236 | Ga0105237_10184363 | 3300009545 | Bacteria | 2087 |
| 237 | Ga0105237_10228526 | 3300009545 | Bacteria | 1861 |
| 238 | Ga0105237_10299721 | 3300009545 | Bacteria | 1611 |
| 239 | Ga0105238_10094707 | 3300009551 | Bacteria | 2974 |
| 240 | Ga0105238_10191499 | 3300009551 | Bacteria | 2021 |
| 241 | Ga0105238_10369036 | 3300009551 | Bacteria | 1425 |
| 242 | Ga0105238_10581332 | 3300009551 | Bacteria | 1127 |
| 243 | Ga0105238_10615885 | 3300009551 | Bacteria | 1094 |
| 244 | Ga0105238_10706922 | 3300009551 | Bacteria | 1020 |
| 245 | Ga0105249_10000103 | 3300009553 | Bacteria | 118397 |
| 246 | Ga0105249_10000748 | 3300009553 | Bacteria | 29239 |
| 247 | Ga0105249_11195675 | 3300009553 | Bacteria | 831 |
| 248 | Ga0105148_100050 | 3300009978 | Bacteria | 18144 |
| 249 | Ga0105239_10000320 | 3300010375 | Bacteria | 70971 |
| 250 | Ga0105239_10392896 | 3300010375 | Bacteria | 1569 |
| 251 | Ga0105239_10643966 | 3300010375 | Bacteria | 1210 |
| 252 | Ga0105246_10015969 | 3300011119 | Bacteria | 4749 |
| 253 | Ga0157326_1000547 | 3300012513 | Bacteria | 4458 |
| 254 | Ga0157326_1004308 | 3300012513 | Bacteria | 1494 |
| 255 | Ga0157373_10396210 | 3300013100 | Bacteria | 989 |
| 256 | Ga0157373_10513996 | 3300013100 | Bacteria | 866 |
| 257 | Ga0157373_10787447 | 3300013100 | Bacteria | 701 |
| 258 | Ga0157371_10002068 | 3300013102 | Bacteria | 19673 |
| 259 | Ga0157371_10105735 | 3300013102 | Bacteria | 1997 |
| 260 | Ga0157370_10396287 | 3300013104 | Bacteria | 1271 |
| 261 | Ga0157370_10426595 | 3300013104 | Bacteria | 1219 |
| 262 | Ga0157370_10445842 | 3300013104 | Bacteria | 1190 |
| 263 | Ga0157370_10595387 | 3300013104 | Bacteria | 1012 |
| 264 | Ga0157369_10000298 | 3300013105 | Bacteria | 66393 |
| 265 | Ga0157369_10004587 | 3300013105 | Bacteria | 16237 |
| 266 | Ga0157369_10593630 | 3300013105 | Bacteria | 1143 |
| 267 | Ga0157369_10817235 | 3300013105 | Bacteria | 957 |
| 268 | Ga0157369_10818286 | 3300013105 | Bacteria | 957 |
| 269 | Ga0157369_10946228 | 3300013105 | Bacteria | 883 |
| 270 | Ga0157374_10141224 | 3300013296 | Bacteria | 2338 |
| 271 | Ga0157378_10153888 | 3300013297 | Bacteria | 2144 |
| 272 | Ga0163162_10004388 | 3300013306 | Bacteria | 13573 |
| 273 | Ga0163162_10166387 | 3300013306 | Bacteria | 2329 |
| 274 | Ga0163162_10290159 | 3300013306 | Bacteria | 1768 |
| 275 | Ga0163162_10994567 | 3300013306 | Bacteria | 948 |
| 276 | Ga0157372_10054162 | 3300013307 | Bacteria | 4474 |
| 277 | Ga0157372_10066845 | 3300013307 | Bacteria | 4039 |
| 278 | Ga0157372_10067875 | 3300013307 | Bacteria | 4008 |
| 279 | Ga0157372_10088444 | 3300013307 | Bacteria | 3517 |
| 280 | Ga0157372_10286770 | 3300013307 | Bacteria | 1915 |
| 281 | Ga0157372_10307967 | 3300013307 | Bacteria | 1843 |
| 282 | Ga0157372_10650829 | 3300013307 | Bacteria | 1227 |
| 283 | Ga0157372_12458342 | 3300013307 | Bacteria | 598 |
| 284 | Ga0157375_12108032 | 3300013308 | Bacteria | 671 |
| 285 | Ga0163163_10011243 | 3300014325 | Bacteria | 8112 |
| 286 | Ga0163163_10029678 | 3300014325 | Bacteria | 5263 |
| 287 | Ga0157380_10000134 | 3300014326 | Bacteria | 41479 |
| 288 | Ga0157380_10047718 | 3300014326 | Bacteria | 3370 |
| 289 | Ga0157380_10451141 | 3300014326 | Bacteria | 1235 |
| 290 | Ga0157380_10927867 | 3300014326 | Bacteria | 899 |
| 291 | Ga0157379_10005282 | 3300014968 | Bacteria | 11092 |
| 292 | Ga0157379_10687645 | 3300014968 | Bacteria | 960 |
| 293 | Ga0157376_10290474 | 3300014969 | Bacteria | 1543 |
| 294 | Ga0163161_10089708 | 3300017792 | Bacteria | 2274 |
| 295 | Ga0163161_10104274 | 3300017792 | Bacteria | 2114 |
| 296 | Ga0163161_10158995 | 3300017792 | Bacteria | 1722 |
| 297 | Ga0206353_10346769 | 3300020082 | Bacteria | 2740 |
| 298 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 299 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 300 | Ga0209674_114085 | 3300025226 | Bacteria | 724 |
| 301 | Ga0209147_102362 | 3300025229 | Bacteria | 4796 |
| 302 | Ga0207425_1000026 | 3300025245 | Bacteria | 301303 |
| 303 | Ga0207425_1005446 | 3300025245 | Bacteria | 3628 |
| 304 | Ga0209148_1000338 | 3300025254 | Bacteria | 62960 |
| 305 | Ga0209148_1001156 | 3300025254 | Bacteria | 15345 |
| 306 | Ga0209129_1001922 | 3300025258 | Bacteria | 10907 |
| 307 | Ga0209233_1000066 | 3300025261 | Bacteria | 381218 |
| 308 | Ga0209565_1000010 | 3300025263 | Bacteria | 687724 |
| 309 | Ga0209565_1000064 | 3300025263 | Bacteria | 180732 |
| 310 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 311 | Ga0209455_1001029 | 3300025272 | Bacteria | 13882 |
| 312 | Ga0209673_1002611 | 3300025273 | Bacteria | 12108 |
| 313 | Ga0209673_1046675 | 3300025273 | Bacteria | 1180 |
| 314 | Ga0209676_1008246 | 3300025292 | Bacteria | 4687 |
| 315 | Ga0209025_1000551 | 3300025294 | Bacteria | 69956 |
| 316 | Ga0209564_1003529 | 3300025295 | Bacteria | 10551 |
| 317 | Ga0209564_1018595 | 3300025295 | Bacteria | 2640 |
| 318 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 319 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 320 | Ga0209758_1002673 | 3300025297 | Bacteria | 17608 |
| 321 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 322 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 323 | Ga0209050_1002186 | 3300025298 | Bacteria | 17647 |
| 324 | Ga0209050_1011661 | 3300025298 | Bacteria | 4136 |
| 325 | Ga0209256_1000034 | 3300025299 | Bacteria | 388475 |
| 326 | Ga0207426_1014974 | 3300025302 | Bacteria | 2830 |
| 327 | Ga0209051_1001333 | 3300025303 | Bacteria | 21480 |
| 328 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 329 | Ga0209257_1005333 | 3300025304 | Bacteria | 9104 |
| 330 | Ga0209257_1016095 | 3300025304 | Bacteria | 3051 |
| 331 | Ga0207697_10001015 | 3300025315 | Bacteria | 15714 |
| 332 | Ga0207656_10010757 | 3300025321 | Bacteria | 3438 |
| 333 | Ga0207656_10069700 | 3300025321 | Bacteria | 1560 |
| 334 | Ga0207682_10000992 | 3300025893 | Bacteria | 13115 |
| 335 | Ga0207682_10197228 | 3300025893 | Bacteria | 924 |
| 336 | Ga0207710_10002894 | 3300025900 | Bacteria | 7801 |
| 337 | Ga0207680_10003517 | 3300025903 | Bacteria | 7371 |
| 338 | Ga0207680_10128707 | 3300025903 | Bacteria | 1666 |
| 339 | Ga0207680_10174088 | 3300025903 | Bacteria | 1451 |
| 340 | Ga0207647_10001182 | 3300025904 | Bacteria | 20104 |
| 341 | Ga0207647_10008705 | 3300025904 | Bacteria | 7249 |
| 342 | Ga0207647_10210138 | 3300025904 | Bacteria | 1124 |
| 343 | Ga0207647_10210139 | 3300025904 | Bacteria | 1124 |
| 344 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 345 | Ga0207705_10000027 | 3300025909 | Bacteria | 248863 |
| 346 | Ga0207705_10000915 | 3300025909 | Bacteria | 24186 |
| 347 | Ga0207705_10004780 | 3300025909 | Bacteria | 10199 |
| 348 | Ga0207705_10213995 | 3300025909 | Bacteria | 1462 |
| 349 | Ga0207705_10253338 | 3300025909 | Bacteria | 1343 |
| 350 | Ga0207705_10311488 | 3300025909 | Bacteria | 1208 |
| 351 | Ga0207705_10527101 | 3300025909 | Bacteria | 918 |
| 352 | Ga0207654_10048248 | 3300025911 | Bacteria | 2436 |
| 353 | Ga0207654_10173917 | 3300025911 | Bacteria | 1400 |
| 354 | Ga0207695_10017086 | 3300025913 | Bacteria | 8458 |
| 355 | Ga0207695_10082639 | 3300025913 | Bacteria | 3246 |
| 356 | Ga0207695_10142203 | 3300025913 | Bacteria | 2347 |
| 357 | Ga0207671_10061563 | 3300025914 | Bacteria | 2785 |
| 358 | Ga0207671_10118564 | 3300025914 | Bacteria | 2021 |
| 359 | Ga0207671_10192273 | 3300025914 | Bacteria | 1591 |
| 360 | Ga0207671_10281666 | 3300025914 | Bacteria | 1311 |
| 361 | Ga0207657_10001109 | 3300025919 | Bacteria | 28595 |
| 362 | Ga0207657_10001208 | 3300025919 | Bacteria | 27508 |
| 363 | Ga0207657_10002470 | 3300025919 | Bacteria | 19999 |
| 364 | Ga0207657_10035193 | 3300025919 | Bacteria | 4494 |
| 365 | Ga0207657_10037177 | 3300025919 | Bacteria | 4352 |
| 366 | Ga0207657_10138328 | 3300025919 | Bacteria | 1991 |
| 367 | Ga0207657_10168890 | 3300025919 | Bacteria | 1773 |
| 368 | Ga0207657_10301401 | 3300025919 | Bacteria | 1269 |
| 369 | Ga0207649_10000235 | 3300025920 | Bacteria | 45363 |
| 370 | Ga0207649_10192386 | 3300025920 | Bacteria | 1436 |
| 371 | Ga0207649_10219986 | 3300025920 | Bacteria | 1352 |
| 372 | Ga0207649_10785267 | 3300025920 | Bacteria | 743 |
| 373 | Ga0207652_10000005 | 3300025921 | Bacteria | 343384 |
| 374 | Ga0207652_10000006 | 3300025921 | Bacteria | 302991 |
| 375 | Ga0207652_10000007 | 3300025921 | Bacteria | 301303 |
| 376 | Ga0207652_10000009 | 3300025921 | Bacteria | 257234 |
| 377 | Ga0207652_10360977 | 3300025921 | Bacteria | 1311 |
| 378 | Ga0207652_10455777 | 3300025921 | Bacteria | 1153 |
| 379 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 380 | Ga0207681_10000013 | 3300025923 | Bacteria | 357411 |
| 381 | Ga0207681_10047884 | 3300025923 | Bacteria | 2883 |
| 382 | Ga0207681_10249423 | 3300025923 | Bacteria | 1385 |
| 383 | Ga0207694_10167615 | 3300025924 | Bacteria | 1777 |
| 384 | Ga0207694_10321454 | 3300025924 | Bacteria | 1277 |
| 385 | Ga0207694_10494248 | 3300025924 | Bacteria | 1024 |
| 386 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 387 | Ga0207650_10001666 | 3300025925 | Bacteria | 15824 |
| 388 | Ga0207650_10007720 | 3300025925 | Bacteria | 7331 |
| 389 | Ga0207687_10063568 | 3300025927 | Bacteria | 2614 |
| 390 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 391 | Ga0207644_10000030 | 3300025931 | Bacteria | 136272 |
| 392 | Ga0207644_10000046 | 3300025931 | Bacteria | 103962 |
| 393 | Ga0207644_10004648 | 3300025931 | Bacteria | 8925 |
| 394 | Ga0207690_10004899 | 3300025932 | Bacteria | 7899 |
| 395 | Ga0207690_10284841 | 3300025932 | Bacteria | 1288 |
| 396 | Ga0207706_10003238 | 3300025933 | Bacteria | 15605 |
| 397 | Ga0207706_10005292 | 3300025933 | Bacteria | 12029 |
| 398 | Ga0207706_10051297 | 3300025933 | Bacteria | 3643 |
| 399 | Ga0207706_10393734 | 3300025933 | Bacteria | 1201 |
| 400 | Ga0207706_10995734 | 3300025933 | Bacteria | 704 |
| 401 | Ga0207686_10719094 | 3300025934 | Bacteria | 795 |
| 402 | Ga0207709_10000201 | 3300025935 | Bacteria | 78554 |
| 403 | Ga0207709_10686197 | 3300025935 | Bacteria | 818 |
| 404 | Ga0207709_10696659 | 3300025935 | Bacteria | 812 |
| 405 | Ga0207670_10180514 | 3300025936 | Bacteria | 1590 |
| 406 | Ga0207669_10000042 | 3300025937 | Bacteria | 65679 |
| 407 | Ga0207669_10013513 | 3300025937 | Bacteria | 4057 |
| 408 | Ga0207691_10079430 | 3300025940 | Bacteria | 2953 |
| 409 | Ga0207711_10003703 | 3300025941 | Bacteria | 13178 |
| 410 | Ga0207711_10094340 | 3300025941 | Bacteria | 2637 |
| 411 | Ga0207711_10130631 | 3300025941 | Bacteria | 2252 |
| 412 | Ga0207711_10414159 | 3300025941 | Bacteria | 1253 |
| 413 | Ga0207661_11027976 | 3300025944 | Bacteria | 759 |
| 414 | Ga0207679_11159432 | 3300025945 | Bacteria | 709 |
| 415 | Ga0207667_10000109 | 3300025949 | Bacteria | 132054 |
| 416 | Ga0207667_10000504 | 3300025949 | Bacteria | 51526 |
| 417 | Ga0207667_10020841 | 3300025949 | Bacteria | 7278 |
| 418 | Ga0207667_10053655 | 3300025949 | Bacteria | 4241 |
| 419 | Ga0207667_10264118 | 3300025949 | Bacteria | 1760 |
| 420 | Ga0207667_10288460 | 3300025949 | Bacteria | 1677 |
| 421 | Ga0207667_10446221 | 3300025949 | Bacteria | 1315 |
| 422 | Ga0207651_10196425 | 3300025960 | Bacteria | 1613 |
| 423 | Ga0207651_10283621 | 3300025960 | Bacteria | 1370 |
| 424 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 425 | Ga0207712_10004601 | 3300025961 | Bacteria | 8715 |
| 426 | Ga0207668_10000140 | 3300025972 | Bacteria | 49509 |
| 427 | Ga0207668_10000256 | 3300025972 | Bacteria | 35517 |
| 428 | Ga0207668_10000294 | 3300025972 | Bacteria | 32757 |
| 429 | Ga0207668_10024318 | 3300025972 | Bacteria | 3908 |
| 430 | Ga0207640_10004411 | 3300025981 | Bacteria | 7631 |
| 431 | Ga0207640_10015179 | 3300025981 | Bacteria | 4453 |
| 432 | Ga0207640_10360382 | 3300025981 | Bacteria | 1171 |
| 433 | Ga0207640_10794630 | 3300025981 | Bacteria | 819 |
| 434 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 435 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 436 | Ga0207658_10712357 | 3300025986 | Bacteria | 907 |
| 437 | Ga0207658_10744787 | 3300025986 | Bacteria | 887 |
| 438 | Ga0207658_10849857 | 3300025986 | Bacteria | 830 |
| 439 | Ga0207703_10000501 | 3300026035 | Bacteria | 40495 |
| 440 | Ga0207703_10000677 | 3300026035 | Bacteria | 33813 |
| 441 | Ga0207703_10004439 | 3300026035 | Bacteria | 11520 |
| 442 | Ga0207703_10026618 | 3300026035 | Bacteria | 4554 |
| 443 | Ga0207703_10182370 | 3300026035 | Bacteria | 1853 |
| 444 | Ga0207639_10009698 | 3300026041 | Bacteria | 6651 |
| 445 | Ga0207639_10021378 | 3300026041 | Bacteria | 4647 |
| 446 | Ga0207639_10107040 | 3300026041 | Bacteria | 2271 |
| 447 | Ga0207639_10151591 | 3300026041 | Bacteria | 1942 |
| 448 | Ga0207639_10358941 | 3300026041 | Bacteria | 1303 |
| 449 | Ga0207639_10589094 | 3300026041 | Bacteria | 1024 |
| 450 | Ga0207678_10000622 | 3300026067 | Bacteria | 32445 |
| 451 | Ga0207678_10082780 | 3300026067 | Bacteria | 2745 |
| 452 | Ga0207678_10263424 | 3300026067 | Bacteria | 1477 |
| 453 | Ga0207702_10015330 | 3300026078 | Bacteria | 6352 |
| 454 | Ga0207702_10015475 | 3300026078 | Bacteria | 6317 |
| 455 | Ga0207702_10043899 | 3300026078 | Bacteria | 3755 |
| 456 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 457 | Ga0207641_10000818 | 3300026088 | Bacteria | 33059 |
| 458 | Ga0207641_10001290 | 3300026088 | Bacteria | 24911 |
| 459 | Ga0207641_10002303 | 3300026088 | Bacteria | 17752 |
| 460 | Ga0207641_10004282 | 3300026088 | Bacteria | 12408 |
| 461 | Ga0207641_10004485 | 3300026088 | Bacteria | 12077 |
| 462 | Ga0207641_10098794 | 3300026088 | Bacteria | 2567 |
| 463 | Ga0207641_10702582 | 3300026088 | Bacteria | 996 |
| 464 | Ga0207648_10018044 | 3300026089 | Bacteria | 6394 |
| 465 | Ga0207648_11391861 | 3300026089 | Bacteria | 659 |
| 466 | Ga0207676_10000012 | 3300026095 | Bacteria | 353971 |
| 467 | Ga0207676_10000184 | 3300026095 | Bacteria | 55154 |
| 468 | Ga0207676_10001239 | 3300026095 | Bacteria | 19003 |
| 469 | Ga0207676_10006305 | 3300026095 | Bacteria | 8377 |
| 470 | Ga0207676_10332862 | 3300026095 | Bacteria | 1398 |
| 471 | Ga0207674_10002143 | 3300026116 | Bacteria | 24953 |
| 472 | Ga0207674_10038181 | 3300026116 | Bacteria | 4989 |
