F486818

General Info

Members Datasets Scaffolds Average Seq Length
959 387 944 174

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100008282|Ga0068863_1000082825
Length 196
Sequence MRLPRYACRSYSARGESIVAQHQDTILPSELVEAARRVVDANRAAGRKVAVAESCTGGLVSAALTEIAGSSDVVGACFVTYSNDAKISMLGVSMELIETFGAVSIAVAWAMARGALEHSGADTAVAITGVAGPGGGTDKKPVGTVVFGRARKGRDAEDIVADKRHFGDLGRGGVRLQAALCALELLMPGATLSGDA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
9 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
13 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
14 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
15 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
16 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
17 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
18 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
19 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
20 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
36 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
241 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
249 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
289 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
290 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
291 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
317 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
318 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
319 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
328 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
329 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
330 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
331 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
332 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
333 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
334 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
335 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
336 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
337 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
340 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
341 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
342 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
343 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
344 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
349 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
356 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
357 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
358 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
359 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
360 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
361 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
362 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
363 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
366 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
367 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
371 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
372 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
375 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
376 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
377 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
378 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
379 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
380 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
381 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
382 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
383 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
384 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
385 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
386 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
387 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0.1
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 13.24
Nodule 0.21
Rhizoplane 2.29
Rhizosphere 74.77
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1180352 2162886007 Bacteria 6701
2 ARcpr5yngRDRAFT_c001224 3300000043 Bacteria 2887
3 LJQas_1013961 3300000549 Bacteria 944
4 ARCol0yngRDRAFT_1002626 3300000652 Bacteria 1347
5 JGI24736J21556_1005436 3300001904 Bacteria 2152
6 JGI24736J21556_1010100 3300001904 Bacteria 1547
7 JGI24741J21665_1000043 3300001915 Bacteria 30255
8 JGI24752J21851_1006306 3300001976 Bacteria 1550
9 JGI24739J22299_10001086 3300001989 Bacteria 10126
10 JGI24739J22299_10008251 3300001989 Bacteria 3886
11 JGI24739J22299_10008868 3300001989 Bacteria 3750
12 JGI24739J22299_10032344 3300001989 Bacteria 1800
13 JGI24739J22299_10103781 3300001989 Bacteria 857
14 JGI24739J22299_10150961 3300001989 Bacteria 687
15 JGI24737J22298_10008114 3300001990 Bacteria 3529
16 JGI24737J22298_10008735 3300001990 Bacteria 3383
17 JGI24737J22298_10018638 3300001990 Bacteria 2226
18 JGI24737J22298_10059028 3300001990 Bacteria 1156
19 JGI24735J21928_10000815 3300002067 Bacteria 11084
20 JGI24735J21928_10013121 3300002067 Bacteria 2610
21 JGI24735J21928_10025174 3300002067 Bacteria 1797
22 JGI24735J21928_10031019 3300002067 Bacteria 1585
23 JGI24735J21928_10045121 3300002067 Bacteria 1280
24 JGI24735J21928_10046323 3300002067 Bacteria 1261
25 JGI24738J21930_10001110 3300002075 Bacteria 7590
26 JGI24738J21930_10003415 3300002075 Bacteria 4008
27 JGI24749J21850_1000111 3300002076 Bacteria 13544
28 JGI24751J29686_10000002 3300002459 Bacteria 160619
29 JGI24751J29686_10004995 3300002459 Bacteria 2704
30 JGI24751J29686_10020488 3300002459 Bacteria 1369
31 JGI25151J46595_10009635 3300003187 Bacteria 4558
32 JGI25165J46597_1000032 3300003214 Bacteria 294371
33 JGI25153J46596_10000002 3300003215 Bacteria 653569
34 JGI25153J46596_10000044 3300003215 Bacteria 154263
35 JGI25153J46596_10011927 3300003215 Bacteria 3802
36 rootH1_10122630 3300003316 Bacteria 1248
37 rootL2_10010215 3300003322 Bacteria 2561
38 rootL2_10033985 3300003322 Bacteria 3181
39 rootH1_10098301 3300003323 Bacteria 3703
40 Ga0055542_1000046 3300003762 Bacteria 201922
41 Ga0055542_1004873 3300003762 Bacteria 3139
42 Ga0055529_1000007 3300003763 Bacteria 403604
43 Ga0055526_1011554 3300003771 Bacteria 3960
44 Ga0055537_1000874 3300003773 Bacteria 14424
45 Ga0055537_1001004 3300003773 Bacteria 12769
46 Ga0055524_1000088 3300003775 Bacteria 116065
47 Ga0055536_1021354 3300003781 Bacteria 1968
48 Ga0055528_1038469 3300003790 Bacteria 1108
49 Ga0055540_1000717 3300003792 Bacteria 22584
50 Ga0055531_10000016 3300003794 Bacteria 181898
51 Ga0055531_10008252 3300003794 Bacteria 5537
52 Ga0055543_1037273 3300004625 Bacteria 831
53 Ga0065165_1003585 3300005262 Bacteria 10701
54 Ga0065165_1004738 3300005262 Bacteria 8160
55 Ga0065165_1013352 3300005262 Bacteria 3272
56 Ga0065165_1075133 3300005262 Bacteria 889
57 Ga0065165_1085341 3300005262 Bacteria 813
58 Ga0065704_10003859 3300005289 Bacteria 6264
59 Ga0065707_10084130 3300005295 Bacteria 7653
60 Ga0070658_10000001 3300005327 Bacteria 856789
61 Ga0070658_10000082 3300005327 Bacteria 89656
62 Ga0070658_10001506 3300005327 Bacteria 19773
63 Ga0070658_10042620 3300005327 Bacteria 3666
64 Ga0070658_10117346 3300005327 Bacteria 2209
65 Ga0070658_10320973 3300005327 Bacteria 1322
66 Ga0070658_10401678 3300005327 Bacteria 1177
67 Ga0070670_100000012 3300005331 Bacteria 256314
68 Ga0070670_100002503 3300005331 Bacteria 15155
69 Ga0070670_100004838 3300005331 Bacteria 11321
70 Ga0070677_10001096 3300005333 Bacteria 8710
71 Ga0070666_10000092 3300005335 Bacteria 62551
72 Ga0070666_10024022 3300005335 Bacteria 3969
73 Ga0070666_10156997 3300005335 Bacteria 1589
74 Ga0070680_100000534 3300005336 Bacteria 25964
75 Ga0070680_100205486 3300005336 Bacteria 1661
76 Ga0070680_100630651 3300005336 Bacteria 921
77 Ga0070682_100818374 3300005337 Bacteria 758
78 Ga0070660_100000401 3300005339 Bacteria 28844
79 Ga0070660_100001071 3300005339 Bacteria 18386
80 Ga0070660_100056240 3300005339 Bacteria 3043
81 Ga0070660_100097373 3300005339 Bacteria 2327
82 Ga0070660_100126231 3300005339 Bacteria 2044
83 Ga0070660_100141166 3300005339 Bacteria 1933
84 Ga0070660_100380542 3300005339 Bacteria 1165
85 Ga0070661_100043250 3300005344 Bacteria 3290
86 Ga0070661_100093676 3300005344 Bacteria 2225
87 Ga0070661_100282428 3300005344 Bacteria 1288
88 Ga0070661_100804456 3300005344 Bacteria 771
89 Ga0070692_10038481 3300005345 Bacteria 2438
90 Ga0070668_100000004 3300005347 Bacteria 189408
91 Ga0070668_100000330 3300005347 Bacteria 31137
92 Ga0070668_100046239 3300005347 Bacteria 3341
93 Ga0070668_100102263 3300005347 Bacteria 2272
94 Ga0070669_100000018 3300005353 Bacteria 195789
95 Ga0070669_100000041 3300005353 Bacteria 127426
96 Ga0070669_100073089 3300005353 Bacteria 2540
97 Ga0070669_100098905 3300005353 Bacteria 2198
98 Ga0070669_100304443 3300005353 Bacteria 1283
99 Ga0070669_100584863 3300005353 Bacteria 934
100 Ga0070675_100836220 3300005354 Bacteria 842
101 Ga0070675_101016432 3300005354 Bacteria 761
102 Ga0070671_100000011 3300005355 Bacteria 202057
103 Ga0070671_100000014 3300005355 Bacteria 167986
104 Ga0070671_100000136 3300005355 Bacteria 47367
105 Ga0070671_100015156 3300005355 Bacteria 6227
106 Ga0070674_100000639 3300005356 Bacteria 17624
107 Ga0070674_100066686 3300005356 Bacteria 2530
108 Ga0070673_100250069 3300005364 Bacteria 1545
109 Ga0070673_100320001 3300005364 Bacteria 1370
110 Ga0070659_100007571 3300005366 Bacteria 7892
111 Ga0070659_100035817 3300005366 Bacteria 3866
112 Ga0070659_100349090 3300005366 Bacteria 1241
113 Ga0070659_100671783 3300005366 Bacteria 894
114 Ga0070667_100000037 3300005367 Bacteria 172343
115 Ga0070667_100000089 3300005367 Bacteria 113661
116 Ga0070667_100070948 3300005367 Bacteria 2966
117 Ga0070705_100006873 3300005440 Bacteria 5591
118 Ga0070708_100460602 3300005445 Bacteria 1199
119 Ga0070663_100042668 3300005455 Bacteria 3188
120 Ga0070663_100285767 3300005455 Bacteria 1316
121 Ga0070663_100304553 3300005455 Bacteria 1277
122 Ga0070678_100000104 3300005456 Bacteria 32585
123 Ga0070662_100252622 3300005457 Bacteria 1418
124 Ga0070662_100392669 3300005457 Bacteria 1144
125 Ga0070662_100418223 3300005457 Bacteria 1108
126 Ga0070679_100000005 3300005530 Bacteria 263201
127 Ga0070679_100349033 3300005530 Bacteria 1427
128 Ga0070679_100372060 3300005530 Bacteria 1376
129 Ga0070684_100713447 3300005535 Bacteria 935
130 Ga0068853_100001346 3300005539 Bacteria 17708
131 Ga0068853_100052401 3300005539 Bacteria 3515
132 Ga0068853_100090889 3300005539 Bacteria 2684
133 Ga0068853_100145477 3300005539 Bacteria 2130
134 Ga0068853_100166348 3300005539 Bacteria 1993
135 Ga0068853_100741180 3300005539 Bacteria 939
136 Ga0068853_100849593 3300005539 Bacteria 875
137 Ga0068853_100923997 3300005539 Bacteria 838
138 Ga0070672_100081453 3300005543 Bacteria 2595
139 Ga0070686_100600100 3300005544 Bacteria 867
140 Ga0070693_100215646 3300005547 Bacteria 1255
141 Ga0070665_100030492 3300005548 Bacteria 5425
142 Ga0070665_100600288 3300005548 Bacteria 1114
143 Ga0068855_100000416 3300005563 Bacteria 52868
144 Ga0068855_100001528 3300005563 Bacteria 29013
145 Ga0068855_100068705 3300005563 Bacteria 4124
146 Ga0068855_100078020 3300005563 Bacteria 3843
147 Ga0068855_100345800 3300005563 Bacteria 1639
148 Ga0070664_100255042 3300005564 Bacteria 1577
149 Ga0068857_100028662 3300005577 Bacteria 4913
150 Ga0068857_100062712 3300005577 Bacteria 3305
151 Ga0068857_100667034 3300005577 Bacteria 986
152 Ga0068857_100830344 3300005577 Bacteria 883
153 Ga0068854_100005589 3300005578 Bacteria 7943
154 Ga0068854_100176021 3300005578 Bacteria 1668
155 Ga0068854_100346967 3300005578 Bacteria 1214
156 Ga0068856_100004201 3300005614 Bacteria 14383
157 Ga0068856_100023608 3300005614 Bacteria 5980
158 Ga0068856_100863271 3300005614 Bacteria 924
159 Ga0068852_100005250 3300005616 Bacteria 9241
160 Ga0068852_100318295 3300005616 Bacteria 1510
161 Ga0068852_100333498 3300005616 Bacteria 1476
162 Ga0068852_100764919 3300005616 Bacteria 979
163 Ga0068852_100900870 3300005616 Bacteria 901
164 Ga0068852_101139348 3300005616 Bacteria 801
165 Ga0068859_100000805 3300005617 Bacteria 31840
166 Ga0068859_100005780 3300005617 Bacteria 12567
167 Ga0068859_100007191 3300005617 Bacteria 11298
168 Ga0068859_100356626 3300005617 Bacteria 1557
169 Ga0068859_100435092 3300005617 Bacteria 1408
170 Ga0068859_100552363 3300005617 Bacteria 1246
171 Ga0068859_100766840 3300005617 Bacteria 1053
172 Ga0068859_100955834 3300005617 Bacteria 940
173 Ga0068859_101112497 3300005617 Bacteria 869
174 Ga0068859_101742347 3300005617 Bacteria 688
175 Ga0068864_100000010 3300005618 Bacteria 358723
176 Ga0068864_100000403 3300005618 Bacteria 37462
177 Ga0068864_100002670 3300005618 Bacteria 14735
178 Ga0068864_100008484 3300005618 Bacteria 8478
179 Ga0068864_100284186 3300005618 Bacteria 1545
180 Ga0068861_100000086 3300005719 Bacteria 44879
181 Ga0068861_100001727 3300005719 Bacteria 14012
182 Ga0068861_100045012 3300005719 Bacteria 3321
183 Ga0068861_100861142 3300005719 Bacteria 855
184 Ga0068861_101002577 3300005719 Bacteria 797
185 Ga0068851_10017503 3300005834 Bacteria 3443
186 Ga0068863_100000001 3300005841 Bacteria 581116
187 Ga0068863_100004589 3300005841 Bacteria 13621
188 Ga0068863_100005416 3300005841 Bacteria 12576
189 Ga0068863_100008282 3300005841 Bacteria 10159
190 Ga0068863_100654350 3300005841 Bacteria 1042
191 Ga0068858_100001988 3300005842 Bacteria 20899
192 Ga0068858_100002719 3300005842 Bacteria 17826
193 Ga0068858_100006177 3300005842 Bacteria 11684
194 Ga0068858_100006359 3300005842 Bacteria 11503
195 Ga0068858_100045893 3300005842 Bacteria 4051
196 Ga0068860_100000002 3300005843 Bacteria 627849
197 Ga0068860_100000148 3300005843 Bacteria 113661
198 Ga0068860_100012019 3300005843 Bacteria 8528
199 Ga0068860_100050733 3300005843 Bacteria 3949
200 Ga0068860_100234850 3300005843 Bacteria 1782
201 Ga0068860_100400906 3300005843 Bacteria 1357
202 Ga0068862_100000016 3300005844 Bacteria 250031
203 Ga0068862_100000280 3300005844 Bacteria 56780
204 Ga0068862_100002391 3300005844 Bacteria 16687
205 Ga0075367_10000022 3300006178 Bacteria 33901
206 Ga0097621_100088459 3300006237 Bacteria 2588
207 Ga0075370_10033771 3300006353 Bacteria 2865
208 Ga0068871_100088693 3300006358 Bacteria 2574
209 Ga0068865_100572666 3300006881 Bacteria 951
210 Ga0097620_100000805 3300006931 Bacteria 31840
211 Ga0097620_100005780 3300006931 Bacteria 12567
212 Ga0097620_100007191 3300006931 Bacteria 11298
213 Ga0097620_100007340 3300006931 Bacteria 11181
214 Ga0097620_100356601 3300006931 Bacteria 1557
215 Ga0097620_100435110 3300006931 Bacteria 1408
216 Ga0097620_100552350 3300006931 Bacteria 1246
217 Ga0097620_100766891 3300006931 Bacteria 1053
218 Ga0097620_101112457 3300006931 Bacteria 869
219 Ga0097620_101741797 3300006931 Bacteria 688
220 Ga0079104_1030896 3300006946 Bacteria 1333
221 Ga0105251_10053937 3300009011 Bacteria 1910
222 Ga0105240_10034553 3300009093 Bacteria 6520
223 Ga0105240_10178147 3300009093 Bacteria 2511
224 Ga0105240_10188479 3300009093 Bacteria 2427
225 Ga0105240_10891679 3300009093 Bacteria 957
226 Ga0105247_10004644 3300009101 Bacteria 8755
227 Ga0114129_10314289 3300009147 Bacteria 2084
228 Ga0105243_10002588 3300009148 Bacteria 15095
229 Ga0105241_10007217 3300009174 Bacteria 8180
230 Ga0105242_10497526 3300009176 Bacteria 1159
231 Ga0105248_10000053 3300009177 Bacteria 143972
232 Ga0105248_10043510 3300009177 Bacteria 5035
233 Ga0105248_10150901 3300009177 Bacteria 2622
234 Ga0105248_10557854 3300009177 Bacteria 1292
235 Ga0105237_10047102 3300009545 Bacteria 4335
236 Ga0105237_10184363 3300009545 Bacteria 2087
237 Ga0105237_10228526 3300009545 Bacteria 1861
238 Ga0105237_10299721 3300009545 Bacteria 1611
239 Ga0105238_10094707 3300009551 Bacteria 2974
240 Ga0105238_10191499 3300009551 Bacteria 2021
241 Ga0105238_10369036 3300009551 Bacteria 1425
242 Ga0105238_10581332 3300009551 Bacteria 1127
243 Ga0105238_10615885 3300009551 Bacteria 1094
244 Ga0105238_10706922 3300009551 Bacteria 1020
245 Ga0105249_10000103 3300009553 Bacteria 118397
246 Ga0105249_10000748 3300009553 Bacteria 29239
247 Ga0105249_11195675 3300009553 Bacteria 831
248 Ga0105148_100050 3300009978 Bacteria 18144
249 Ga0105239_10000320 3300010375 Bacteria 70971
250 Ga0105239_10392896 3300010375 Bacteria 1569
251 Ga0105239_10643966 3300010375 Bacteria 1210
252 Ga0105246_10015969 3300011119 Bacteria 4749
253 Ga0157326_1000547 3300012513 Bacteria 4458
254 Ga0157326_1004308 3300012513 Bacteria 1494
255 Ga0157373_10396210 3300013100 Bacteria 989
256 Ga0157373_10513996 3300013100 Bacteria 866
257 Ga0157373_10787447 3300013100 Bacteria 701
258 Ga0157371_10002068 3300013102 Bacteria 19673
259 Ga0157371_10105735 3300013102 Bacteria 1997
260 Ga0157370_10396287 3300013104 Bacteria 1271
261 Ga0157370_10426595 3300013104 Bacteria 1219
262 Ga0157370_10445842 3300013104 Bacteria 1190
263 Ga0157370_10595387 3300013104 Bacteria 1012
264 Ga0157369_10000298 3300013105 Bacteria 66393
265 Ga0157369_10004587 3300013105 Bacteria 16237
266 Ga0157369_10593630 3300013105 Bacteria 1143
267 Ga0157369_10817235 3300013105 Bacteria 957
268 Ga0157369_10818286 3300013105 Bacteria 957
269 Ga0157369_10946228 3300013105 Bacteria 883
270 Ga0157374_10141224 3300013296 Bacteria 2338
271 Ga0157378_10153888 3300013297 Bacteria 2144
272 Ga0163162_10004388 3300013306 Bacteria 13573
273 Ga0163162_10166387 3300013306 Bacteria 2329
274 Ga0163162_10290159 3300013306 Bacteria 1768
275 Ga0163162_10994567 3300013306 Bacteria 948
276 Ga0157372_10054162 3300013307 Bacteria 4474
277 Ga0157372_10066845 3300013307 Bacteria 4039
278 Ga0157372_10067875 3300013307 Bacteria 4008
279 Ga0157372_10088444 3300013307 Bacteria 3517
280 Ga0157372_10286770 3300013307 Bacteria 1915
281 Ga0157372_10307967 3300013307 Bacteria 1843
282 Ga0157372_10650829 3300013307 Bacteria 1227
283 Ga0157372_12458342 3300013307 Bacteria 598
284 Ga0157375_12108032 3300013308 Bacteria 671
285 Ga0163163_10011243 3300014325 Bacteria 8112
286 Ga0163163_10029678 3300014325 Bacteria 5263
287 Ga0157380_10000134 3300014326 Bacteria 41479
288 Ga0157380_10047718 3300014326 Bacteria 3370
289 Ga0157380_10451141 3300014326 Bacteria 1235
290 Ga0157380_10927867 3300014326 Bacteria 899
291 Ga0157379_10005282 3300014968 Bacteria 11092
292 Ga0157379_10687645 3300014968 Bacteria 960
293 Ga0157376_10290474 3300014969 Bacteria 1543
294 Ga0163161_10089708 3300017792 Bacteria 2274
295 Ga0163161_10104274 3300017792 Bacteria 2114
296 Ga0163161_10158995 3300017792 Bacteria 1722
297 Ga0206353_10346769 3300020082 Bacteria 2740
298 Ga0213873_10000006 3300021358 Bacteria 408723
299 Ga0213876_10000004 3300021384 Bacteria 943822
300 Ga0209674_114085 3300025226 Bacteria 724
301 Ga0209147_102362 3300025229 Bacteria 4796
302 Ga0207425_1000026 3300025245 Bacteria 301303
303 Ga0207425_1005446 3300025245 Bacteria 3628
304 Ga0209148_1000338 3300025254 Bacteria 62960
305 Ga0209148_1001156 3300025254 Bacteria 15345
306 Ga0209129_1001922 3300025258 Bacteria 10907
307 Ga0209233_1000066 3300025261 Bacteria 381218
308 Ga0209565_1000010 3300025263 Bacteria 687724
309 Ga0209565_1000064 3300025263 Bacteria 180732
310 Ga0209455_1000005 3300025272 Bacteria 1416756
311 Ga0209455_1001029 3300025272 Bacteria 13882
312 Ga0209673_1002611 3300025273 Bacteria 12108
313 Ga0209673_1046675 3300025273 Bacteria 1180
314 Ga0209676_1008246 3300025292 Bacteria 4687
315 Ga0209025_1000551 3300025294 Bacteria 69956
316 Ga0209564_1003529 3300025295 Bacteria 10551
317 Ga0209564_1018595 3300025295 Bacteria 2640
318 Ga0209758_1000001 3300025297 Bacteria 1981790
319 Ga0209758_1000004 3300025297 Bacteria 1375322
320 Ga0209758_1002673 3300025297 Bacteria 17608
321 Ga0209050_1000001 3300025298 Bacteria 3563507
322 Ga0209050_1000026 3300025298 Bacteria 499134
323 Ga0209050_1002186 3300025298 Bacteria 17647
324 Ga0209050_1011661 3300025298 Bacteria 4136
325 Ga0209256_1000034 3300025299 Bacteria 388475
326 Ga0207426_1014974 3300025302 Bacteria 2830
327 Ga0209051_1001333 3300025303 Bacteria 21480
328 Ga0209257_1000009 3300025304 Bacteria 1205047
329 Ga0209257_1005333 3300025304 Bacteria 9104
330 Ga0209257_1016095 3300025304 Bacteria 3051
331 Ga0207697_10001015 3300025315 Bacteria 15714
332 Ga0207656_10010757 3300025321 Bacteria 3438
333 Ga0207656_10069700 3300025321 Bacteria 1560
334 Ga0207682_10000992 3300025893 Bacteria 13115
335 Ga0207682_10197228 3300025893 Bacteria 924
336 Ga0207710_10002894 3300025900 Bacteria 7801
337 Ga0207680_10003517 3300025903 Bacteria 7371
338 Ga0207680_10128707 3300025903 Bacteria 1666
339 Ga0207680_10174088 3300025903 Bacteria 1451
340 Ga0207647_10001182 3300025904 Bacteria 20104
341 Ga0207647_10008705 3300025904 Bacteria 7249
342 Ga0207647_10210138 3300025904 Bacteria 1124
343 Ga0207647_10210139 3300025904 Bacteria 1124
344 Ga0207705_10000002 3300025909 Bacteria 2046852
345 Ga0207705_10000027 3300025909 Bacteria 248863
346 Ga0207705_10000915 3300025909 Bacteria 24186
347 Ga0207705_10004780 3300025909 Bacteria 10199
348 Ga0207705_10213995 3300025909 Bacteria 1462
349 Ga0207705_10253338 3300025909 Bacteria 1343
350 Ga0207705_10311488 3300025909 Bacteria 1208
351 Ga0207705_10527101 3300025909 Bacteria 918
352 Ga0207654_10048248 3300025911 Bacteria 2436
353 Ga0207654_10173917 3300025911 Bacteria 1400
354 Ga0207695_10017086 3300025913 Bacteria 8458
355 Ga0207695_10082639 3300025913 Bacteria 3246
356 Ga0207695_10142203 3300025913 Bacteria 2347
357 Ga0207671_10061563 3300025914 Bacteria 2785
358 Ga0207671_10118564 3300025914 Bacteria 2021
359 Ga0207671_10192273 3300025914 Bacteria 1591
360 Ga0207671_10281666 3300025914 Bacteria 1311
361 Ga0207657_10001109 3300025919 Bacteria 28595
362 Ga0207657_10001208 3300025919 Bacteria 27508
363 Ga0207657_10002470 3300025919 Bacteria 19999
364 Ga0207657_10035193 3300025919 Bacteria 4494
365 Ga0207657_10037177 3300025919 Bacteria 4352
366 Ga0207657_10138328 3300025919 Bacteria 1991
367 Ga0207657_10168890 3300025919 Bacteria 1773
368 Ga0207657_10301401 3300025919 Bacteria 1269
369 Ga0207649_10000235 3300025920 Bacteria 45363
370 Ga0207649_10192386 3300025920 Bacteria 1436
371 Ga0207649_10219986 3300025920 Bacteria 1352
372 Ga0207649_10785267 3300025920 Bacteria 743
373 Ga0207652_10000005 3300025921 Bacteria 343384
374 Ga0207652_10000006 3300025921 Bacteria 302991
375 Ga0207652_10000007 3300025921 Bacteria 301303
376 Ga0207652_10000009 3300025921 Bacteria 257234
377 Ga0207652_10360977 3300025921 Bacteria 1311
378 Ga0207652_10455777 3300025921 Bacteria 1153
379 Ga0207681_10000008 3300025923 Bacteria 414329
380 Ga0207681_10000013 3300025923 Bacteria 357411
381 Ga0207681_10047884 3300025923 Bacteria 2883
382 Ga0207681_10249423 3300025923 Bacteria 1385
383 Ga0207694_10167615 3300025924 Bacteria 1777
384 Ga0207694_10321454 3300025924 Bacteria 1277
385 Ga0207694_10494248 3300025924 Bacteria 1024
386 Ga0207650_10000008 3300025925 Bacteria 498534
387 Ga0207650_10001666 3300025925 Bacteria 15824
388 Ga0207650_10007720 3300025925 Bacteria 7331
389 Ga0207687_10063568 3300025927 Bacteria 2614
390 Ga0207644_10000006 3300025931 Bacteria 408793
391 Ga0207644_10000030 3300025931 Bacteria 136272
392 Ga0207644_10000046 3300025931 Bacteria 103962
393 Ga0207644_10004648 3300025931 Bacteria 8925
394 Ga0207690_10004899 3300025932 Bacteria 7899
395 Ga0207690_10284841 3300025932 Bacteria 1288
396 Ga0207706_10003238 3300025933 Bacteria 15605
397 Ga0207706_10005292 3300025933 Bacteria 12029
398 Ga0207706_10051297 3300025933 Bacteria 3643
399 Ga0207706_10393734 3300025933 Bacteria 1201
400 Ga0207706_10995734 3300025933 Bacteria 704
401 Ga0207686_10719094 3300025934 Bacteria 795
402 Ga0207709_10000201 3300025935 Bacteria 78554
403 Ga0207709_10686197 3300025935 Bacteria 818
404 Ga0207709_10696659 3300025935 Bacteria 812
405 Ga0207670_10180514 3300025936 Bacteria 1590
406 Ga0207669_10000042 3300025937 Bacteria 65679
407 Ga0207669_10013513 3300025937 Bacteria 4057
408 Ga0207691_10079430 3300025940 Bacteria 2953
409 Ga0207711_10003703 3300025941 Bacteria 13178
410 Ga0207711_10094340 3300025941 Bacteria 2637
411 Ga0207711_10130631 3300025941 Bacteria 2252
412 Ga0207711_10414159 3300025941 Bacteria 1253
413 Ga0207661_11027976 3300025944 Bacteria 759
414 Ga0207679_11159432 3300025945 Bacteria 709
415 Ga0207667_10000109 3300025949 Bacteria 132054
416 Ga0207667_10000504 3300025949 Bacteria 51526
417 Ga0207667_10020841 3300025949 Bacteria 7278
418 Ga0207667_10053655 3300025949 Bacteria 4241
419 Ga0207667_10264118 3300025949 Bacteria 1760
420 Ga0207667_10288460 3300025949 Bacteria 1677
421 Ga0207667_10446221 3300025949 Bacteria 1315
422 Ga0207651_10196425 3300025960 Bacteria 1613
423 Ga0207651_10283621 3300025960 Bacteria 1370
424 Ga0207712_10000069 3300025961 Bacteria 127318
425 Ga0207712_10004601 3300025961 Bacteria 8715
426 Ga0207668_10000140 3300025972 Bacteria 49509
427 Ga0207668_10000256 3300025972 Bacteria 35517
428 Ga0207668_10000294 3300025972 Bacteria 32757
429 Ga0207668_10024318 3300025972 Bacteria 3908
430 Ga0207640_10004411 3300025981 Bacteria 7631
431 Ga0207640_10015179 3300025981 Bacteria 4453
432 Ga0207640_10360382 3300025981 Bacteria 1171
433 Ga0207640_10794630 3300025981 Bacteria 819
434 Ga0207658_10000002 3300025986 Bacteria 1364188
435 Ga0207658_10000069 3300025986 Bacteria 113687
436 Ga0207658_10712357 3300025986 Bacteria 907
437 Ga0207658_10744787 3300025986 Bacteria 887
438 Ga0207658_10849857 3300025986 Bacteria 830
439 Ga0207703_10000501 3300026035 Bacteria 40495
440 Ga0207703_10000677 3300026035 Bacteria 33813
441 Ga0207703_10004439 3300026035 Bacteria 11520
442 Ga0207703_10026618 3300026035 Bacteria 4554
443 Ga0207703_10182370 3300026035 Bacteria 1853
444 Ga0207639_10009698 3300026041 Bacteria 6651
445 Ga0207639_10021378 3300026041 Bacteria 4647
446 Ga0207639_10107040 3300026041 Bacteria 2271
447 Ga0207639_10151591 3300026041 Bacteria 1942
448 Ga0207639_10358941 3300026041 Bacteria 1303
449 Ga0207639_10589094 3300026041 Bacteria 1024
450 Ga0207678_10000622 3300026067 Bacteria 32445
451 Ga0207678_10082780 3300026067 Bacteria 2745
452 Ga0207678_10263424 3300026067 Bacteria 1477
453 Ga0207702_10015330 3300026078 Bacteria 6352
454 Ga0207702_10015475 3300026078 Bacteria 6317
455 Ga0207702_10043899 3300026078 Bacteria 3755
456 Ga0207641_10000001 3300026088 Bacteria 1180841
457 Ga0207641_10000818 3300026088 Bacteria 33059
458 Ga0207641_10001290 3300026088 Bacteria 24911
459 Ga0207641_10002303 3300026088 Bacteria 17752
460 Ga0207641_10004282 3300026088 Bacteria 12408
461 Ga0207641_10004485 3300026088 Bacteria 12077
462 Ga0207641_10098794 3300026088 Bacteria 2567
463 Ga0207641_10702582 3300026088 Bacteria 996
464 Ga0207648_10018044 3300026089 Bacteria 6394
465 Ga0207648_11391861 3300026089 Bacteria 659
466 Ga0207676_10000012 3300026095 Bacteria 353971
467 Ga0207676_10000184 3300026095 Bacteria 55154
468 Ga0207676_10001239 3300026095 Bacteria 19003
469 Ga0207676_10006305 3300026095 Bacteria 8377
470 Ga0207676_10332862 3300026095 Bacteria 1398
471 Ga0207674_10002143 3300026116 Bacteria 24953
472 Ga0207674_10038181 3300026116 Bacteria 4989
473 Ga0207674_10076729 3300026116 Bacteria 3349
474 Ga0207674_10176789 3300026116 Bacteria 2087
475 Ga0207674_10693644 3300026116 Bacteria 983
476 Ga0207675_100000822 3300026118 Bacteria 30908
477 Ga0207675_100006217 3300026118 Bacteria 11338
478 Ga0207675_100053569 3300026118 Bacteria 3764
479 Ga0207675_100074606 3300026118 Bacteria 3174
480 Ga0207675_100250507 3300026118 Bacteria 1714