| 473 | Ga0207674_10076729 | 3300026116 | Bacteria | 3349 |
| 474 | Ga0207674_10176789 | 3300026116 | Bacteria | 2087 |
| 475 | Ga0207674_10693644 | 3300026116 | Bacteria | 983 |
| 476 | Ga0207675_100000822 | 3300026118 | Bacteria | 30908 |
| 477 | Ga0207675_100006217 | 3300026118 | Bacteria | 11338 |
| 478 | Ga0207675_100053569 | 3300026118 | Bacteria | 3764 |
| 479 | Ga0207675_100074606 | 3300026118 | Bacteria | 3174 |
| 480 | Ga0207675_100250507 | 3300026118 | Bacteria | 1714 |
| 481 | Ga0207683_10000067 | 3300026121 | Bacteria | 79552 |
| 482 | Ga0207698_10261953 | 3300026142 | Bacteria | 1589 |
| 483 | Ga0207698_10268441 | 3300026142 | Bacteria | 1571 |
| 484 | Ga0207698_10286465 | 3300026142 | Bacteria | 1526 |
| 485 | Ga0207698_10321175 | 3300026142 | Bacteria | 1450 |
| 486 | Ga0207698_10389568 | 3300026142 | Bacteria | 1328 |
| 487 | Ga0207698_10438462 | 3300026142 | Unclassified | 1258 |
| 488 | Ga0209281_1022262 | 3300027111 | Bacteria | 1215 |
| 489 | Ga0209813_10000224 | 3300027866 | Bacteria | 17403 |
| 490 | Ga0268266_10002533 | 3300028379 | Bacteria | 19412 |
| 491 | Ga0268266_10557732 | 3300028379 | Bacteria | 1098 |
| 492 | Ga0268265_10000006 | 3300028380 | Bacteria | 466482 |
| 493 | Ga0268265_10000064 | 3300028380 | Bacteria | 144164 |
| 494 | Ga0268265_10001032 | 3300028380 | Bacteria | 25108 |
| 495 | Ga0268265_10004641 | 3300028380 | Bacteria | 9484 |
| 496 | Ga0268265_10778555 | 3300028380 | Bacteria | 931 |
| 497 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 498 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 499 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 500 | Ga0268264_10000381 | 3300028381 | Bacteria | 64651 |
| 501 | Ga0268264_10018242 | 3300028381 | Bacteria | 5739 |
| 502 | Ga0307517_10045291 | 3300028786 | Bacteria | 4626 |
| 503 | Ga0307515_10419399 | 3300028794 | Bacteria | 959 |
| 504 | Ga0316182_1105435 | 3300030745 | Bacteria | 863 |
| 505 | Ga0307513_10190564 | 3300031456 | Bacteria | 1903 |
| 506 | Ga0307513_10371082 | 3300031456 | Bacteria | 1173 |
| 507 | Ga0307509_10226867 | 3300031507 | Bacteria | 1675 |
| 508 | Ga0307408_100008396 | 3300031548 | Bacteria | 6818 |
| 509 | Ga0307408_100013448 | 3300031548 | Bacteria | 5431 |
| 510 | Ga0307408_100046157 | 3300031548 | Bacteria | 3115 |
| 511 | Ga0307408_100060456 | 3300031548 | Bacteria | 2762 |
| 512 | Ga0307408_100310385 | 3300031548 | Bacteria | 1325 |
| 513 | Ga0307408_100375426 | 3300031548 | Bacteria | 1214 |
| 514 | Ga0307408_100410934 | 3300031548 | Bacteria | 1164 |
| 515 | Ga0307408_100473552 | 3300031548 | Bacteria | 1091 |
| 516 | Ga0307408_100753864 | 3300031548 | Bacteria | 880 |
| 517 | Ga0307408_100771869 | 3300031548 | Bacteria | 870 |
| 518 | Ga0307508_10000638 | 3300031616 | Bacteria | 42145 |
| 519 | Ga0307405_10023181 | 3300031731 | Bacteria | 3524 |
| 520 | Ga0307405_10061287 | 3300031731 | Bacteria | 2377 |
| 521 | Ga0307405_10223445 | 3300031731 | Bacteria | 1383 |
| 522 | Ga0307405_10305053 | 3300031731 | Bacteria | 1209 |
| 523 | Ga0307405_11034309 | 3300031731 | Bacteria | 702 |
| 524 | Ga0307405_11703150 | 3300031731 | Bacteria | 558 |
| 525 | Ga0307413_10032195 | 3300031824 | Bacteria | 2969 |
| 526 | Ga0307413_10057100 | 3300031824 | Bacteria | 2385 |
| 527 | Ga0307413_10080840 | 3300031824 | Bacteria | 2082 |
| 528 | Ga0307413_10219146 | 3300031824 | Bacteria | 1388 |
| 529 | Ga0307413_10239950 | 3300031824 | Bacteria | 1338 |
| 530 | Ga0307413_10333499 | 3300031824 | Bacteria | 1164 |
| 531 | Ga0307413_10493321 | 3300031824 | Bacteria | 982 |
| 532 | Ga0307410_10129803 | 3300031852 | Bacteria | 1850 |
| 533 | Ga0307410_10241964 | 3300031852 | Bacteria | 1399 |
| 534 | Ga0307410_10622484 | 3300031852 | Bacteria | 902 |
| 535 | Ga0307410_11072257 | 3300031852 | Bacteria | 697 |
| 536 | Ga0307406_10004070 | 3300031901 | Bacteria | 7959 |
| 537 | Ga0307406_10020839 | 3300031901 | Bacteria | 3868 |
| 538 | Ga0307406_10029680 | 3300031901 | Bacteria | 3313 |
| 539 | Ga0307406_10080622 | 3300031901 | Bacteria | 2162 |
| 540 | Ga0307406_10214737 | 3300031901 | Bacteria | 1426 |
| 541 | Ga0307407_10063086 | 3300031903 | Bacteria | 2173 |
| 542 | Ga0307407_10093093 | 3300031903 | Bacteria | 1852 |
| 543 | Ga0307407_10125243 | 3300031903 | Bacteria | 1635 |
| 544 | Ga0307412_10006640 | 3300031911 | Bacteria | 6555 |
| 545 | Ga0307412_10006836 | 3300031911 | Bacteria | 6474 |
| 546 | Ga0307412_10017510 | 3300031911 | Bacteria | 4289 |
| 547 | Ga0307412_10026305 | 3300031911 | Bacteria | 3615 |
| 548 | Ga0307412_10048489 | 3300031911 | Bacteria | 2794 |
| 549 | Ga0307412_10146928 | 3300031911 | Bacteria | 1734 |
| 550 | Ga0307412_10156229 | 3300031911 | Bacteria | 1689 |
| 551 | Ga0307412_10184436 | 3300031911 | Bacteria | 1572 |
| 552 | Ga0307412_10406811 | 3300031911 | Bacteria | 1109 |
| 553 | Ga0307412_10439319 | 3300031911 | Bacteria | 1072 |
| 554 | Ga0307409_100136565 | 3300031995 | Bacteria | 2105 |
| 555 | Ga0307409_100175442 | 3300031995 | Bacteria | 1891 |
| 556 | Ga0307409_100193090 | 3300031995 | Bacteria | 1814 |
| 557 | Ga0307409_101495577 | 3300031995 | Bacteria | 703 |
| 558 | Ga0307416_100005856 | 3300032002 | Bacteria | 7623 |
| 559 | Ga0307416_100020485 | 3300032002 | Bacteria | 4722 |
| 560 | Ga0307416_100083026 | 3300032002 | Bacteria | 2716 |
| 561 | Ga0307416_100478347 | 3300032002 | Bacteria | 1305 |
| 562 | Ga0307416_100540706 | 3300032002 | Bacteria | 1237 |
| 563 | Ga0307416_101591817 | 3300032002 | Bacteria | 759 |
| 564 | Ga0307414_10000911 | 3300032004 | Bacteria | 15167 |
| 565 | Ga0307414_10014817 | 3300032004 | Bacteria | 4688 |
| 566 | Ga0307414_10040341 | 3300032004 | Bacteria | 3152 |
| 567 | Ga0307414_10053390 | 3300032004 | Bacteria | 2818 |
| 568 | Ga0307414_10120555 | 3300032004 | Bacteria | 2016 |
| 569 | Ga0307414_10136036 | 3300032004 | Bacteria | 1916 |
| 570 | Ga0307414_10291899 | 3300032004 | Bacteria | 1375 |
| 571 | Ga0307414_10381536 | 3300032004 | Bacteria | 1219 |
| 572 | Ga0307414_10800735 | 3300032004 | Bacteria | 859 |
| 573 | Ga0307414_11053423 | 3300032004 | Bacteria | 750 |
| 574 | Ga0307414_11168622 | 3300032004 | Bacteria | 712 |
| 575 | Ga0307411_10014349 | 3300032005 | Bacteria | 4405 |
| 576 | Ga0307411_10074692 | 3300032005 | Bacteria | 2311 |
| 577 | Ga0307411_10098250 | 3300032005 | Bacteria | 2063 |
| 578 | Ga0307411_10461558 | 3300032005 | Unclassified | 1065 |
| 579 | Ga0307415_100031013 | 3300032126 | Bacteria | 3439 |
| 580 | Ga0307415_100093990 | 3300032126 | Bacteria | 2179 |
| 581 | Ga0307415_100206421 | 3300032126 | Bacteria | 1563 |
| 582 | Ga0307415_100616126 | 3300032126 | Bacteria | 968 |
| 583 | Ga0307415_101236798 | 3300032126 | Bacteria | 705 |
| 584 | Ga0307510_10010127 | 3300033180 | Bacteria | 11208 |
| 585 | Ga0373927_0176280 | 3300035695 | Bacteria | 1402 |
| 586 | Ga0395899_0012107 | 3300037312 | Bacteria | 6605 |
| 587 | Ga0395900_0009928 | 3300037418 | Bacteria | 9746 |
| 588 | Ga0395900_0137923 | 3300037418 | Bacteria | 2499 |
| 589 | Ga0395900_0204307 | 3300037418 | Bacteria | 1997 |
| 590 | Ga0395898_0082714 | 3300037466 | Bacteria | 3094 |
| 591 | Ga0395898_0146412 | 3300037466 | Bacteria | 2260 |
| 592 | Ga0395905_0119946 | 3300037471 | Bacteria | 2472 |
| 593 | Ga0395905_1210529 | 3300037471 | Bacteria | 659 |
| 594 | Ga0436364_1344939 | 3300037853 | Bacteria | 997 |
| 595 | Ga0395901_0091016 | 3300038443 | Bacteria | 3193 |
| 596 | Ga0395901_0165215 | 3300038443 | Bacteria | 2324 |
| 597 | Ga0237819_00162 | 3300038705 | Bacteria | 24529 |
| 598 | Ga0436365_1244885 | 3300039437 | Bacteria | 63227 |
| 599 | Ga0436365_1911487 | 3300039437 | Bacteria | 52227 |
| 600 | Ga0436362_0953683 | 3300039453 | Bacteria | 32384 |
| 601 | Ga0439436_0013362 | 3300041404 | Bacteria | 2483 |
| 602 | Ga0439461_0003711 | 3300041410 | Bacteria | 2522 |
| 603 | Ga0439465_0058126 | 3300041413 | Bacteria | 1277 |
| 604 | Ga0451793_0851206 | 3300041452 | Bacteria | 1673 |
| 605 | Ga0451800_0009767 | 3300041459 | Bacteria | 1158 |
| 606 | Ga0451806_664586 | 3300041462 | Bacteria | 3963 |
| 607 | Ga0451807_1001113 | 3300041486 | Bacteria | 719 |
| 608 | Ga0451807_1401903 | 3300041486 | Bacteria | 3006 |
| 609 | Ga0451849_0642865 | 3300041505 | Bacteria | 1011 |
| 610 | Ga0439431_0012827 | 3300041997 | Bacteria | 1929 |
| 611 | Ga0439445_0085994 | 3300042004 | Bacteria | 882 |
| 612 | Ga0439445_0146095 | 3300042004 | Bacteria | 687 |
| 613 | Ga0439448_0003560 | 3300042005 | Bacteria | 4327 |
| 614 | Ga0439448_0011342 | 3300042005 | Bacteria | 2655 |
| 615 | Ga0439448_0020246 | 3300042005 | Bacteria | 2056 |
| 616 | Ga0439432_041325 | 3300042006 | Bacteria | 1460 |
| 617 | Ga0439449_0054781 | 3300042007 | Bacteria | 1473 |
| 618 | Ga0439452_029964 | 3300042010 | Bacteria | 1346 |
| 619 | Ga0439454_009429 | 3300042011 | Bacteria | 1267 |
| 620 | Ga0439455_0000240 | 3300042012 | Bacteria | 6577 |
| 621 | Ga0439455_0000681 | 3300042012 | Bacteria | 5004 |
| 622 | Ga0439457_030075 | 3300042014 | Bacteria | 1203 |
| 623 | Ga0439462_0018038 | 3300042015 | Bacteria | 1831 |
| 624 | Ga0439462_0056833 | 3300042015 | Bacteria | 1056 |
| 625 | Ga0439462_0162858 | 3300042015 | Bacteria | 630 |
| 626 | Ga0450912_003228 | 3300042116 | Bacteria | 1150 |
| 627 | Ga0439446_0061242 | 3300042156 | Bacteria | 1138 |
| 628 | Ga0439458_0000211 | 3300042157 | Bacteria | 13700 |
| 629 | Ga0439458_0001587 | 3300042157 | Bacteria | 5676 |
| 630 | Ga0450909_028799 | 3300042185 | Bacteria | 839 |
| 631 | Ga0439434_0003638 | 3300042435 | Bacteria | 4509 |
| 632 | Ga0466969_0004200 | 3300044656 | Bacteria | 7644 |
| 633 | Ga0466966_0005297 | 3300044684 | Bacteria | 8480 |
| 634 | Ga0466961_0005451 | 3300044693 | Bacteria | 8023 |
| 635 | Ga0466961_0242551 | 3300044693 | Unclassified | 1107 |
| 636 | Ga0466963_0005238 | 3300044694 | Bacteria | 7575 |
| 637 | Ga0466963_0005868 | 3300044694 | Bacteria | 7236 |
| 638 | Ga0466963_0019396 | 3300044694 | Bacteria | 4264 |
| 639 | Ga0466971_0002248 | 3300044719 | Bacteria | 8170 |
| 640 | Ga0466971_0239415 | 3300044719 | Bacteria | 863 |
| 641 | Ga0466968_0105149 | 3300044735 | Bacteria | 1264 |
| 642 | Ga0466968_0168271 | 3300044735 | Bacteria | 1014 |
| 643 | Ga0466970_0020502 | 3300044765 | Bacteria | 3435 |
| 644 | Ga0466970_0107151 | 3300044765 | Bacteria | 1525 |
| 645 | Ga0466957_0000189 | 3300044842 | Bacteria | 28184 |
| 646 | Ga0466957_0010079 | 3300044842 | Bacteria | 5408 |
| 647 | Ga0466957_0021703 | 3300044842 | Bacteria | 3784 |
| 648 | Ga0466957_0606276 | 3300044842 | Bacteria | 767 |
| 649 | Ga0466960_0317516 | 3300044901 | Bacteria | 882 |
| 650 | Ga0466959_0003340 | 3300045049 | Bacteria | 10484 |
| 651 | Ga0466959_0014024 | 3300045049 | Bacteria | 5817 |
| 652 | Ga0466958_0002871 | 3300045836 | Bacteria | 8778 |
| 653 | Ga0466958_0016124 | 3300045836 | Bacteria | 4298 |
| 654 | Ga0466958_0058702 | 3300045836 | Bacteria | 2339 |
| 655 | Ga0466967_0014351 | 3300045976 | Bacteria | 6168 |
| 656 | Ga0495617_010535 | 3300046452 | Bacteria | 3167 |
| 657 | Ga0495627_000155 | 3300046453 | Bacteria | 79691 |
| 658 | Ga0495627_009659 | 3300046453 | Bacteria | 3541 |
| 659 | Ga0495638_0001486 | 3300046460 | Bacteria | 21191 |
| 660 | Ga0495638_0146771 | 3300046460 | Bacteria | 1372 |
| 661 | Ga0495584_0011626 | 3300046491 | Bacteria | 4508 |
| 662 | Ga0495584_0045768 | 3300046491 | Bacteria | 2207 |
| 663 | Ga0495584_0098998 | 3300046491 | Bacteria | 1473 |
| 664 | Ga0495585_0022756 | 3300046492 | Bacteria | 3598 |
| 665 | Ga0495585_0034452 | 3300046492 | Bacteria | 2862 |
| 666 | Ga0495583_0002872 | 3300046506 | Bacteria | 13979 |
| 667 | Ga0495583_0014784 | 3300046506 | Bacteria | 4279 |
| 668 | Ga0495583_0034644 | 3300046506 | Bacteria | 2416 |
| 669 | Ga0495583_0073449 | 3300046506 | Bacteria | 1499 |
| 670 | Ga0495583_0130953 | 3300046506 | Bacteria | 1049 |
| 671 | Ga0495583_0270157 | 3300046506 | Bacteria | 679 |
| 672 | Ga0495606_0000978 | 3300046507 | Bacteria | 41691 |
| 673 | Ga0495606_0113010 | 3300046507 | Bacteria | 1635 |
| 674 | Ga0495606_0173200 | 3300046507 | Bacteria | 1250 |
| 675 | Ga0495610_0001777 | 3300046512 | Bacteria | 18843 |
| 676 | Ga0495616_0185841 | 3300046513 | Bacteria | 921 |
| 677 | Ga0495616_0190350 | 3300046513 | Bacteria | 907 |
| 678 | Ga0495631_0019792 | 3300046518 | Bacteria | 3153 |
| 679 | Ga0495632_0000211 | 3300046519 | Bacteria | 59066 |
| 680 | Ga0495632_0003768 | 3300046519 | Bacteria | 10599 |
| 681 | Ga0495637_0001513 | 3300046520 | Bacteria | 13621 |
| 682 | Ga0495637_0021337 | 3300046520 | Bacteria | 2972 |
| 683 | Ga0495637_0049978 | 3300046520 | Bacteria | 1755 |
| 684 | Ga0495637_0057349 | 3300046520 | Bacteria | 1609 |
| 685 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 686 | Ga0495643_0006712 | 3300046522 | Bacteria | 7536 |
| 687 | Ga0495643_0017112 | 3300046522 | Bacteria | 4245 |
| 688 | Ga0495643_0026420 | 3300046522 | Bacteria | 3277 |
| 689 | Ga0495643_0072076 | 3300046522 | Bacteria | 1812 |
| 690 | Ga0495643_0143859 | 3300046522 | Bacteria | 1186 |
| 691 | Ga0495643_0164576 | 3300046522 | Bacteria | 1089 |
| 692 | Ga0495648_0000102 | 3300046524 | Bacteria | 106768 |
| 693 | Ga0495648_0048110 | 3300046524 | Bacteria | 2629 |
| 694 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 695 | Ga0495663_0080366 | 3300046525 | Bacteria | 1049 |
| 696 | Ga0495621_0246173 | 3300046539 | Bacteria | 729 |
| 697 | Ga0495597_0028176 | 3300046542 | Bacteria | 2572 |
| 698 | Ga0495633_0000320 | 3300046558 | Bacteria | 54350 |
| 699 | Ga0495633_0001111 | 3300046558 | Bacteria | 21646 |
| 700 | Ga0495633_0002680 | 3300046558 | Bacteria | 12377 |
| 701 | Ga0495633_0012350 | 3300046558 | Bacteria | 4547 |
| 702 | Ga0495668_0000261 | 3300046616 | Bacteria | 74577 |
| 703 | Ga0495668_0004403 | 3300046616 | Bacteria | 10020 |
| 704 | Ga0495668_0020010 | 3300046616 | Bacteria | 3850 |
| 705 | Ga0495668_0369869 | 3300046616 | Bacteria | 787 |
| 706 | Ga0495611_0025833 | 3300046648 | Bacteria | 2561 |
| 707 | Ga0495611_0066498 | 3300046648 | Bacteria | 1644 |
| 708 | Ga0495625_0000570 | 3300046660 | Bacteria | 54000 |
| 709 | Ga0495625_0023939 | 3300046660 | Bacteria | 4656 |
| 710 | Ga0495625_0033676 | 3300046660 | Bacteria | 3785 |
| 711 | Ga0495625_0068919 | 3300046660 | Bacteria | 2486 |