481 Ga0207683_10000067 3300026121 Bacteria 79552
482 Ga0207698_10261953 3300026142 Bacteria 1589
483 Ga0207698_10268441 3300026142 Bacteria 1571
484 Ga0207698_10286465 3300026142 Bacteria 1526
485 Ga0207698_10321175 3300026142 Bacteria 1450
486 Ga0207698_10389568 3300026142 Bacteria 1328
487 Ga0207698_10438462 3300026142 Unclassified 1258
488 Ga0209281_1022262 3300027111 Bacteria 1215
489 Ga0209813_10000224 3300027866 Bacteria 17403
490 Ga0268266_10002533 3300028379 Bacteria 19412
491 Ga0268266_10557732 3300028379 Bacteria 1098
492 Ga0268265_10000006 3300028380 Bacteria 466482
493 Ga0268265_10000064 3300028380 Bacteria 144164
494 Ga0268265_10001032 3300028380 Bacteria 25108
495 Ga0268265_10004641 3300028380 Bacteria 9484
496 Ga0268265_10778555 3300028380 Bacteria 931
497 Ga0268264_10000001 3300028381 Bacteria 1221000
498 Ga0268264_10000010 3300028381 Bacteria 596543
499 Ga0268264_10000217 3300028381 Bacteria 113674
500 Ga0268264_10000381 3300028381 Bacteria 64651
501 Ga0268264_10018242 3300028381 Bacteria 5739
502 Ga0307517_10045291 3300028786 Bacteria 4626
503 Ga0307515_10419399 3300028794 Bacteria 959
504 Ga0316182_1105435 3300030745 Bacteria 863
505 Ga0307513_10190564 3300031456 Bacteria 1903
506 Ga0307513_10371082 3300031456 Bacteria 1173
507 Ga0307509_10226867 3300031507 Bacteria 1675
508 Ga0307408_100008396 3300031548 Bacteria 6818
509 Ga0307408_100013448 3300031548 Bacteria 5431
510 Ga0307408_100046157 3300031548 Bacteria 3115
511 Ga0307408_100060456 3300031548 Bacteria 2762
512 Ga0307408_100310385 3300031548 Bacteria 1325
513 Ga0307408_100375426 3300031548 Bacteria 1214
514 Ga0307408_100410934 3300031548 Bacteria 1164
515 Ga0307408_100473552 3300031548 Bacteria 1091
516 Ga0307408_100753864 3300031548 Bacteria 880
517 Ga0307408_100771869 3300031548 Bacteria 870
518 Ga0307508_10000638 3300031616 Bacteria 42145
519 Ga0307405_10023181 3300031731 Bacteria 3524
520 Ga0307405_10061287 3300031731 Bacteria 2377
521 Ga0307405_10223445 3300031731 Bacteria 1383
522 Ga0307405_10305053 3300031731 Bacteria 1209
523 Ga0307405_11034309 3300031731 Bacteria 702
524 Ga0307405_11703150 3300031731 Bacteria 558
525 Ga0307413_10032195 3300031824 Bacteria 2969
526 Ga0307413_10057100 3300031824 Bacteria 2385
527 Ga0307413_10080840 3300031824 Bacteria 2082
528 Ga0307413_10219146 3300031824 Bacteria 1388
529 Ga0307413_10239950 3300031824 Bacteria 1338
530 Ga0307413_10333499 3300031824 Bacteria 1164
531 Ga0307413_10493321 3300031824 Bacteria 982
532 Ga0307410_10129803 3300031852 Bacteria 1850
533 Ga0307410_10241964 3300031852 Bacteria 1399
534 Ga0307410_10622484 3300031852 Bacteria 902
535 Ga0307410_11072257 3300031852 Bacteria 697
536 Ga0307406_10004070 3300031901 Bacteria 7959
537 Ga0307406_10020839 3300031901 Bacteria 3868
538 Ga0307406_10029680 3300031901 Bacteria 3313
539 Ga0307406_10080622 3300031901 Bacteria 2162
540 Ga0307406_10214737 3300031901 Bacteria 1426
541 Ga0307407_10063086 3300031903 Bacteria 2173
542 Ga0307407_10093093 3300031903 Bacteria 1852
543 Ga0307407_10125243 3300031903 Bacteria 1635
544 Ga0307412_10006640 3300031911 Bacteria 6555
545 Ga0307412_10006836 3300031911 Bacteria 6474
546 Ga0307412_10017510 3300031911 Bacteria 4289
547 Ga0307412_10026305 3300031911 Bacteria 3615
548 Ga0307412_10048489 3300031911 Bacteria 2794
549 Ga0307412_10146928 3300031911 Bacteria 1734
550 Ga0307412_10156229 3300031911 Bacteria 1689
551 Ga0307412_10184436 3300031911 Bacteria 1572
552 Ga0307412_10406811 3300031911 Bacteria 1109
553 Ga0307412_10439319 3300031911 Bacteria 1072
554 Ga0307409_100136565 3300031995 Bacteria 2105
555 Ga0307409_100175442 3300031995 Bacteria 1891
556 Ga0307409_100193090 3300031995 Bacteria 1814
557 Ga0307409_101495577 3300031995 Bacteria 703
558 Ga0307416_100005856 3300032002 Bacteria 7623
559 Ga0307416_100020485 3300032002 Bacteria 4722
560 Ga0307416_100083026 3300032002 Bacteria 2716
561 Ga0307416_100478347 3300032002 Bacteria 1305
562 Ga0307416_100540706 3300032002 Bacteria 1237
563 Ga0307416_101591817 3300032002 Bacteria 759
564 Ga0307414_10000911 3300032004 Bacteria 15167
565 Ga0307414_10014817 3300032004 Bacteria 4688
566 Ga0307414_10040341 3300032004 Bacteria 3152
567 Ga0307414_10053390 3300032004 Bacteria 2818
568 Ga0307414_10120555 3300032004 Bacteria 2016
569 Ga0307414_10136036 3300032004 Bacteria 1916
570 Ga0307414_10291899 3300032004 Bacteria 1375
571 Ga0307414_10381536 3300032004 Bacteria 1219
572 Ga0307414_10800735 3300032004 Bacteria 859
573 Ga0307414_11053423 3300032004 Bacteria 750
574 Ga0307414_11168622 3300032004 Bacteria 712
575 Ga0307411_10014349 3300032005 Bacteria 4405
576 Ga0307411_10074692 3300032005 Bacteria 2311
577 Ga0307411_10098250 3300032005 Bacteria 2063
578 Ga0307411_10461558 3300032005 Unclassified 1065
579 Ga0307415_100031013 3300032126 Bacteria 3439
580 Ga0307415_100093990 3300032126 Bacteria 2179
581 Ga0307415_100206421 3300032126 Bacteria 1563
582 Ga0307415_100616126 3300032126 Bacteria 968
583 Ga0307415_101236798 3300032126 Bacteria 705
584 Ga0307510_10010127 3300033180 Bacteria 11208
585 Ga0373927_0176280 3300035695 Bacteria 1402
586 Ga0395899_0012107 3300037312 Bacteria 6605
587 Ga0395900_0009928 3300037418 Bacteria 9746
588 Ga0395900_0137923 3300037418 Bacteria 2499
589 Ga0395900_0204307 3300037418 Bacteria 1997
590 Ga0395898_0082714 3300037466 Bacteria 3094
591 Ga0395898_0146412 3300037466 Bacteria 2260
592 Ga0395905_0119946 3300037471 Bacteria 2472
593 Ga0395905_1210529 3300037471 Bacteria 659
594 Ga0436364_1344939 3300037853 Bacteria 997
595 Ga0395901_0091016 3300038443 Bacteria 3193
596 Ga0395901_0165215 3300038443 Bacteria 2324
597 Ga0237819_00162 3300038705 Bacteria 24529
598 Ga0436365_1244885 3300039437 Bacteria 63227
599 Ga0436365_1911487 3300039437 Bacteria 52227
600 Ga0436362_0953683 3300039453 Bacteria 32384
601 Ga0439436_0013362 3300041404 Bacteria 2483
602 Ga0439461_0003711 3300041410 Bacteria 2522
603 Ga0439465_0058126 3300041413 Bacteria 1277
604 Ga0451793_0851206 3300041452 Bacteria 1673
605 Ga0451800_0009767 3300041459 Bacteria 1158
606 Ga0451806_664586 3300041462 Bacteria 3963
607 Ga0451807_1001113 3300041486 Bacteria 719
608 Ga0451807_1401903 3300041486 Bacteria 3006
609 Ga0451849_0642865 3300041505 Bacteria 1011
610 Ga0439431_0012827 3300041997 Bacteria 1929
611 Ga0439445_0085994 3300042004 Bacteria 882
612 Ga0439445_0146095 3300042004 Bacteria 687
613 Ga0439448_0003560 3300042005 Bacteria 4327
614 Ga0439448_0011342 3300042005 Bacteria 2655
615 Ga0439448_0020246 3300042005 Bacteria 2056
616 Ga0439432_041325 3300042006 Bacteria 1460
617 Ga0439449_0054781 3300042007 Bacteria 1473
618 Ga0439452_029964 3300042010 Bacteria 1346
619 Ga0439454_009429 3300042011 Bacteria 1267
620 Ga0439455_0000240 3300042012 Bacteria 6577
621 Ga0439455_0000681 3300042012 Bacteria 5004
622 Ga0439457_030075 3300042014 Bacteria 1203
623 Ga0439462_0018038 3300042015 Bacteria 1831
624 Ga0439462_0056833 3300042015 Bacteria 1056
625 Ga0439462_0162858 3300042015 Bacteria 630
626 Ga0450912_003228 3300042116 Bacteria 1150
627 Ga0439446_0061242 3300042156 Bacteria 1138
628 Ga0439458_0000211 3300042157 Bacteria 13700
629 Ga0439458_0001587 3300042157 Bacteria 5676
630 Ga0450909_028799 3300042185 Bacteria 839
631 Ga0439434_0003638 3300042435 Bacteria 4509
632 Ga0466969_0004200 3300044656 Bacteria 7644
633 Ga0466966_0005297 3300044684 Bacteria 8480
634 Ga0466961_0005451 3300044693 Bacteria 8023
635 Ga0466961_0242551 3300044693 Unclassified 1107
636 Ga0466963_0005238 3300044694 Bacteria 7575
637 Ga0466963_0005868 3300044694 Bacteria 7236
638 Ga0466963_0019396 3300044694 Bacteria 4264
639 Ga0466971_0002248 3300044719 Bacteria 8170
640 Ga0466971_0239415 3300044719 Bacteria 863
641 Ga0466968_0105149 3300044735 Bacteria 1264
642 Ga0466968_0168271 3300044735 Bacteria 1014
643 Ga0466970_0020502 3300044765 Bacteria 3435
644 Ga0466970_0107151 3300044765 Bacteria 1525
645 Ga0466957_0000189 3300044842 Bacteria 28184
646 Ga0466957_0010079 3300044842 Bacteria 5408
647 Ga0466957_0021703 3300044842 Bacteria 3784
648 Ga0466957_0606276 3300044842 Bacteria 767
649 Ga0466960_0317516 3300044901 Bacteria 882
650 Ga0466959_0003340 3300045049 Bacteria 10484
651 Ga0466959_0014024 3300045049 Bacteria 5817
652 Ga0466958_0002871 3300045836 Bacteria 8778
653 Ga0466958_0016124 3300045836 Bacteria 4298
654 Ga0466958_0058702 3300045836 Bacteria 2339
655 Ga0466967_0014351 3300045976 Bacteria 6168
656 Ga0495617_010535 3300046452 Bacteria 3167
657 Ga0495627_000155 3300046453 Bacteria 79691
658 Ga0495627_009659 3300046453 Bacteria 3541
659 Ga0495638_0001486 3300046460 Bacteria 21191
660 Ga0495638_0146771 3300046460 Bacteria 1372
661 Ga0495584_0011626 3300046491 Bacteria 4508
662 Ga0495584_0045768 3300046491 Bacteria 2207
663 Ga0495584_0098998 3300046491 Bacteria 1473
664 Ga0495585_0022756 3300046492 Bacteria 3598
665 Ga0495585_0034452 3300046492 Bacteria 2862
666 Ga0495583_0002872 3300046506 Bacteria 13979
667 Ga0495583_0014784 3300046506 Bacteria 4279
668 Ga0495583_0034644 3300046506 Bacteria 2416
669 Ga0495583_0073449 3300046506 Bacteria 1499
670 Ga0495583_0130953 3300046506 Bacteria 1049
671 Ga0495583_0270157 3300046506 Bacteria 679
672 Ga0495606_0000978 3300046507 Bacteria 41691
673 Ga0495606_0113010 3300046507 Bacteria 1635
674 Ga0495606_0173200 3300046507 Bacteria 1250
675 Ga0495610_0001777 3300046512 Bacteria 18843
676 Ga0495616_0185841 3300046513 Bacteria 921
677 Ga0495616_0190350 3300046513 Bacteria 907
678 Ga0495631_0019792 3300046518 Bacteria 3153
679 Ga0495632_0000211 3300046519 Bacteria 59066
680 Ga0495632_0003768 3300046519 Bacteria 10599
681 Ga0495637_0001513 3300046520 Bacteria 13621
682 Ga0495637_0021337 3300046520 Bacteria 2972
683 Ga0495637_0049978 3300046520 Bacteria 1755
684 Ga0495637_0057349 3300046520 Bacteria 1609
685 Ga0495643_0000053 3300046522 Bacteria 202031
686 Ga0495643_0006712 3300046522 Bacteria 7536
687 Ga0495643_0017112 3300046522 Bacteria 4245
688 Ga0495643_0026420 3300046522 Bacteria 3277
689 Ga0495643_0072076 3300046522 Bacteria 1812
690 Ga0495643_0143859 3300046522 Bacteria 1186
691 Ga0495643_0164576 3300046522 Bacteria 1089
692 Ga0495648_0000102 3300046524 Bacteria 106768
693 Ga0495648_0048110 3300046524 Bacteria 2629
694 Ga0495663_0000020 3300046525 Bacteria 124560
695 Ga0495663_0080366 3300046525 Bacteria 1049
696 Ga0495621_0246173 3300046539 Bacteria 729
697 Ga0495597_0028176 3300046542 Bacteria 2572
698 Ga0495633_0000320 3300046558 Bacteria 54350
699 Ga0495633_0001111 3300046558 Bacteria 21646
700 Ga0495633_0002680 3300046558 Bacteria 12377
701 Ga0495633_0012350 3300046558 Bacteria 4547
702 Ga0495668_0000261 3300046616 Bacteria 74577
703 Ga0495668_0004403 3300046616 Bacteria 10020
704 Ga0495668_0020010 3300046616 Bacteria 3850
705 Ga0495668_0369869 3300046616 Bacteria 787
706 Ga0495611_0025833 3300046648 Bacteria 2561
707 Ga0495611_0066498 3300046648 Bacteria 1644
708 Ga0495625_0000570 3300046660 Bacteria 54000
709 Ga0495625_0023939 3300046660 Bacteria 4656
710 Ga0495625_0033676 3300046660 Bacteria 3785
711 Ga0495625_0068919 3300046660 Bacteria 2486
712 Ga0495625_0071795 3300046660 Bacteria 2429
713 Ga0495625_0240765 3300046660 Bacteria 1178
714 Ga0495625_0289504 3300046660 Bacteria 1051
715 Ga0495661_0164292 3300046665 Bacteria 1189
716 Ga0495669_0000333 3300046684 Bacteria 25095
717 Ga0495669_0025332 3300046684 Bacteria 2587
718 Ga0495670_0000009 3300046691 Bacteria 210956
719 Ga0495670_0024341 3300046691 Bacteria 2992
720 Ga0495670_0046523 3300046691 Bacteria 2167
721 Ga0495670_0048691 3300046691 Bacteria 2120
722 Ga0495670_0077744 3300046691 Bacteria 1687
723 Ga0495670_0416490 3300046691 Bacteria 726
724 Ga0495671_0000031 3300046692 Bacteria 202030
725 Ga0495671_0000065 3300046692 Bacteria 106122
726 Ga0495671_0017921 3300046692 Bacteria 3765
727 Ga0495671_0034554 3300046692 Bacteria 2570
728 Ga0495636_0066270 3300047318 Bacteria 1535
729 Ga0495687_000470 3300047443 Bacteria 48865
730 Ga0495687_001491 3300047443 Bacteria 21376
731 Ga0495687_111471 3300047443 Bacteria 1005
732 Ga0495677_0017046 3300047445 Bacteria 2633
733 Ga0495677_0030696 3300047445 Bacteria 1956
734 Ga0495673_0000174 3300047469 Bacteria 106069
735 Ga0495681_0000228 3300047470 Bacteria 46877
736 Ga0495681_0018954 3300047470 Bacteria 3774
737 Ga0495681_0065650 3300047470 Bacteria 1658
738 Ga0495686_0000185 3300047472 Bacteria 116495
739 Ga0495686_0005738 3300047472 Bacteria 9705
740 Ga0495686_0027901 3300047472 Bacteria 3680
741 Ga0495686_0046918 3300047472 Bacteria 2729
742 Ga0495686_0113510 3300047472 Bacteria 1622
743 Ga0495686_0363672 3300047472 Bacteria 784
744 Ga0496101_0541130 3300048904 Bacteria 921
745 Ga0496101_1101498 3300048904 Bacteria 623
746 Ga0496102_0000043 3300048905 Bacteria 189201
747 Ga0496102_0885688 3300048905 Bacteria 814
748 Ga0496103_0000086 3300048906 Bacteria 104765
749 Ga0496103_0266364 3300048906 Bacteria 1102
750 Ga0496105_0124495 3300048908 Bacteria 2125
751 Ga0496105_0460120 3300048908 Bacteria 1003
752 Ga0496108_0004571 3300048911 Bacteria 11149
753 Ga0496108_0058786 3300048911 Bacteria 3232
754 Ga0496109_0341499 3300048912 Bacteria 1414
755 Ga0496110_0014526 3300048913 Bacteria 6543
756 Ga0496111_0399267 3300048914 Bacteria 1016
757 Ga0496113_0110841 3300048916 Bacteria 2136
758 Ga0496114_0114758 3300048917 Bacteria 2310
759 Ga0496115_0001442 3300048918 Bacteria 17034
760 Ga0496115_0030277 3300048918 Bacteria 4257
761 Ga0496116_0004889 3300048919 Bacteria 12638
762 Ga0496116_0104998 3300048919 Bacteria 1677
763 Ga0496117_0000104 3300048920 Bacteria 189201
764 Ga0496117_0013607 3300048920 Bacteria 7086
765 Ga0496117_0015430 3300048920 Bacteria 6514
766 Ga0496117_0067040 3300048920 Bacteria 2431
767 Ga0496118_0000080 3300048921 Bacteria 189201
768 Ga0496118_0019663 3300048921 Bacteria 6027