| 712 | Ga0495625_0071795 | 3300046660 | Bacteria | 2429 |
| 713 | Ga0495625_0240765 | 3300046660 | Bacteria | 1178 |
| 714 | Ga0495625_0289504 | 3300046660 | Bacteria | 1051 |
| 715 | Ga0495661_0164292 | 3300046665 | Bacteria | 1189 |
| 716 | Ga0495669_0000333 | 3300046684 | Bacteria | 25095 |
| 717 | Ga0495669_0025332 | 3300046684 | Bacteria | 2587 |
| 718 | Ga0495670_0000009 | 3300046691 | Bacteria | 210956 |
| 719 | Ga0495670_0024341 | 3300046691 | Bacteria | 2992 |
| 720 | Ga0495670_0046523 | 3300046691 | Bacteria | 2167 |
| 721 | Ga0495670_0048691 | 3300046691 | Bacteria | 2120 |
| 722 | Ga0495670_0077744 | 3300046691 | Bacteria | 1687 |
| 723 | Ga0495670_0416490 | 3300046691 | Bacteria | 726 |
| 724 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 725 | Ga0495671_0000065 | 3300046692 | Bacteria | 106122 |
| 726 | Ga0495671_0017921 | 3300046692 | Bacteria | 3765 |
| 727 | Ga0495671_0034554 | 3300046692 | Bacteria | 2570 |
| 728 | Ga0495636_0066270 | 3300047318 | Bacteria | 1535 |
| 729 | Ga0495687_000470 | 3300047443 | Bacteria | 48865 |
| 730 | Ga0495687_001491 | 3300047443 | Bacteria | 21376 |
| 731 | Ga0495687_111471 | 3300047443 | Bacteria | 1005 |
| 732 | Ga0495677_0017046 | 3300047445 | Bacteria | 2633 |
| 733 | Ga0495677_0030696 | 3300047445 | Bacteria | 1956 |
| 734 | Ga0495673_0000174 | 3300047469 | Bacteria | 106069 |
| 735 | Ga0495681_0000228 | 3300047470 | Bacteria | 46877 |
| 736 | Ga0495681_0018954 | 3300047470 | Bacteria | 3774 |
| 737 | Ga0495681_0065650 | 3300047470 | Bacteria | 1658 |
| 738 | Ga0495686_0000185 | 3300047472 | Bacteria | 116495 |
| 739 | Ga0495686_0005738 | 3300047472 | Bacteria | 9705 |
| 740 | Ga0495686_0027901 | 3300047472 | Bacteria | 3680 |
| 741 | Ga0495686_0046918 | 3300047472 | Bacteria | 2729 |
| 742 | Ga0495686_0113510 | 3300047472 | Bacteria | 1622 |
| 743 | Ga0495686_0363672 | 3300047472 | Bacteria | 784 |
| 744 | Ga0496101_0541130 | 3300048904 | Bacteria | 921 |
| 745 | Ga0496101_1101498 | 3300048904 | Bacteria | 623 |
| 746 | Ga0496102_0000043 | 3300048905 | Bacteria | 189201 |
| 747 | Ga0496102_0885688 | 3300048905 | Bacteria | 814 |
| 748 | Ga0496103_0000086 | 3300048906 | Bacteria | 104765 |
| 749 | Ga0496103_0266364 | 3300048906 | Bacteria | 1102 |
| 750 | Ga0496105_0124495 | 3300048908 | Bacteria | 2125 |
| 751 | Ga0496105_0460120 | 3300048908 | Bacteria | 1003 |
| 752 | Ga0496108_0004571 | 3300048911 | Bacteria | 11149 |
| 753 | Ga0496108_0058786 | 3300048911 | Bacteria | 3232 |
| 754 | Ga0496109_0341499 | 3300048912 | Bacteria | 1414 |
| 755 | Ga0496110_0014526 | 3300048913 | Bacteria | 6543 |
| 756 | Ga0496111_0399267 | 3300048914 | Bacteria | 1016 |
| 757 | Ga0496113_0110841 | 3300048916 | Bacteria | 2136 |
| 758 | Ga0496114_0114758 | 3300048917 | Bacteria | 2310 |
| 759 | Ga0496115_0001442 | 3300048918 | Bacteria | 17034 |
| 760 | Ga0496115_0030277 | 3300048918 | Bacteria | 4257 |
| 761 | Ga0496116_0004889 | 3300048919 | Bacteria | 12638 |
| 762 | Ga0496116_0104998 | 3300048919 | Bacteria | 1677 |
| 763 | Ga0496117_0000104 | 3300048920 | Bacteria | 189201 |
| 764 | Ga0496117_0013607 | 3300048920 | Bacteria | 7086 |
| 765 | Ga0496117_0015430 | 3300048920 | Bacteria | 6514 |
| 766 | Ga0496117_0067040 | 3300048920 | Bacteria | 2431 |
| 767 | Ga0496118_0000080 | 3300048921 | Bacteria | 189201 |
| 768 | Ga0496118_0019663 | 3300048921 | Bacteria | 6027 |
| 769 | Ga0496118_0030842 | 3300048921 | Bacteria | 4461 |
| 770 | Ga0496118_0040230 | 3300048921 | Bacteria | 3719 |
| 771 | Ga0496118_0062182 | 3300048921 | Bacteria | 2759 |
| 772 | Ga0496118_0176499 | 3300048921 | Bacteria | 1297 |
| 773 | Ga0496118_0242678 | 3300048921 | Bacteria | 1030 |
| 774 | Ga0496119_0014145 | 3300048922 | Bacteria | 6270 |
| 775 | Ga0496119_0037511 | 3300048922 | Bacteria | 3147 |
| 776 | Ga0496119_0118599 | 3300048922 | Bacteria | 1458 |
| 777 | Ga0496119_0126202 | 3300048922 | Bacteria | 1400 |
| 778 | Ga0496119_0289068 | 3300048922 | Bacteria | 812 |
| 779 | Ga0496120_0043101 | 3300048923 | Bacteria | 2631 |
| 780 | Ga0496120_0078589 | 3300048923 | Bacteria | 1793 |
| 781 | Ga0496120_0105520 | 3300048923 | Bacteria | 1481 |
| 782 | Ga0496120_0151357 | 3300048923 | Bacteria | 1166 |
| 783 | Ga0496120_0160689 | 3300048923 | Bacteria | 1120 |
| 784 | Ga0496121_0000681 | 3300048924 | Bacteria | 63345 |
| 785 | Ga0496121_0001025 | 3300048924 | Bacteria | 49756 |
| 786 | Ga0496121_0001630 | 3300048924 | Bacteria | 37148 |
| 787 | Ga0496121_0013852 | 3300048924 | Bacteria | 8626 |
| 788 | Ga0496121_0035808 | 3300048924 | Bacteria | 4438 |
| 789 | Ga0496121_0067090 | 3300048924 | Bacteria | 2909 |
| 790 | Ga0496121_0094896 | 3300048924 | Bacteria | 2319 |
| 791 | Ga0496121_0259767 | 3300048924 | Bacteria | 1200 |
| 792 | Ga0496122_0000589 | 3300048925 | Bacteria | 74585 |
| 793 | Ga0496122_0009235 | 3300048925 | Bacteria | 10433 |
| 794 | Ga0496122_0017421 | 3300048925 | Bacteria | 6718 |
| 795 | Ga0496122_0046285 | 3300048925 | Bacteria | 3371 |
| 796 | Ga0496123_0001872 | 3300048926 | Bacteria | 27559 |
| 797 | Ga0496123_0002066 | 3300048926 | Bacteria | 25899 |
| 798 | Ga0496123_0031058 | 3300048926 | Bacteria | 3896 |
| 799 | Ga0496123_0039234 | 3300048926 | Bacteria | 3315 |
| 800 | Ga0496123_0064664 | 3300048926 | Bacteria | 2330 |
| 801 | Ga0496123_0075283 | 3300048926 | Bacteria | 2084 |
| 802 | Ga0496123_0076064 | 3300048926 | Bacteria | 2068 |
| 803 | Ga0496123_0080819 | 3300048926 | Bacteria | 1978 |
| 804 | Ga0496123_0218830 | 3300048926 | Bacteria | 962 |
| 805 | Ga0496124_0000093 | 3300048927 | Bacteria | 189201 |
| 806 | Ga0496124_0000204 | 3300048927 | Bacteria | 116976 |
| 807 | Ga0496124_0002278 | 3300048927 | Bacteria | 25389 |
| 808 | Ga0496124_0011745 | 3300048927 | Bacteria | 8735 |
| 809 | Ga0496124_0012980 | 3300048927 | Bacteria | 8167 |
| 810 | Ga0496124_0018373 | 3300048927 | Bacteria | 6549 |
| 811 | Ga0496124_0056279 | 3300048927 | Bacteria | 3318 |
| 812 | Ga0496124_0099235 | 3300048927 | Bacteria | 2362 |
| 813 | Ga0496124_0252935 | 3300048927 | Bacteria | 1302 |
| 814 | Ga0496124_0781764 | 3300048927 | Bacteria | 594 |
| 815 | Ga0496125_0001206 | 3300048928 | Bacteria | 38876 |
| 816 | Ga0496125_0018837 | 3300048928 | Bacteria | 6536 |
| 817 | Ga0496125_0039047 | 3300048928 | Bacteria | 4096 |
| 818 | Ga0496125_0043236 | 3300048928 | Bacteria | 3827 |
| 819 | Ga0496125_0061621 | 3300048928 | Bacteria | 3007 |
| 820 | Ga0496126_0016562 | 3300048929 | Bacteria | 7367 |
| 821 | Ga0496126_0057622 | 3300048929 | Bacteria | 3506 |
| 822 | Ga0496126_0184524 | 3300048929 | Bacteria | 1770 |
| 823 | Ga0496126_0231779 | 3300048929 | Bacteria | 1547 |
| 824 | Ga0496126_0294207 | 3300048929 | Bacteria | 1342 |
| 825 | Ga0496126_0468908 | 3300048929 | Bacteria | 1011 |
| 826 | Ga0495678_021780 | 3300049459 | Bacteria | 2816 |
| 827 | Ga0495682_0010872 | 3300049460 | Bacteria | 3508 |
| 828 | Ga0501290_003218 | 3300049513 | Bacteria | 2072 |
| 829 | Ga0501290_008713 | 3300049513 | Bacteria | 1286 |
| 830 | Ga0501292_000074 | 3300049515 | Bacteria | 19994 |
| 831 | Ga0501294_000612 | 3300049517 | Bacteria | 4074 |
| 832 | Ga0501034_0456527 | 3300049571 | Bacteria | 1195 |
| 833 | Ga0501034_0694461 | 3300049571 | Bacteria | 916 |
| 834 | Ga0501036_0165544 | 3300049572 | Bacteria | 1864 |
| 835 | Ga0501043_0048052 | 3300049579 | Bacteria | 3355 |
| 836 | Ga0501043_0057895 | 3300049579 | Bacteria | 3042 |
| 837 | Ga0501046_0067509 | 3300049580 | Bacteria | 2785 |
| 838 | Ga0501046_0661856 | 3300049580 | Bacteria | 738 |
| 839 | Ga0501047_0028974 | 3300049581 | Bacteria | 5340 |
| 840 | Ga0501047_0110681 | 3300049581 | Bacteria | 2629 |
| 841 | Ga0501047_0374014 | 3300049581 | Bacteria | 1260 |
| 842 | Ga0501048_0078770 | 3300049582 | Bacteria | 2326 |
| 843 | Ga0501048_0546740 | 3300049582 | Bacteria | 831 |
| 844 | Ga0501071_0371476 | 3300049587 | Bacteria | 1090 |
| 845 | Ga0501206_000630 | 3300049653 | Bacteria | 4238 |
| 846 | Ga0501211_005901 | 3300049658 | Bacteria | 1219 |
| 847 | Ga0501222_001135 | 3300049662 | Bacteria | 3770 |
| 848 | Ga0501223_000025 | 3300049663 | Bacteria | 58092 |
| 849 | Ga0501223_008131 | 3300049663 | Bacteria | 2140 |
| 850 | Ga0501224_003673 | 3300049664 | Bacteria | 2154 |
| 851 | Ga0501235_003892 | 3300049669 | Bacteria | 3230 |
| 852 | Ga0501235_013506 | 3300049669 | Bacteria | 1797 |
| 853 | Ga0501249_000305 | 3300049679 | Bacteria | 13816 |
| 854 | Ga0501257_000568 | 3300049686 | Bacteria | 7318 |
| 855 | Ga0501259_001177 | 3300049688 | Bacteria | 4359 |
| 856 | Ga0501261_000602 | 3300049690 | Bacteria | 4577 |
| 857 | Ga0501221_005405 | 3300049704 | Bacteria | 2133 |
| 858 | Ga0501225_0000036 | 3300049705 | Bacteria | 46300 |
| 859 | Ga0501225_0003823 | 3300049705 | Bacteria | 4522 |
| 860 | Ga0501225_0048315 | 3300049705 | Bacteria | 1182 |
| 861 | Ga0501278_008090 | 3300049774 | Bacteria | 808 |
| 862 | Ga0501279_000058 | 3300049775 | Bacteria | 20363 |
| 863 | Ga0501280_000122 | 3300049776 | Bacteria | 20266 |
| 864 | Ga0501280_003611 | 3300049776 | Bacteria | 2357 |
| 865 | Ga0501281_00828 | 3300049777 | Bacteria | 2645 |
| 866 | Ga0501282_000646 | 3300049778 | Bacteria | 4020 |
| 867 | Ga0501283_005863 | 3300049779 | Bacteria | 1701 |
| 868 | Ga0501035_0331501 | 3300049822 | Bacteria | 1277 |
| 869 | Ga0501044_0196671 | 3300049823 | Bacteria | 1976 |
| 870 | nmdc:mga06z11_7_c1 | 3300050494 | Bacteria | 121804 |
| 871 | nmdc:mga04h51_44_c1 | 3300050495 | Bacteria | 41495 |
| 872 | nmdc:mga07m45_150221_c1 | 3300050496 | Bacteria | 1351 |
| 873 | nmdc:mga05p37_382339_c1 | 3300050507 | Bacteria | 1649 |
| 874 | Ga0500610_0000661 | 3300053079 | Bacteria | 10628 |
| 875 | Ga0500643_000089 | 3300053087 | Bacteria | 93982 |
| 876 | Ga0500643_000129 | 3300053087 | Bacteria | 77787 |
| 877 | Ga0500643_000641 | 3300053087 | Bacteria | 23561 |
| 878 | Ga0500643_001043 | 3300053087 | Bacteria | 16808 |
| 879 | Ga0500643_011332 | 3300053087 | Bacteria | 3257 |
| 880 | Ga0500643_011522 | 3300053087 | Bacteria | 3223 |
| 881 | Ga0500643_011530 | 3300053087 | Bacteria | 3220 |
| 882 | Ga0500643_012809 | 3300053087 | Bacteria | 2990 |
| 883 | Ga0500643_015322 | 3300053087 | Bacteria | 2633 |
| 884 | Ga0500643_069033 | 3300053087 | Bacteria | 982 |
| 885 | Ga0500643_077379 | 3300053087 | Bacteria | 917 |
| 886 | Ga0500643_183888 | 3300053087 | Bacteria | 560 |
| 887 | Ga0500647_0018649 | 3300053091 | Bacteria | 3216 |
| 888 | Ga0500651_0083340 | 3300053093 | Bacteria | 1978 |
| 889 | Ga0500566_0000691 | 3300053094 | Bacteria | 18979 |
| 890 | Ga0500641_0056781 | 3300053096 | Bacteria | 1623 |
| 891 | Ga0500641_0123928 | 3300053096 | Bacteria | 1114 |
| 892 | Ga0500641_0217775 | 3300053096 | Bacteria | 810 |
| 893 | Ga0500650_0069216 | 3300053098 | Bacteria | 1650 |
| 894 | Ga0500554_102645 | 3300053102 | Bacteria | 958 |
| 895 | Ga0500555_000430 | 3300053103 | Bacteria | 17416 |
| 896 | Ga0500555_044473 | 3300053103 | Bacteria | 1229 |
| 897 | Ga0500556_0000027 | 3300053104 | Bacteria | 165855 |
| 898 | Ga0500557_061050 | 3300053105 | Bacteria | 1224 |
| 899 | Ga0500592_000086 | 3300053116 | Bacteria | 21326 |
| 900 | Ga0500594_0019585 | 3300053118 | Bacteria | 1679 |
| 901 | Ga0500594_0026602 | 3300053118 | Bacteria | 1491 |
| 902 | Ga0500595_002106 | 3300053119 | Bacteria | 10171 |
| 903 | Ga0500608_058243 | 3300053122 | Bacteria | 1850 |
| 904 | Ga0500608_065769 | 3300053122 | Bacteria | 1729 |
| 905 | Ga0500618_007224 | 3300053125 | Bacteria | 3187 |
| 906 | Ga0500626_288782 | 3300053128 | Bacteria | 587 |
| 907 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 908 | Ga0500652_226492 | 3300053131 | Bacteria | 750 |
| 909 | Ga0500655_000122 | 3300053133 | Bacteria | 19897 |
| 910 | Ga0500658_0007651 | 3300053134 | Bacteria | 3991 |
| 911 | Ga0500658_0026539 | 3300053134 | Bacteria | 2232 |
| 912 | Ga0500559_0005855 | 3300053136 | Bacteria | 5602 |
| 913 | Ga0500559_0012017 | 3300053136 | Bacteria | 3689 |
| 914 | Ga0500559_0028777 | 3300053136 | Bacteria | 2375 |
| 915 | Ga0500559_0067700 | 3300053136 | Bacteria | 1603 |
| 916 | Ga0500559_0070803 | 3300053136 | Bacteria | 1570 |
| 917 | Ga0500559_0086269 | 3300053136 | Bacteria | 1433 |
| 918 | Ga0500568_0000917 | 3300053139 | Bacteria | 20344 |
| 919 | Ga0500573_0000016 | 3300053140 | Bacteria | 182675 |
| 920 | Ga0500573_0270236 | 3300053140 | Bacteria | 866 |
| 921 | Ga0500577_0047339 | 3300053142 | Bacteria | 1598 |
| 922 | Ga0500590_004273 | 3300053148 | Bacteria | 6718 |
| 923 | Ga0500604_0000023 | 3300053151 | Bacteria | 70298 |
| 924 | Ga0500616_0000318 | 3300053153 | Bacteria | 69201 |
| 925 | Ga0500616_0006486 | 3300053153 | Bacteria | 7656 |
| 926 | Ga0500616_0014454 | 3300053153 | Bacteria | 4536 |
| 927 | Ga0500616_0173260 | 3300053153 | Bacteria | 978 |
| 928 | Ga0500622_0122137 | 3300053156 | Bacteria | 1262 |
| 929 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 930 | Ga0500624_000765 | 3300053157 | Bacteria | 7702 |
| 931 | Ga0500624_050028 | 3300053157 | Bacteria | 775 |
| 932 | Ga0500627_0000549 | 3300053158 | Bacteria | 10114 |
| 933 | Ga0500639_068732 | 3300053163 | Bacteria | 1809 |
| 934 | Ga0500636_0015291 | 3300053177 | Bacteria | 4521 |
| 935 | Ga0500636_0056736 | 3300053177 | Bacteria | 2293 |
| 936 | Ga0500637_0000248 | 3300053178 | Bacteria | 20072 |
| 937 | Ga0500570_003257 | 3300053724 | Bacteria | 8295 |
| 938 | Ga0500645_000062 | 3300053730 | Bacteria | 85561 |
| 939 | Ga0500645_000424 | 3300053730 | Bacteria | 29265 |
| 940 | Ga0500645_002084 | 3300053730 | Bacteria | 9261 |
| 941 | Ga0466962_0004503 | 3300061719 | Bacteria | 6681 |
| 942 | Ga0466962_0015483 | 3300061719 | Bacteria | 3678 |
| 943 | Ga0466962_0017955 | 3300061719 | Bacteria | 3404 |
| 944 | Ga0466962_0093754 | 3300061719 | Bacteria | 1439 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049679 | Ga0501249_000305 | Ga0501249_000305_6313_6849 | 153 |
| 2 | 3300005262 | Ga0065165_1075133 | Ga0065165_10751332 | 157 |
| 3 | 3300031548 | Ga0307408_100046157 | Ga0307408_1000461573 | 158 |
| 4 | 3300031731 | Ga0307405_10223445 | Ga0307405_102234452 | 158 |
| 5 | 3300031824 | Ga0307413_10057100 | Ga0307413_100571003 | 158 |
| 6 | 3300031852 | Ga0307410_10129803 | Ga0307410_101298032 | 158 |
| 7 | 3300031901 | Ga0307406_10004070 | Ga0307406_100040706 | 158 |