769 Ga0496118_0030842 3300048921 Bacteria 4461
770 Ga0496118_0040230 3300048921 Bacteria 3719
771 Ga0496118_0062182 3300048921 Bacteria 2759
772 Ga0496118_0176499 3300048921 Bacteria 1297
773 Ga0496118_0242678 3300048921 Bacteria 1030
774 Ga0496119_0014145 3300048922 Bacteria 6270
775 Ga0496119_0037511 3300048922 Bacteria 3147
776 Ga0496119_0118599 3300048922 Bacteria 1458
777 Ga0496119_0126202 3300048922 Bacteria 1400
778 Ga0496119_0289068 3300048922 Bacteria 812
779 Ga0496120_0043101 3300048923 Bacteria 2631
780 Ga0496120_0078589 3300048923 Bacteria 1793
781 Ga0496120_0105520 3300048923 Bacteria 1481
782 Ga0496120_0151357 3300048923 Bacteria 1166
783 Ga0496120_0160689 3300048923 Bacteria 1120
784 Ga0496121_0000681 3300048924 Bacteria 63345
785 Ga0496121_0001025 3300048924 Bacteria 49756
786 Ga0496121_0001630 3300048924 Bacteria 37148
787 Ga0496121_0013852 3300048924 Bacteria 8626
788 Ga0496121_0035808 3300048924 Bacteria 4438
789 Ga0496121_0067090 3300048924 Bacteria 2909
790 Ga0496121_0094896 3300048924 Bacteria 2319
791 Ga0496121_0259767 3300048924 Bacteria 1200
792 Ga0496122_0000589 3300048925 Bacteria 74585
793 Ga0496122_0009235 3300048925 Bacteria 10433
794 Ga0496122_0017421 3300048925 Bacteria 6718
795 Ga0496122_0046285 3300048925 Bacteria 3371
796 Ga0496123_0001872 3300048926 Bacteria 27559
797 Ga0496123_0002066 3300048926 Bacteria 25899
798 Ga0496123_0031058 3300048926 Bacteria 3896
799 Ga0496123_0039234 3300048926 Bacteria 3315
800 Ga0496123_0064664 3300048926 Bacteria 2330
801 Ga0496123_0075283 3300048926 Bacteria 2084
802 Ga0496123_0076064 3300048926 Bacteria 2068
803 Ga0496123_0080819 3300048926 Bacteria 1978
804 Ga0496123_0218830 3300048926 Bacteria 962
805 Ga0496124_0000093 3300048927 Bacteria 189201
806 Ga0496124_0000204 3300048927 Bacteria 116976
807 Ga0496124_0002278 3300048927 Bacteria 25389
808 Ga0496124_0011745 3300048927 Bacteria 8735
809 Ga0496124_0012980 3300048927 Bacteria 8167
810 Ga0496124_0018373 3300048927 Bacteria 6549
811 Ga0496124_0056279 3300048927 Bacteria 3318
812 Ga0496124_0099235 3300048927 Bacteria 2362
813 Ga0496124_0252935 3300048927 Bacteria 1302
814 Ga0496124_0781764 3300048927 Bacteria 594
815 Ga0496125_0001206 3300048928 Bacteria 38876
816 Ga0496125_0018837 3300048928 Bacteria 6536
817 Ga0496125_0039047 3300048928 Bacteria 4096
818 Ga0496125_0043236 3300048928 Bacteria 3827
819 Ga0496125_0061621 3300048928 Bacteria 3007
820 Ga0496126_0016562 3300048929 Bacteria 7367
821 Ga0496126_0057622 3300048929 Bacteria 3506
822 Ga0496126_0184524 3300048929 Bacteria 1770
823 Ga0496126_0231779 3300048929 Bacteria 1547
824 Ga0496126_0294207 3300048929 Bacteria 1342
825 Ga0496126_0468908 3300048929 Bacteria 1011
826 Ga0495678_021780 3300049459 Bacteria 2816
827 Ga0495682_0010872 3300049460 Bacteria 3508
828 Ga0501290_003218 3300049513 Bacteria 2072
829 Ga0501290_008713 3300049513 Bacteria 1286
830 Ga0501292_000074 3300049515 Bacteria 19994
831 Ga0501294_000612 3300049517 Bacteria 4074
832 Ga0501034_0456527 3300049571 Bacteria 1195
833 Ga0501034_0694461 3300049571 Bacteria 916
834 Ga0501036_0165544 3300049572 Bacteria 1864
835 Ga0501043_0048052 3300049579 Bacteria 3355
836 Ga0501043_0057895 3300049579 Bacteria 3042
837 Ga0501046_0067509 3300049580 Bacteria 2785
838 Ga0501046_0661856 3300049580 Bacteria 738
839 Ga0501047_0028974 3300049581 Bacteria 5340
840 Ga0501047_0110681 3300049581 Bacteria 2629
841 Ga0501047_0374014 3300049581 Bacteria 1260
842 Ga0501048_0078770 3300049582 Bacteria 2326
843 Ga0501048_0546740 3300049582 Bacteria 831
844 Ga0501071_0371476 3300049587 Bacteria 1090
845 Ga0501206_000630 3300049653 Bacteria 4238
846 Ga0501211_005901 3300049658 Bacteria 1219
847 Ga0501222_001135 3300049662 Bacteria 3770
848 Ga0501223_000025 3300049663 Bacteria 58092
849 Ga0501223_008131 3300049663 Bacteria 2140
850 Ga0501224_003673 3300049664 Bacteria 2154
851 Ga0501235_003892 3300049669 Bacteria 3230
852 Ga0501235_013506 3300049669 Bacteria 1797
853 Ga0501249_000305 3300049679 Bacteria 13816
854 Ga0501257_000568 3300049686 Bacteria 7318
855 Ga0501259_001177 3300049688 Bacteria 4359
856 Ga0501261_000602 3300049690 Bacteria 4577
857 Ga0501221_005405 3300049704 Bacteria 2133
858 Ga0501225_0000036 3300049705 Bacteria 46300
859 Ga0501225_0003823 3300049705 Bacteria 4522
860 Ga0501225_0048315 3300049705 Bacteria 1182
861 Ga0501278_008090 3300049774 Bacteria 808
862 Ga0501279_000058 3300049775 Bacteria 20363
863 Ga0501280_000122 3300049776 Bacteria 20266
864 Ga0501280_003611 3300049776 Bacteria 2357
865 Ga0501281_00828 3300049777 Bacteria 2645
866 Ga0501282_000646 3300049778 Bacteria 4020
867 Ga0501283_005863 3300049779 Bacteria 1701
868 Ga0501035_0331501 3300049822 Bacteria 1277
869 Ga0501044_0196671 3300049823 Bacteria 1976
870 nmdc:mga06z11_7_c1 3300050494 Bacteria 121804
871 nmdc:mga04h51_44_c1 3300050495 Bacteria 41495
872 nmdc:mga07m45_150221_c1 3300050496 Bacteria 1351
873 nmdc:mga05p37_382339_c1 3300050507 Bacteria 1649
874 Ga0500610_0000661 3300053079 Bacteria 10628
875 Ga0500643_000089 3300053087 Bacteria 93982
876 Ga0500643_000129 3300053087 Bacteria 77787
877 Ga0500643_000641 3300053087 Bacteria 23561
878 Ga0500643_001043 3300053087 Bacteria 16808
879 Ga0500643_011332 3300053087 Bacteria 3257
880 Ga0500643_011522 3300053087 Bacteria 3223
881 Ga0500643_011530 3300053087 Bacteria 3220
882 Ga0500643_012809 3300053087 Bacteria 2990
883 Ga0500643_015322 3300053087 Bacteria 2633
884 Ga0500643_069033 3300053087 Bacteria 982
885 Ga0500643_077379 3300053087 Bacteria 917
886 Ga0500643_183888 3300053087 Bacteria 560
887 Ga0500647_0018649 3300053091 Bacteria 3216
888 Ga0500651_0083340 3300053093 Bacteria 1978
889 Ga0500566_0000691 3300053094 Bacteria 18979
890 Ga0500641_0056781 3300053096 Bacteria 1623
891 Ga0500641_0123928 3300053096 Bacteria 1114
892 Ga0500641_0217775 3300053096 Bacteria 810
893 Ga0500650_0069216 3300053098 Bacteria 1650
894 Ga0500554_102645 3300053102 Bacteria 958
895 Ga0500555_000430 3300053103 Bacteria 17416
896 Ga0500555_044473 3300053103 Bacteria 1229
897 Ga0500556_0000027 3300053104 Bacteria 165855
898 Ga0500557_061050 3300053105 Bacteria 1224
899 Ga0500592_000086 3300053116 Bacteria 21326
900 Ga0500594_0019585 3300053118 Bacteria 1679
901 Ga0500594_0026602 3300053118 Bacteria 1491
902 Ga0500595_002106 3300053119 Bacteria 10171
903 Ga0500608_058243 3300053122 Bacteria 1850
904 Ga0500608_065769 3300053122 Bacteria 1729
905 Ga0500618_007224 3300053125 Bacteria 3187
906 Ga0500626_288782 3300053128 Bacteria 587
907 Ga0500642_0000003 3300053130 Bacteria 544899
908 Ga0500652_226492 3300053131 Bacteria 750
909 Ga0500655_000122 3300053133 Bacteria 19897
910 Ga0500658_0007651 3300053134 Bacteria 3991
911 Ga0500658_0026539 3300053134 Bacteria 2232
912 Ga0500559_0005855 3300053136 Bacteria 5602
913 Ga0500559_0012017 3300053136 Bacteria 3689
914 Ga0500559_0028777 3300053136 Bacteria 2375
915 Ga0500559_0067700 3300053136 Bacteria 1603
916 Ga0500559_0070803 3300053136 Bacteria 1570
917 Ga0500559_0086269 3300053136 Bacteria 1433
918 Ga0500568_0000917 3300053139 Bacteria 20344
919 Ga0500573_0000016 3300053140 Bacteria 182675
920 Ga0500573_0270236 3300053140 Bacteria 866
921 Ga0500577_0047339 3300053142 Bacteria 1598
922 Ga0500590_004273 3300053148 Bacteria 6718
923 Ga0500604_0000023 3300053151 Bacteria 70298
924 Ga0500616_0000318 3300053153 Bacteria 69201
925 Ga0500616_0006486 3300053153 Bacteria 7656
926 Ga0500616_0014454 3300053153 Bacteria 4536
927 Ga0500616_0173260 3300053153 Bacteria 978
928 Ga0500622_0122137 3300053156 Bacteria 1262
929 Ga0500624_000001 3300053157 Bacteria 284974
930 Ga0500624_000765 3300053157 Bacteria 7702
931 Ga0500624_050028 3300053157 Bacteria 775
932 Ga0500627_0000549 3300053158 Bacteria 10114
933 Ga0500639_068732 3300053163 Bacteria 1809
934 Ga0500636_0015291 3300053177 Bacteria 4521
935 Ga0500636_0056736 3300053177 Bacteria 2293
936 Ga0500637_0000248 3300053178 Bacteria 20072
937 Ga0500570_003257 3300053724 Bacteria 8295
938 Ga0500645_000062 3300053730 Bacteria 85561
939 Ga0500645_000424 3300053730 Bacteria 29265
940 Ga0500645_002084 3300053730 Bacteria 9261
941 Ga0466962_0004503 3300061719 Bacteria 6681
942 Ga0466962_0015483 3300061719 Bacteria 3678
943 Ga0466962_0017955 3300061719 Bacteria 3404
944 Ga0466962_0093754 3300061719 Bacteria 1439

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049679 Ga0501249_000305 Ga0501249_000305_6313_6849 153
2 3300005262 Ga0065165_1075133 Ga0065165_10751332 157
3 3300031548 Ga0307408_100046157 Ga0307408_1000461573 158
4 3300031731 Ga0307405_10223445 Ga0307405_102234452 158
5 3300031824 Ga0307413_10057100 Ga0307413_100571003 158
6 3300031852 Ga0307410_10129803 Ga0307410_101298032 158
7 3300031901 Ga0307406_10004070 Ga0307406_100040706 158
8 3300031903 Ga0307407_10093093 Ga0307407_100930932 158
9 3300031911 Ga0307412_10006836 Ga0307412_100068368 158
10 3300032002 Ga0307416_100005856 Ga0307416_1000058563 158
11 3300032005 Ga0307411_10074692 Ga0307411_100746923 158
12 3300032126 Ga0307415_100031013 Ga0307415_1000310133 158
13 3300025986 Ga0207658_10849857 Ga0207658_108498572 159
14 3300046616 Ga0495668_0004403 Ga0495668_0004403_5974_6462 159
15 3300032004 Ga0307414_10000911 Ga0307414_1000091112 160
16 3300046522 Ga0495643_0026420 Ga0495643_0026420_926_1411 161
17 iso_pu_bacteria 2643221588 2643949314 161
18 3300005842 Ga0068858_100045893 Ga0068858_1000458934 162
19 3300006353 Ga0075370_10033771 Ga0075370_100337713 162
20 3300009177 Ga0105248_10557854 Ga0105248_105578541 162
21 3300014968 Ga0157379_10687645 Ga0157379_106876452 162
22 3300026035 Ga0207703_10026618 Ga0207703_100266184 162
23 3300048906 Ga0496103_0266364 Ga0496103_0266364_429_941 162
24 3300048919 Ga0496116_0104998 Ga0496116_0104998_275_787 162
25 3300048920 Ga0496117_0015430 Ga0496117_0015430_2854_3366 162
26 3300048921 Ga0496118_0019663 Ga0496118_0019663_5020_5532 162
27 3300048922 Ga0496119_0289068 Ga0496119_0289068_216_728 162
28 3300048923 Ga0496120_0151357 Ga0496120_0151357_459_971 162
29 3300048927 Ga0496124_0012980 Ga0496124_0012980_6336_6848 162
30 3300049823 Ga0501044_0196671 Ga0501044_0196671_1310_1804 162
31 3300005547 Ga0070693_100215646 Ga0070693_1002156462 163
32 3300014326 Ga0157380_10451141 Ga0157380_104511412 163
33 3300026067 Ga0207678_10082780 Ga0207678_100827803 163
34 3300031548 Ga0307408_100375426 Ga0307408_1003754262 163
35 3300031824 Ga0307413_10219146 Ga0307413_102191462 163
36 3300031824 Ga0307413_10239950 Ga0307413_102399502 163
37 3300031824 Ga0307413_10333499 Ga0307413_103334991 163
38 3300031995 Ga0307409_101495577 Ga0307409_1014955771 163
39 3300032004 Ga0307414_10040341 Ga0307414_100403414 163
40 3300032004 Ga0307414_10136036 Ga0307414_101360363 163
41 3300032004 Ga0307414_10291899 Ga0307414_102918992 163
42 3300032005 Ga0307411_10098250 Ga0307411_100982502 163
43 3300032126 Ga0307415_100093990 Ga0307415_1000939903 163
44 3300042116 Ga0450912_003228 Ga0450912_003228_439_936 163
45 3300053118 Ga0500594_0019585 Ga0500594_0019585_18_524 163
46 3300025945 Ga0207679_11159432 Ga0207679_111594322 164
47 3300032002 Ga0307416_101591817 Ga0307416_1015918171 164
48 3300003323 rootH1_10098301 rootH1_100983014 165
49 3300005262 Ga0065165_1004738 Ga0065165_10047385 165
50 3300005336 Ga0070680_100630651 Ga0070680_1006306512 165
51 3300005344 Ga0070661_100093676 Ga0070661_1000936762 165
52 3300005353 Ga0070669_100304443 Ga0070669_1003044432 165
53 3300005354 Ga0070675_101016432 Ga0070675_1010164322 165
54 3300005364 Ga0070673_100320001 Ga0070673_1003200012 165
55 3300005455 Ga0070663_100304553 Ga0070663_1003045532 165
56 3300005530 Ga0070679_100349033 Ga0070679_1003490333 165
57 3300005563 Ga0068855_100068705 Ga0068855_1000687053 165
58 3300005578 Ga0068854_100176021 Ga0068854_1001760213 165
59 3300005614 Ga0068856_100004201 Ga0068856_10000420113 165
60 3300005616 Ga0068852_100005250 Ga0068852_1000052509 165
61 3300013102 Ga0157371_10002068 Ga0157371_100020687 165
62 3300013104 Ga0157370_10396287 Ga0157370_103962872 165
63 3300013104 Ga0157370_10445842 Ga0157370_104458422 165
64 3300013105 Ga0157369_10000298 Ga0157369_1000029824 165
65 3300013105 Ga0157369_10004587 Ga0157369_1000458713 165
66 3300013307 Ga0157372_10650829 Ga0157372_106508291 165
67 3300014326 Ga0157380_10927867 Ga0157380_109278672 165
68 3300025893 Ga0207682_10197228 Ga0207682_101972281 165
69 3300025909 Ga0207705_10213995 Ga0207705_102139952 165
70 3300025920 Ga0207649_10785267 Ga0207649_107852672 165
71 3300025921 Ga0207652_10360977 Ga0207652_103609773 165
72 3300025923 Ga0207681_10249423 Ga0207681_102494232 165
73 3300025936 Ga0207670_10180514 Ga0207670_101805142 165
74 3300025949 Ga0207667_10020841 Ga0207667_100208412 165
75 3300025960 Ga0207651_10283621 Ga0207651_102836212 165
76 3300026067 Ga0207678_10263424 Ga0207678_102634242 165
77 3300026078 Ga0207702_10015330 Ga0207702_100153304 165
78 3300026078 Ga0207702_10015475 Ga0207702_100154755 165
79 3300031731 Ga0307405_10023181 Ga0307405_100231813 165
80 3300031824 Ga0307413_10032195 Ga0307413_100321953 165
81 3300031852 Ga0307410_10622484 Ga0307410_106224842 165
82 3300031901 Ga0307406_10029680 Ga0307406_100296804 165
83 3300031903 Ga0307407_10125243 Ga0307407_101252431 165
84 3300031995 Ga0307409_100193090 Ga0307409_1001930902 165
85 3300032004 Ga0307414_10014817 Ga0307414_100148172 165
86 3300032004 Ga0307414_11053423 Ga0307414_110534232 165
87 3300032004 Ga0307414_11168622 Ga0307414_111686222 165
88 3300032005 Ga0307411_10014349 Ga0307411_100143495 165
89 3300032126 Ga0307415_100206421 Ga0307415_1002064212 165
90 3300037312 Ga0395899_0012107 Ga0395899_0012107_5500_6003 165
91 3300037418 Ga0395900_0009928 Ga0395900_0009928_4334_4837 165
92 3300037418 Ga0395900_0204307 Ga0395900_0204307_1053_1556 165