| 8 | 3300031903 | Ga0307407_10093093 | Ga0307407_100930932 | 158 |
| 9 | 3300031911 | Ga0307412_10006836 | Ga0307412_100068368 | 158 |
| 10 | 3300032002 | Ga0307416_100005856 | Ga0307416_1000058563 | 158 |
| 11 | 3300032005 | Ga0307411_10074692 | Ga0307411_100746923 | 158 |
| 12 | 3300032126 | Ga0307415_100031013 | Ga0307415_1000310133 | 158 |
| 13 | 3300025986 | Ga0207658_10849857 | Ga0207658_108498572 | 159 |
| 14 | 3300046616 | Ga0495668_0004403 | Ga0495668_0004403_5974_6462 | 159 |
| 15 | 3300032004 | Ga0307414_10000911 | Ga0307414_1000091112 | 160 |
| 16 | 3300046522 | Ga0495643_0026420 | Ga0495643_0026420_926_1411 | 161 |
| 17 | iso_pu_bacteria | 2643221588 | 2643949314 | 161 |
| 18 | 3300005842 | Ga0068858_100045893 | Ga0068858_1000458934 | 162 |
| 19 | 3300006353 | Ga0075370_10033771 | Ga0075370_100337713 | 162 |
| 20 | 3300009177 | Ga0105248_10557854 | Ga0105248_105578541 | 162 |
| 21 | 3300014968 | Ga0157379_10687645 | Ga0157379_106876452 | 162 |
| 22 | 3300026035 | Ga0207703_10026618 | Ga0207703_100266184 | 162 |
| 23 | 3300048906 | Ga0496103_0266364 | Ga0496103_0266364_429_941 | 162 |
| 24 | 3300048919 | Ga0496116_0104998 | Ga0496116_0104998_275_787 | 162 |
| 25 | 3300048920 | Ga0496117_0015430 | Ga0496117_0015430_2854_3366 | 162 |
| 26 | 3300048921 | Ga0496118_0019663 | Ga0496118_0019663_5020_5532 | 162 |
| 27 | 3300048922 | Ga0496119_0289068 | Ga0496119_0289068_216_728 | 162 |
| 28 | 3300048923 | Ga0496120_0151357 | Ga0496120_0151357_459_971 | 162 |
| 29 | 3300048927 | Ga0496124_0012980 | Ga0496124_0012980_6336_6848 | 162 |
| 30 | 3300049823 | Ga0501044_0196671 | Ga0501044_0196671_1310_1804 | 162 |
| 31 | 3300005547 | Ga0070693_100215646 | Ga0070693_1002156462 | 163 |
| 32 | 3300014326 | Ga0157380_10451141 | Ga0157380_104511412 | 163 |
| 33 | 3300026067 | Ga0207678_10082780 | Ga0207678_100827803 | 163 |
| 34 | 3300031548 | Ga0307408_100375426 | Ga0307408_1003754262 | 163 |
| 35 | 3300031824 | Ga0307413_10219146 | Ga0307413_102191462 | 163 |
| 36 | 3300031824 | Ga0307413_10239950 | Ga0307413_102399502 | 163 |
| 37 | 3300031824 | Ga0307413_10333499 | Ga0307413_103334991 | 163 |
| 38 | 3300031995 | Ga0307409_101495577 | Ga0307409_1014955771 | 163 |
| 39 | 3300032004 | Ga0307414_10040341 | Ga0307414_100403414 | 163 |
| 40 | 3300032004 | Ga0307414_10136036 | Ga0307414_101360363 | 163 |
| 41 | 3300032004 | Ga0307414_10291899 | Ga0307414_102918992 | 163 |
| 42 | 3300032005 | Ga0307411_10098250 | Ga0307411_100982502 | 163 |
| 43 | 3300032126 | Ga0307415_100093990 | Ga0307415_1000939903 | 163 |
| 44 | 3300042116 | Ga0450912_003228 | Ga0450912_003228_439_936 | 163 |
| 45 | 3300053118 | Ga0500594_0019585 | Ga0500594_0019585_18_524 | 163 |
| 46 | 3300025945 | Ga0207679_11159432 | Ga0207679_111594322 | 164 |
| 47 | 3300032002 | Ga0307416_101591817 | Ga0307416_1015918171 | 164 |
| 48 | 3300003323 | rootH1_10098301 | rootH1_100983014 | 165 |
| 49 | 3300005262 | Ga0065165_1004738 | Ga0065165_10047385 | 165 |
| 50 | 3300005336 | Ga0070680_100630651 | Ga0070680_1006306512 | 165 |
| 51 | 3300005344 | Ga0070661_100093676 | Ga0070661_1000936762 | 165 |
| 52 | 3300005353 | Ga0070669_100304443 | Ga0070669_1003044432 | 165 |
| 53 | 3300005354 | Ga0070675_101016432 | Ga0070675_1010164322 | 165 |
| 54 | 3300005364 | Ga0070673_100320001 | Ga0070673_1003200012 | 165 |
| 55 | 3300005455 | Ga0070663_100304553 | Ga0070663_1003045532 | 165 |
| 56 | 3300005530 | Ga0070679_100349033 | Ga0070679_1003490333 | 165 |
| 57 | 3300005563 | Ga0068855_100068705 | Ga0068855_1000687053 | 165 |
| 58 | 3300005578 | Ga0068854_100176021 | Ga0068854_1001760213 | 165 |
| 59 | 3300005614 | Ga0068856_100004201 | Ga0068856_10000420113 | 165 |
| 60 | 3300005616 | Ga0068852_100005250 | Ga0068852_1000052509 | 165 |
| 61 | 3300013102 | Ga0157371_10002068 | Ga0157371_100020687 | 165 |
| 62 | 3300013104 | Ga0157370_10396287 | Ga0157370_103962872 | 165 |
| 63 | 3300013104 | Ga0157370_10445842 | Ga0157370_104458422 | 165 |
| 64 | 3300013105 | Ga0157369_10000298 | Ga0157369_1000029824 | 165 |
| 65 | 3300013105 | Ga0157369_10004587 | Ga0157369_1000458713 | 165 |
| 66 | 3300013307 | Ga0157372_10650829 | Ga0157372_106508291 | 165 |
| 67 | 3300014326 | Ga0157380_10927867 | Ga0157380_109278672 | 165 |
| 68 | 3300025893 | Ga0207682_10197228 | Ga0207682_101972281 | 165 |
| 69 | 3300025909 | Ga0207705_10213995 | Ga0207705_102139952 | 165 |
| 70 | 3300025920 | Ga0207649_10785267 | Ga0207649_107852672 | 165 |
| 71 | 3300025921 | Ga0207652_10360977 | Ga0207652_103609773 | 165 |
| 72 | 3300025923 | Ga0207681_10249423 | Ga0207681_102494232 | 165 |
| 73 | 3300025936 | Ga0207670_10180514 | Ga0207670_101805142 | 165 |
| 74 | 3300025949 | Ga0207667_10020841 | Ga0207667_100208412 | 165 |
| 75 | 3300025960 | Ga0207651_10283621 | Ga0207651_102836212 | 165 |
| 76 | 3300026067 | Ga0207678_10263424 | Ga0207678_102634242 | 165 |
| 77 | 3300026078 | Ga0207702_10015330 | Ga0207702_100153304 | 165 |
| 78 | 3300026078 | Ga0207702_10015475 | Ga0207702_100154755 | 165 |
| 79 | 3300031731 | Ga0307405_10023181 | Ga0307405_100231813 | 165 |
| 80 | 3300031824 | Ga0307413_10032195 | Ga0307413_100321953 | 165 |
| 81 | 3300031852 | Ga0307410_10622484 | Ga0307410_106224842 | 165 |
| 82 | 3300031901 | Ga0307406_10029680 | Ga0307406_100296804 | 165 |
| 83 | 3300031903 | Ga0307407_10125243 | Ga0307407_101252431 | 165 |
| 84 | 3300031995 | Ga0307409_100193090 | Ga0307409_1001930902 | 165 |
| 85 | 3300032004 | Ga0307414_10014817 | Ga0307414_100148172 | 165 |
| 86 | 3300032004 | Ga0307414_11053423 | Ga0307414_110534232 | 165 |
| 87 | 3300032004 | Ga0307414_11168622 | Ga0307414_111686222 | 165 |
| 88 | 3300032005 | Ga0307411_10014349 | Ga0307411_100143495 | 165 |
| 89 | 3300032126 | Ga0307415_100206421 | Ga0307415_1002064212 | 165 |
| 90 | 3300037312 | Ga0395899_0012107 | Ga0395899_0012107_5500_6003 | 165 |
| 91 | 3300037418 | Ga0395900_0009928 | Ga0395900_0009928_4334_4837 | 165 |
| 92 | 3300037418 | Ga0395900_0204307 | Ga0395900_0204307_1053_1556 | 165 |
| 93 | 3300037466 | Ga0395898_0082714 | Ga0395898_0082714_68_571 | 165 |
| 94 | 3300037466 | Ga0395898_0146412 | Ga0395898_0146412_169_672 | 165 |
| 95 | 3300037471 | Ga0395905_0119946 | Ga0395905_0119946_451_957 | 165 |
| 96 | 3300037471 | Ga0395905_1210529 | Ga0395905_1210529_10_516 | 165 |
| 97 | 3300041486 | Ga0451807_1001113 | Ga0451807_1001113_107_619 | 165 |
| 98 | 3300042004 | Ga0439445_0146095 | Ga0439445_0146095_40_543 | 165 |
| 99 | 3300042007 | Ga0439449_0054781 | Ga0439449_0054781_791_1294 | 165 |
| 100 | 3300042015 | Ga0439462_0056833 | Ga0439462_0056833_478_990 | 165 |
| 101 | 3300042015 | Ga0439462_0162858 | Ga0439462_0162858_16_519 | 165 |
| 102 | 3300044656 | Ga0466969_0004200 | Ga0466969_0004200_2733_3236 | 165 |
| 103 | 3300044684 | Ga0466966_0005297 | Ga0466966_0005297_2054_2557 | 165 |
| 104 | 3300044693 | Ga0466961_0005451 | Ga0466961_0005451_2183_2686 | 165 |
| 105 | 3300044693 | Ga0466961_0242551 | Ga0466961_0242551_416_919 | 165 |
| 106 | 3300044694 | Ga0466963_0005868 | Ga0466963_0005868_4956_5459 | 165 |
| 107 | 3300044694 | Ga0466963_0019396 | Ga0466963_0019396_1712_2215 | 165 |
| 108 | 3300044719 | Ga0466971_0002248 | Ga0466971_0002248_5080_5583 | 165 |
| 109 | 3300044719 | Ga0466971_0239415 | Ga0466971_0239415_157_660 | 165 |
| 110 | 3300044765 | Ga0466970_0020502 | Ga0466970_0020502_1750_2253 | 165 |
| 111 | 3300044765 | Ga0466970_0107151 | Ga0466970_0107151_906_1409 | 165 |
| 112 | 3300044842 | Ga0466957_0000189 | Ga0466957_0000189_3843_4346 | 165 |
| 113 | 3300044901 | Ga0466960_0317516 | Ga0466960_0317516_37_540 | 165 |
| 114 | 3300045049 | Ga0466959_0003340 | Ga0466959_0003340_6798_7301 | 165 |
| 115 | 3300045049 | Ga0466959_0014024 | Ga0466959_0014024_3578_4081 | 165 |
| 116 | 3300045836 | Ga0466958_0016124 | Ga0466958_0016124_1869_2372 | 165 |
| 117 | 3300045836 | Ga0466958_0058702 | Ga0466958_0058702_69_572 | 165 |
| 118 | 3300046539 | Ga0495621_0246173 | Ga0495621_0246173_212_715 | 165 |
| 119 | 3300048911 | Ga0496108_0058786 | Ga0496108_0058786_1878_2381 | 165 |
| 120 | 3300048917 | Ga0496114_0114758 | Ga0496114_0114758_574_1077 | 165 |
| 121 | 3300048918 | Ga0496115_0001442 | Ga0496115_0001442_3570_4073 | 165 |
| 122 | 3300049582 | Ga0501048_0546740 | Ga0501048_0546740_119_634 | 165 |
| 123 | 3300061719 | Ga0466962_0004503 | Ga0466962_0004503_1293_1796 | 165 |
| 124 | 3300061719 | Ga0466962_0093754 | Ga0466962_0093754_253_756 | 165 |
| 125 | 3300003762 | Ga0055542_1004873 | Ga0055542_10048733 | 166 |
| 126 | 3300005327 | Ga0070658_10001506 | Ga0070658_100015067 | 166 |
| 127 | 3300005339 | Ga0070660_100000401 | Ga0070660_10000040114 | 166 |
| 128 | 3300005539 | Ga0068853_100145477 | Ga0068853_1001454773 | 166 |
| 129 | 3300005563 | Ga0068855_100001528 | Ga0068855_10000152813 | 166 |
| 130 | 3300005563 | Ga0068855_100078020 | Ga0068855_1000780202 | 166 |
| 131 | 3300005577 | Ga0068857_100062712 | Ga0068857_1000627122 | 166 |
| 132 | 3300005616 | Ga0068852_100764919 | Ga0068852_1007649192 | 166 |
| 133 | 3300009545 | Ga0105237_10184363 | Ga0105237_101843633 | 166 |
| 134 | 3300010375 | Ga0105239_10392896 | Ga0105239_103928962 | 166 |
| 135 | 3300010375 | Ga0105239_10643966 | Ga0105239_106439662 | 166 |
| 136 | 3300013306 | Ga0163162_10290159 | Ga0163162_102901592 | 166 |
| 137 | 3300025254 | Ga0209148_1000338 | Ga0209148_10003386 | 166 |
| 138 | 3300025909 | Ga0207705_10000027 | Ga0207705_10000027110 | 166 |
| 139 | 3300025914 | Ga0207671_10192273 | Ga0207671_101922733 | 166 |
| 140 | 3300025919 | Ga0207657_10001109 | Ga0207657_1000110918 | 166 |
| 141 | 3300025949 | Ga0207667_10000109 | Ga0207667_1000010918 | 166 |
| 142 | 3300025949 | Ga0207667_10053655 | Ga0207667_100536555 | 166 |
| 143 | 3300026041 | Ga0207639_10358941 | Ga0207639_103589413 | 166 |
| 144 | 3300031548 | Ga0307408_100753864 | Ga0307408_1007538642 | 166 |
| 145 | 3300032004 | Ga0307414_10381536 | Ga0307414_103815362 | 166 |
| 146 | 3300053087 | Ga0500643_015322 | Ga0500643_015322_431_940 | 166 |
| 147 | 3300053122 | Ga0500608_058243 | Ga0500608_058243_337_846 | 166 |
| 148 | 3300053153 | Ga0500616_0014454 | Ga0500616_0014454_2579_3088 | 166 |
| 149 | 3300005617 | Ga0068859_100955834 | Ga0068859_1009558342 | 167 |
| 150 | 3300046522 | Ga0495643_0164576 | Ga0495643_0164576_298_813 | 167 |
| 151 | 3300053153 | Ga0500616_0173260 | Ga0500616_0173260_403_918 | 167 |
| 152 | iso_pu_bacteria | 2751185897 | 2753763779 | 167 |
| 153 | iso_pu_bacteria | 2885429604 | 2885429621 | 167 |
| 154 | 3300005262 | Ga0065165_1003585 | Ga0065165_10035859 | 168 |
| 155 | 3300028380 | Ga0268265_10778555 | Ga0268265_107785552 | 168 |
| 156 | 3300046691 | Ga0495670_0046523 | Ga0495670_0046523_670_1200 | 168 |
| 157 | 3300049571 | Ga0501034_0694461 | Ga0501034_0694461_226_744 | 168 |
| 158 | 3300053136 | Ga0500559_0028777 | Ga0500559_0028777_1236_1748 | 168 |
| 159 | 3300053140 | Ga0500573_0000016 | Ga0500573_0000016_73394_73918 | 168 |
| 160 | 3300053140 | Ga0500573_0270236 | Ga0500573_0270236_114_626 | 168 |
| 161 | iso_pu_bacteria | 2775507255 | 2778123970 | 168 |
| 162 | iso_pu_bacteria | 2808606405 | 2809082168 | 168 |
| 163 | iso_pu_bacteria | 2880518877 | 2880519655 | 168 |
| 164 | iso_pu_bacteria | 2919709256 | 2919709901 | 168 |
| 165 | iso_pu_bacteria | 2990265787 | 2990266587 | 168 |
| 166 | iso_pu_bacteria | 2993693658 | 2993695614 | 168 |
| 167 | 3300000043 | ARcpr5yngRDRAFT_c001224 | ARcpr5yngRDRAFT_0012242 | 169 |
| 168 | 3300000652 | ARCol0yngRDRAFT_1002626 | ARCol0yngRDRAFT_10026263 | 169 |
| 169 | 3300001904 | JGI24736J21556_1005436 | JGI24736J21556_10054362 | 169 |
| 170 | 3300001989 | JGI24739J22299_10001086 | JGI24739J22299_100010862 | 169 |
| 171 | 3300001989 | JGI24739J22299_10008251 | JGI24739J22299_100082513 | 169 |
| 172 | 3300001989 | JGI24739J22299_10008868 | JGI24739J22299_100088685 | 169 |
| 173 | 3300001990 | JGI24737J22298_10008114 | JGI24737J22298_100081142 | 169 |
| 174 | 3300001990 | JGI24737J22298_10008735 | JGI24737J22298_100087353 | 169 |
| 175 | 3300001990 | JGI24737J22298_10018638 | JGI24737J22298_100186384 | 169 |
| 176 | 3300001990 | JGI24737J22298_10059028 | JGI24737J22298_100590282 | 169 |
| 177 | 3300002067 | JGI24735J21928_10000815 | JGI24735J21928_100008156 | 169 |
| 178 | 3300002067 | JGI24735J21928_10013121 | JGI24735J21928_100131213 | 169 |
| 179 | 3300002067 | JGI24735J21928_10025174 | JGI24735J21928_100251742 | 169 |
| 180 | 3300002067 | JGI24735J21928_10031019 | JGI24735J21928_100310193 | 169 |
| 181 | 3300002067 | JGI24735J21928_10046323 | JGI24735J21928_100463231 | 169 |
| 182 | 3300002075 | JGI24738J21930_10001110 | JGI24738J21930_100011109 | 169 |
| 183 | 3300003214 | JGI25165J46597_1000032 | JGI25165J46597_1000032104 | 169 |
| 184 | 3300003215 | JGI25153J46596_10011927 | JGI25153J46596_100119274 | 169 |
| 185 | 3300003316 | rootH1_10122630 | rootH1_101226302 | 169 |
| 186 | 3300003322 | rootL2_10010215 | rootL2_100102152 | 169 |
| 187 | 3300003322 | rootL2_10033985 | rootL2_100339854 | 169 |
| 188 | 3300003773 | Ga0055537_1000874 | Ga0055537_10008744 | 169 |
| 189 | 3300003775 | Ga0055524_1000088 | Ga0055524_100008837 | 169 |
| 190 | 3300003790 | Ga0055528_1038469 | Ga0055528_10384692 | 169 |
| 191 | 3300003794 | Ga0055531_10000016 | Ga0055531_1000001672 | 169 |
| 192 | 3300003794 | Ga0055531_10008252 | Ga0055531_100082528 | 169 |
| 193 | 3300004625 | Ga0055543_1037273 | Ga0055543_10372732 | 169 |
| 194 | 3300005262 | Ga0065165_1013352 | Ga0065165_10133522 | 169 |
| 195 | 3300005327 | Ga0070658_10000082 | Ga0070658_1000008291 | 169 |
| 196 | 3300005327 | Ga0070658_10117346 | Ga0070658_101173463 | 169 |
| 197 | 3300005327 | Ga0070658_10320973 | Ga0070658_103209732 | 169 |
| 198 | 3300005327 | Ga0070658_10401678 | Ga0070658_104016782 | 169 |
| 199 | 3300005335 | Ga0070666_10024022 | Ga0070666_100240223 | 169 |
| 200 | 3300005336 | Ga0070680_100205486 | Ga0070680_1002054863 | 169 |
| 201 | 3300005337 | Ga0070682_100818374 | Ga0070682_1008183742 | 169 |
| 202 | 3300005339 | Ga0070660_100097373 | Ga0070660_1000973733 | 169 |
| 203 | 3300005339 | Ga0070660_100126231 | Ga0070660_1001262313 | 169 |
| 204 | 3300005339 | Ga0070660_100380542 | Ga0070660_1003805422 | 169 |
| 205 | 3300005344 | Ga0070661_100282428 | Ga0070661_1002824282 | 169 |