93 3300037466 Ga0395898_0082714 Ga0395898_0082714_68_571 165
94 3300037466 Ga0395898_0146412 Ga0395898_0146412_169_672 165
95 3300037471 Ga0395905_0119946 Ga0395905_0119946_451_957 165
96 3300037471 Ga0395905_1210529 Ga0395905_1210529_10_516 165
97 3300041486 Ga0451807_1001113 Ga0451807_1001113_107_619 165
98 3300042004 Ga0439445_0146095 Ga0439445_0146095_40_543 165
99 3300042007 Ga0439449_0054781 Ga0439449_0054781_791_1294 165
100 3300042015 Ga0439462_0056833 Ga0439462_0056833_478_990 165
101 3300042015 Ga0439462_0162858 Ga0439462_0162858_16_519 165
102 3300044656 Ga0466969_0004200 Ga0466969_0004200_2733_3236 165
103 3300044684 Ga0466966_0005297 Ga0466966_0005297_2054_2557 165
104 3300044693 Ga0466961_0005451 Ga0466961_0005451_2183_2686 165
105 3300044693 Ga0466961_0242551 Ga0466961_0242551_416_919 165
106 3300044694 Ga0466963_0005868 Ga0466963_0005868_4956_5459 165
107 3300044694 Ga0466963_0019396 Ga0466963_0019396_1712_2215 165
108 3300044719 Ga0466971_0002248 Ga0466971_0002248_5080_5583 165
109 3300044719 Ga0466971_0239415 Ga0466971_0239415_157_660 165
110 3300044765 Ga0466970_0020502 Ga0466970_0020502_1750_2253 165
111 3300044765 Ga0466970_0107151 Ga0466970_0107151_906_1409 165
112 3300044842 Ga0466957_0000189 Ga0466957_0000189_3843_4346 165
113 3300044901 Ga0466960_0317516 Ga0466960_0317516_37_540 165
114 3300045049 Ga0466959_0003340 Ga0466959_0003340_6798_7301 165
115 3300045049 Ga0466959_0014024 Ga0466959_0014024_3578_4081 165
116 3300045836 Ga0466958_0016124 Ga0466958_0016124_1869_2372 165
117 3300045836 Ga0466958_0058702 Ga0466958_0058702_69_572 165
118 3300046539 Ga0495621_0246173 Ga0495621_0246173_212_715 165
119 3300048911 Ga0496108_0058786 Ga0496108_0058786_1878_2381 165
120 3300048917 Ga0496114_0114758 Ga0496114_0114758_574_1077 165
121 3300048918 Ga0496115_0001442 Ga0496115_0001442_3570_4073 165
122 3300049582 Ga0501048_0546740 Ga0501048_0546740_119_634 165
123 3300061719 Ga0466962_0004503 Ga0466962_0004503_1293_1796 165
124 3300061719 Ga0466962_0093754 Ga0466962_0093754_253_756 165
125 3300003762 Ga0055542_1004873 Ga0055542_10048733 166
126 3300005327 Ga0070658_10001506 Ga0070658_100015067 166
127 3300005339 Ga0070660_100000401 Ga0070660_10000040114 166
128 3300005539 Ga0068853_100145477 Ga0068853_1001454773 166
129 3300005563 Ga0068855_100001528 Ga0068855_10000152813 166
130 3300005563 Ga0068855_100078020 Ga0068855_1000780202 166
131 3300005577 Ga0068857_100062712 Ga0068857_1000627122 166
132 3300005616 Ga0068852_100764919 Ga0068852_1007649192 166
133 3300009545 Ga0105237_10184363 Ga0105237_101843633 166
134 3300010375 Ga0105239_10392896 Ga0105239_103928962 166
135 3300010375 Ga0105239_10643966 Ga0105239_106439662 166
136 3300013306 Ga0163162_10290159 Ga0163162_102901592 166
137 3300025254 Ga0209148_1000338 Ga0209148_10003386 166
138 3300025909 Ga0207705_10000027 Ga0207705_10000027110 166
139 3300025914 Ga0207671_10192273 Ga0207671_101922733 166
140 3300025919 Ga0207657_10001109 Ga0207657_1000110918 166
141 3300025949 Ga0207667_10000109 Ga0207667_1000010918 166
142 3300025949 Ga0207667_10053655 Ga0207667_100536555 166
143 3300026041 Ga0207639_10358941 Ga0207639_103589413 166
144 3300031548 Ga0307408_100753864 Ga0307408_1007538642 166
145 3300032004 Ga0307414_10381536 Ga0307414_103815362 166
146 3300053087 Ga0500643_015322 Ga0500643_015322_431_940 166
147 3300053122 Ga0500608_058243 Ga0500608_058243_337_846 166
148 3300053153 Ga0500616_0014454 Ga0500616_0014454_2579_3088 166
149 3300005617 Ga0068859_100955834 Ga0068859_1009558342 167
150 3300046522 Ga0495643_0164576 Ga0495643_0164576_298_813 167
151 3300053153 Ga0500616_0173260 Ga0500616_0173260_403_918 167
152 iso_pu_bacteria 2751185897 2753763779 167
153 iso_pu_bacteria 2885429604 2885429621 167
154 3300005262 Ga0065165_1003585 Ga0065165_10035859 168
155 3300028380 Ga0268265_10778555 Ga0268265_107785552 168
156 3300046691 Ga0495670_0046523 Ga0495670_0046523_670_1200 168
157 3300049571 Ga0501034_0694461 Ga0501034_0694461_226_744 168
158 3300053136 Ga0500559_0028777 Ga0500559_0028777_1236_1748 168
159 3300053140 Ga0500573_0000016 Ga0500573_0000016_73394_73918 168
160 3300053140 Ga0500573_0270236 Ga0500573_0270236_114_626 168
161 iso_pu_bacteria 2775507255 2778123970 168
162 iso_pu_bacteria 2808606405 2809082168 168
163 iso_pu_bacteria 2880518877 2880519655 168
164 iso_pu_bacteria 2919709256 2919709901 168
165 iso_pu_bacteria 2990265787 2990266587 168
166 iso_pu_bacteria 2993693658 2993695614 168
167 3300000043 ARcpr5yngRDRAFT_c001224 ARcpr5yngRDRAFT_0012242 169
168 3300000652 ARCol0yngRDRAFT_1002626 ARCol0yngRDRAFT_10026263 169
169 3300001904 JGI24736J21556_1005436 JGI24736J21556_10054362 169
170 3300001989 JGI24739J22299_10001086 JGI24739J22299_100010862 169
171 3300001989 JGI24739J22299_10008251 JGI24739J22299_100082513 169
172 3300001989 JGI24739J22299_10008868 JGI24739J22299_100088685 169
173 3300001990 JGI24737J22298_10008114 JGI24737J22298_100081142 169
174 3300001990 JGI24737J22298_10008735 JGI24737J22298_100087353 169
175 3300001990 JGI24737J22298_10018638 JGI24737J22298_100186384 169
176 3300001990 JGI24737J22298_10059028 JGI24737J22298_100590282 169
177 3300002067 JGI24735J21928_10000815 JGI24735J21928_100008156 169
178 3300002067 JGI24735J21928_10013121 JGI24735J21928_100131213 169
179 3300002067 JGI24735J21928_10025174 JGI24735J21928_100251742 169
180 3300002067 JGI24735J21928_10031019 JGI24735J21928_100310193 169
181 3300002067 JGI24735J21928_10046323 JGI24735J21928_100463231 169
182 3300002075 JGI24738J21930_10001110 JGI24738J21930_100011109 169
183 3300003214 JGI25165J46597_1000032 JGI25165J46597_1000032104 169
184 3300003215 JGI25153J46596_10011927 JGI25153J46596_100119274 169
185 3300003316 rootH1_10122630 rootH1_101226302 169
186 3300003322 rootL2_10010215 rootL2_100102152 169
187 3300003322 rootL2_10033985 rootL2_100339854 169
188 3300003773 Ga0055537_1000874 Ga0055537_10008744 169
189 3300003775 Ga0055524_1000088 Ga0055524_100008837 169
190 3300003790 Ga0055528_1038469 Ga0055528_10384692 169
191 3300003794 Ga0055531_10000016 Ga0055531_1000001672 169
192 3300003794 Ga0055531_10008252 Ga0055531_100082528 169
193 3300004625 Ga0055543_1037273 Ga0055543_10372732 169
194 3300005262 Ga0065165_1013352 Ga0065165_10133522 169
195 3300005327 Ga0070658_10000082 Ga0070658_1000008291 169
196 3300005327 Ga0070658_10117346 Ga0070658_101173463 169
197 3300005327 Ga0070658_10320973 Ga0070658_103209732 169
198 3300005327 Ga0070658_10401678 Ga0070658_104016782 169
199 3300005335 Ga0070666_10024022 Ga0070666_100240223 169
200 3300005336 Ga0070680_100205486 Ga0070680_1002054863 169
201 3300005337 Ga0070682_100818374 Ga0070682_1008183742 169
202 3300005339 Ga0070660_100097373 Ga0070660_1000973733 169
203 3300005339 Ga0070660_100126231 Ga0070660_1001262313 169
204 3300005339 Ga0070660_100380542 Ga0070660_1003805422 169
205 3300005344 Ga0070661_100282428 Ga0070661_1002824282 169
206 3300005354 Ga0070675_100836220 Ga0070675_1008362202 169
207 3300005355 Ga0070671_100015156 Ga0070671_1000151564 169
208 3300005356 Ga0070674_100066686 Ga0070674_1000666863 169
209 3300005366 Ga0070659_100349090 Ga0070659_1003490902 169
210 3300005366 Ga0070659_100671783 Ga0070659_1006717832 169
211 3300005455 Ga0070663_100285767 Ga0070663_1002857672 169
212 3300005457 Ga0070662_100252622 Ga0070662_1002526223 169
213 3300005457 Ga0070662_100392669 Ga0070662_1003926692 169
214 3300005530 Ga0070679_100372060 Ga0070679_1003720602 169
215 3300005539 Ga0068853_100001346 Ga0068853_1000013463 169
216 3300005539 Ga0068853_100166348 Ga0068853_1001663482 169
217 3300005539 Ga0068853_100741180 Ga0068853_1007411802 169
218 3300005563 Ga0068855_100000416 Ga0068855_10000041619 169
219 3300005563 Ga0068855_100345800 Ga0068855_1003458003 169
220 3300005614 Ga0068856_100863271 Ga0068856_1008632712 169
221 3300005616 Ga0068852_100318295 Ga0068852_1003182953 169
222 3300005617 Ga0068859_101742347 Ga0068859_1017423472 169
223 3300005618 Ga0068864_100284186 Ga0068864_1002841862 169
224 3300005719 Ga0068861_100000086 Ga0068861_1000000869 169
225 3300005719 Ga0068861_101002577 Ga0068861_1010025772 169
226 3300005834 Ga0068851_10017503 Ga0068851_100175035 169
227 3300005842 Ga0068858_100002719 Ga0068858_1000027195 169
228 3300006881 Ga0068865_100572666 Ga0068865_1005726661 169
229 3300006931 Ga0097620_100007340 Ga0097620_10000734010 169
230 3300006931 Ga0097620_101741797 Ga0097620_1017417972 169
231 3300006946 Ga0079104_1030896 Ga0079104_10308962 169
232 3300009093 Ga0105240_10188479 Ga0105240_101884793 169
233 3300009545 Ga0105237_10047102 Ga0105237_100471025 169
234 3300009545 Ga0105237_10299721 Ga0105237_102997213 169
235 3300009551 Ga0105238_10191499 Ga0105238_101914993 169
236 3300013100 Ga0157373_10396210 Ga0157373_103962101 169
237 3300013100 Ga0157373_10513996 Ga0157373_105139962 169
238 3300013100 Ga0157373_10787447 Ga0157373_107874471 169
239 3300013104 Ga0157370_10595387 Ga0157370_105953872 169
240 3300013105 Ga0157369_10593630 Ga0157369_105936302 169
241 3300013105 Ga0157369_10818286 Ga0157369_108182862 169
242 3300013306 Ga0163162_10994567 Ga0163162_109945672 169
243 3300013307 Ga0157372_10054162 Ga0157372_100541623 169
244 3300013307 Ga0157372_10066845 Ga0157372_100668453 169
245 3300013307 Ga0157372_10067875 Ga0157372_100678753 169
246 3300013307 Ga0157372_10088444 Ga0157372_100884443 169
247 3300013308 Ga0157375_12108032 Ga0157375_121080321 169
248 3300025245 Ga0207425_1005446 Ga0207425_10054462 169
249 3300025254 Ga0209148_1001156 Ga0209148_10011564 169
250 3300025261 Ga0209233_1000066 Ga0209233_1000066106 169
251 3300025263 Ga0209565_1000010 Ga0209565_1000010415 169
252 3300025272 Ga0209455_1001029 Ga0209455_10010295 169
253 3300025273 Ga0209673_1002611 Ga0209673_10026115 169
254 3300025297 Ga0209758_1002673 Ga0209758_10026733 169
255 3300025298 Ga0209050_1000026 Ga0209050_1000026384 169
256 3300025298 Ga0209050_1002186 Ga0209050_100218614 169
257 3300025299 Ga0209256_1000034 Ga0209256_1000034271 169
258 3300025304 Ga0209257_1000009 Ga0209257_1000009384 169
259 3300025304 Ga0209257_1005333 Ga0209257_10053332 169
260 3300025304 Ga0209257_1016095 Ga0209257_10160954 169
261 3300025321 Ga0207656_10069700 Ga0207656_100697002 169
262 3300025903 Ga0207680_10128707 Ga0207680_101287072 169
263 3300025904 Ga0207647_10001182 Ga0207647_1000118217 169
264 3300025904 Ga0207647_10008705 Ga0207647_100087057 169
265 3300025909 Ga0207705_10000915 Ga0207705_1000091515 169
266 3300025909 Ga0207705_10004780 Ga0207705_100047808 169
267 3300025909 Ga0207705_10253338 Ga0207705_102533382 169
268 3300025909 Ga0207705_10311488 Ga0207705_103114882 169
269 3300025911 Ga0207654_10173917 Ga0207654_101739173 169
270 3300025914 Ga0207671_10061563 Ga0207671_100615632 169
271 3300025914 Ga0207671_10118564 Ga0207671_101185643 169
272 3300025919 Ga0207657_10002470 Ga0207657_1000247011 169
273 3300025919 Ga0207657_10138328 Ga0207657_101383282 169
274 3300025919 Ga0207657_10168890 Ga0207657_101688902 169
275 3300025919 Ga0207657_10301401 Ga0207657_103014012 169
276 3300025920 Ga0207649_10219986 Ga0207649_102199862 169
277 3300025921 Ga0207652_10455777 Ga0207652_104557772 169
278 3300025924 Ga0207694_10167615 Ga0207694_101676152 169
279 3300025931 Ga0207644_10004648 Ga0207644_100046488 169
280 3300025932 Ga0207690_10284841 Ga0207690_102848412 169
281 3300025933 Ga0207706_10003238 Ga0207706_100032389 169
282 3300025933 Ga0207706_10005292 Ga0207706_1000529211 169
283 3300025933 Ga0207706_10393734 Ga0207706_103937342 169
284 3300025935 Ga0207709_10686197 Ga0207709_106861972 169
285 3300025937 Ga0207669_10013513 Ga0207669_100135133 169
286 3300025941 Ga0207711_10414159 Ga0207711_104141592 169
287 3300025949 Ga0207667_10000504 Ga0207667_1000050425 169
288 3300025949 Ga0207667_10264118 Ga0207667_102641183 169
289 3300025949 Ga0207667_10288460 Ga0207667_102884603 169
290 3300026035 Ga0207703_10000677 Ga0207703_1000067720 169
291 3300026041 Ga0207639_10009698 Ga0207639_100096983 169
292 3300026041 Ga0207639_10151591 Ga0207639_101515912 169
293 3300026041 Ga0207639_10589094 Ga0207639_105890942 169
294 3300026089 Ga0207648_11391861 Ga0207648_113918611 169
295 3300026095 Ga0207676_10332862 Ga0207676_103328621 169
296 3300026116 Ga0207674_10002143 Ga0207674_100021435 169
297 3300026116 Ga0207674_10176789 Ga0207674_101767892 169
298 3300026118 Ga0207675_100006217 Ga0207675_1000062178 169
299 3300026142 Ga0207698_10321175 Ga0207698_103211752 169
300 3300026142 Ga0207698_10389568 Ga0207698_103895682 169
301 3300026142 Ga0207698_10438462 Ga0207698_104384622 169
302 3300027111 Ga0209281_1022262 Ga0209281_10222622 169
303 3300030745 Ga0316182_1105435 Ga0316182_11054352 169
304 3300031456 Ga0307513_10190564 Ga0307513_101905643 169
305 3300031507 Ga0307509_10226867 Ga0307509_102268672 169
306 3300031616 Ga0307508_10000638 Ga0307508_1000063817 169
307 3300031824 Ga0307413_10493321 Ga0307413_104933212 169
308 3300031852 Ga0307410_10241964 Ga0307410_102419643 169
309 3300032005 Ga0307411_10461558 Ga0307411_104615582 169
310 3300037418 Ga0395900_0137923 Ga0395900_0137923_704_1222 169
311 3300038443 Ga0395901_0091016 Ga0395901_0091016_1479_1997 169
312 3300041404 Ga0439436_0013362 Ga0439436_0013362_730_1266 169
313 3300041410 Ga0439461_0003711 Ga0439461_0003711_1272_1808 169
314 3300041413 Ga0439465_0058126 Ga0439465_0058126_367_903 169
315 3300041452 Ga0451793_0851206 Ga0451793_0851206_588_1109 169
316 3300041459 Ga0451800_0009767 Ga0451800_0009767_320_841 169
317 3300041462 Ga0451806_664586 Ga0451806_664586_2673_3194 169
318 3300041486 Ga0451807_1401903 Ga0451807_1401903_1180_1701 169
319 3300041505 Ga0451849_0642865 Ga0451849_0642865_103_624 169
320 3300041997 Ga0439431_0012827 Ga0439431_0012827_778_1314 169
321 3300042005 Ga0439448_0003560 Ga0439448_0003560_1049_1570 169
322 3300042005 Ga0439448_0011342 Ga0439448_0011342_993_1514 169
323 3300042005 Ga0439448_0020246 Ga0439448_0020246_606_1127 169
324 3300042006 Ga0439432_041325 Ga0439432_041325_388_924 169
325 3300042010 Ga0439452_029964 Ga0439452_029964_454_990 169
326 3300042011 Ga0439454_009429 Ga0439454_009429_177_698 169
327 3300042012 Ga0439455_0000240 Ga0439455_0000240_3093_3614 169
328 3300042012 Ga0439455_0000681 Ga0439455_0000681_3818_4339 169
329 3300042014 Ga0439457_030075 Ga0439457_030075_454_990 169
330 3300042015 Ga0439462_0018038 Ga0439462_0018038_738_1274 169
331 3300042156 Ga0439446_0061242 Ga0439446_0061242_436_972 169
332 3300042157 Ga0439458_0000211 Ga0439458_0000211_3261_3782 169
333 3300042157 Ga0439458_0001587 Ga0439458_0001587_373_894 169
334 3300042185 Ga0450909_028799 Ga0450909_028799_131_667 169
335 3300042435 Ga0439434_0003638 Ga0439434_0003638_2732_3268 169
336 3300044694 Ga0466963_0005238 Ga0466963_0005238_2556_3077 169
337 3300044735 Ga0466968_0105149 Ga0466968_0105149_116_631 169
338 3300044842 Ga0466957_0010079 Ga0466957_0010079_3154_3675 169
339 3300044842 Ga0466957_0021703 Ga0466957_0021703_3207_3728 169
340 3300044842 Ga0466957_0606276 Ga0466957_0606276_62_583 169
341 3300045836 Ga0466958_0002871 Ga0466958_0002871_3006_3527 169
342 3300045976 Ga0466967_0014351 Ga0466967_0014351_4997_5518 169
343 3300046453 Ga0495627_009659 Ga0495627_009659_2849_3385 169
344 3300046460 Ga0495638_0001486 Ga0495638_0001486_906_1427 169
345 3300046492 Ga0495585_0022756 Ga0495585_0022756_1419_1946 169
346 3300046525 Ga0495663_0080366 Ga0495663_0080366_203_724 169
347 3300046660 Ga0495625_0068919 Ga0495625_0068919_1549_2067 169
348 3300046691 Ga0495670_0000009 Ga0495670_0000009_54376_54915 169
349 3300047443 Ga0495687_111471 Ga0495687_111471_260_781 169
350 3300047470 Ga0495681_0065650 Ga0495681_0065650_775_1311 169
351 3300047472 Ga0495686_0363672 Ga0495686_0363672_140_679 169
352 3300048904 Ga0496101_1101498 Ga0496101_1101498_32_568 169
353 3300048905 Ga0496102_0000043 Ga0496102_0000043_23972_24490 169
354 3300048906 Ga0496103_0000086 Ga0496103_0000086_86083_86601 169
355 3300048908 Ga0496105_0124495 Ga0496105_0124495_321_839 169
356 3300048919 Ga0496116_0004889 Ga0496116_0004889_5400_5918 169
357 3300048920 Ga0496117_0000104 Ga0496117_0000104_23972_24490 169
358 3300048920 Ga0496117_0013607 Ga0496117_0013607_2312_2833 169
359 3300048921 Ga0496118_0000080 Ga0496118_0000080_164712_165230 169
360 3300048921 Ga0496118_0030842 Ga0496118_0030842_3846_4364 169
361 3300048921 Ga0496118_0040230 Ga0496118_0040230_737_1258 169
362 3300048922 Ga0496119_0014145 Ga0496119_0014145_3092_3613 169
363 3300048922 Ga0496119_0037511 Ga0496119_0037511_1918_2436 169
364 3300048923 Ga0496120_0043101 Ga0496120_0043101_1106_1627 169
365 3300048923 Ga0496120_0078589 Ga0496120_0078589_434_955 169
366 3300048923 Ga0496120_0105520 Ga0496120_0105520_897_1424 169
367 3300048924 Ga0496121_0013852 Ga0496121_0013852_6330_6851 169
368 3300048924 Ga0496121_0035808 Ga0496121_0035808_775_1296 169
369 3300048925 Ga0496122_0017421 Ga0496122_0017421_3454_3975 169
370 3300048926 Ga0496123_0002066 Ga0496123_0002066_13688_14230 169
371 3300048926 Ga0496123_0039234 Ga0496123_0039234_668_1189 169
372 3300048926 Ga0496123_0075283 Ga0496123_0075283_783_1319 169
373 3300048926 Ga0496123_0076064 Ga0496123_0076064_63_599 169
374 3300048926 Ga0496123_0080819 Ga0496123_0080819_1422_1958 169
375 3300048927 Ga0496124_0000093 Ga0496124_0000093_164712_165230 169
376 3300048927 Ga0496124_0000204 Ga0496124_0000204_62829_63356 169
377 3300048927 Ga0496124_0002278 Ga0496124_0002278_17605_18141 169
378 3300048927 Ga0496124_0018373 Ga0496124_0018373_4974_5516 169
379 3300048927 Ga0496124_0056279 Ga0496124_0056279_1705_2241 169
380 3300048927 Ga0496124_0099235 Ga0496124_0099235_1214_1735 169
381 3300048927 Ga0496124_0252935 Ga0496124_0252935_343_864 169
382 3300048927 Ga0496124_0781764 Ga0496124_0781764_55_576 169
383 3300048929 Ga0496126_0468908 Ga0496126_0468908_422_952 169
384 3300049513 Ga0501290_003218 Ga0501290_003218_1319_1837 169
385 3300049515 Ga0501292_000074 Ga0501292_000074_16752_17270 169
386 3300049517 Ga0501294_000612 Ga0501294_000612_2846_3364 169
387 3300049580 Ga0501046_0661856 Ga0501046_0661856_30_545 169
388 3300049581 Ga0501047_0110681 Ga0501047_0110681_693_1208 169
389 3300049587 Ga0501071_0371476 Ga0501071_0371476_315_842 169
390 3300049653 Ga0501206_000630 Ga0501206_000630_2760_3278 169
391 3300049662 Ga0501222_001135 Ga0501222_001135_2288_2806 169
392 3300049663 Ga0501223_008131 Ga0501223_008131_286_804 169
393 3300049664 Ga0501224_003673 Ga0501224_003673_662_1180 169
394 3300049669 Ga0501235_013506 Ga0501235_013506_796_1314 169
395 3300049688 Ga0501259_001177 Ga0501259_001177_1158_1676 169
396 3300049690 Ga0501261_000602 Ga0501261_000602_1351_1869 169
397 3300049704 Ga0501221_005405 Ga0501221_005405_829_1347 169
398 3300049775 Ga0501279_000058 Ga0501279_000058_2841_3359 169
399 3300049776 Ga0501280_000122 Ga0501280_000122_2840_3358 169
400 3300049777 Ga0501281_00828 Ga0501281_00828_1355_1873 169
401 3300049778 Ga0501282_000646 Ga0501282_000646_1891_2409 169
402 3300049779 Ga0501283_005863 Ga0501283_005863_794_1312 169
403 3300049822 Ga0501035_0331501 Ga0501035_0331501_381_902 169
404 3300053087 Ga0500643_011332 Ga0500643_011332_1673_2209 169
405 3300053087 Ga0500643_069033 Ga0500643_069033_97_636 169
406 3300053094 Ga0500566_0000691 Ga0500566_0000691_183_722 169
407 3300053096 Ga0500641_0056781 Ga0500641_0056781_695_1216 169
408 3300053103 Ga0500555_044473 Ga0500555_044473_450_986 169
409 3300053128 Ga0500626_288782 Ga0500626_288782_10_549 169
410 3300053131 Ga0500652_226492 Ga0500652_226492_114_653 169
411 3300053134 Ga0500658_0007651 Ga0500658_0007651_2802_3323 169
412 3300053134 Ga0500658_0026539 Ga0500658_0026539_342_878 169
413 3300053136 Ga0500559_0086269 Ga0500559_0086269_891_1418 169
414 3300053157 Ga0500624_000765 Ga0500624_000765_2836_3375 169
415 3300053157 Ga0500624_050028 Ga0500624_050028_24_551 169
416 3300053177 Ga0500636_0015291 Ga0500636_0015291_3603_4142 169
417 3300061719 Ga0466962_0015483 Ga0466962_0015483_1954_2475 169
418 3300061719 Ga0466962_0017955 Ga0466962_0017955_2243_2764 169
419 3300001976 JGI24752J21851_1006306 JGI24752J21851_10063063 170
420 3300002459 JGI24751J29686_10020488 JGI24751J29686_100204882 170
421 3300005331 Ga0070670_100004838 Ga0070670_10000483811 170
422 3300005335 Ga0070666_10000092 Ga0070666_1000009252 170
423 3300005347 Ga0070668_100046239 Ga0070668_1000462394 170
424 3300005353 Ga0070669_100000018 Ga0070669_10000001893 170
425 3300005355 Ga0070671_100000011 Ga0070671_100000011104 170
426 3300005367 Ga0070667_100070948 Ga0070667_1000709484 170
427 3300005440 Ga0070705_100006873 Ga0070705_1000068735 170
428 3300005445 Ga0070708_100460602 Ga0070708_1004606022 170
429 3300005544 Ga0070686_100600100 Ga0070686_1006001001 170
430 3300005548 Ga0070665_100030492 Ga0070665_1000304923 170
431 3300005617 Ga0068859_100000805 Ga0068859_10000080520 170
432 3300005617 Ga0068859_100766840 Ga0068859_1007668401 170
433 3300005618 Ga0068864_100000403 Ga0068864_10000040315 170
434 3300005618 Ga0068864_100002670 Ga0068864_1000026709 170
435 3300005719 Ga0068861_100045012 Ga0068861_1000450122 170
436 3300005842 Ga0068858_100001988 Ga0068858_1000019889 170
437 3300005842 Ga0068858_100006359 Ga0068858_1000063595 170
438 3300005843 Ga0068860_100050733 Ga0068860_1000507332 170
439 3300006931 Ga0097620_100000805 Ga0097620_10000080520 170
440 3300006931 Ga0097620_100766891 Ga0097620_1007668911 170
441 3300009011 Ga0105251_10053937 Ga0105251_100539373 170
442 3300009101 Ga0105247_10004644 Ga0105247_100046443 170
443 3300009147 Ga0114129_10314289 Ga0114129_103142892 170
444 3300009177 Ga0105248_10043510 Ga0105248_100435102 170
445 3300009177 Ga0105248_10150901 Ga0105248_101509012 170
446 3300009545 Ga0105237_10228526 Ga0105237_102285262 170
447 3300009553 Ga0105249_10000748 Ga0105249_1000074819 170
448 3300009978 Ga0105148_100050 Ga0105148_1000509 170
449 3300013306 Ga0163162_10004388 Ga0163162_100043885 170
450 3300013306 Ga0163162_10166387 Ga0163162_101663873 170
451 3300013307 Ga0157372_10286770 Ga0157372_102867702 170
452 3300014325 Ga0163163_10011243 Ga0163163_100112435 170
453 3300014326 Ga0157380_10047718 Ga0157380_100477182 170
454 3300014968 Ga0157379_10005282 Ga0157379_100052821 170
455 3300017792 Ga0163161_10089708 Ga0163161_100897083 170
456 3300025315 Ga0207697_10001015 Ga0207697_1000101516 170
457 3300025900 Ga0207710_10002894 Ga0207710_100028946 170
458 3300025903 Ga0207680_10003517 Ga0207680_100035178 170
459 3300025914 Ga0207671_10281666 Ga0207671_102816662 170
460 3300025923 Ga0207681_10000008 Ga0207681_10000008319 170
461 3300025925 Ga0207650_10007720 Ga0207650_1000772010 170
462 3300025931 Ga0207644_10000006 Ga0207644_10000006310 170
463 3300025941 Ga0207711_10094340 Ga0207711_100943403 170
464 3300025941 Ga0207711_10130631 Ga0207711_101306313 170
465 3300025961 Ga0207712_10004601 Ga0207712_100046015 170
466 3300025972 Ga0207668_10000294 Ga0207668_1000029423 170
467 3300025986 Ga0207658_10712357 Ga0207658_107123572 170
468 3300025986 Ga0207658_10744787 Ga0207658_107447872 170
469 3300026035 Ga0207703_10000501 Ga0207703_1000050137 170
470 3300026035 Ga0207703_10182370 Ga0207703_101823702 170
471 3300026088 Ga0207641_10098794 Ga0207641_100987944 170
472 3300026095 Ga0207676_10000184 Ga0207676_100001845 170
473 3300026095 Ga0207676_10001239 Ga0207676_100012397 170
474 3300026118 Ga0207675_100000822 Ga0207675_10000082220 170
475 3300026118 Ga0207675_100250507 Ga0207675_1002505072 170
476 3300028380 Ga0268265_10000064 Ga0268265_1000006499 170
477 3300028381 Ga0268264_10000010 Ga0268264_10000010103 170
478 3300028786 Ga0307517_10045291 Ga0307517_100452915 170
479 3300028794 Ga0307515_10419399 Ga0307515_104193992 170
480 3300031456 Ga0307513_10371082 Ga0307513_103710822 170
481 3300031731 Ga0307405_11703150 Ga0307405_117031501 170
482 3300031824 Ga0307413_10080840 Ga0307413_100808402 170
483 3300031901 Ga0307406_10214737 Ga0307406_102147372 170
484 3300031903 Ga0307407_10063086 Ga0307407_100630863 170
485 3300031995 Ga0307409_100136565 Ga0307409_1001365653 170
486 3300032002 Ga0307416_100083026 Ga0307416_1000830262 170
487 3300032004 Ga0307414_10053390 Ga0307414_100533903 170
488 3300032126 Ga0307415_100616126 Ga0307415_1006161262 170
489 3300033180 Ga0307510_10010127 Ga0307510_100101279 170
490 3300046491 Ga0495584_0011626 Ga0495584_0011626_1799_2311 170
491 3300046506 Ga0495583_0002872 Ga0495583_0002872_6609_7142 170
492 3300046506 Ga0495583_0034644 Ga0495583_0034644_149_673 170
493 3300046507 Ga0495606_0000978 Ga0495606_0000978_34795_35322 170
494 3300046519 Ga0495632_0000211 Ga0495632_0000211_45713_46225 170
495 3300046520 Ga0495637_0001513 Ga0495637_0001513_969_1481 170
496 3300046522 Ga0495643_0000053 Ga0495643_0000053_90284_90796 170
497 3300046524 Ga0495648_0048110 Ga0495648_0048110_822_1355 170
498 3300046525 Ga0495663_0000020 Ga0495663_0000020_111207_111719 170
499 3300046558 Ga0495633_0000320 Ga0495633_0000320_24613_25125 170
500 3300046558 Ga0495633_0002680 Ga0495633_0002680_11167_11679 170
501 3300046648 Ga0495611_0066498 Ga0495611_0066498_480_1013 170
502 3300046660 Ga0495625_0000570 Ga0495625_0000570_13575_14096 170
503 3300046665 Ga0495661_0164292 Ga0495661_0164292_263_796 170
504 3300046691 Ga0495670_0048691 Ga0495670_0048691_543_1064 170
505 3300046691 Ga0495670_0077744 Ga0495670_0077744_557_1090 170
506 3300046692 Ga0495671_0000031 Ga0495671_0000031_111235_111747 170
507 3300046692 Ga0495671_0017921 Ga0495671_0017921_775_1308 170
508 3300047445 Ga0495677_0030696 Ga0495677_0030696_1225_1749 170
509 3300047470 Ga0495681_0018954 Ga0495681_0018954_2126_2638 170
510 3300047472 Ga0495686_0005738 Ga0495686_0005738_627_1157 170
511 3300047472 Ga0495686_0027901 Ga0495686_0027901_1035_1556 170
512 3300047472 Ga0495686_0113510 Ga0495686_0113510_896_1408 170
513 3300048904 Ga0496101_0541130 Ga0496101_0541130_20_565 170
514 3300048905 Ga0496102_0885688 Ga0496102_0885688_185_721 170
515 3300048918 Ga0496115_0030277 Ga0496115_0030277_777_1322 170
516 3300048922 Ga0496119_0126202 Ga0496119_0126202_445_981 170
517 3300048923 Ga0496120_0160689 Ga0496120_0160689_112_648 170
518 3300048924 Ga0496121_0000681 Ga0496121_0000681_28106_28627 170
519 3300048924 Ga0496121_0259767 Ga0496121_0259767_276_803 170
520 3300048926 Ga0496123_0064664 Ga0496123_0064664_1619_2152 170
521 3300049460 Ga0495682_0010872 Ga0495682_0010872_1943_2476 170
522 3300049513 Ga0501290_008713 Ga0501290_008713_306_824 170
523 3300049572 Ga0501036_0165544 Ga0501036_0165544_1113_1640 170
524 3300049658 Ga0501211_005901 Ga0501211_005901_82_594 170
525 3300049663 Ga0501223_000025 Ga0501223_000025_44906_45418 170
526 3300049669 Ga0501235_003892 Ga0501235_003892_1777_2289 170
527 3300049686 Ga0501257_000568 Ga0501257_000568_2804_3322 170
528 3300049705 Ga0501225_0000036 Ga0501225_0000036_6739_7251 170
529 3300049705 Ga0501225_0003823 Ga0501225_0003823_98_610 170
530 3300049705 Ga0501225_0048315 Ga0501225_0048315_407_919 170
531 3300049774 Ga0501278_008090 Ga0501278_008090_62_580 170
532 3300049776 Ga0501280_003611 Ga0501280_003611_992_1510 170
533 3300050507 nmdc:mga05p37_382339_c1 nmdc:mga05p37_382339_c1_802_1314 170
534 3300053087 Ga0500643_012809 Ga0500643_012809_687_1223 170
535 3300053087 Ga0500643_077379 Ga0500643_077379_55_588 170
536 3300053096 Ga0500641_0217775 Ga0500641_0217775_200_721 170
537 3300053102 Ga0500554_102645 Ga0500554_102645_87_608 170
538 3300053103 Ga0500555_000430 Ga0500555_000430_10011_10544 170
539 3300053136 Ga0500559_0005855 Ga0500559_0005855_638_1174 170
540 3300053136 Ga0500559_0067700 Ga0500559_0067700_428_958 170
541 3300053136 Ga0500559_0070803 Ga0500559_0070803_487_1020 170
542 3300053153 Ga0500616_0006486 Ga0500616_0006486_2102_2623 170
543 3300053157 Ga0500624_000001 Ga0500624_000001_19008_19568 170
544 3300053178 Ga0500637_0000248 Ga0500637_0000248_540_1100 170
545 iso_pu_bacteria 2582581305 2585262318 170
546 iso_pu_bacteria 2643221541 2643730357 170
547 iso_pu_bacteria 2643221605 2644037225 170
548 iso_pu_bacteria 2643221606 2644043526 170
549 iso_pu_bacteria 2643221671 2644393685 170
550 3300000549 LJQas_1013961 LJQas_10139612 171
551 3300001989 JGI24739J22299_10032344 JGI24739J22299_100323443 171
552 3300001989 JGI24739J22299_10103781 JGI24739J22299_101037812 171
553 3300001989 JGI24739J22299_10150961 JGI24739J22299_101509612 171
554 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002605 171
555 3300003762 Ga0055542_1000046 Ga0055542_100004672 171
556 3300003763 Ga0055529_1000007 Ga0055529_1000007157 171
557 3300005353 Ga0070669_100584863 Ga0070669_1005848632 171
558 3300005356 Ga0070674_100000639 Ga0070674_1000006394 171
559 3300005364 Ga0070673_100250069 Ga0070673_1002500692 171
560 3300005456 Ga0070678_100000104 Ga0070678_10000010430 171
561 3300005539 Ga0068853_100052401 Ga0068853_1000524012 171
562 3300005543 Ga0070672_100081453 Ga0070672_1000814533 171
563 3300005578 Ga0068854_100346967 Ga0068854_1003469672 171
564 3300005616 Ga0068852_100333498 Ga0068852_1003334982 171
565 3300006237 Ga0097621_100088459 Ga0097621_1000884592 171
566 3300006358 Ga0068871_100088693 Ga0068871_1000886933 171
567 3300009093 Ga0105240_10034553 Ga0105240_100345536 171
568 3300009148 Ga0105243_10002588 Ga0105243_100025883 171
569 3300009551 Ga0105238_10094707 Ga0105238_100947072 171
570 3300009551 Ga0105238_10369036 Ga0105238_103690362 171
571 3300010375 Ga0105239_10000320 Ga0105239_1000032062 171
572 3300011119 Ga0105246_10015969 Ga0105246_100159695 171
573 3300012513 Ga0157326_1004308 Ga0157326_10043083 171
574 3300013296 Ga0157374_10141224 Ga0157374_101412243 171
575 3300013297 Ga0157378_10153888 Ga0157378_101538882 171
576 3300014969 Ga0157376_10290474 Ga0157376_102904743 171
577 3300025226 Ga0209674_114085 Ga0209674_1140852 171
578 3300025229 Ga0209147_102362 Ga0209147_1023623 171
579 3300025272 Ga0209455_1000005 Ga0209455_1000005976 171
580 3300025297 Ga0209758_1000001 Ga0209758_10000011402 171
581 3300025913 Ga0207695_10017086 Ga0207695_100170866 171
582 3300025913 Ga0207695_10082639 Ga0207695_100826394 171
583 3300025920 Ga0207649_10192386 Ga0207649_101923862 171
584 3300025924 Ga0207694_10321454 Ga0207694_103214543 171
585 3300025924 Ga0207694_10494248 Ga0207694_104942482 171
586 3300025935 Ga0207709_10000201 Ga0207709_1000020136 171
587 3300025935 Ga0207709_10696659 Ga0207709_106966592 171
588 3300025937 Ga0207669_10000042 Ga0207669_1000004234 171
589 3300025940 Ga0207691_10079430 Ga0207691_100794303 171
590 3300025960 Ga0207651_10196425 Ga0207651_101964253 171
591 3300025981 Ga0207640_10360382 Ga0207640_103603822 171
592 3300025981 Ga0207640_10794630 Ga0207640_107946302 171
593 3300026041 Ga0207639_10021378 Ga0207639_100213783 171
594 3300026088 Ga0207641_10702582 Ga0207641_107025822 171
595 3300026089 Ga0207648_10018044 Ga0207648_1001804410 171
596 3300026116 Ga0207674_10076729 Ga0207674_100767293 171
597 3300026121 Ga0207683_10000067 Ga0207683_1000006747 171
598 3300026142 Ga0207698_10261953 Ga0207698_102619532 171
599 3300031548 Ga0307408_100060456 Ga0307408_1000604561 171
600 3300031731 Ga0307405_10305053 Ga0307405_103050532 171
601 3300031901 Ga0307406_10080622 Ga0307406_100806222 171
602 3300031911 Ga0307412_10006640 Ga0307412_100066406 171
603 3300031911 Ga0307412_10026305 Ga0307412_100263053 171
604 3300031911 Ga0307412_10156229 Ga0307412_101562292 171
605 3300031911 Ga0307412_10184436 Ga0307412_101844362 171
606 3300031995 Ga0307409_100175442 Ga0307409_1001754422 171
607 3300032002 Ga0307416_100540706 Ga0307416_1005407062 171
608 3300042004 Ga0439445_0085994 Ga0439445_0085994_29_556 171
609 3300046452 Ga0495617_010535 Ga0495617_010535_2348_2863 171
610 3300046453 Ga0495627_000155 Ga0495627_000155_12497_13012 171
611 3300046460 Ga0495638_0146771 Ga0495638_0146771_518_1048 171
612 3300046491 Ga0495584_0045768 Ga0495584_0045768_1408_1938 171
613 3300046491 Ga0495584_0098998 Ga0495584_0098998_160_690 171
614 3300046492 Ga0495585_0034452 Ga0495585_0034452_1210_1740 171
615 3300046506 Ga0495583_0014784 Ga0495583_0014784_2385_2915 171
616 3300046506 Ga0495583_0073449 Ga0495583_0073449_367_897 171
617 3300046506 Ga0495583_0130953 Ga0495583_0130953_12_542 171
618 3300046507 Ga0495606_0113010 Ga0495606_0113010_274_804 171
619 3300046507 Ga0495606_0173200 Ga0495606_0173200_27_557 171
620 3300046512 Ga0495610_0001777 Ga0495610_0001777_12632_13147 171
621 3300046513 Ga0495616_0185841 Ga0495616_0185841_211_741 171
622 3300046513 Ga0495616_0190350 Ga0495616_0190350_151_681 171
623 3300046518 Ga0495631_0019792 Ga0495631_0019792_597_1127 171
624 3300046520 Ga0495637_0021337 Ga0495637_0021337_55_585 171
625 3300046520 Ga0495637_0057349 Ga0495637_0057349_771_1286 171
626 3300046522 Ga0495643_0006712 Ga0495643_0006712_1667_2197 171
627 3300046522 Ga0495643_0072076 Ga0495643_0072076_562_1092 171
628 3300046522 Ga0495643_0143859 Ga0495643_0143859_116_646 171
629 3300046558 Ga0495633_0001111 Ga0495633_0001111_20193_20723 171
630 3300046616 Ga0495668_0000261 Ga0495668_0000261_58351_58881 171
631 3300046616 Ga0495668_0369869 Ga0495668_0369869_217_747 171
632 3300046648 Ga0495611_0025833 Ga0495611_0025833_768_1298 171
633 3300046660 Ga0495625_0023939 Ga0495625_0023939_1833_2363 171
634 3300046660 Ga0495625_0033676 Ga0495625_0033676_1968_2498 171
635 3300046660 Ga0495625_0071795 Ga0495625_0071795_1156_1686 171
636 3300046684 Ga0495669_0000333 Ga0495669_0000333_10809_11339 171
637 3300046691 Ga0495670_0024341 Ga0495670_0024341_1098_1625 171
638 3300046691 Ga0495670_0416490 Ga0495670_0416490_47_568 171
639 3300047318 Ga0495636_0066270 Ga0495636_0066270_82_612 171
640 3300047443 Ga0495687_000470 Ga0495687_000470_27637_28167 171
641 3300047443 Ga0495687_001491 Ga0495687_001491_16625_17155 171
642 3300047445 Ga0495677_0017046 Ga0495677_0017046_723_1253 171
643 3300047470 Ga0495681_0000228 Ga0495681_0000228_3374_3889 171
644 3300047472 Ga0495686_0000185 Ga0495686_0000185_45795_46322 171
645 3300047472 Ga0495686_0046918 Ga0495686_0046918_1428_1943 171
646 3300048916 Ga0496113_0110841 Ga0496113_0110841_1234_1764 171
647 3300048920 Ga0496117_0067040 Ga0496117_0067040_271_819 171
648 3300048921 Ga0496118_0062182 Ga0496118_0062182_400_948 171
649 3300048924 Ga0496121_0001025 Ga0496121_0001025_26092_26652 171
650 3300048924 Ga0496121_0067090 Ga0496121_0067090_2036_2584 171
651 3300048924 Ga0496121_0094896 Ga0496121_0094896_563_1111 171
652 3300048925 Ga0496122_0046285 Ga0496122_0046285_919_1449 171
653 3300048928 Ga0496125_0001206 Ga0496125_0001206_6269_6799 171
654 3300048929 Ga0496126_0057622 Ga0496126_0057622_1146_1706 171
655 3300049459 Ga0495678_021780 Ga0495678_021780_1635_2150 171
656 3300049579 Ga0501043_0048052 Ga0501043_0048052_2094_2642 171
657 3300049581 Ga0501047_0374014 Ga0501047_0374014_692_1240 171
658 3300053079 Ga0500610_0000661 Ga0500610_0000661_5390_5920 171
659 3300053087 Ga0500643_000129 Ga0500643_000129_42974_43495 171
660 3300053119 Ga0500595_002106 Ga0500595_002106_8415_8942 171
661 3300053730 Ga0500645_000062 Ga0500645_000062_38746_39276 171
662 3300053730 Ga0500645_002084 Ga0500645_002084_6884_7426 171
663 2162886007 SwRhRL2b_contig_1180352 SwRhRL2b_0538.00001990 172
664 3300001904 JGI24736J21556_1010100 JGI24736J21556_10101002 172
665 3300001915 JGI24741J21665_1000043 JGI24741J21665_100004312 172
666 3300002067 JGI24735J21928_10045121 JGI24735J21928_100451212 172
667 3300002075 JGI24738J21930_10003415 JGI24738J21930_100034156 172
668 3300002076 JGI24749J21850_1000111 JGI24749J21850_10001116 172
669 3300002459 JGI24751J29686_10000002 JGI24751J29686_10000002135 172
670 3300002459 JGI24751J29686_10004995 JGI24751J29686_100049953 172
671 3300003187 JGI25151J46595_10009635 JGI25151J46595_100096352 172
672 3300003215 JGI25153J46596_10000044 JGI25153J46596_10000044163 172
673 3300003771 Ga0055526_1011554 Ga0055526_10115544 172
674 3300003773 Ga0055537_1001004 Ga0055537_10010045 172
675 3300003781 Ga0055536_1021354 Ga0055536_10213541 172
676 3300003792 Ga0055540_1000717 Ga0055540_100071713 172
677 3300005262 Ga0065165_1085341 Ga0065165_10853412 172
678 3300005289 Ga0065704_10003859 Ga0065704_100038592 172
679 3300005295 Ga0065707_10084130 Ga0065707_100841303 172
680 3300005327 Ga0070658_10000001 Ga0070658_10000001441 172
681 3300005327 Ga0070658_10042620 Ga0070658_100426204 172
682 3300005331 Ga0070670_100000012 Ga0070670_10000001265 172
683 3300005331 Ga0070670_100002503 Ga0070670_10000250310 172
684 3300005333 Ga0070677_10001096 Ga0070677_100010967 172
685 3300005335 Ga0070666_10156997 Ga0070666_101569972 172
686 3300005336 Ga0070680_100000534 Ga0070680_10000053422 172
687 3300005339 Ga0070660_100001071 Ga0070660_1000010718 172
688 3300005339 Ga0070660_100056240 Ga0070660_1000562404 172
689 3300005339 Ga0070660_100141166 Ga0070660_1001411662 172
690 3300005344 Ga0070661_100043250 Ga0070661_1000432503 172
691 3300005344 Ga0070661_100804456 Ga0070661_1008044562 172
692 3300005345 Ga0070692_10038481 Ga0070692_100384813 172
693 3300005347 Ga0070668_100000004 Ga0070668_10000000461 172
694 3300005347 Ga0070668_100000330 Ga0070668_10000033012 172
695 3300005347 Ga0070668_100102263 Ga0070668_1001022633 172
696 3300005353 Ga0070669_100000041 Ga0070669_10000004143 172
697 3300005353 Ga0070669_100073089 Ga0070669_1000730892 172
698 3300005353 Ga0070669_100098905 Ga0070669_1000989053 172
699 3300005355 Ga0070671_100000014 Ga0070671_100000014142 172
700 3300005355 Ga0070671_100000136 Ga0070671_1000001367 172
701 3300005366 Ga0070659_100007571 Ga0070659_1000075713 172
702 3300005366 Ga0070659_100035817 Ga0070659_1000358172 172
703 3300005367 Ga0070667_100000037 Ga0070667_10000003757 172
704 3300005367 Ga0070667_100000089 Ga0070667_10000008952 172
705 3300005455 Ga0070663_100042668 Ga0070663_1000426683 172
706 3300005457 Ga0070662_100418223 Ga0070662_1004182231 172
707 3300005530 Ga0070679_100000005 Ga0070679_100000005134 172
708 3300005535 Ga0070684_100713447 Ga0070684_1007134471 172
709 3300005539 Ga0068853_100090889 Ga0068853_1000908892 172
710 3300005539 Ga0068853_100849593 Ga0068853_1008495931 172
711 3300005539 Ga0068853_100923997 Ga0068853_1009239972 172
712 3300005548 Ga0070665_100600288 Ga0070665_1006002881 172
713 3300005564 Ga0070664_100255042 Ga0070664_1002550422 172
714 3300005577 Ga0068857_100028662 Ga0068857_1000286626 172
715 3300005577 Ga0068857_100667034 Ga0068857_1006670342 172
716 3300005577 Ga0068857_100830344 Ga0068857_1008303442 172
717 3300005578 Ga0068854_100005589 Ga0068854_1000055895 172
718 3300005614 Ga0068856_100023608 Ga0068856_1000236083 172
719 3300005616 Ga0068852_100900870 Ga0068852_1009008702 172
720 3300005616 Ga0068852_101139348 Ga0068852_1011393482 172
721 3300005617 Ga0068859_100005780 Ga0068859_1000057807 172
722 3300005617 Ga0068859_100007191 Ga0068859_1000071912 172
723 3300005617 Ga0068859_100356626 Ga0068859_1003566262 172
724 3300005617 Ga0068859_100435092 Ga0068859_1004350922 172
725 3300005617 Ga0068859_100552363 Ga0068859_1005523632 172
726 3300005617 Ga0068859_101112497 Ga0068859_1011124972 172
727 3300005618 Ga0068864_100000010 Ga0068864_100000010161 172
728 3300005618 Ga0068864_100008484 Ga0068864_1000084847 172
729 3300005719 Ga0068861_100001727 Ga0068861_1000017277 172
730 3300005719 Ga0068861_100861142 Ga0068861_1008611422 172
731 3300005841 Ga0068863_100000001 Ga0068863_1000000018 172
732 3300005841 Ga0068863_100004589 Ga0068863_1000045896 172
733 3300005841 Ga0068863_100005416 Ga0068863_10000541611 172
734 3300005841 Ga0068863_100008282 Ga0068863_1000082825 172
735 3300005841 Ga0068863_100654350 Ga0068863_1006543502 172
736 3300005842 Ga0068858_100006177 Ga0068858_1000061776 172
737 3300005843 Ga0068860_100000002 Ga0068860_100000002549 172
738 3300005843 Ga0068860_100000148 Ga0068860_10000014879 172
739 3300005843 Ga0068860_100012019 Ga0068860_1000120192 172
740 3300005843 Ga0068860_100234850 Ga0068860_1002348502 172
741 3300005843 Ga0068860_100400906 Ga0068860_1004009063 172
742 3300005844 Ga0068862_100000016 Ga0068862_10000001655 172
743 3300005844 Ga0068862_100000280 Ga0068862_10000028042 172
744 3300005844 Ga0068862_100002391 Ga0068862_1000023919 172
745 3300006178 Ga0075367_10000022 Ga0075367_100000225 172
746 3300006931 Ga0097620_100005780 Ga0097620_1000057807 172
747 3300006931 Ga0097620_100007191 Ga0097620_1000071912 172
748 3300006931 Ga0097620_100356601 Ga0097620_1003566012 172
749 3300006931 Ga0097620_100435110 Ga0097620_1004351103 172
750 3300006931 Ga0097620_100552350 Ga0097620_1005523502 172
751 3300006931 Ga0097620_101112457 Ga0097620_1011124572 172
752 3300009093 Ga0105240_10178147 Ga0105240_101781474 172
753 3300009093 Ga0105240_10891679 Ga0105240_108916792 172
754 3300009174 Ga0105241_10007217 Ga0105241_100072177 172
755 3300009176 Ga0105242_10497526 Ga0105242_104975261 172
756 3300009177 Ga0105248_10000053 Ga0105248_100000537 172
757 3300009551 Ga0105238_10581332 Ga0105238_105813322 172
758 3300009551 Ga0105238_10615885 Ga0105238_106158852 172
759 3300009551 Ga0105238_10706922 Ga0105238_107069222 172
760 3300009553 Ga0105249_10000103 Ga0105249_1000010367 172
761 3300009553 Ga0105249_11195675 Ga0105249_111956752 172
762 3300012513 Ga0157326_1000547 Ga0157326_10005476 172
763 3300013102 Ga0157371_10105735 Ga0157371_101057352 172
764 3300013104 Ga0157370_10426595 Ga0157370_104265952 172
765 3300013105 Ga0157369_10817235 Ga0157369_108172352 172
766 3300013105 Ga0157369_10946228 Ga0157369_109462282 172
767 3300013307 Ga0157372_10307967 Ga0157372_103079673 172
768 3300013307 Ga0157372_12458342 Ga0157372_124583421 172
769 3300014325 Ga0163163_10029678 Ga0163163_100296785 172
770 3300014326 Ga0157380_10000134 Ga0157380_1000013426 172
771 3300017792 Ga0163161_10104274 Ga0163161_101042742 172
772 3300017792 Ga0163161_10158995 Ga0163161_101589953 172
773 3300020082 Ga0206353_10346769 Ga0206353_103467693 172
774 3300021358 Ga0213873_10000006 Ga0213873_10000006247 172
775 3300021384 Ga0213876_10000004 Ga0213876_10000004753 172
776 3300025245 Ga0207425_1000026 Ga0207425_1000026258 172
777 3300025258 Ga0209129_1001922 Ga0209129_10019223 172
778 3300025263 Ga0209565_1000064 Ga0209565_10000648 172
779 3300025273 Ga0209673_1046675 Ga0209673_10466752 172
780 3300025292 Ga0209676_1008246 Ga0209676_10082464 172
781 3300025294 Ga0209025_1000551 Ga0209025_100055148 172
782 3300025295 Ga0209564_1003529 Ga0209564_10035295 172
783 3300025295 Ga0209564_1018595 Ga0209564_10185952 172
784 3300025297 Ga0209758_1000004 Ga0209758_10000041200 172
785 3300025298 Ga0209050_1000001 Ga0209050_10000013196 172
786 3300025298 Ga0209050_1011661 Ga0209050_10116613 172
787 3300025302 Ga0207426_1014974 Ga0207426_10149743 172
788 3300025303 Ga0209051_1001333 Ga0209051_100133312 172
789 3300025321 Ga0207656_10010757 Ga0207656_100107573 172
790 3300025893 Ga0207682_10000992 Ga0207682_100009927 172
791 3300025903 Ga0207680_10174088 Ga0207680_101740882 172
792 3300025904 Ga0207647_10210138 Ga0207647_102101382 172
793 3300025904 Ga0207647_10210139 Ga0207647_102101392 172
794 3300025909 Ga0207705_10000002 Ga0207705_100000021439 172
795 3300025909 Ga0207705_10527101 Ga0207705_105271012 172
796 3300025911 Ga0207654_10048248 Ga0207654_100482482 172
797 3300025913 Ga0207695_10142203 Ga0207695_101422032 172
798 3300025919 Ga0207657_10001208 Ga0207657_1000120829 172
799 3300025919 Ga0207657_10035193 Ga0207657_100351934 172
800 3300025919 Ga0207657_10037177 Ga0207657_100371771 172
801 3300025920 Ga0207649_10000235 Ga0207649_1000023544 172
802 3300025921 Ga0207652_10000005 Ga0207652_100000056 172
803 3300025921 Ga0207652_10000006 Ga0207652_10000006274 172
804 3300025921 Ga0207652_10000007 Ga0207652_10000007275 172
805 3300025921 Ga0207652_10000009 Ga0207652_10000009235 172
806 3300025923 Ga0207681_10000013 Ga0207681_10000013147 172
807 3300025923 Ga0207681_10047884 Ga0207681_100478842 172
808 3300025925 Ga0207650_10000008 Ga0207650_10000008227 172
809 3300025925 Ga0207650_10001666 Ga0207650_1000166610 172
810 3300025927 Ga0207687_10063568 Ga0207687_100635682 172
811 3300025931 Ga0207644_10000030 Ga0207644_1000003030 172
812 3300025931 Ga0207644_10000046 Ga0207644_1000004649 172
813 3300025932 Ga0207690_10004899 Ga0207690_100048997 172
814 3300025933 Ga0207706_10051297 Ga0207706_100512972 172
815 3300025933 Ga0207706_10995734 Ga0207706_109957341 172
816 3300025934 Ga0207686_10719094 Ga0207686_107190941 172
817 3300025941 Ga0207711_10003703 Ga0207711_100037033 172
818 3300025944 Ga0207661_11027976 Ga0207661_110279761 172
819 3300025949 Ga0207667_10446221 Ga0207667_104462212 172
820 3300025961 Ga0207712_10000069 Ga0207712_1000006969 172
821 3300025972 Ga0207668_10000140 Ga0207668_1000014012 172
822 3300025972 Ga0207668_10000256 Ga0207668_1000025616 172
823 3300025972 Ga0207668_10024318 Ga0207668_100243183 172
824 3300025981 Ga0207640_10004411 Ga0207640_100044116 172
825 3300025981 Ga0207640_10015179 Ga0207640_100151795 172
826 3300025986 Ga0207658_10000002 Ga0207658_10000002832 172
827 3300025986 Ga0207658_10000069 Ga0207658_1000006976 172
828 3300026035 Ga0207703_10004439 Ga0207703_100044397 172
829 3300026041 Ga0207639_10107040 Ga0207639_101070403 172
830 3300026067 Ga0207678_10000622 Ga0207678_100006229 172
831 3300026078 Ga0207702_10043899 Ga0207702_100438993 172
832 3300026088 Ga0207641_10000001 Ga0207641_10000001349 172
833 3300026088 Ga0207641_10000818 Ga0207641_100008186 172
834 3300026088 Ga0207641_10001290 Ga0207641_100012907 172
835 3300026088 Ga0207641_10002303 Ga0207641_100023036 172
836 3300026088 Ga0207641_10004282 Ga0207641_100042826 172
837 3300026088 Ga0207641_10004485 Ga0207641_100044854 172
838 3300026095 Ga0207676_10000012 Ga0207676_10000012170 172
839 3300026095 Ga0207676_10006305 Ga0207676_100063057 172
840 3300026116 Ga0207674_10038181 Ga0207674_100381812 172
841 3300026116 Ga0207674_10693644 Ga0207674_106936442 172
842 3300026118 Ga0207675_100053569 Ga0207675_1000535691 172
843 3300026118 Ga0207675_100074606 Ga0207675_1000746063 172
844 3300026142 Ga0207698_10268441 Ga0207698_102684412 172
845 3300026142 Ga0207698_10286465 Ga0207698_102864652 172
846 3300027866 Ga0209813_10000224 Ga0209813_1000022410 172
847 3300028379 Ga0268266_10002533 Ga0268266_1000253319 172
848 3300028379 Ga0268266_10557732 Ga0268266_105577321 172
849 3300028380 Ga0268265_10000006 Ga0268265_10000006254 172
850 3300028380 Ga0268265_10001032 Ga0268265_1000103220 172
851 3300028380 Ga0268265_10004641 Ga0268265_100046418 172
852 3300028381 Ga0268264_10000001 Ga0268264_100000011157 172
853 3300028381 Ga0268264_10000217 Ga0268264_1000021776 172
854 3300028381 Ga0268264_10000381 Ga0268264_100003813 172
855 3300028381 Ga0268264_10018242 Ga0268264_100182428 172
856 3300031548 Ga0307408_100008396 Ga0307408_1000083961 172
857 3300031548 Ga0307408_100013448 Ga0307408_1000134483 172
858 3300031548 Ga0307408_100310385 Ga0307408_1003103853 172
859 3300031548 Ga0307408_100410934 Ga0307408_1004109342 172
860 3300031548 Ga0307408_100473552 Ga0307408_1004735522 172
861 3300031548 Ga0307408_100771869 Ga0307408_1007718692 172
862 3300031731 Ga0307405_10061287 Ga0307405_100612873 172
863 3300031731 Ga0307405_11034309 Ga0307405_110343092 172
864 3300031852 Ga0307410_11072257 Ga0307410_110722572 172
865 3300031901 Ga0307406_10020839 Ga0307406_100208393 172
866 3300031911 Ga0307412_10017510 Ga0307412_100175102 172
867 3300031911 Ga0307412_10048489 Ga0307412_100484893 172
868 3300031911 Ga0307412_10146928 Ga0307412_101469282 172
869 3300031911 Ga0307412_10406811 Ga0307412_104068112 172
870 3300031911 Ga0307412_10439319 Ga0307412_104393192 172
871 3300032002 Ga0307416_100020485 Ga0307416_1000204854 172
872 3300032002 Ga0307416_100478347 Ga0307416_1004783472 172
873 3300032004 Ga0307414_10120555 Ga0307414_101205552 172
874 3300032004 Ga0307414_10800735 Ga0307414_108007351 172
875 3300032126 Ga0307415_101236798 Ga0307415_1012367982 172
876 3300035695 Ga0373927_0176280 Ga0373927_0176280_763_1332 172
877 3300037853 Ga0436364_1344939 Ga0436364_1344939_448_987 172
878 3300038443 Ga0395901_0165215 Ga0395901_0165215_370_936 172
879 3300038705 Ga0237819_00162 Ga0237819_00162_18695_19237 172
880 3300039437 Ga0436365_1244885 Ga0436365_1244885_13654_14190 172
881 3300039437 Ga0436365_1911487 Ga0436365_1911487_27509_28063 172
882 3300039453 Ga0436362_0953683 Ga0436362_0953683_4322_4876 172
883 3300044735 Ga0466968_0168271 Ga0466968_0168271_149_712 172
884 3300046506 Ga0495583_0270157 Ga0495583_0270157_18_554 172
885 3300046519 Ga0495632_0003768 Ga0495632_0003768_710_1240 172
886 3300046520 Ga0495637_0049978 Ga0495637_0049978_761_1315 172
887 3300046522 Ga0495643_0017112 Ga0495643_0017112_3421_3975 172
888 3300046524 Ga0495648_0000102 Ga0495648_0000102_101717_102247 172
889 3300046542 Ga0495597_0028176 Ga0495597_0028176_240_788 172
890 3300046558 Ga0495633_0012350 Ga0495633_0012350_3737_4255 172
891 3300046616 Ga0495668_0020010 Ga0495668_0020010_3068_3616 172
892 3300046660 Ga0495625_0240765 Ga0495625_0240765_117_671 172
893 3300046660 Ga0495625_0289504 Ga0495625_0289504_166_714 172
894 3300046684 Ga0495669_0025332 Ga0495669_0025332_831_1385 172
895 3300046692 Ga0495671_0000065 Ga0495671_0000065_101077_101607 172
896 3300046692 Ga0495671_0034554 Ga0495671_0034554_1137_1673 172
897 3300047469 Ga0495673_0000174 Ga0495673_0000174_101077_101607 172
898 3300048908 Ga0496105_0460120 Ga0496105_0460120_355_873 172
899 3300048911 Ga0496108_0004571 Ga0496108_0004571_248_766 172
900 3300048912 Ga0496109_0341499 Ga0496109_0341499_596_1114 172
901 3300048913 Ga0496110_0014526 Ga0496110_0014526_5396_5914 172
902 3300048914 Ga0496111_0399267 Ga0496111_0399267_254_772 172
903 3300048921 Ga0496118_0176499 Ga0496118_0176499_288_806 172
904 3300048921 Ga0496118_0242678 Ga0496118_0242678_102_620 172
905 3300048922 Ga0496119_0118599 Ga0496119_0118599_372_890 172
906 3300048924 Ga0496121_0001630 Ga0496121_0001630_9336_9854 172
907 3300048925 Ga0496122_0000589 Ga0496122_0000589_50615_51166 172
908 3300048925 Ga0496122_0009235 Ga0496122_0009235_5163_5681 172
909 3300048926 Ga0496123_0001872 Ga0496123_0001872_23430_23981 172
910 3300048926 Ga0496123_0031058 Ga0496123_0031058_971_1489 172
911 3300048926 Ga0496123_0218830 Ga0496123_0218830_59_577 172
912 3300048927 Ga0496124_0011745 Ga0496124_0011745_3206_3724 172
913 3300048928 Ga0496125_0018837 Ga0496125_0018837_4026_4544 172
914 3300048928 Ga0496125_0039047 Ga0496125_0039047_2436_2972 172
915 3300048928 Ga0496125_0043236 Ga0496125_0043236_2709_3227 172
916 3300048928 Ga0496125_0061621 Ga0496125_0061621_744_1304 172
917 3300048929 Ga0496126_0016562 Ga0496126_0016562_4409_4927 172
918 3300048929 Ga0496126_0184524 Ga0496126_0184524_1163_1714 172
919 3300048929 Ga0496126_0231779 Ga0496126_0231779_887_1423 172
920 3300048929 Ga0496126_0294207 Ga0496126_0294207_452_1003 172
921 3300049571 Ga0501034_0456527 Ga0501034_0456527_30_590 172
922 3300049579 Ga0501043_0057895 Ga0501043_0057895_886_1422 172
923 3300049580 Ga0501046_0067509 Ga0501046_0067509_687_1223 172
924 3300049581 Ga0501047_0028974 Ga0501047_0028974_1746_2282 172
925 3300049582 Ga0501048_0078770 Ga0501048_0078770_629_1165 172
926 3300050494 nmdc:mga06z11_7_c1 nmdc:mga06z11_7_c1_59453_59971 172
927 3300050495 nmdc:mga04h51_44_c1 nmdc:mga04h51_44_c1_25845_26363 172
928 3300050496 nmdc:mga07m45_150221_c1 nmdc:mga07m45_150221_c1_804_1322 172
929 3300053087 Ga0500643_000089 Ga0500643_000089_54568_55092 172
930 3300053087 Ga0500643_000641 Ga0500643_000641_13223_13765 172
931 3300053087 Ga0500643_001043 Ga0500643_001043_12529_13089 172
932 3300053087 Ga0500643_011522 Ga0500643_011522_1891_2439 172
933 3300053087 Ga0500643_011530 Ga0500643_011530_2059_2601 172
934 3300053087 Ga0500643_183888 Ga0500643_183888_14_541 172
935 3300053091 Ga0500647_0018649 Ga0500647_0018649_1612_2181 172
936 3300053093 Ga0500651_0083340 Ga0500651_0083340_476_1045 172
937 3300053096 Ga0500641_0123928 Ga0500641_0123928_220_789 172
938 3300053098 Ga0500650_0069216 Ga0500650_0069216_317_865 172
939 3300053104 Ga0500556_0000027 Ga0500556_0000027_51885_52433 172
940 3300053105 Ga0500557_061050 Ga0500557_061050_593_1141 172
941 3300053116 Ga0500592_000086 Ga0500592_000086_2142_2669 172
942 3300053118 Ga0500594_0026602 Ga0500594_0026602_81_617 172
943 3300053122 Ga0500608_065769 Ga0500608_065769_94_642 172
944 3300053125 Ga0500618_007224 Ga0500618_007224_1493_2062 172
945 3300053130 Ga0500642_0000003 Ga0500642_0000003_422818_423366 172
946 3300053133 Ga0500655_000122 Ga0500655_000122_663_1217 172
947 3300053136 Ga0500559_0012017 Ga0500559_0012017_1478_2014 172
948 3300053139 Ga0500568_0000917 Ga0500568_0000917_11790_12317 172
949 3300053142 Ga0500577_0047339 Ga0500577_0047339_562_1116 172
950 3300053148 Ga0500590_004273 Ga0500590_004273_4615_5169 172
951 3300053151 Ga0500604_0000023 Ga0500604_0000023_39843_40370 172
952 3300053153 Ga0500616_0000318 Ga0500616_0000318_38747_39274 172
953 3300053156 Ga0500622_0122137 Ga0500622_0122137_419_967 172
954 3300053158 Ga0500627_0000549 Ga0500627_0000549_2856_3383 172
955 3300053163 Ga0500639_068732 Ga0500639_068732_369_923 172
956 3300053177 Ga0500636_0056736 Ga0500636_0056736_1234_1803 172
957 3300053724 Ga0500570_003257 Ga0500570_003257_4229_4783 172
958 3300053730 Ga0500645_000424 Ga0500645_000424_23158_23706 172
959 iso_pu_bacteria 2808606404 2809078124 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02464

CinA

Competence-damaged protein

31

189

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9s-assembly1.cif.gz_B the crystal structure of competence/damage inducible protein ciha from agrobacterium tumefaciens 0.9591 4 165
5v01-assembly1.cif.gz_B crystal structure of the competence damage-inducible protein a (coma) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9518 10 165
5kvk-assembly1.cif.gz_A-2 crystal structure of the competence-damaged protein (cina) superfamily protein kp700603 from klebsiella pneumoniae 700603 0.9508 10 165
6mr3-assembly2.cif.gz_C-2 crystal structure of the competence-damaged protein (cina) superfamily protein from streptococcus mutans 0.9403 13 165
6l19-assembly1.cif.gz_B the crystal structure of competence or damage-inducible protein from enterobacter asburiae 0.9214 7 165
ID Description Score Start End Superfamily
2a9sB00 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9591 4 165 3.90.950.20
af_P0A6G3_1_161_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9539 1 166 3.90.950.20
af_P9WPE3_267_424_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9315 10 165 3.90.950.20
af_P0A6G3_1_161_3.90.950.20 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9308 1 166 3.90.950.20
2a9sB00 Alpha Beta;Alpha-Beta Complex;Maf protein;CinA-like 0.9198 4 165 3.90.950.20
ID Description Score Start End GO Terms
AF-A0A495RX23-F1-model_v4 deleted 0.985 4 171
AF-Q9S1D3-F1-model_v4 CinA C-terminal domain-containing protein 0.9843 5 172
AF-A0A418Q1B0-F1-model_v4 CinA family protein 0.9826 1 167
AF-A0A1M3I834-F1-model_v4 Competence protein 0.9825 1 167
AF-A0A0T2QF59-F1-model_v4 Competence protein 0.9789 1 167

Feature Viewer

pLDDT pTM Quality
93.81 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map