| 206 | 3300005354 | Ga0070675_100836220 | Ga0070675_1008362202 | 169 |
| 207 | 3300005355 | Ga0070671_100015156 | Ga0070671_1000151564 | 169 |
| 208 | 3300005356 | Ga0070674_100066686 | Ga0070674_1000666863 | 169 |
| 209 | 3300005366 | Ga0070659_100349090 | Ga0070659_1003490902 | 169 |
| 210 | 3300005366 | Ga0070659_100671783 | Ga0070659_1006717832 | 169 |
| 211 | 3300005455 | Ga0070663_100285767 | Ga0070663_1002857672 | 169 |
| 212 | 3300005457 | Ga0070662_100252622 | Ga0070662_1002526223 | 169 |
| 213 | 3300005457 | Ga0070662_100392669 | Ga0070662_1003926692 | 169 |
| 214 | 3300005530 | Ga0070679_100372060 | Ga0070679_1003720602 | 169 |
| 215 | 3300005539 | Ga0068853_100001346 | Ga0068853_1000013463 | 169 |
| 216 | 3300005539 | Ga0068853_100166348 | Ga0068853_1001663482 | 169 |
| 217 | 3300005539 | Ga0068853_100741180 | Ga0068853_1007411802 | 169 |
| 218 | 3300005563 | Ga0068855_100000416 | Ga0068855_10000041619 | 169 |
| 219 | 3300005563 | Ga0068855_100345800 | Ga0068855_1003458003 | 169 |
| 220 | 3300005614 | Ga0068856_100863271 | Ga0068856_1008632712 | 169 |
| 221 | 3300005616 | Ga0068852_100318295 | Ga0068852_1003182953 | 169 |
| 222 | 3300005617 | Ga0068859_101742347 | Ga0068859_1017423472 | 169 |
| 223 | 3300005618 | Ga0068864_100284186 | Ga0068864_1002841862 | 169 |
| 224 | 3300005719 | Ga0068861_100000086 | Ga0068861_1000000869 | 169 |
| 225 | 3300005719 | Ga0068861_101002577 | Ga0068861_1010025772 | 169 |
| 226 | 3300005834 | Ga0068851_10017503 | Ga0068851_100175035 | 169 |
| 227 | 3300005842 | Ga0068858_100002719 | Ga0068858_1000027195 | 169 |
| 228 | 3300006881 | Ga0068865_100572666 | Ga0068865_1005726661 | 169 |
| 229 | 3300006931 | Ga0097620_100007340 | Ga0097620_10000734010 | 169 |
| 230 | 3300006931 | Ga0097620_101741797 | Ga0097620_1017417972 | 169 |
| 231 | 3300006946 | Ga0079104_1030896 | Ga0079104_10308962 | 169 |
| 232 | 3300009093 | Ga0105240_10188479 | Ga0105240_101884793 | 169 |
| 233 | 3300009545 | Ga0105237_10047102 | Ga0105237_100471025 | 169 |
| 234 | 3300009545 | Ga0105237_10299721 | Ga0105237_102997213 | 169 |
| 235 | 3300009551 | Ga0105238_10191499 | Ga0105238_101914993 | 169 |
| 236 | 3300013100 | Ga0157373_10396210 | Ga0157373_103962101 | 169 |
| 237 | 3300013100 | Ga0157373_10513996 | Ga0157373_105139962 | 169 |
| 238 | 3300013100 | Ga0157373_10787447 | Ga0157373_107874471 | 169 |
| 239 | 3300013104 | Ga0157370_10595387 | Ga0157370_105953872 | 169 |
| 240 | 3300013105 | Ga0157369_10593630 | Ga0157369_105936302 | 169 |
| 241 | 3300013105 | Ga0157369_10818286 | Ga0157369_108182862 | 169 |
| 242 | 3300013306 | Ga0163162_10994567 | Ga0163162_109945672 | 169 |
| 243 | 3300013307 | Ga0157372_10054162 | Ga0157372_100541623 | 169 |
| 244 | 3300013307 | Ga0157372_10066845 | Ga0157372_100668453 | 169 |
| 245 | 3300013307 | Ga0157372_10067875 | Ga0157372_100678753 | 169 |
| 246 | 3300013307 | Ga0157372_10088444 | Ga0157372_100884443 | 169 |
| 247 | 3300013308 | Ga0157375_12108032 | Ga0157375_121080321 | 169 |
| 248 | 3300025245 | Ga0207425_1005446 | Ga0207425_10054462 | 169 |
| 249 | 3300025254 | Ga0209148_1001156 | Ga0209148_10011564 | 169 |
| 250 | 3300025261 | Ga0209233_1000066 | Ga0209233_1000066106 | 169 |
| 251 | 3300025263 | Ga0209565_1000010 | Ga0209565_1000010415 | 169 |
| 252 | 3300025272 | Ga0209455_1001029 | Ga0209455_10010295 | 169 |
| 253 | 3300025273 | Ga0209673_1002611 | Ga0209673_10026115 | 169 |
| 254 | 3300025297 | Ga0209758_1002673 | Ga0209758_10026733 | 169 |
| 255 | 3300025298 | Ga0209050_1000026 | Ga0209050_1000026384 | 169 |
| 256 | 3300025298 | Ga0209050_1002186 | Ga0209050_100218614 | 169 |
| 257 | 3300025299 | Ga0209256_1000034 | Ga0209256_1000034271 | 169 |
| 258 | 3300025304 | Ga0209257_1000009 | Ga0209257_1000009384 | 169 |
| 259 | 3300025304 | Ga0209257_1005333 | Ga0209257_10053332 | 169 |
| 260 | 3300025304 | Ga0209257_1016095 | Ga0209257_10160954 | 169 |
| 261 | 3300025321 | Ga0207656_10069700 | Ga0207656_100697002 | 169 |
| 262 | 3300025903 | Ga0207680_10128707 | Ga0207680_101287072 | 169 |
| 263 | 3300025904 | Ga0207647_10001182 | Ga0207647_1000118217 | 169 |
| 264 | 3300025904 | Ga0207647_10008705 | Ga0207647_100087057 | 169 |
| 265 | 3300025909 | Ga0207705_10000915 | Ga0207705_1000091515 | 169 |
| 266 | 3300025909 | Ga0207705_10004780 | Ga0207705_100047808 | 169 |
| 267 | 3300025909 | Ga0207705_10253338 | Ga0207705_102533382 | 169 |
| 268 | 3300025909 | Ga0207705_10311488 | Ga0207705_103114882 | 169 |
| 269 | 3300025911 | Ga0207654_10173917 | Ga0207654_101739173 | 169 |
| 270 | 3300025914 | Ga0207671_10061563 | Ga0207671_100615632 | 169 |
| 271 | 3300025914 | Ga0207671_10118564 | Ga0207671_101185643 | 169 |
| 272 | 3300025919 | Ga0207657_10002470 | Ga0207657_1000247011 | 169 |
| 273 | 3300025919 | Ga0207657_10138328 | Ga0207657_101383282 | 169 |
| 274 | 3300025919 | Ga0207657_10168890 | Ga0207657_101688902 | 169 |
| 275 | 3300025919 | Ga0207657_10301401 | Ga0207657_103014012 | 169 |
| 276 | 3300025920 | Ga0207649_10219986 | Ga0207649_102199862 | 169 |
| 277 | 3300025921 | Ga0207652_10455777 | Ga0207652_104557772 | 169 |
| 278 | 3300025924 | Ga0207694_10167615 | Ga0207694_101676152 | 169 |
| 279 | 3300025931 | Ga0207644_10004648 | Ga0207644_100046488 | 169 |
| 280 | 3300025932 | Ga0207690_10284841 | Ga0207690_102848412 | 169 |
| 281 | 3300025933 | Ga0207706_10003238 | Ga0207706_100032389 | 169 |
| 282 | 3300025933 | Ga0207706_10005292 | Ga0207706_1000529211 | 169 |
| 283 | 3300025933 | Ga0207706_10393734 | Ga0207706_103937342 | 169 |
| 284 | 3300025935 | Ga0207709_10686197 | Ga0207709_106861972 | 169 |
| 285 | 3300025937 | Ga0207669_10013513 | Ga0207669_100135133 | 169 |
| 286 | 3300025941 | Ga0207711_10414159 | Ga0207711_104141592 | 169 |
| 287 | 3300025949 | Ga0207667_10000504 | Ga0207667_1000050425 | 169 |
| 288 | 3300025949 | Ga0207667_10264118 | Ga0207667_102641183 | 169 |
| 289 | 3300025949 | Ga0207667_10288460 | Ga0207667_102884603 | 169 |
| 290 | 3300026035 | Ga0207703_10000677 | Ga0207703_1000067720 | 169 |
| 291 | 3300026041 | Ga0207639_10009698 | Ga0207639_100096983 | 169 |
| 292 | 3300026041 | Ga0207639_10151591 | Ga0207639_101515912 | 169 |
| 293 | 3300026041 | Ga0207639_10589094 | Ga0207639_105890942 | 169 |
| 294 | 3300026089 | Ga0207648_11391861 | Ga0207648_113918611 | 169 |
| 295 | 3300026095 | Ga0207676_10332862 | Ga0207676_103328621 | 169 |
| 296 | 3300026116 | Ga0207674_10002143 | Ga0207674_100021435 | 169 |
| 297 | 3300026116 | Ga0207674_10176789 | Ga0207674_101767892 | 169 |
| 298 | 3300026118 | Ga0207675_100006217 | Ga0207675_1000062178 | 169 |
| 299 | 3300026142 | Ga0207698_10321175 | Ga0207698_103211752 | 169 |
| 300 | 3300026142 | Ga0207698_10389568 | Ga0207698_103895682 | 169 |
| 301 | 3300026142 | Ga0207698_10438462 | Ga0207698_104384622 | 169 |
| 302 | 3300027111 | Ga0209281_1022262 | Ga0209281_10222622 | 169 |
| 303 | 3300030745 | Ga0316182_1105435 | Ga0316182_11054352 | 169 |
| 304 | 3300031456 | Ga0307513_10190564 | Ga0307513_101905643 | 169 |
| 305 | 3300031507 | Ga0307509_10226867 | Ga0307509_102268672 | 169 |
| 306 | 3300031616 | Ga0307508_10000638 | Ga0307508_1000063817 | 169 |
| 307 | 3300031824 | Ga0307413_10493321 | Ga0307413_104933212 | 169 |
| 308 | 3300031852 | Ga0307410_10241964 | Ga0307410_102419643 | 169 |
| 309 | 3300032005 | Ga0307411_10461558 | Ga0307411_104615582 | 169 |
| 310 | 3300037418 | Ga0395900_0137923 | Ga0395900_0137923_704_1222 | 169 |
| 311 | 3300038443 | Ga0395901_0091016 | Ga0395901_0091016_1479_1997 | 169 |
| 312 | 3300041404 | Ga0439436_0013362 | Ga0439436_0013362_730_1266 | 169 |
| 313 | 3300041410 | Ga0439461_0003711 | Ga0439461_0003711_1272_1808 | 169 |
| 314 | 3300041413 | Ga0439465_0058126 | Ga0439465_0058126_367_903 | 169 |
| 315 | 3300041452 | Ga0451793_0851206 | Ga0451793_0851206_588_1109 | 169 |
| 316 | 3300041459 | Ga0451800_0009767 | Ga0451800_0009767_320_841 | 169 |
| 317 | 3300041462 | Ga0451806_664586 | Ga0451806_664586_2673_3194 | 169 |
| 318 | 3300041486 | Ga0451807_1401903 | Ga0451807_1401903_1180_1701 | 169 |
| 319 | 3300041505 | Ga0451849_0642865 | Ga0451849_0642865_103_624 | 169 |
| 320 | 3300041997 | Ga0439431_0012827 | Ga0439431_0012827_778_1314 | 169 |
| 321 | 3300042005 | Ga0439448_0003560 | Ga0439448_0003560_1049_1570 | 169 |
| 322 | 3300042005 | Ga0439448_0011342 | Ga0439448_0011342_993_1514 | 169 |
| 323 | 3300042005 | Ga0439448_0020246 | Ga0439448_0020246_606_1127 | 169 |
| 324 | 3300042006 | Ga0439432_041325 | Ga0439432_041325_388_924 | 169 |
| 325 | 3300042010 | Ga0439452_029964 | Ga0439452_029964_454_990 | 169 |
| 326 | 3300042011 | Ga0439454_009429 | Ga0439454_009429_177_698 | 169 |
| 327 | 3300042012 | Ga0439455_0000240 | Ga0439455_0000240_3093_3614 | 169 |
| 328 | 3300042012 | Ga0439455_0000681 | Ga0439455_0000681_3818_4339 | 169 |
| 329 | 3300042014 | Ga0439457_030075 | Ga0439457_030075_454_990 | 169 |
| 330 | 3300042015 | Ga0439462_0018038 | Ga0439462_0018038_738_1274 | 169 |
| 331 | 3300042156 | Ga0439446_0061242 | Ga0439446_0061242_436_972 | 169 |
| 332 | 3300042157 | Ga0439458_0000211 | Ga0439458_0000211_3261_3782 | 169 |
| 333 | 3300042157 | Ga0439458_0001587 | Ga0439458_0001587_373_894 | 169 |
| 334 | 3300042185 | Ga0450909_028799 | Ga0450909_028799_131_667 | 169 |
| 335 | 3300042435 | Ga0439434_0003638 | Ga0439434_0003638_2732_3268 | 169 |
| 336 | 3300044694 | Ga0466963_0005238 | Ga0466963_0005238_2556_3077 | 169 |
| 337 | 3300044735 | Ga0466968_0105149 | Ga0466968_0105149_116_631 | 169 |
| 338 | 3300044842 | Ga0466957_0010079 | Ga0466957_0010079_3154_3675 | 169 |
| 339 | 3300044842 | Ga0466957_0021703 | Ga0466957_0021703_3207_3728 | 169 |
| 340 | 3300044842 | Ga0466957_0606276 | Ga0466957_0606276_62_583 | 169 |
| 341 | 3300045836 | Ga0466958_0002871 | Ga0466958_0002871_3006_3527 | 169 |
| 342 | 3300045976 | Ga0466967_0014351 | Ga0466967_0014351_4997_5518 | 169 |
| 343 | 3300046453 | Ga0495627_009659 | Ga0495627_009659_2849_3385 | 169 |
| 344 | 3300046460 | Ga0495638_0001486 | Ga0495638_0001486_906_1427 | 169 |
| 345 | 3300046492 | Ga0495585_0022756 | Ga0495585_0022756_1419_1946 | 169 |
| 346 | 3300046525 | Ga0495663_0080366 | Ga0495663_0080366_203_724 | 169 |
| 347 | 3300046660 | Ga0495625_0068919 | Ga0495625_0068919_1549_2067 | 169 |
| 348 | 3300046691 | Ga0495670_0000009 | Ga0495670_0000009_54376_54915 | 169 |
| 349 | 3300047443 | Ga0495687_111471 | Ga0495687_111471_260_781 | 169 |
| 350 | 3300047470 | Ga0495681_0065650 | Ga0495681_0065650_775_1311 | 169 |
| 351 | 3300047472 | Ga0495686_0363672 | Ga0495686_0363672_140_679 | 169 |
| 352 | 3300048904 | Ga0496101_1101498 | Ga0496101_1101498_32_568 | 169 |
| 353 | 3300048905 | Ga0496102_0000043 | Ga0496102_0000043_23972_24490 | 169 |
| 354 | 3300048906 | Ga0496103_0000086 | Ga0496103_0000086_86083_86601 | 169 |
| 355 | 3300048908 | Ga0496105_0124495 | Ga0496105_0124495_321_839 | 169 |
| 356 | 3300048919 | Ga0496116_0004889 | Ga0496116_0004889_5400_5918 | 169 |
| 357 | 3300048920 | Ga0496117_0000104 | Ga0496117_0000104_23972_24490 | 169 |
| 358 | 3300048920 | Ga0496117_0013607 | Ga0496117_0013607_2312_2833 | 169 |
| 359 | 3300048921 | Ga0496118_0000080 | Ga0496118_0000080_164712_165230 | 169 |
| 360 | 3300048921 | Ga0496118_0030842 | Ga0496118_0030842_3846_4364 | 169 |
| 361 | 3300048921 | Ga0496118_0040230 | Ga0496118_0040230_737_1258 | 169 |
| 362 | 3300048922 | Ga0496119_0014145 | Ga0496119_0014145_3092_3613 | 169 |
| 363 | 3300048922 | Ga0496119_0037511 | Ga0496119_0037511_1918_2436 | 169 |
| 364 | 3300048923 | Ga0496120_0043101 | Ga0496120_0043101_1106_1627 | 169 |
| 365 | 3300048923 | Ga0496120_0078589 | Ga0496120_0078589_434_955 | 169 |
| 366 | 3300048923 | Ga0496120_0105520 | Ga0496120_0105520_897_1424 | 169 |
| 367 | 3300048924 | Ga0496121_0013852 | Ga0496121_0013852_6330_6851 | 169 |
| 368 | 3300048924 | Ga0496121_0035808 | Ga0496121_0035808_775_1296 | 169 |
| 369 | 3300048925 | Ga0496122_0017421 | Ga0496122_0017421_3454_3975 | 169 |
| 370 | 3300048926 | Ga0496123_0002066 | Ga0496123_0002066_13688_14230 | 169 |
| 371 | 3300048926 | Ga0496123_0039234 | Ga0496123_0039234_668_1189 | 169 |
| 372 | 3300048926 | Ga0496123_0075283 | Ga0496123_0075283_783_1319 | 169 |
| 373 | 3300048926 | Ga0496123_0076064 | Ga0496123_0076064_63_599 | 169 |
| 374 | 3300048926 | Ga0496123_0080819 | Ga0496123_0080819_1422_1958 | 169 |
| 375 | 3300048927 | Ga0496124_0000093 | Ga0496124_0000093_164712_165230 | 169 |
| 376 | 3300048927 | Ga0496124_0000204 | Ga0496124_0000204_62829_63356 | 169 |
| 377 | 3300048927 | Ga0496124_0002278 | Ga0496124_0002278_17605_18141 | 169 |
| 378 | 3300048927 | Ga0496124_0018373 | Ga0496124_0018373_4974_5516 | 169 |
| 379 | 3300048927 | Ga0496124_0056279 | Ga0496124_0056279_1705_2241 | 169 |
| 380 | 3300048927 | Ga0496124_0099235 | Ga0496124_0099235_1214_1735 | 169 |
| 381 | 3300048927 | Ga0496124_0252935 | Ga0496124_0252935_343_864 | 169 |
| 382 | 3300048927 | Ga0496124_0781764 | Ga0496124_0781764_55_576 | 169 |
| 383 | 3300048929 | Ga0496126_0468908 | Ga0496126_0468908_422_952 | 169 |
| 384 | 3300049513 | Ga0501290_003218 | Ga0501290_003218_1319_1837 | 169 |
| 385 | 3300049515 | Ga0501292_000074 | Ga0501292_000074_16752_17270 | 169 |
| 386 | 3300049517 | Ga0501294_000612 | Ga0501294_000612_2846_3364 | 169 |
| 387 | 3300049580 | Ga0501046_0661856 | Ga0501046_0661856_30_545 | 169 |
| 388 | 3300049581 | Ga0501047_0110681 | Ga0501047_0110681_693_1208 | 169 |
| 389 | 3300049587 | Ga0501071_0371476 | Ga0501071_0371476_315_842 | 169 |
| 390 | 3300049653 | Ga0501206_000630 | Ga0501206_000630_2760_3278 | 169 |
| 391 | 3300049662 | Ga0501222_001135 | Ga0501222_001135_2288_2806 | 169 |
| 392 | 3300049663 | Ga0501223_008131 | Ga0501223_008131_286_804 | 169 |
| 393 | 3300049664 | Ga0501224_003673 | Ga0501224_003673_662_1180 | 169 |
| 394 | 3300049669 | Ga0501235_013506 | Ga0501235_013506_796_1314 | 169 |
| 395 | 3300049688 | Ga0501259_001177 | Ga0501259_001177_1158_1676 | 169 |
| 396 | 3300049690 | Ga0501261_000602 | Ga0501261_000602_1351_1869 | 169 |
| 397 | 3300049704 | Ga0501221_005405 | Ga0501221_005405_829_1347 | 169 |
| 398 | 3300049775 | Ga0501279_000058 | Ga0501279_000058_2841_3359 | 169 |
| 399 | 3300049776 | Ga0501280_000122 | Ga0501280_000122_2840_3358 | 169 |
| 400 | 3300049777 | Ga0501281_00828 | Ga0501281_00828_1355_1873 | 169 |
| 401 | 3300049778 | Ga0501282_000646 | Ga0501282_000646_1891_2409 | 169 |
| 402 | 3300049779 | Ga0501283_005863 | Ga0501283_005863_794_1312 | 169 |
| 403 | 3300049822 | Ga0501035_0331501 | Ga0501035_0331501_381_902 | 169 |
| 404 | 3300053087 | Ga0500643_011332 | Ga0500643_011332_1673_2209 | 169 |
| 405 | 3300053087 | Ga0500643_069033 | Ga0500643_069033_97_636 | 169 |
| 406 | 3300053094 | Ga0500566_0000691 | Ga0500566_0000691_183_722 | 169 |
| 407 | 3300053096 | Ga0500641_0056781 | Ga0500641_0056781_695_1216 | 169 |
| 408 | 3300053103 | Ga0500555_044473 | Ga0500555_044473_450_986 | 169 |
| 409 | 3300053128 | Ga0500626_288782 | Ga0500626_288782_10_549 | 169 |
| 410 | 3300053131 | Ga0500652_226492 | Ga0500652_226492_114_653 | 169 |
| 411 | 3300053134 | Ga0500658_0007651 | Ga0500658_0007651_2802_3323 | 169 |
| 412 | 3300053134 | Ga0500658_0026539 | Ga0500658_0026539_342_878 | 169 |
| 413 | 3300053136 | Ga0500559_0086269 | Ga0500559_0086269_891_1418 | 169 |
| 414 | 3300053157 | Ga0500624_000765 | Ga0500624_000765_2836_3375 | 169 |
| 415 | 3300053157 | Ga0500624_050028 | Ga0500624_050028_24_551 | 169 |
| 416 | 3300053177 | Ga0500636_0015291 | Ga0500636_0015291_3603_4142 | 169 |
| 417 | 3300061719 | Ga0466962_0015483 | Ga0466962_0015483_1954_2475 | 169 |
| 418 | 3300061719 | Ga0466962_0017955 | Ga0466962_0017955_2243_2764 | 169 |
| 419 | 3300001976 | JGI24752J21851_1006306 | JGI24752J21851_10063063 | 170 |
| 420 | 3300002459 | JGI24751J29686_10020488 | JGI24751J29686_100204882 | 170 |
| 421 | 3300005331 | Ga0070670_100004838 | Ga0070670_10000483811 | 170 |
| 422 | 3300005335 | Ga0070666_10000092 | Ga0070666_1000009252 | 170 |
| 423 | 3300005347 | Ga0070668_100046239 | Ga0070668_1000462394 | 170 |
| 424 | 3300005353 | Ga0070669_100000018 | Ga0070669_10000001893 | 170 |
| 425 | 3300005355 | Ga0070671_100000011 | Ga0070671_100000011104 | 170 |
| 426 | 3300005367 | Ga0070667_100070948 | Ga0070667_1000709484 | 170 |
| 427 | 3300005440 | Ga0070705_100006873 | Ga0070705_1000068735 | 170 |
| 428 | 3300005445 | Ga0070708_100460602 | Ga0070708_1004606022 | 170 |
| 429 | 3300005544 | Ga0070686_100600100 | Ga0070686_1006001001 | 170 |
| 430 | 3300005548 | Ga0070665_100030492 | Ga0070665_1000304923 | 170 |
| 431 | 3300005617 | Ga0068859_100000805 | Ga0068859_10000080520 | 170 |
| 432 | 3300005617 | Ga0068859_100766840 | Ga0068859_1007668401 | 170 |
| 433 | 3300005618 | Ga0068864_100000403 | Ga0068864_10000040315 | 170 |
| 434 | 3300005618 | Ga0068864_100002670 | Ga0068864_1000026709 | 170 |
| 435 | 3300005719 | Ga0068861_100045012 | Ga0068861_1000450122 | 170 |
| 436 | 3300005842 | Ga0068858_100001988 | Ga0068858_1000019889 | 170 |
| 437 | 3300005842 | Ga0068858_100006359 | Ga0068858_1000063595 | 170 |
| 438 | 3300005843 | Ga0068860_100050733 | Ga0068860_1000507332 | 170 |
| 439 | 3300006931 | Ga0097620_100000805 | Ga0097620_10000080520 | 170 |
| 440 | 3300006931 | Ga0097620_100766891 | Ga0097620_1007668911 | 170 |
| 441 | 3300009011 | Ga0105251_10053937 | Ga0105251_100539373 | 170 |
| 442 | 3300009101 | Ga0105247_10004644 | Ga0105247_100046443 | 170 |
| 443 | 3300009147 | Ga0114129_10314289 | Ga0114129_103142892 | 170 |
| 444 | 3300009177 | Ga0105248_10043510 | Ga0105248_100435102 | 170 |
| 445 | 3300009177 | Ga0105248_10150901 | Ga0105248_101509012 | 170 |
| 446 | 3300009545 | Ga0105237_10228526 | Ga0105237_102285262 | 170 |
| 447 | 3300009553 | Ga0105249_10000748 | Ga0105249_1000074819 | 170 |
| 448 | 3300009978 | Ga0105148_100050 | Ga0105148_1000509 | 170 |
| 449 | 3300013306 | Ga0163162_10004388 | Ga0163162_100043885 | 170 |
| 450 | 3300013306 | Ga0163162_10166387 | Ga0163162_101663873 | 170 |
| 451 | 3300013307 | Ga0157372_10286770 | Ga0157372_102867702 | 170 |
| 452 | 3300014325 | Ga0163163_10011243 | Ga0163163_100112435 | 170 |
| 453 | 3300014326 | Ga0157380_10047718 | Ga0157380_100477182 | 170 |
| 454 | 3300014968 | Ga0157379_10005282 | Ga0157379_100052821 | 170 |
| 455 | 3300017792 | Ga0163161_10089708 | Ga0163161_100897083 | 170 |
| 456 | 3300025315 | Ga0207697_10001015 | Ga0207697_1000101516 | 170 |
| 457 | 3300025900 | Ga0207710_10002894 | Ga0207710_100028946 | 170 |
| 458 | 3300025903 | Ga0207680_10003517 | Ga0207680_100035178 | 170 |
| 459 | 3300025914 | Ga0207671_10281666 | Ga0207671_102816662 | 170 |
| 460 | 3300025923 | Ga0207681_10000008 | Ga0207681_10000008319 | 170 |
| 461 | 3300025925 | Ga0207650_10007720 | Ga0207650_1000772010 | 170 |
| 462 | 3300025931 | Ga0207644_10000006 | Ga0207644_10000006310 | 170 |
| 463 | 3300025941 | Ga0207711_10094340 | Ga0207711_100943403 | 170 |
| 464 | 3300025941 | Ga0207711_10130631 | Ga0207711_101306313 | 170 |
| 465 | 3300025961 | Ga0207712_10004601 | Ga0207712_100046015 | 170 |
| 466 | 3300025972 | Ga0207668_10000294 | Ga0207668_1000029423 | 170 |
| 467 | 3300025986 | Ga0207658_10712357 | Ga0207658_107123572 | 170 |
| 468 | 3300025986 | Ga0207658_10744787 | Ga0207658_107447872 | 170 |
| 469 | 3300026035 | Ga0207703_10000501 | Ga0207703_1000050137 | 170 |
| 470 | 3300026035 | Ga0207703_10182370 | Ga0207703_101823702 | 170 |
| 471 | 3300026088 | Ga0207641_10098794 | Ga0207641_100987944 | 170 |
| 472 | 3300026095 | Ga0207676_10000184 | Ga0207676_100001845 | 170 |
| 473 | 3300026095 | Ga0207676_10001239 | Ga0207676_100012397 | 170 |
| 474 | 3300026118 | Ga0207675_100000822 | Ga0207675_10000082220 | 170 |
| 475 | 3300026118 | Ga0207675_100250507 | Ga0207675_1002505072 | 170 |
| 476 | 3300028380 | Ga0268265_10000064 | Ga0268265_1000006499 | 170 |
| 477 | 3300028381 | Ga0268264_10000010 | Ga0268264_10000010103 | 170 |
| 478 | 3300028786 | Ga0307517_10045291 | Ga0307517_100452915 | 170 |
| 479 | 3300028794 | Ga0307515_10419399 | Ga0307515_104193992 | 170 |
| 480 | 3300031456 | Ga0307513_10371082 | Ga0307513_103710822 | 170 |
| 481 | 3300031731 | Ga0307405_11703150 | Ga0307405_117031501 | 170 |
| 482 | 3300031824 | Ga0307413_10080840 | Ga0307413_100808402 | 170 |
| 483 | 3300031901 | Ga0307406_10214737 | Ga0307406_102147372 | 170 |
| 484 | 3300031903 | Ga0307407_10063086 | Ga0307407_100630863 | 170 |
| 485 | 3300031995 | Ga0307409_100136565 | Ga0307409_1001365653 | 170 |
| 486 | 3300032002 | Ga0307416_100083026 | Ga0307416_1000830262 | 170 |
| 487 | 3300032004 | Ga0307414_10053390 | Ga0307414_100533903 | 170 |
| 488 | 3300032126 | Ga0307415_100616126 | Ga0307415_1006161262 | 170 |
| 489 | 3300033180 | Ga0307510_10010127 | Ga0307510_100101279 | 170 |
| 490 | 3300046491 | Ga0495584_0011626 | Ga0495584_0011626_1799_2311 | 170 |
| 491 | 3300046506 | Ga0495583_0002872 | Ga0495583_0002872_6609_7142 | 170 |
| 492 | 3300046506 | Ga0495583_0034644 | Ga0495583_0034644_149_673 | 170 |
| 493 | 3300046507 | Ga0495606_0000978 | Ga0495606_0000978_34795_35322 | 170 |
| 494 | 3300046519 | Ga0495632_0000211 | Ga0495632_0000211_45713_46225 | 170 |
| 495 | 3300046520 | Ga0495637_0001513 | Ga0495637_0001513_969_1481 | 170 |
| 496 | 3300046522 | Ga0495643_0000053 | Ga0495643_0000053_90284_90796 | 170 |
| 497 | 3300046524 | Ga0495648_0048110 | Ga0495648_0048110_822_1355 | 170 |
| 498 | 3300046525 | Ga0495663_0000020 | Ga0495663_0000020_111207_111719 | 170 |
| 499 | 3300046558 | Ga0495633_0000320 | Ga0495633_0000320_24613_25125 | 170 |
| 500 | 3300046558 | Ga0495633_0002680 | Ga0495633_0002680_11167_11679 | 170 |
| 501 | 3300046648 | Ga0495611_0066498 | Ga0495611_0066498_480_1013 | 170 |
| 502 | 3300046660 | Ga0495625_0000570 | Ga0495625_0000570_13575_14096 | 170 |
| 503 | 3300046665 | Ga0495661_0164292 | Ga0495661_0164292_263_796 | 170 |
| 504 | 3300046691 | Ga0495670_0048691 | Ga0495670_0048691_543_1064 | 170 |
| 505 | 3300046691 | Ga0495670_0077744 | Ga0495670_0077744_557_1090 | 170 |
| 506 | 3300046692 | Ga0495671_0000031 | Ga0495671_0000031_111235_111747 | 170 |
| 507 | 3300046692 | Ga0495671_0017921 | Ga0495671_0017921_775_1308 | 170 |
| 508 | 3300047445 | Ga0495677_0030696 | Ga0495677_0030696_1225_1749 | 170 |
| 509 | 3300047470 | Ga0495681_0018954 | Ga0495681_0018954_2126_2638 | 170 |
| 510 | 3300047472 | Ga0495686_0005738 | Ga0495686_0005738_627_1157 | 170 |
| 511 | 3300047472 | Ga0495686_0027901 | Ga0495686_0027901_1035_1556 | 170 |
| 512 | 3300047472 | Ga0495686_0113510 | Ga0495686_0113510_896_1408 | 170 |
| 513 | 3300048904 | Ga0496101_0541130 | Ga0496101_0541130_20_565 | 170 |
| 514 | 3300048905 | Ga0496102_0885688 | Ga0496102_0885688_185_721 | 170 |
| 515 | 3300048918 | Ga0496115_0030277 | Ga0496115_0030277_777_1322 | 170 |
| 516 | 3300048922 | Ga0496119_0126202 | Ga0496119_0126202_445_981 | 170 |
| 517 | 3300048923 | Ga0496120_0160689 | Ga0496120_0160689_112_648 | 170 |
| 518 | 3300048924 | Ga0496121_0000681 | Ga0496121_0000681_28106_28627 | 170 |
| 519 | 3300048924 | Ga0496121_0259767 | Ga0496121_0259767_276_803 | 170 |
| 520 | 3300048926 | Ga0496123_0064664 | Ga0496123_0064664_1619_2152 | 170 |
| 521 | 3300049460 | Ga0495682_0010872 | Ga0495682_0010872_1943_2476 | 170 |
| 522 | 3300049513 | Ga0501290_008713 | Ga0501290_008713_306_824 | 170 |
| 523 | 3300049572 | Ga0501036_0165544 | Ga0501036_0165544_1113_1640 | 170 |
| 524 | 3300049658 | Ga0501211_005901 | Ga0501211_005901_82_594 | 170 |
| 525 | 3300049663 | Ga0501223_000025 | Ga0501223_000025_44906_45418 | 170 |
| 526 | 3300049669 | Ga0501235_003892 | Ga0501235_003892_1777_2289 | 170 |
| 527 | 3300049686 | Ga0501257_000568 | Ga0501257_000568_2804_3322 | 170 |
| 528 | 3300049705 | Ga0501225_0000036 | Ga0501225_0000036_6739_7251 | 170 |
| 529 | 3300049705 | Ga0501225_0003823 | Ga0501225_0003823_98_610 | 170 |
| 530 | 3300049705 | Ga0501225_0048315 | Ga0501225_0048315_407_919 | 170 |
| 531 | 3300049774 | Ga0501278_008090 | Ga0501278_008090_62_580 | 170 |
| 532 | 3300049776 | Ga0501280_003611 | Ga0501280_003611_992_1510 | 170 |
| 533 | 3300050507 | nmdc:mga05p37_382339_c1 | nmdc:mga05p37_382339_c1_802_1314 | 170 |
| 534 | 3300053087 | Ga0500643_012809 | Ga0500643_012809_687_1223 | 170 |
| 535 | 3300053087 | Ga0500643_077379 | Ga0500643_077379_55_588 | 170 |
| 536 | 3300053096 | Ga0500641_0217775 | Ga0500641_0217775_200_721 | 170 |
| 537 | 3300053102 | Ga0500554_102645 | Ga0500554_102645_87_608 | 170 |
| 538 | 3300053103 | Ga0500555_000430 | Ga0500555_000430_10011_10544 | 170 |
| 539 | 3300053136 | Ga0500559_0005855 | Ga0500559_0005855_638_1174 | 170 |
| 540 | 3300053136 | Ga0500559_0067700 | Ga0500559_0067700_428_958 | 170 |
| 541 | 3300053136 | Ga0500559_0070803 | Ga0500559_0070803_487_1020 | 170 |
| 542 | 3300053153 | Ga0500616_0006486 | Ga0500616_0006486_2102_2623 | 170 |
| 543 | 3300053157 | Ga0500624_000001 | Ga0500624_000001_19008_19568 | 170 |
| 544 | 3300053178 | Ga0500637_0000248 | Ga0500637_0000248_540_1100 | 170 |
| 545 | iso_pu_bacteria | 2582581305 | 2585262318 | 170 |
| 546 | iso_pu_bacteria | 2643221541 | 2643730357 | 170 |
| 547 | iso_pu_bacteria | 2643221605 | 2644037225 | 170 |
| 548 | iso_pu_bacteria | 2643221606 | 2644043526 | 170 |
| 549 | iso_pu_bacteria | 2643221671 | 2644393685 | 170 |
| 550 | 3300000549 | LJQas_1013961 | LJQas_10139612 | 171 |
| 551 | 3300001989 | JGI24739J22299_10032344 | JGI24739J22299_100323443 | 171 |
| 552 | 3300001989 | JGI24739J22299_10103781 | JGI24739J22299_101037812 | 171 |
| 553 | 3300001989 | JGI24739J22299_10150961 | JGI24739J22299_101509612 | 171 |
| 554 | 3300003215 | JGI25153J46596_10000002 | JGI25153J46596_10000002605 | 171 |
| 555 | 3300003762 | Ga0055542_1000046 | Ga0055542_100004672 | 171 |
| 556 | 3300003763 | Ga0055529_1000007 | Ga0055529_1000007157 | 171 |
| 557 | 3300005353 | Ga0070669_100584863 | Ga0070669_1005848632 | 171 |
| 558 | 3300005356 | Ga0070674_100000639 | Ga0070674_1000006394 | 171 |
| 559 | 3300005364 | Ga0070673_100250069 | Ga0070673_1002500692 | 171 |
| 560 | 3300005456 | Ga0070678_100000104 | Ga0070678_10000010430 | 171 |
| 561 | 3300005539 | Ga0068853_100052401 | Ga0068853_1000524012 | 171 |
| 562 | 3300005543 | Ga0070672_100081453 | Ga0070672_1000814533 | 171 |
| 563 | 3300005578 | Ga0068854_100346967 | Ga0068854_1003469672 | 171 |
| 564 | 3300005616 | Ga0068852_100333498 | Ga0068852_1003334982 | 171 |
| 565 | 3300006237 | Ga0097621_100088459 | Ga0097621_1000884592 | 171 |
| 566 | 3300006358 | Ga0068871_100088693 | Ga0068871_1000886933 | 171 |
| 567 | 3300009093 | Ga0105240_10034553 | Ga0105240_100345536 | 171 |
| 568 | 3300009148 | Ga0105243_10002588 | Ga0105243_100025883 | 171 |
| 569 | 3300009551 | Ga0105238_10094707 | Ga0105238_100947072 | 171 |
| 570 | 3300009551 | Ga0105238_10369036 | Ga0105238_103690362 | 171 |
| 571 | 3300010375 | Ga0105239_10000320 | Ga0105239_1000032062 | 171 |
| 572 | 3300011119 | Ga0105246_10015969 | Ga0105246_100159695 | 171 |
| 573 | 3300012513 | Ga0157326_1004308 | Ga0157326_10043083 | 171 |
| 574 | 3300013296 | Ga0157374_10141224 | Ga0157374_101412243 | 171 |
| 575 | 3300013297 | Ga0157378_10153888 | Ga0157378_101538882 | 171 |
| 576 | 3300014969 | Ga0157376_10290474 | Ga0157376_102904743 | 171 |
| 577 | 3300025226 | Ga0209674_114085 | Ga0209674_1140852 | 171 |
| 578 | 3300025229 | Ga0209147_102362 | Ga0209147_1023623 | 171 |
| 579 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005976 | 171 |
| 580 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011402 | 171 |
| 581 | 3300025913 | Ga0207695_10017086 | Ga0207695_100170866 | 171 |
| 582 | 3300025913 | Ga0207695_10082639 | Ga0207695_100826394 | 171 |
| 583 | 3300025920 | Ga0207649_10192386 | Ga0207649_101923862 | 171 |
| 584 | 3300025924 | Ga0207694_10321454 | Ga0207694_103214543 | 171 |
| 585 | 3300025924 | Ga0207694_10494248 | Ga0207694_104942482 | 171 |
| 586 | 3300025935 | Ga0207709_10000201 | Ga0207709_1000020136 | 171 |
| 587 | 3300025935 | Ga0207709_10696659 | Ga0207709_106966592 | 171 |
| 588 | 3300025937 | Ga0207669_10000042 | Ga0207669_1000004234 | 171 |
| 589 | 3300025940 | Ga0207691_10079430 | Ga0207691_100794303 | 171 |
| 590 | 3300025960 | Ga0207651_10196425 | Ga0207651_101964253 | 171 |
| 591 | 3300025981 | Ga0207640_10360382 | Ga0207640_103603822 | 171 |
| 592 | 3300025981 | Ga0207640_10794630 | Ga0207640_107946302 | 171 |
| 593 | 3300026041 | Ga0207639_10021378 | Ga0207639_100213783 | 171 |
| 594 | 3300026088 | Ga0207641_10702582 | Ga0207641_107025822 | 171 |
| 595 | 3300026089 | Ga0207648_10018044 | Ga0207648_1001804410 | 171 |
| 596 | 3300026116 | Ga0207674_10076729 | Ga0207674_100767293 | 171 |
| 597 | 3300026121 | Ga0207683_10000067 | Ga0207683_1000006747 | 171 |
| 598 | 3300026142 | Ga0207698_10261953 | Ga0207698_102619532 | 171 |
| 599 | 3300031548 | Ga0307408_100060456 | Ga0307408_1000604561 | 171 |
| 600 | 3300031731 | Ga0307405_10305053 | Ga0307405_103050532 | 171 |
| 601 | 3300031901 | Ga0307406_10080622 | Ga0307406_100806222 | 171 |
| 602 | 3300031911 | Ga0307412_10006640 | Ga0307412_100066406 | 171 |
| 603 | 3300031911 | Ga0307412_10026305 | Ga0307412_100263053 | 171 |
| 604 | 3300031911 | Ga0307412_10156229 | Ga0307412_101562292 | 171 |
| 605 | 3300031911 | Ga0307412_10184436 | Ga0307412_101844362 | 171 |
| 606 | 3300031995 | Ga0307409_100175442 | Ga0307409_1001754422 | 171 |
| 607 | 3300032002 | Ga0307416_100540706 | Ga0307416_1005407062 | 171 |
| 608 | 3300042004 | Ga0439445_0085994 | Ga0439445_0085994_29_556 | 171 |
| 609 | 3300046452 | Ga0495617_010535 | Ga0495617_010535_2348_2863 | 171 |
| 610 | 3300046453 | Ga0495627_000155 | Ga0495627_000155_12497_13012 | 171 |
| 611 | 3300046460 | Ga0495638_0146771 | Ga0495638_0146771_518_1048 | 171 |
| 612 | 3300046491 | Ga0495584_0045768 | Ga0495584_0045768_1408_1938 | 171 |
| 613 | 3300046491 | Ga0495584_0098998 | Ga0495584_0098998_160_690 | 171 |
| 614 | 3300046492 | Ga0495585_0034452 | Ga0495585_0034452_1210_1740 | 171 |
| 615 | 3300046506 | Ga0495583_0014784 | Ga0495583_0014784_2385_2915 | 171 |
| 616 | 3300046506 | Ga0495583_0073449 | Ga0495583_0073449_367_897 | 171 |
| 617 | 3300046506 | Ga0495583_0130953 | Ga0495583_0130953_12_542 | 171 |
| 618 | 3300046507 | Ga0495606_0113010 | Ga0495606_0113010_274_804 | 171 |
| 619 | 3300046507 | Ga0495606_0173200 | Ga0495606_0173200_27_557 | 171 |
| 620 | 3300046512 | Ga0495610_0001777 | Ga0495610_0001777_12632_13147 | 171 |
| 621 | 3300046513 | Ga0495616_0185841 | Ga0495616_0185841_211_741 | 171 |
| 622 | 3300046513 | Ga0495616_0190350 | Ga0495616_0190350_151_681 | 171 |
| 623 | 3300046518 | Ga0495631_0019792 | Ga0495631_0019792_597_1127 | 171 |
| 624 | 3300046520 | Ga0495637_0021337 | Ga0495637_0021337_55_585 | 171 |
| 625 | 3300046520 | Ga0495637_0057349 | Ga0495637_0057349_771_1286 | 171 |
| 626 | 3300046522 | Ga0495643_0006712 | Ga0495643_0006712_1667_2197 | 171 |
| 627 | 3300046522 | Ga0495643_0072076 | Ga0495643_0072076_562_1092 | 171 |
| 628 | 3300046522 | Ga0495643_0143859 | Ga0495643_0143859_116_646 | 171 |
| 629 | 3300046558 | Ga0495633_0001111 | Ga0495633_0001111_20193_20723 | 171 |
| 630 | 3300046616 | Ga0495668_0000261 | Ga0495668_0000261_58351_58881 | 171 |
| 631 | 3300046616 | Ga0495668_0369869 | Ga0495668_0369869_217_747 | 171 |
| 632 | 3300046648 | Ga0495611_0025833 | Ga0495611_0025833_768_1298 | 171 |
| 633 | 3300046660 | Ga0495625_0023939 | Ga0495625_0023939_1833_2363 | 171 |
| 634 | 3300046660 | Ga0495625_0033676 | Ga0495625_0033676_1968_2498 | 171 |
| 635 | 3300046660 | Ga0495625_0071795 | Ga0495625_0071795_1156_1686 | 171 |
| 636 | 3300046684 | Ga0495669_0000333 | Ga0495669_0000333_10809_11339 | 171 |
| 637 | 3300046691 | Ga0495670_0024341 | Ga0495670_0024341_1098_1625 | 171 |
| 638 | 3300046691 | Ga0495670_0416490 | Ga0495670_0416490_47_568 | 171 |
| 639 | 3300047318 | Ga0495636_0066270 | Ga0495636_0066270_82_612 | 171 |
| 640 | 3300047443 | Ga0495687_000470 | Ga0495687_000470_27637_28167 | 171 |
| 641 | 3300047443 | Ga0495687_001491 | Ga0495687_001491_16625_17155 | 171 |
| 642 | 3300047445 | Ga0495677_0017046 | Ga0495677_0017046_723_1253 | 171 |
| 643 | 3300047470 | Ga0495681_0000228 | Ga0495681_0000228_3374_3889 | 171 |
| 644 | 3300047472 | Ga0495686_0000185 | Ga0495686_0000185_45795_46322 | 171 |
| 645 | 3300047472 | Ga0495686_0046918 | Ga0495686_0046918_1428_1943 | 171 |
| 646 | 3300048916 | Ga0496113_0110841 | Ga0496113_0110841_1234_1764 | 171 |
| 647 | 3300048920 | Ga0496117_0067040 | Ga0496117_0067040_271_819 | 171 |
| 648 | 3300048921 | Ga0496118_0062182 | Ga0496118_0062182_400_948 | 171 |
| 649 | 3300048924 | Ga0496121_0001025 | Ga0496121_0001025_26092_26652 | 171 |
| 650 | 3300048924 | Ga0496121_0067090 | Ga0496121_0067090_2036_2584 | 171 |
| 651 | 3300048924 | Ga0496121_0094896 | Ga0496121_0094896_563_1111 | 171 |
| 652 | 3300048925 | Ga0496122_0046285 | Ga0496122_0046285_919_1449 | 171 |
| 653 | 3300048928 | Ga0496125_0001206 | Ga0496125_0001206_6269_6799 | 171 |
| 654 | 3300048929 | Ga0496126_0057622 | Ga0496126_0057622_1146_1706 | 171 |
| 655 | 3300049459 | Ga0495678_021780 | Ga0495678_021780_1635_2150 | 171 |
| 656 | 3300049579 | Ga0501043_0048052 | Ga0501043_0048052_2094_2642 | 171 |
| 657 | 3300049581 | Ga0501047_0374014 | Ga0501047_0374014_692_1240 | 171 |
| 658 | 3300053079 | Ga0500610_0000661 | Ga0500610_0000661_5390_5920 | 171 |
| 659 | 3300053087 | Ga0500643_000129 | Ga0500643_000129_42974_43495 | 171 |
| 660 | 3300053119 | Ga0500595_002106 | Ga0500595_002106_8415_8942 | 171 |
| 661 | 3300053730 | Ga0500645_000062 | Ga0500645_000062_38746_39276 | 171 |
| 662 | 3300053730 | Ga0500645_002084 | Ga0500645_002084_6884_7426 | 171 |
| 663 | 2162886007 | SwRhRL2b_contig_1180352 | SwRhRL2b_0538.00001990 | 172 |
| 664 | 3300001904 | JGI24736J21556_1010100 | JGI24736J21556_10101002 | 172 |
| 665 | 3300001915 | JGI24741J21665_1000043 | JGI24741J21665_100004312 | 172 |
| 666 | 3300002067 | JGI24735J21928_10045121 | JGI24735J21928_100451212 | 172 |
| 667 | 3300002075 | JGI24738J21930_10003415 | JGI24738J21930_100034156 | 172 |
| 668 | 3300002076 | JGI24749J21850_1000111 | JGI24749J21850_10001116 | 172 |
| 669 | 3300002459 | JGI24751J29686_10000002 | JGI24751J29686_10000002135 | 172 |
| 670 | 3300002459 | JGI24751J29686_10004995 | JGI24751J29686_100049953 | 172 |
| 671 | 3300003187 | JGI25151J46595_10009635 | JGI25151J46595_100096352 | 172 |
| 672 | 3300003215 | JGI25153J46596_10000044 | JGI25153J46596_10000044163 | 172 |
| 673 | 3300003771 | Ga0055526_1011554 | Ga0055526_10115544 | 172 |
| 674 | 3300003773 | Ga0055537_1001004 | Ga0055537_10010045 | 172 |
| 675 | 3300003781 | Ga0055536_1021354 | Ga0055536_10213541 | 172 |
| 676 | 3300003792 | Ga0055540_1000717 | Ga0055540_100071713 | 172 |
| 677 | 3300005262 | Ga0065165_1085341 | Ga0065165_10853412 | 172 |
| 678 | 3300005289 | Ga0065704_10003859 | Ga0065704_100038592 | 172 |
| 679 | 3300005295 | Ga0065707_10084130 | Ga0065707_100841303 | 172 |
| 680 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001441 | 172 |
| 681 | 3300005327 | Ga0070658_10042620 | Ga0070658_100426204 | 172 |
| 682 | 3300005331 | Ga0070670_100000012 | Ga0070670_10000001265 | 172 |
| 683 | 3300005331 | Ga0070670_100002503 | Ga0070670_10000250310 | 172 |
| 684 | 3300005333 | Ga0070677_10001096 | Ga0070677_100010967 | 172 |
| 685 | 3300005335 | Ga0070666_10156997 | Ga0070666_101569972 | 172 |
| 686 | 3300005336 | Ga0070680_100000534 | Ga0070680_10000053422 | 172 |
| 687 | 3300005339 | Ga0070660_100001071 | Ga0070660_1000010718 | 172 |
| 688 | 3300005339 | Ga0070660_100056240 | Ga0070660_1000562404 | 172 |
| 689 | 3300005339 | Ga0070660_100141166 | Ga0070660_1001411662 | 172 |
| 690 | 3300005344 | Ga0070661_100043250 | Ga0070661_1000432503 | 172 |
| 691 | 3300005344 | Ga0070661_100804456 | Ga0070661_1008044562 | 172 |
| 692 | 3300005345 | Ga0070692_10038481 | Ga0070692_100384813 | 172 |
| 693 | 3300005347 | Ga0070668_100000004 | Ga0070668_10000000461 | 172 |
| 694 | 3300005347 | Ga0070668_100000330 | Ga0070668_10000033012 | 172 |
| 695 | 3300005347 | Ga0070668_100102263 | Ga0070668_1001022633 | 172 |
| 696 | 3300005353 | Ga0070669_100000041 | Ga0070669_10000004143 | 172 |
| 697 | 3300005353 | Ga0070669_100073089 | Ga0070669_1000730892 | 172 |
| 698 | 3300005353 | Ga0070669_100098905 | Ga0070669_1000989053 | 172 |
| 699 | 3300005355 | Ga0070671_100000014 | Ga0070671_100000014142 | 172 |
| 700 | 3300005355 | Ga0070671_100000136 | Ga0070671_1000001367 | 172 |
| 701 | 3300005366 | Ga0070659_100007571 | Ga0070659_1000075713 | 172 |
| 702 | 3300005366 | Ga0070659_100035817 | Ga0070659_1000358172 | 172 |
| 703 | 3300005367 | Ga0070667_100000037 | Ga0070667_10000003757 | 172 |
| 704 | 3300005367 | Ga0070667_100000089 | Ga0070667_10000008952 | 172 |
| 705 | 3300005455 | Ga0070663_100042668 | Ga0070663_1000426683 | 172 |
| 706 | 3300005457 | Ga0070662_100418223 | Ga0070662_1004182231 | 172 |
| 707 | 3300005530 | Ga0070679_100000005 | Ga0070679_100000005134 | 172 |
| 708 | 3300005535 | Ga0070684_100713447 | Ga0070684_1007134471 | 172 |
| 709 | 3300005539 | Ga0068853_100090889 | Ga0068853_1000908892 | 172 |
| 710 | 3300005539 | Ga0068853_100849593 | Ga0068853_1008495931 | 172 |
| 711 | 3300005539 | Ga0068853_100923997 | Ga0068853_1009239972 | 172 |
| 712 | 3300005548 | Ga0070665_100600288 | Ga0070665_1006002881 | 172 |
| 713 | 3300005564 | Ga0070664_100255042 | Ga0070664_1002550422 | 172 |
| 714 | 3300005577 | Ga0068857_100028662 | Ga0068857_1000286626 | 172 |
| 715 | 3300005577 | Ga0068857_100667034 | Ga0068857_1006670342 | 172 |
| 716 | 3300005577 | Ga0068857_100830344 | Ga0068857_1008303442 | 172 |
| 717 | 3300005578 | Ga0068854_100005589 | Ga0068854_1000055895 | 172 |
| 718 | 3300005614 | Ga0068856_100023608 | Ga0068856_1000236083 | 172 |
| 719 | 3300005616 | Ga0068852_100900870 | Ga0068852_1009008702 | 172 |
| 720 | 3300005616 | Ga0068852_101139348 | Ga0068852_1011393482 | 172 |
| 721 | 3300005617 | Ga0068859_100005780 | Ga0068859_1000057807 | 172 |
| 722 | 3300005617 | Ga0068859_100007191 | Ga0068859_1000071912 | 172 |
| 723 | 3300005617 | Ga0068859_100356626 | Ga0068859_1003566262 | 172 |
| 724 | 3300005617 | Ga0068859_100435092 | Ga0068859_1004350922 | 172 |
| 725 | 3300005617 | Ga0068859_100552363 | Ga0068859_1005523632 | 172 |
| 726 | 3300005617 | Ga0068859_101112497 | Ga0068859_1011124972 | 172 |
| 727 | 3300005618 | Ga0068864_100000010 | Ga0068864_100000010161 | 172 |
| 728 | 3300005618 | Ga0068864_100008484 | Ga0068864_1000084847 | 172 |
| 729 | 3300005719 | Ga0068861_100001727 | Ga0068861_1000017277 | 172 |
| 730 | 3300005719 | Ga0068861_100861142 | Ga0068861_1008611422 | 172 |
| 731 | 3300005841 | Ga0068863_100000001 | Ga0068863_1000000018 | 172 |
| 732 | 3300005841 | Ga0068863_100004589 | Ga0068863_1000045896 | 172 |
| 733 | 3300005841 | Ga0068863_100005416 | Ga0068863_10000541611 | 172 |
| 734 | 3300005841 | Ga0068863_100008282 | Ga0068863_1000082825 | 172 |
| 735 | 3300005841 | Ga0068863_100654350 | Ga0068863_1006543502 | 172 |
| 736 | 3300005842 | Ga0068858_100006177 | Ga0068858_1000061776 | 172 |
| 737 | 3300005843 | Ga0068860_100000002 | Ga0068860_100000002549 | 172 |
| 738 | 3300005843 | Ga0068860_100000148 | Ga0068860_10000014879 | 172 |
| 739 | 3300005843 | Ga0068860_100012019 | Ga0068860_1000120192 | 172 |
| 740 | 3300005843 | Ga0068860_100234850 | Ga0068860_1002348502 | 172 |
| 741 | 3300005843 | Ga0068860_100400906 | Ga0068860_1004009063 | 172 |
| 742 | 3300005844 | Ga0068862_100000016 | Ga0068862_10000001655 | 172 |
| 743 | 3300005844 | Ga0068862_100000280 | Ga0068862_10000028042 | 172 |
| 744 | 3300005844 | Ga0068862_100002391 | Ga0068862_1000023919 | 172 |
| 745 | 3300006178 | Ga0075367_10000022 | Ga0075367_100000225 | 172 |
| 746 | 3300006931 | Ga0097620_100005780 | Ga0097620_1000057807 | 172 |
| 747 | 3300006931 | Ga0097620_100007191 | Ga0097620_1000071912 | 172 |
| 748 | 3300006931 | Ga0097620_100356601 | Ga0097620_1003566012 | 172 |
| 749 | 3300006931 | Ga0097620_100435110 | Ga0097620_1004351103 | 172 |
| 750 | 3300006931 | Ga0097620_100552350 | Ga0097620_1005523502 | 172 |
| 751 | 3300006931 | Ga0097620_101112457 | Ga0097620_1011124572 | 172 |
| 752 | 3300009093 | Ga0105240_10178147 | Ga0105240_101781474 | 172 |
| 753 | 3300009093 | Ga0105240_10891679 | Ga0105240_108916792 | 172 |
| 754 | 3300009174 | Ga0105241_10007217 | Ga0105241_100072177 | 172 |
| 755 | 3300009176 | Ga0105242_10497526 | Ga0105242_104975261 | 172 |
| 756 | 3300009177 | Ga0105248_10000053 | Ga0105248_100000537 | 172 |
| 757 | 3300009551 | Ga0105238_10581332 | Ga0105238_105813322 | 172 |
| 758 | 3300009551 | Ga0105238_10615885 | Ga0105238_106158852 | 172 |
| 759 | 3300009551 | Ga0105238_10706922 | Ga0105238_107069222 | 172 |
| 760 | 3300009553 | Ga0105249_10000103 | Ga0105249_1000010367 | 172 |
| 761 | 3300009553 | Ga0105249_11195675 | Ga0105249_111956752 | 172 |
| 762 | 3300012513 | Ga0157326_1000547 | Ga0157326_10005476 | 172 |
| 763 | 3300013102 | Ga0157371_10105735 | Ga0157371_101057352 | 172 |
| 764 | 3300013104 | Ga0157370_10426595 | Ga0157370_104265952 | 172 |
| 765 | 3300013105 | Ga0157369_10817235 | Ga0157369_108172352 | 172 |
| 766 | 3300013105 | Ga0157369_10946228 | Ga0157369_109462282 | 172 |
| 767 | 3300013307 | Ga0157372_10307967 | Ga0157372_103079673 | 172 |
| 768 | 3300013307 | Ga0157372_12458342 | Ga0157372_124583421 | 172 |
| 769 | 3300014325 | Ga0163163_10029678 | Ga0163163_100296785 | 172 |
| 770 | 3300014326 | Ga0157380_10000134 | Ga0157380_1000013426 | 172 |
| 771 | 3300017792 | Ga0163161_10104274 | Ga0163161_101042742 | 172 |
| 772 | 3300017792 | Ga0163161_10158995 | Ga0163161_101589953 | 172 |
| 773 | 3300020082 | Ga0206353_10346769 | Ga0206353_103467693 | 172 |
| 774 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006247 | 172 |
| 775 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004753 | 172 |
| 776 | 3300025245 | Ga0207425_1000026 | Ga0207425_1000026258 | 172 |
| 777 | 3300025258 | Ga0209129_1001922 | Ga0209129_10019223 | 172 |
| 778 | 3300025263 | Ga0209565_1000064 | Ga0209565_10000648 | 172 |
| 779 | 3300025273 | Ga0209673_1046675 | Ga0209673_10466752 | 172 |
| 780 | 3300025292 | Ga0209676_1008246 | Ga0209676_10082464 | 172 |
| 781 | 3300025294 | Ga0209025_1000551 | Ga0209025_100055148 | 172 |
| 782 | 3300025295 | Ga0209564_1003529 | Ga0209564_10035295 | 172 |
| 783 | 3300025295 | Ga0209564_1018595 | Ga0209564_10185952 | 172 |
| 784 | 3300025297 | Ga0209758_1000004 | Ga0209758_10000041200 | 172 |
| 785 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000013196 | 172 |
| 786 | 3300025298 | Ga0209050_1011661 | Ga0209050_10116613 | 172 |
| 787 | 3300025302 | Ga0207426_1014974 | Ga0207426_10149743 | 172 |
| 788 | 3300025303 | Ga0209051_1001333 | Ga0209051_100133312 | 172 |
| 789 | 3300025321 | Ga0207656_10010757 | Ga0207656_100107573 | 172 |
| 790 | 3300025893 | Ga0207682_10000992 | Ga0207682_100009927 | 172 |
| 791 | 3300025903 | Ga0207680_10174088 | Ga0207680_101740882 | 172 |
| 792 | 3300025904 | Ga0207647_10210138 | Ga0207647_102101382 | 172 |
| 793 | 3300025904 | Ga0207647_10210139 | Ga0207647_102101392 | 172 |
| 794 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021439 | 172 |
| 795 | 3300025909 | Ga0207705_10527101 | Ga0207705_105271012 | 172 |
| 796 | 3300025911 | Ga0207654_10048248 | Ga0207654_100482482 | 172 |
| 797 | 3300025913 | Ga0207695_10142203 | Ga0207695_101422032 | 172 |
| 798 | 3300025919 | Ga0207657_10001208 | Ga0207657_1000120829 | 172 |
| 799 | 3300025919 | Ga0207657_10035193 | Ga0207657_100351934 | 172 |
| 800 | 3300025919 | Ga0207657_10037177 | Ga0207657_100371771 | 172 |
| 801 | 3300025920 | Ga0207649_10000235 | Ga0207649_1000023544 | 172 |
| 802 | 3300025921 | Ga0207652_10000005 | Ga0207652_100000056 | 172 |
| 803 | 3300025921 | Ga0207652_10000006 | Ga0207652_10000006274 | 172 |
| 804 | 3300025921 | Ga0207652_10000007 | Ga0207652_10000007275 | 172 |
| 805 | 3300025921 | Ga0207652_10000009 | Ga0207652_10000009235 | 172 |
| 806 | 3300025923 | Ga0207681_10000013 | Ga0207681_10000013147 | 172 |
| 807 | 3300025923 | Ga0207681_10047884 | Ga0207681_100478842 | 172 |
| 808 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008227 | 172 |
| 809 | 3300025925 | Ga0207650_10001666 | Ga0207650_1000166610 | 172 |
| 810 | 3300025927 | Ga0207687_10063568 | Ga0207687_100635682 | 172 |
| 811 | 3300025931 | Ga0207644_10000030 | Ga0207644_1000003030 | 172 |
| 812 | 3300025931 | Ga0207644_10000046 | Ga0207644_1000004649 | 172 |
| 813 | 3300025932 | Ga0207690_10004899 | Ga0207690_100048997 | 172 |
| 814 | 3300025933 | Ga0207706_10051297 | Ga0207706_100512972 | 172 |
| 815 | 3300025933 | Ga0207706_10995734 | Ga0207706_109957341 | 172 |
| 816 | 3300025934 | Ga0207686_10719094 | Ga0207686_107190941 | 172 |
| 817 | 3300025941 | Ga0207711_10003703 | Ga0207711_100037033 | 172 |
| 818 | 3300025944 | Ga0207661_11027976 | Ga0207661_110279761 | 172 |
| 819 | 3300025949 | Ga0207667_10446221 | Ga0207667_104462212 | 172 |
| 820 | 3300025961 | Ga0207712_10000069 | Ga0207712_1000006969 | 172 |
| 821 | 3300025972 | Ga0207668_10000140 | Ga0207668_1000014012 | 172 |
| 822 | 3300025972 | Ga0207668_10000256 | Ga0207668_1000025616 | 172 |
| 823 | 3300025972 | Ga0207668_10024318 | Ga0207668_100243183 | 172 |
| 824 | 3300025981 | Ga0207640_10004411 | Ga0207640_100044116 | 172 |
| 825 | 3300025981 | Ga0207640_10015179 | Ga0207640_100151795 | 172 |
| 826 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002832 | 172 |
| 827 | 3300025986 | Ga0207658_10000069 | Ga0207658_1000006976 | 172 |
| 828 | 3300026035 | Ga0207703_10004439 | Ga0207703_100044397 | 172 |
| 829 | 3300026041 | Ga0207639_10107040 | Ga0207639_101070403 | 172 |
| 830 | 3300026067 | Ga0207678_10000622 | Ga0207678_100006229 | 172 |
| 831 | 3300026078 | Ga0207702_10043899 | Ga0207702_100438993 | 172 |
| 832 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001349 | 172 |
| 833 | 3300026088 | Ga0207641_10000818 | Ga0207641_100008186 | 172 |
| 834 | 3300026088 | Ga0207641_10001290 | Ga0207641_100012907 | 172 |
| 835 | 3300026088 | Ga0207641_10002303 | Ga0207641_100023036 | 172 |
| 836 | 3300026088 | Ga0207641_10004282 | Ga0207641_100042826 | 172 |
| 837 | 3300026088 | Ga0207641_10004485 | Ga0207641_100044854 | 172 |
| 838 | 3300026095 | Ga0207676_10000012 | Ga0207676_10000012170 | 172 |
| 839 | 3300026095 | Ga0207676_10006305 | Ga0207676_100063057 | 172 |
| 840 | 3300026116 | Ga0207674_10038181 | Ga0207674_100381812 | 172 |
| 841 | 3300026116 | Ga0207674_10693644 | Ga0207674_106936442 | 172 |
| 842 | 3300026118 | Ga0207675_100053569 | Ga0207675_1000535691 | 172 |
| 843 | 3300026118 | Ga0207675_100074606 | Ga0207675_1000746063 | 172 |
| 844 | 3300026142 | Ga0207698_10268441 | Ga0207698_102684412 | 172 |
| 845 | 3300026142 | Ga0207698_10286465 | Ga0207698_102864652 | 172 |
| 846 | 3300027866 | Ga0209813_10000224 | Ga0209813_1000022410 | 172 |
| 847 | 3300028379 | Ga0268266_10002533 | Ga0268266_1000253319 | 172 |
| 848 | 3300028379 | Ga0268266_10557732 | Ga0268266_105577321 | 172 |
| 849 | 3300028380 | Ga0268265_10000006 | Ga0268265_10000006254 | 172 |
| 850 | 3300028380 | Ga0268265_10001032 | Ga0268265_1000103220 | 172 |
| 851 | 3300028380 | Ga0268265_10004641 | Ga0268265_100046418 | 172 |
| 852 | 3300028381 | Ga0268264_10000001 | Ga0268264_100000011157 | 172 |
| 853 | 3300028381 | Ga0268264_10000217 | Ga0268264_1000021776 | 172 |
| 854 | 3300028381 | Ga0268264_10000381 | Ga0268264_100003813 | 172 |
| 855 | 3300028381 | Ga0268264_10018242 | Ga0268264_100182428 | 172 |
| 856 | 3300031548 | Ga0307408_100008396 | Ga0307408_1000083961 | 172 |
| 857 | 3300031548 | Ga0307408_100013448 | Ga0307408_1000134483 | 172 |
| 858 | 3300031548 | Ga0307408_100310385 | Ga0307408_1003103853 | 172 |
| 859 | 3300031548 | Ga0307408_100410934 | Ga0307408_1004109342 | 172 |
| 860 | 3300031548 | Ga0307408_100473552 | Ga0307408_1004735522 | 172 |
| 861 | 3300031548 | Ga0307408_100771869 | Ga0307408_1007718692 | 172 |
| 862 | 3300031731 | Ga0307405_10061287 | Ga0307405_100612873 | 172 |
| 863 | 3300031731 | Ga0307405_11034309 | Ga0307405_110343092 | 172 |
| 864 | 3300031852 | Ga0307410_11072257 | Ga0307410_110722572 | 172 |
| 865 | 3300031901 | Ga0307406_10020839 | Ga0307406_100208393 | 172 |
| 866 | 3300031911 | Ga0307412_10017510 | Ga0307412_100175102 | 172 |
| 867 | 3300031911 | Ga0307412_10048489 | Ga0307412_100484893 | 172 |
| 868 | 3300031911 | Ga0307412_10146928 | Ga0307412_101469282 | 172 |
| 869 | 3300031911 | Ga0307412_10406811 | Ga0307412_104068112 | 172 |
| 870 | 3300031911 | Ga0307412_10439319 | Ga0307412_104393192 | 172 |
| 871 | 3300032002 | Ga0307416_100020485 | Ga0307416_1000204854 | 172 |
| 872 | 3300032002 | Ga0307416_100478347 | Ga0307416_1004783472 | 172 |
| 873 | 3300032004 | Ga0307414_10120555 | Ga0307414_101205552 | 172 |
| 874 | 3300032004 | Ga0307414_10800735 | Ga0307414_108007351 | 172 |
| 875 | 3300032126 | Ga0307415_101236798 | Ga0307415_1012367982 | 172 |
| 876 | 3300035695 | Ga0373927_0176280 | Ga0373927_0176280_763_1332 | 172 |
| 877 | 3300037853 | Ga0436364_1344939 | Ga0436364_1344939_448_987 | 172 |
| 878 | 3300038443 | Ga0395901_0165215 | Ga0395901_0165215_370_936 | 172 |
| 879 | 3300038705 | Ga0237819_00162 | Ga0237819_00162_18695_19237 | 172 |
| 880 | 3300039437 | Ga0436365_1244885 | Ga0436365_1244885_13654_14190 | 172 |
| 881 | 3300039437 | Ga0436365_1911487 | Ga0436365_1911487_27509_28063 | 172 |
| 882 | 3300039453 | Ga0436362_0953683 | Ga0436362_0953683_4322_4876 | 172 |
| 883 | 3300044735 | Ga0466968_0168271 | Ga0466968_0168271_149_712 | 172 |
| 884 | 3300046506 | Ga0495583_0270157 | Ga0495583_0270157_18_554 | 172 |
| 885 | 3300046519 | Ga0495632_0003768 | Ga0495632_0003768_710_1240 | 172 |
| 886 | 3300046520 | Ga0495637_0049978 | Ga0495637_0049978_761_1315 | 172 |
| 887 | 3300046522 | Ga0495643_0017112 | Ga0495643_0017112_3421_3975 | 172 |
| 888 | 3300046524 | Ga0495648_0000102 | Ga0495648_0000102_101717_102247 | 172 |
| 889 | 3300046542 | Ga0495597_0028176 | Ga0495597_0028176_240_788 | 172 |
| 890 | 3300046558 | Ga0495633_0012350 | Ga0495633_0012350_3737_4255 | 172 |
| 891 | 3300046616 | Ga0495668_0020010 | Ga0495668_0020010_3068_3616 | 172 |
| 892 | 3300046660 | Ga0495625_0240765 | Ga0495625_0240765_117_671 | 172 |
| 893 | 3300046660 | Ga0495625_0289504 | Ga0495625_0289504_166_714 | 172 |
| 894 | 3300046684 | Ga0495669_0025332 | Ga0495669_0025332_831_1385 | 172 |
| 895 | 3300046692 | Ga0495671_0000065 | Ga0495671_0000065_101077_101607 | 172 |
| 896 | 3300046692 | Ga0495671_0034554 | Ga0495671_0034554_1137_1673 | 172 |
| 897 | 3300047469 | Ga0495673_0000174 | Ga0495673_0000174_101077_101607 | 172 |
| 898 | 3300048908 | Ga0496105_0460120 | Ga0496105_0460120_355_873 | 172 |
| 899 | 3300048911 | Ga0496108_0004571 | Ga0496108_0004571_248_766 | 172 |
| 900 | 3300048912 | Ga0496109_0341499 | Ga0496109_0341499_596_1114 | 172 |
| 901 | 3300048913 | Ga0496110_0014526 | Ga0496110_0014526_5396_5914 | 172 |
| 902 | 3300048914 | Ga0496111_0399267 | Ga0496111_0399267_254_772 | 172 |
| 903 | 3300048921 | Ga0496118_0176499 | Ga0496118_0176499_288_806 | 172 |
| 904 | 3300048921 | Ga0496118_0242678 | Ga0496118_0242678_102_620 | 172 |
| 905 | 3300048922 | Ga0496119_0118599 | Ga0496119_0118599_372_890 | 172 |
| 906 | 3300048924 | Ga0496121_0001630 | Ga0496121_0001630_9336_9854 | 172 |
| 907 | 3300048925 | Ga0496122_0000589 | Ga0496122_0000589_50615_51166 | 172 |
| 908 | 3300048925 | Ga0496122_0009235 | Ga0496122_0009235_5163_5681 | 172 |
| 909 | 3300048926 | Ga0496123_0001872 | Ga0496123_0001872_23430_23981 | 172 |
| 910 | 3300048926 | Ga0496123_0031058 | Ga0496123_0031058_971_1489 | 172 |
| 911 | 3300048926 | Ga0496123_0218830 | Ga0496123_0218830_59_577 | 172 |
| 912 | 3300048927 | Ga0496124_0011745 | Ga0496124_0011745_3206_3724 | 172 |
| 913 | 3300048928 | Ga0496125_0018837 | Ga0496125_0018837_4026_4544 | 172 |
| 914 | 3300048928 | Ga0496125_0039047 | Ga0496125_0039047_2436_2972 | 172 |
| 915 | 3300048928 | Ga0496125_0043236 | Ga0496125_0043236_2709_3227 | 172 |
| 916 | 3300048928 | Ga0496125_0061621 | Ga0496125_0061621_744_1304 | 172 |
| 917 | 3300048929 | Ga0496126_0016562 | Ga0496126_0016562_4409_4927 | 172 |
| 918 | 3300048929 | Ga0496126_0184524 | Ga0496126_0184524_1163_1714 | 172 |
| 919 | 3300048929 | Ga0496126_0231779 | Ga0496126_0231779_887_1423 | 172 |
| 920 | 3300048929 | Ga0496126_0294207 | Ga0496126_0294207_452_1003 | 172 |
| 921 | 3300049571 | Ga0501034_0456527 | Ga0501034_0456527_30_590 | 172 |
| 922 | 3300049579 | Ga0501043_0057895 | Ga0501043_0057895_886_1422 | 172 |
| 923 | 3300049580 | Ga0501046_0067509 | Ga0501046_0067509_687_1223 | 172 |
| 924 | 3300049581 | Ga0501047_0028974 | Ga0501047_0028974_1746_2282 | 172 |
| 925 | 3300049582 | Ga0501048_0078770 | Ga0501048_0078770_629_1165 | 172 |
| 926 | 3300050494 | nmdc:mga06z11_7_c1 | nmdc:mga06z11_7_c1_59453_59971 | 172 |
| 927 | 3300050495 | nmdc:mga04h51_44_c1 | nmdc:mga04h51_44_c1_25845_26363 | 172 |
| 928 | 3300050496 | nmdc:mga07m45_150221_c1 | nmdc:mga07m45_150221_c1_804_1322 | 172 |
| 929 | 3300053087 | Ga0500643_000089 | Ga0500643_000089_54568_55092 | 172 |
| 930 | 3300053087 | Ga0500643_000641 | Ga0500643_000641_13223_13765 | 172 |
| 931 | 3300053087 | Ga0500643_001043 | Ga0500643_001043_12529_13089 | 172 |
| 932 | 3300053087 | Ga0500643_011522 | Ga0500643_011522_1891_2439 | 172 |
| 933 | 3300053087 | Ga0500643_011530 | Ga0500643_011530_2059_2601 | 172 |
| 934 | 3300053087 | Ga0500643_183888 | Ga0500643_183888_14_541 | 172 |
| 935 | 3300053091 | Ga0500647_0018649 | Ga0500647_0018649_1612_2181 | 172 |
| 936 | 3300053093 | Ga0500651_0083340 | Ga0500651_0083340_476_1045 | 172 |
| 937 | 3300053096 | Ga0500641_0123928 | Ga0500641_0123928_220_789 | 172 |
| 938 | 3300053098 | Ga0500650_0069216 | Ga0500650_0069216_317_865 | 172 |
| 939 | 3300053104 | Ga0500556_0000027 | Ga0500556_0000027_51885_52433 | 172 |
| 940 | 3300053105 | Ga0500557_061050 | Ga0500557_061050_593_1141 | 172 |
| 941 | 3300053116 | Ga0500592_000086 | Ga0500592_000086_2142_2669 | 172 |
| 942 | 3300053118 | Ga0500594_0026602 | Ga0500594_0026602_81_617 | 172 |
| 943 | 3300053122 | Ga0500608_065769 | Ga0500608_065769_94_642 | 172 |
| 944 | 3300053125 | Ga0500618_007224 | Ga0500618_007224_1493_2062 | 172 |
| 945 | 3300053130 | Ga0500642_0000003 | Ga0500642_0000003_422818_423366 | 172 |
| 946 | 3300053133 | Ga0500655_000122 | Ga0500655_000122_663_1217 | 172 |
| 947 | 3300053136 | Ga0500559_0012017 | Ga0500559_0012017_1478_2014 | 172 |
| 948 | 3300053139 | Ga0500568_0000917 | Ga0500568_0000917_11790_12317 | 172 |
| 949 | 3300053142 | Ga0500577_0047339 | Ga0500577_0047339_562_1116 | 172 |
| 950 | 3300053148 | Ga0500590_004273 | Ga0500590_004273_4615_5169 | 172 |
| 951 | 3300053151 | Ga0500604_0000023 | Ga0500604_0000023_39843_40370 | 172 |
| 952 | 3300053153 | Ga0500616_0000318 | Ga0500616_0000318_38747_39274 | 172 |
| 953 | 3300053156 | Ga0500622_0122137 | Ga0500622_0122137_419_967 | 172 |
| 954 | 3300053158 | Ga0500627_0000549 | Ga0500627_0000549_2856_3383 | 172 |
| 955 | 3300053163 | Ga0500639_068732 | Ga0500639_068732_369_923 | 172 |
| 956 | 3300053177 | Ga0500636_0056736 | Ga0500636_0056736_1234_1803 | 172 |
| 957 | 3300053724 | Ga0500570_003257 | Ga0500570_003257_4229_4783 | 172 |
| 958 | 3300053730 | Ga0500645_000424 | Ga0500645_000424_23158_23706 | 172 |
| 959 | iso_pu_bacteria | 2808606404 | 2809078124 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a9s-assembly1.cif.gz_B | the crystal structure of competence/damage inducible protein ciha from agrobacterium tumefaciens | 0.9591 | 4 | 165 |
| 5v01-assembly1.cif.gz_B | crystal structure of the competence damage-inducible protein a (coma) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.9518 | 10 | 165 |
| 5kvk-assembly1.cif.gz_A-2 | crystal structure of the competence-damaged protein (cina) superfamily protein kp700603 from klebsiella pneumoniae 700603 | 0.9508 | 10 | 165 |
| 6mr3-assembly2.cif.gz_C-2 | crystal structure of the competence-damaged protein (cina) superfamily protein from streptococcus mutans | 0.9403 | 13 | 165 |
| 6l19-assembly1.cif.gz_B | the crystal structure of competence or damage-inducible protein from enterobacter asburiae | 0.9214 | 7 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2a9sB00 | Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like | 0.9591 | 4 | 165 | 3.90.950.20 |
| af_P0A6G3_1_161_3.90.950.20 | Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like | 0.9539 | 1 | 166 | 3.90.950.20 |
| af_P9WPE3_267_424_3.90.950.20 | Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like | 0.9315 | 10 | 165 | 3.90.950.20 |
| af_P0A6G3_1_161_3.90.950.20 | Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like | 0.9308 | 1 | 166 | 3.90.950.20 |
| 2a9sB00 | Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like | 0.9198 | 4 | 165 | 3.90.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A495RX23-F1-model_v4 | deleted | 0.985 | 4 | 171 |
|
| AF-Q9S1D3-F1-model_v4 | CinA C-terminal domain-containing protein | 0.9843 | 5 | 172 |
|
| AF-A0A418Q1B0-F1-model_v4 | CinA family protein | 0.9826 | 1 | 167 |
|
| AF-A0A1M3I834-F1-model_v4 | Competence protein | 0.9825 | 1 | 167 |
|
| AF-A0A0T2QF59-F1-model_v4 | Competence protein | 0.9789 | 1 | 167 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar