F486808

General Info

Members Datasets Scaffolds Average Seq Length
958 425 955 298

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0095280|Ga0501034_0095280_556_1548
Length 330
Sequence MRDPYEVLGVSKSASEADIKSAYRGLAKKLHPDANKHDPKAASRFAELNAAYEIVGDDEKRKAFDRGEIDAEGKPRFRGFEGYGAQPGGGFNRGDAQFETFSFGPDGFQRRGRASGGGGFEDLLRGMFGGAARGPRGGYGGTFEAEDFGPPPTGQDLHASLTITLPEAAKGTKARVTLPTGKSVEVKIPAGLASGQQIRLKGQGWPAAGGGKAGDALITVNVTPHPVFKPDGADLRLDLPITLYEAVLGGKVRVPTLDGAVELAIPAGTSSGRTFRLRGKGLKKDGSKSSTGDLLATVRIVLPEHTDDALTDLMKTWRDSKPYDPRGDIS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
243 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
244 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
245 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
246 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
247 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
252 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
269 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
277 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
285 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
319 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
320 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
385 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
386 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
387 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
388 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
391 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
412 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
413 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
414 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
418 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
419 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
420 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
421 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
425 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.21
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0.31
Rhizoplane 8.66
Rhizosphere 87.06
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214656053 2209111006 Bacteria 4786
2 ARcpr5oldR_c000226 3300000041 Bacteria 9278
3 ARSoilYngRDRAFT_c00122 3300000042 Bacteria 13299
4 ARcpr5yngRDRAFT_c000316 3300000043 Bacteria 6756
5 ARSoilOldRDRAFT_c000054 3300000044 Bacteria 23692
6 ARCol0yngRDRAFT_1000054 3300000652 Bacteria 20195
7 JGI24032J14994_100197 3300001430 Bacteria 3099
8 JGI24746J21847_1004760 3300001977 Bacteria 2132
9 JGI24747J21853_1000617 3300001978 Bacteria 2321
10 JGI24740J21852_10019512 3300001979 Bacteria 2387
11 JGI24739J22299_10001041 3300001989 Bacteria 10288
12 JGI24737J22298_10000776 3300001990 Bacteria 11303
13 JGI24737J22298_10000959 3300001990 Bacteria 10242
14 JGI24750J21931_1000558 3300002070 Bacteria 5702
15 JGI24738J21930_10000571 3300002075 Bacteria 10549
16 JGI24749J21850_1000591 3300002076 Bacteria 5287
17 JGI24035J26624_1000164 3300002126 Bacteria 6046
18 JGI24034J26672_10000323 3300002239 Bacteria 6166
19 JGI24742J22300_10000080 3300002244 Bacteria 13750
20 JGI25406J46586_10000018 3300003203 Bacteria 88860
21 JGI25404J52841_10006788 3300003659 Bacteria 2403
22 Ga0065716_1001726 3300005277 Bacteria 3775
23 Ga0065712_10009732 3300005290 Bacteria 2250
24 Ga0065712_10069678 3300005290 Bacteria 6896
25 Ga0065715_10001633 3300005293 Bacteria 8375
26 Ga0070658_10008040 3300005327 Bacteria 8479
27 Ga0070658_10034116 3300005327 Bacteria 4094
28 Ga0070683_100000289 3300005329 Bacteria 34698
29 Ga0070683_100064495 3300005329 Bacteria 3410
30 Ga0070690_100006047 3300005330 Bacteria 6846
31 Ga0070690_100010825 3300005330 Bacteria 5320
32 Ga0070670_100027675 3300005331 Bacteria 4877
33 Ga0070670_100108118 3300005331 Bacteria 2396
34 Ga0070677_10000043 3300005333 Bacteria 39363
35 Ga0068869_100002554 3300005334 Bacteria 10982
36 Ga0070666_10013513 3300005335 Bacteria 5182
37 Ga0070680_100008016 3300005336 Bacteria 8065
38 Ga0070680_100016633 3300005336 Bacteria 5790
39 Ga0070680_100035810 3300005336 Bacteria 4008
40 Ga0070680_100050316 3300005336 Bacteria 3399
41 Ga0070680_100170530 3300005336 Bacteria 1831
42 Ga0070682_100000528 3300005337 Bacteria 23870
43 Ga0070682_100040250 3300005337 Bacteria 2875
44 Ga0070682_100088047 3300005337 Bacteria 2026
45 Ga0068868_100000408 3300005338 Bacteria 29034
46 Ga0068868_100040736 3300005338 Bacteria 3616
47 Ga0070660_100011422 3300005339 Bacteria 6308
48 Ga0070660_100037116 3300005339 Bacteria 3693
49 Ga0070689_100000819 3300005340 Bacteria 19235
50 Ga0070689_100008559 3300005340 Bacteria 7212
51 Ga0070689_100068676 3300005340 Bacteria 2764
52 Ga0070691_10009402 3300005341 Bacteria 4461
53 Ga0070687_100000950 3300005343 Bacteria 9837
54 Ga0070661_100000314 3300005344 Bacteria 39090
55 Ga0070661_100008178 3300005344 Bacteria 7217
56 Ga0070692_10000310 3300005345 Bacteria 13896
57 Ga0070692_10037572 3300005345 Bacteria 2462
58 Ga0070668_100000857 3300005347 Bacteria 21127
59 Ga0070669_100005664 3300005353 Bacteria 9015
60 Ga0070669_100047495 3300005353 Bacteria 3132
61 Ga0070675_100004259 3300005354 Bacteria 10893
62 Ga0070675_100031348 3300005354 Bacteria 4298
63 Ga0070671_100000598 3300005355 Bacteria 25820
64 Ga0070671_100031256 3300005355 Bacteria 4397
65 Ga0070671_100223422 3300005355 Bacteria 1598
66 Ga0070674_100010763 3300005356 Bacteria 5545
67 Ga0070674_100404834 3300005356 Bacteria 1116
68 Ga0070673_100000289 3300005364 Bacteria 26187
69 Ga0070673_100244183 3300005364 Bacteria 1562
70 Ga0070688_100000189 3300005365 Bacteria 32631
71 Ga0070688_100005181 3300005365 Bacteria 6843
72 Ga0070688_100041426 3300005365 Bacteria 2827
73 Ga0070659_100075797 3300005366 Bacteria 2681
74 Ga0070667_100000436 3300005367 Bacteria 43897
75 Ga0070667_100016498 3300005367 Bacteria 6113
76 Ga0070667_100164712 3300005367 Bacteria 1955
77 Ga0070703_10002551 3300005406 Bacteria 5247
78 Ga0070709_10000652 3300005434 Bacteria 19741
79 Ga0070709_10001788 3300005434 Bacteria 11676
80 Ga0070709_10026083 3300005434 Bacteria 3459
81 Ga0070709_10029506 3300005434 Bacteria 3282
82 Ga0070714_100025604 3300005435 Bacteria 4870
83 Ga0070714_100026305 3300005435 Bacteria 4808
84 Ga0070714_100027072 3300005435 Bacteria 4744
85 Ga0070714_100037701 3300005435 Bacteria 4063
86 Ga0070714_100070473 3300005435 Bacteria 3022
87 Ga0070714_100093437 3300005435 Bacteria 2638
88 Ga0070714_100501986 3300005435 Bacteria 1157
89 Ga0070713_100001448 3300005436 Bacteria 15190
90 Ga0070713_100020933 3300005436 Bacteria 5022
91 Ga0070713_100024488 3300005436 Bacteria 4702
92 Ga0070713_100120238 3300005436 Bacteria 2302
93 Ga0070710_10001787 3300005437 Bacteria 10169
94 Ga0070710_10035536 3300005437 Bacteria 2717
95 Ga0070710_10105489 3300005437 Bacteria 1685
96 Ga0070701_10000106 3300005438 Bacteria 23737
97 Ga0070701_10009951 3300005438 Bacteria 4187
98 Ga0070701_10071269 3300005438 Bacteria 1858
99 Ga0070711_100001638 3300005439 Bacteria 12376
100 Ga0070711_100023208 3300005439 Bacteria 4031
101 Ga0070711_100071211 3300005439 Bacteria 2449
102 Ga0070711_100079140 3300005439 Bacteria 2337
103 Ga0070705_100000781 3300005440 Bacteria 17954
104 Ga0070705_100061455 3300005440 Bacteria 2233
105 Ga0070700_100001610 3300005441 Bacteria 11254
106 Ga0070694_100003956 3300005444 Bacteria 8867
107 Ga0070694_100005440 3300005444 Bacteria 7710
108 Ga0070663_100000297 3300005455 Bacteria 25442
109 Ga0070663_100050692 3300005455 Bacteria 2954
110 Ga0070663_100199561 3300005455 Bacteria 1560
111 Ga0070678_100001470 3300005456 Bacteria 12559
112 Ga0070678_100011789 3300005456 Bacteria 5407
113 Ga0070662_100035544 3300005457 Bacteria 3520
114 Ga0070662_100065036 3300005457 Bacteria 2672
115 Ga0070662_100172258 3300005457 Bacteria 1700
116 Ga0070681_10000645 3300005458 Bacteria 28768
117 Ga0070681_10022181 3300005458 Bacteria 6373
118 Ga0070681_10042512 3300005458 Bacteria 4553
119 Ga0070681_10109584 3300005458 Bacteria 2701
120 Ga0068867_100017453 3300005459 Bacteria 5098
121 Ga0070685_10034634 3300005466 Bacteria 2844
122 Ga0070685_10215413 3300005466 Bacteria 1255
123 Ga0070679_100060424 3300005530 Bacteria 3777
124 Ga0070679_100115293 3300005530 Bacteria 2672
125 Ga0070679_100185671 3300005530 Bacteria 2050
126 Ga0070679_100230727 3300005530 Bacteria 1810
127 Ga0070679_100510947 3300005530 Bacteria 1145
128 Ga0070684_100006705 3300005535 Bacteria 8926
129 Ga0070684_100015951 3300005535 Bacteria 6134
130 Ga0070684_100043054 3300005535 Bacteria 3898
131 Ga0068853_100007059 3300005539 Bacteria 8981
132 Ga0068853_100224896 3300005539 Bacteria 1715
133 Ga0070672_100000106 3300005543 Bacteria 41858
134 Ga0070672_100126117 3300005543 Bacteria 2100
135 Ga0070686_100000615 3300005544 Bacteria 20904
136 Ga0070686_100015365 3300005544 Bacteria 4433
137 Ga0070695_100001248 3300005545 Bacteria 13985
138 Ga0070695_100017930 3300005545 Bacteria 4295
139 Ga0070695_100029515 3300005545 Bacteria 3408
140 Ga0070695_100145569 3300005545 Bacteria 1648
141 Ga0070696_100008593 3300005546 Bacteria 6832
142 Ga0070696_100031040 3300005546 Bacteria 3660
143 Ga0070696_100059408 3300005546 Bacteria 2672
144 Ga0070696_100071909 3300005546 Bacteria 2435
145 Ga0070693_100071161 3300005547 Bacteria 2048
146 Ga0070693_100123149 3300005547 Bacteria 1611
147 Ga0070704_100004997 3300005549 Bacteria 7705
148 Ga0070704_100018272 3300005549 Bacteria 4479
149 Ga0068855_100053416 3300005563 Bacteria 4753
150 Ga0068855_100155675 3300005563 Bacteria 2596
151 Ga0070664_100017797 3300005564 Bacteria 5837
152 Ga0070664_100465762 3300005564 Bacteria 1162
153 Ga0068857_100000047 3300005577 Bacteria 67784
154 Ga0068854_100000502 3300005578 Bacteria 23837
155 Ga0068854_100059417 3300005578 Bacteria 2763
156 Ga0068856_100001905 3300005614 Bacteria 21761
157 Ga0068856_100361373 3300005614 Bacteria 1470
158 Ga0070702_100004825 3300005615 Bacteria 6199
159 Ga0070702_100031385 3300005615 Bacteria 2906
160 Ga0068852_100011300 3300005616 Bacteria 6716
161 Ga0068859_100005879 3300005617 Bacteria 12451
162 Ga0068859_100024931 3300005617 Bacteria 6003
163 Ga0068859_100202501 3300005617 Bacteria 2070
164 Ga0068864_100000931 3300005618 Bacteria 24535
165 Ga0068864_100116167 3300005618 Bacteria 2387
166 Ga0068866_10000077 3300005718 Bacteria 39340
167 Ga0068866_10014674 3300005718 Bacteria 3465
168 Ga0068861_100011038 3300005719 Bacteria 6278
169 Ga0068870_10001017 3300005840 Bacteria 11098
170 Ga0068863_100000543 3300005841 Bacteria 38366
171 Ga0068863_100036826 3300005841 Bacteria 4659
172 Ga0068858_100002073 3300005842 Bacteria 20401
173 Ga0068858_100028716 3300005842 Bacteria 5166
174 Ga0068858_100040985 3300005842 Bacteria 4295
175 Ga0068858_100258516 3300005842 Bacteria 1655
176 Ga0068860_100005115 3300005843 Bacteria 13336
177 Ga0068860_100034229 3300005843 Bacteria 4871
178 Ga0068862_100000879 3300005844 Bacteria 29265
179 Ga0068862_100013544 3300005844 Bacteria 6756
180 Ga0081455_10000007 3300005937 Bacteria 269394
181 Ga0081455_10000596 3300005937 Bacteria 46863
182 Ga0081455_10009848 3300005937 Bacteria 9788
183 Ga0081540_1000007 3300005983 Bacteria 205328
184 Ga0081540_1001222 3300005983 Bacteria 22443
185 Ga0081539_10000003 3300005985 Bacteria 594833
186 Ga0070717_10000287 3300006028 Bacteria 34051
187 Ga0070717_10136105 3300006028 Bacteria 2116
188 Ga0075368_10067462 3300006042 Bacteria 1440
189 Ga0075364_10203629 3300006051 Bacteria 1342
190 Ga0075432_10000660 3300006058 Bacteria 10552
191 Ga0070715_10000989 3300006163 Bacteria 7957
192 Ga0070716_100026935 3300006173 Bacteria 3082
193 Ga0070716_100043704 3300006173 Bacteria 2507
194 Ga0070712_100031048 3300006175 Bacteria 3596
195 Ga0070712_100083487 3300006175 Bacteria 2320
196 Ga0070712_100086846 3300006175 Bacteria 2281
197 Ga0070712_100174265 3300006175 Bacteria 1671
198 Ga0075362_10001028 3300006177 Bacteria 8594
199 Ga0075367_10026404 3300006178 Bacteria 3294
200 Ga0075367_10131271 3300006178 Bacteria 1548
201 Ga0097621_100000416 3300006237 Bacteria 29698
202 Ga0097621_100007350 3300006237 Bacteria 7877
203 Ga0097621_100201324 3300006237 Bacteria 1729
204 Ga0075370_10139642 3300006353 Bacteria 1416
205 Ga0068871_100000249 3300006358 Bacteria 37516
206 Ga0068871_100004813 3300006358 Bacteria 9439
207 Ga0075428_100047718 3300006844 Bacteria 4702
208 Ga0075430_100002807 3300006846 Bacteria 14570
209 Ga0075431_100013028 3300006847 Bacteria 8398
210 Ga0075433_10001150 3300006852 Bacteria 19214
211 Ga0075433_10151919 3300006852 Bacteria 2060
212 Ga0075434_100003092 3300006871 Bacteria 14816
213 Ga0075434_100003158 3300006871 Bacteria 14688
214 Ga0075434_100055769 3300006871 Bacteria 3926
215 Ga0075434_100067393 3300006871 Bacteria 3565
216 Ga0075429_100001089 3300006880 Bacteria 21839
217 Ga0068865_100000248 3300006881 Bacteria 30110
218 Ga0068865_100065099 3300006881 Bacteria 2567
219 Ga0075436_100015431 3300006914 Bacteria 5230
220 Ga0075436_100069651 3300006914 Bacteria 2431
221 Ga0097620_100005879 3300006931 Bacteria 12451
222 Ga0097620_100024931 3300006931 Bacteria 6003
223 Ga0097620_100202511 3300006931 Bacteria 2070
224 Ga0075435_100040427 3300007076 Bacteria 3723
225 Ga0075435_100211730 3300007076 Bacteria 1645
226 Ga0075435_100258996 3300007076 Unclassified 1482
227 Ga0099795_10004304 3300007788 Bacteria 3656
228 Ga0105251_10019615 3300009011 Bacteria 3567
229 Ga0105251_10028839 3300009011 Bacteria 2801
230 Ga0105240_10034168 3300009093 Bacteria 6562
231 Ga0105240_10150755 3300009093 Bacteria 2769
232 Ga0105240_10234711 3300009093 Bacteria 2129
233 Ga0111539_10002489 3300009094 Bacteria 24423
234 Ga0111539_10002685 3300009094 Bacteria 23545
235 Ga0111539_10013785 3300009094 Bacteria 10099
236 Ga0105245_10016985 3300009098 Bacteria 6352
237 Ga0105245_10619033 3300009098 Bacteria 1111
238 Ga0105247_10000908 3300009101 Bacteria 22289
239 Ga0114129_10035354 3300009147 Bacteria 7058
240 Ga0114129_10094866 3300009147 Bacteria 4132
241 Ga0105243_10001705 3300009148 Bacteria 18936
242 Ga0105243_10022992 3300009148 Bacteria 4741
243 Ga0105241_10002306 3300009174 Bacteria 14330
244 Ga0105241_10085108 3300009174 Bacteria 2484
245 Ga0105242_10001376 3300009176 Bacteria 19167
246 Ga0105242_10052448 3300009176 Bacteria 3328
247 Ga0105242_10232853 3300009176 Bacteria 1652
248 Ga0105248_10016671 3300009177 Bacteria 8087
249 Ga0105248_10248698 3300009177 Bacteria 2001
250 Ga0105237_10002245 3300009545 Bacteria 24070
251 Ga0105237_10041271 3300009545 Bacteria 4654
252 Ga0105237_10089865 3300009545 Bacteria 3061
253 Ga0105238_10094377 3300009551 Bacteria 2979
254 Ga0105249_10000476 3300009553 Bacteria 37263
255 Ga0105249_10032161 3300009553 Bacteria 4745
256 Ga0105249_10136831 3300009553 Bacteria 2345
257 Ga0105249_10398243 3300009553 Bacteria 1406
258 Ga0099796_10000894 3300010159 Bacteria 5532
259 Ga0105239_10015033 3300010375 Bacteria 8581
260 Ga0105239_10179657 3300010375 Bacteria 2368
261 Ga0105239_10389036 3300010375 Bacteria 1577
262 Ga0105246_10000057 3300011119 Bacteria 44951
263 Ga0157338_1000271 3300012515 Bacteria 2787
264 Ga0157371_10013856 3300013102 Bacteria 6108
265 Ga0157371_10141930 3300013102 Bacteria 1711
266 Ga0157369_10438364 3300013105 Bacteria 1353
267 Ga0157374_10032430 3300013296 Bacteria 4756
268 Ga0157374_10040397 3300013296 Bacteria 4296
269 Ga0157378_10146161 3300013297 Bacteria 2199
270 Ga0163162_10001937 3300013306 Bacteria 19439
271 Ga0163162_10075749 3300013306 Bacteria 3425
272 Ga0157375_10001755 3300013308 Bacteria 18608
273 Ga0157375_10054765 3300013308 Bacteria 3930
274 Ga0157375_10069926 3300013308 Bacteria 3518
275 Ga0157375_10551290 3300013308 Bacteria 1314
276 Ga0163163_10001266 3300014325 Bacteria 21327
277 Ga0163163_10002439 3300014325 Bacteria 15729
278 Ga0163163_10003757 3300014325 Bacteria 12927
279 Ga0163163_10101927 3300014325 Bacteria 2893
280 Ga0157380_10002615 3300014326 Bacteria 12181
281 Ga0182008_10079253 3300014497 Bacteria 1616
282 Ga0157377_10002633 3300014745 Bacteria 7965
283 Ga0157377_10019882 3300014745 Bacteria 3512
284 Ga0157379_10000293 3300014968 Bacteria 39625
285 Ga0157379_10004953 3300014968 Bacteria 11423
286 Ga0157379_10062321 3300014968 Bacteria 3336
287 Ga0157379_10084734 3300014968 Bacteria 2840
288 Ga0157379_10140761 3300014968 Bacteria 2175
289 Ga0157376_10000531 3300014969 Bacteria 24495
290 Ga0157376_10349106 3300014969 Bacteria 1415
291 Ga0163161_10000209 3300017792 Bacteria 53534
292 Ga0206353_11779653 3300020082 Bacteria 1594
293 Ga0213873_10014165 3300021358 Bacteria 1763
294 Ga0213876_10008652 3300021384 Bacteria 5507
295 Ga0207666_1000353 3300025271 Bacteria 6302
296 Ga0207697_10000044 3300025315 Bacteria 48337
297 Ga0207697_10011939 3300025315 Bacteria 3658
298 Ga0207653_10011921 3300025885 Bacteria 2711
299 Ga0207682_10000260 3300025893 Bacteria 23782
300 Ga0207692_10001125 3300025898 Bacteria 9843
301 Ga0207692_10001993 3300025898 Bacteria 7798
302 Ga0207692_10020685 3300025898 Bacteria 2998
303 Ga0207692_10081832 3300025898 Bacteria 1729
304 Ga0207642_10000807 3300025899 Bacteria 9746
305 Ga0207642_10175617 3300025899 Bacteria 1163
306 Ga0207710_10003110 3300025900 Bacteria 7435
307 Ga0207710_10009956 3300025900 Bacteria 3997
308 Ga0207688_10012079 3300025901 Bacteria 4698
309 Ga0207647_10004419 3300025904 Bacteria 10421
310 Ga0207647_10006899 3300025904 Bacteria 8230
311 Ga0207699_10000253 3300025906 Bacteria 29543
312 Ga0207699_10006701 3300025906 Bacteria 5590
313 Ga0207645_10000344 3300025907 Bacteria 38826
314 Ga0207643_10000012 3300025908 Bacteria 133318
315 Ga0207705_10012927 3300025909 Bacteria 6023
316 Ga0207705_10258921 3300025909 Bacteria 1328
317 Ga0207654_10036113 3300025911 Bacteria 2759
318 Ga0207707_10018209 3300025912 Bacteria 6122
319 Ga0207707_10036720 3300025912 Bacteria 4283
320 Ga0207707_10116020 3300025912 Bacteria 2340
321 Ga0207695_10077441 3300025913 Bacteria 3377
322 Ga0207671_10022324 3300025914 Bacteria 4786
323 Ga0207693_10000861 3300025915 Bacteria 27070
324 Ga0207693_10002835 3300025915 Bacteria 15018
325 Ga0207693_10024218 3300025915 Bacteria 4820
326 Ga0207693_10056378 3300025915 Bacteria 3081
327 Ga0207693_10108204 3300025915 Bacteria 2181
328 Ga0207693_10170006 3300025915 Bacteria 1717
329 Ga0207693_10191176 3300025915 Bacteria 1611
330 Ga0207693_10208285 3300025915 Bacteria 1537
331 Ga0207663_10014464 3300025916 Bacteria 4320
332 Ga0207663_10033471 3300025916 Bacteria 3062
333 Ga0207663_10083699 3300025916 Bacteria 2096
334 Ga0207660_10000992 3300025917 Bacteria 18816
335 Ga0207662_10000216 3300025918 Bacteria 26834
336 Ga0207662_10004775 3300025918 Bacteria 7163
337 Ga0207662_10158640 3300025918 Bacteria 1444
338 Ga0207657_10000358 3300025919 Bacteria 48238
339 Ga0207657_10012419 3300025919 Bacteria 8416
340 Ga0207657_10036149 3300025919 Bacteria 4423
341 Ga0207657_10223741 3300025919 Bacteria 1507
342 Ga0207649_10000545 3300025920 Bacteria 26032
343 Ga0207652_10012964 3300025921 Bacteria 6745
344 Ga0207652_10016404 3300025921 Bacteria 6048
345 Ga0207652_10234747 3300025921 Bacteria 1653
346 Ga0207681_10000684 3300025923 Bacteria 22260
347 Ga0207681_10173205 3300025923 Bacteria 1637
348 Ga0207694_10083458 3300025924 Bacteria 2512
349 Ga0207694_10280239 3300025924 Bacteria 1369
350 Ga0207650_10016372 3300025925 Bacteria 5183
351 Ga0207650_10133430 3300025925 Bacteria 1945
352 Ga0207659_10000023 3300025926 Bacteria 142947
353 Ga0207659_10008259 3300025926 Bacteria 6453
354 Ga0207687_10000149 3300025927 Bacteria 46713
355 Ga0207687_10025507 3300025927 Bacteria 3955
356 Ga0207700_10011168 3300025928 Bacteria 5716
357 Ga0207700_10018517 3300025928 Bacteria 4682
358 Ga0207700_10093579 3300025928 Bacteria 2379
359 Ga0207700_10097830 3300025928 Bacteria 2333
360 Ga0207700_10165286 3300025928 Bacteria 1841
361 Ga0207664_10005618 3300025929 Bacteria 8581
362 Ga0207664_10015064 3300025929 Bacteria 5602
363 Ga0207664_10029498 3300025929 Bacteria 4179
364 Ga0207664_10067530 3300025929 Bacteria 2870
365 Ga0207644_10007018 3300025931 Bacteria 7334
366 Ga0207644_10088757 3300025931 Bacteria 2300
367 Ga0207690_10000203 3300025932 Bacteria 46451
368 Ga0207690_10034350 3300025932 Bacteria 3267
369 Ga0207690_10307345 3300025932 Bacteria 1243
370 Ga0207706_10002188 3300025933 Bacteria 19056
371 Ga0207706_10008175 3300025933 Bacteria 9651
372 Ga0207706_10023762 3300025933 Bacteria 5500
373 Ga0207686_10001306 3300025934 Bacteria 14268
374 Ga0207686_10004009 3300025934 Bacteria 7903
375 Ga0207709_10000852 3300025935 Bacteria 23321
376 Ga0207670_10005646 3300025936 Bacteria 6883
377 Ga0207669_10000357 3300025937 Bacteria 20792
378 Ga0207669_10108343 3300025937 Bacteria 1855
379 Ga0207704_10002400 3300025938 Bacteria 8418
380 Ga0207704_10070427 3300025938 Bacteria 2214
381 Ga0207665_10000259 3300025939 Bacteria 36733
382 Ga0207665_10011108 3300025939 Bacteria 5907
383 Ga0207665_10019210 3300025939 Bacteria 4490
384 Ga0207665_10213324 3300025939 Bacteria 1411
385 Ga0207691_10000256 3300025940 Bacteria 52748
386 Ga0207691_10328719 3300025940 Bacteria 1310
387 Ga0207711_10011944 3300025941 Bacteria 7218
388 Ga0207711_10020618 3300025941 Bacteria 5500
389 Ga0207689_10000565 3300025942 Bacteria 35394
390 Ga0207689_10028355 3300025942 Bacteria 4684
391 Ga0207661_10000104 3300025944 Bacteria 53977
392 Ga0207679_10000196 3300025945 Bacteria 48433
393 Ga0207679_10052994 3300025945 Bacteria 2978
394 Ga0207679_10392934 3300025945 Bacteria 1218
395 Ga0207667_10032029 3300025949 Bacteria 5668
396 Ga0207667_10219249 3300025949 Bacteria 1949
397 Ga0207667_10337495 3300025949 Bacteria 1538
398 Ga0207651_10001138 3300025960 Bacteria 11864
399 Ga0207712_10000967 3300025961 Bacteria 20676
400 Ga0207712_10027564 3300025961 Bacteria 3794
401 Ga0207712_10117974 3300025961 Bacteria 2002
402 Ga0207668_10000251 3300025972 Bacteria 35861
403 Ga0207668_10103480 3300025972 Bacteria 2120
404 Ga0207640_10000157 3300025981 Bacteria 49126
405 Ga0207640_10099634 3300025981 Bacteria 2034
406 Ga0207658_10010507 3300025986 Bacteria 6288
407 Ga0207658_10031355 3300025986 Bacteria 3774
408 Ga0207658_10086998 3300025986 Bacteria 2412
409 Ga0207658_10119225 3300025986 Bacteria 2100
410 Ga0207677_10000609 3300026023 Bacteria 22003
411 Ga0207703_10007245 3300026035 Bacteria 8820
412 Ga0207703_10044502 3300026035 Bacteria 3568
413 Ga0207639_10002440 3300026041 Bacteria 12492
414 Ga0207639_10113773 3300026041 Bacteria 2210
415 Ga0207639_10171693 3300026041 Bacteria 1837
416 Ga0207678_10001125 3300026067 Bacteria 24491
417 Ga0207678_10055203 3300026067 Bacteria 3422
418 Ga0207708_10000365 3300026075 Bacteria 35380
419 Ga0207708_10015747 3300026075 Bacteria 5673
420 Ga0207702_10003955 3300026078 Bacteria 13300
421 Ga0207702_10163742 3300026078 Bacteria 2033
422 Ga0207702_10193556 3300026078 Bacteria 1881
423 Ga0207702_10238400 3300026078 Bacteria 1703
424 Ga0207702_10281855 3300026078 Bacteria 1571
425 Ga0207641_10002938 3300026088 Bacteria 15413
426 Ga0207648_10000341 3300026089 Bacteria 51269
427 Ga0207648_10023831 3300026089 Bacteria 5474
428 Ga0207648_10154534 3300026089 Bacteria 2025
429 Ga0207676_10004494 3300026095 Bacteria 9861
430 Ga0207676_10012794 3300026095 Bacteria 6021
431 Ga0207676_10450453 3300026095 Bacteria 1213
432 Ga0207674_10001078 3300026116 Bacteria 35464
433 Ga0207675_100003271 3300026118 Bacteria 15865
434 Ga0207675_100072959 3300026118 Bacteria 3210
435 Ga0207675_100160135 3300026118 Bacteria 2146
436 Ga0207683_10000006 3300026121 Bacteria 181260
437 Ga0209995_1019384 3300027471 Bacteria 1123
438 Ga0209966_1001700 3300027695 Bacteria 3741
439 Ga0209966_1002101 3300027695 Bacteria 3327
440 Ga0209998_10000862 3300027717 Bacteria 7798
441 Ga0209998_10001803 3300027717 Bacteria 5069
442 Ga0209998_10043599 3300027717 Bacteria 1024
443 Ga0209974_10002661 3300027876 Bacteria 6469
444 Ga0209974_10067284 3300027876 Bacteria 1218
445 Ga0207428_10000165 3300027907 Bacteria 91701
446 Ga0207428_10000446 3300027907 Bacteria 50240
447 Ga0207428_10001251 3300027907 Bacteria 27203
448 Ga0207428_10301325 3300027907 Bacteria 1186
449 Ga0268266_10016010 3300028379 Bacteria 6413
450 Ga0268265_10001687 3300028380 Bacteria 18006
451 Ga0268265_10036385 3300028380 Bacteria 3605
452 Ga0268264_10002029 3300028381 Bacteria 18124
453 Ga0268264_10018354 3300028381 Bacteria 5720
454 Ga0265337_1014277 3300028556 Bacteria 2636
455 Ga0265326_10055246 3300028558 Bacteria 1123
456 Ga0265338_10035840 3300028800 Bacteria 4758
457 Ga0265338_10045038 3300028800 Bacteria 4063
458 Ga0265330_10009899 3300031235 Bacteria 4512
459 Ga0265328_10016980 3300031239 Bacteria 2824
460 Ga0265328_10053514 3300031239 Bacteria 1481
461 Ga0265325_10000026 3300031241 Bacteria 109937
462 Ga0265325_10015162 3300031241 Bacteria 4340
463 Ga0265325_10021617 3300031241 Bacteria 3531
464 Ga0265325_10036642 3300031241 Bacteria 2597
465 Ga0265340_10023909 3300031247 Bacteria 3109
466 Ga0265339_10000047 3300031249 Bacteria 110601
467 Ga0265331_10001610 3300031250 Bacteria 16482
468 Ga0265331_10018492 3300031250 Bacteria 3613
469 Ga0265327_10033231 3300031251 Bacteria 2877
470 Ga0265316_10171986 3300031344 Bacteria 1616
471 Ga0265316_10182372 3300031344 Bacteria 1562
472 Ga0265313_10000069 3300031595 Bacteria 100065
473 Ga0265313_10000794 3300031595 Bacteria 31959
474 Ga0265313_10013073 3300031595 Bacteria 5013
475 Ga0265313_10020093 3300031595 Bacteria 3695
476 Ga0265313_10024594 3300031595 Bacteria 3213
477 Ga0265313_10053103 3300031595 Bacteria 1930
478 Ga0265313_10069204 3300031595 Bacteria 1629
479 Ga0265313_10093900 3300031595 Bacteria 1342
480 Ga0316579_10087297 3300031691 Bacteria 1488
481 Ga0265314_10005328 3300031711 Bacteria 11638
482 Ga0265314_10022387 3300031711 Bacteria 4840
483 Ga0265342_10000502 3300031712 Bacteria 41908
484 Ga0307413_10268530 3300031824 Bacteria 1276
485 Ga0307406_10049692 3300031901 Bacteria 2655
486 Ga0307409_100061827 3300031995 Bacteria 2928
487 Ga0307415_100103966 3300032126 Bacteria 2091
488 Ga0316593_10089675 3300032168 Bacteria 1082
489 Ga0307510_10005901 3300033180 Bacteria 14608
490 Ga0373930_0002826 3300034816 Bacteria 2719
491 Ga0373948_0000248 3300034817 Bacteria 6472
492 Ga0373950_0022322 3300034818 Bacteria 1125
493 Ga0373958_0000204 3300034819 Bacteria 6946
494 Ga0373958_0001259 3300034819 Bacteria 3386
495 Ga0373958_0003604 3300034819 Bacteria 2244
496 Ga0373959_0004004 3300034820 Bacteria 2360
497 Ga0373959_0004649 3300034820 Bacteria 2222
498 Ga0373938_0000103 3300034957 Bacteria 11575
499 Ga0373938_0001026 3300034957 Bacteria 4492
500 Ga0373928_0001804 3300035084 Bacteria 4170
501 Ga0373928_0002065 3300035084 Bacteria 3912
502 Ga0373929_0002152 3300035085 Bacteria 3656
503 Ga0373929_0009691 3300035085 Bacteria 1790
504 Ga0373934_0031646 3300035086 Bacteria 2072
505 Ga0373944_0002070 3300035089 Bacteria 5089
506 Ga0373949_0002185 3300035090 Bacteria 5118
507 Ga0373949_0009483 3300035090 Bacteria 2132
508 Ga0373951_0001067 3300035091 Bacteria 7345
509 Ga0373951_0001578 3300035091 Bacteria 5976
510 Ga0373951_0004467 3300035091 Bacteria 3321
511 Ga0373952_0002272 3300035092 Bacteria 3458
512 Ga0373952_0004667 3300035092 Bacteria 2491
513 Ga0373952_0007374 3300035092 Bacteria 2060
514 Ga0373932_0000763 3300035112 Bacteria 9537
515 Ga0373932_0002253 3300035112 Bacteria 4938
516 Ga0373932_0034093 3300035112 Bacteria 1433
517 Ga0373936_0002079 3300035113 Bacteria 7426
518 Ga0373939_0000538 3300035114 Bacteria 9510
519 Ga0373939_0001474 3300035114 Bacteria 5703
520 Ga0373939_0004190 3300035114 Bacteria 3400
521 Ga0373939_0006376 3300035114 Bacteria 2840
522 Ga0373939_0011217 3300035114 Bacteria 2257
523 Ga0373941_0003546 3300035115 Bacteria 3544
524 Ga0373945_0004056 3300035116 Bacteria 4634
525 Ga0373945_0027667 3300035116 Bacteria 1982
526 Ga0373953_0004398 3300035117 Bacteria 4490
527 Ga0373954_0003827 3300035118 Bacteria 6434
528 Ga0373954_0004751 3300035118 Bacteria 5857
529 Ga0373954_0016066 3300035118 Bacteria 3349
530 Ga0373956_0007108 3300035119 Bacteria 4504
531 Ga0373956_0039789 3300035119 Bacteria 2085
532 Ga0373956_0072658 3300035119 Bacteria 1571
533 Ga0373957_0002588 3300035120 Bacteria 5190
534 Ga0373957_0040020 3300035120 Bacteria 1761
535 Ga0373960_0000016 3300035121 Bacteria 21415
536 Ga0373943_0010246 3300035170 Bacteria 4204
537 Ga0373943_0019971 3300035170 Bacteria 3085
538 Ga0373943_0030538 3300035170 Bacteria 2551
539 Ga0373943_0031519 3300035170 Bacteria 2515
540 Ga0373946_0000794 3300035171 Bacteria 10763
541 Ga0373946_0040304 3300035171 Bacteria 1910
542 Ga0373955_0001006 3300035172 Bacteria 11984
543 Ga0373955_0001974 3300035172 Bacteria 8836
544 Ga0373955_0003538 3300035172 Bacteria 6874
545 Ga0373955_0015930 3300035172 Bacteria 3690
546 Ga0373955_0024053 3300035172 Bacteria 3110
547 Ga0373942_0001481 3300035207 Bacteria 6042
548 Ga0373942_0004423 3300035207 Bacteria 3263
549 Ga0373961_0003830 3300035241 Bacteria 3676
550 Ga0373961_0003885 3300035241 Bacteria 3646
551 Ga0373961_0005277 3300035241 Bacteria 3108
552 Ga0373962_0000149 3300035242 Bacteria 14459
553 Ga0373962_0000620 3300035242 Bacteria 8028
554 Ga0373962_0001044 3300035242 Bacteria 6427
555 Ga0373924_0001761 3300035410 Bacteria 7148
556 Ga0373931_0002359 3300035691 Bacteria 8345
557 Ga0373931_0004026 3300035691 Bacteria 6658
558 Ga0373931_0012885 3300035691 Bacteria 4061
559 Ga0373931_0035211 3300035691 Bacteria 2601
560 Ga0373935_0003725 3300035692 Bacteria 8896
561 Ga0373935_0074363 3300035692 Bacteria 2196
562 Ga0373927_0014192 3300035695 Bacteria 5282
563 Ga0373927_0019295 3300035695 Bacteria 4472
564 Ga0373927_0022483 3300035695 Bacteria 4131
565 Ga0373933_0003044 3300035724 Bacteria 9355
566 Ga0373933_0007407 3300035724 Bacteria 5985
567 Ga0373933_0014720 3300035724 Bacteria 4353
568 Ga0373947_0048824 3300035725 Bacteria 2540
569 Ga0373947_0058914 3300035725 Bacteria 2327
570 Ga0373937_0001830 3300036401 Bacteria 17860
571 Ga0373937_0003591 3300036401 Bacteria 13079
572 Ga0373937_0003746 3300036401 Bacteria 12849
573 Ga0373937_0018802 3300036401 Bacteria 6176
574 Ga0373937_0026471 3300036401 Bacteria 5242
575 Ga0373925_0004912 3300037068 Bacteria 10054
576 Ga0395899_0055599 3300037312 Bacteria 2927
577 Ga0395900_0001539 3300037418 Bacteria 27389
578 Ga0395900_0014500 3300037418 Bacteria 8041
579 Ga0395900_0065578 3300037418 Bacteria 3731
580 Ga0395898_0018398 3300037466 Bacteria 7124
581 Ga0395898_0053996 3300037466 Bacteria 3922
582 Ga0395901_0019085 3300038443 Bacteria 7011
583 Ga0436365_0276616 3300039437 Bacteria 4975
584 Ga0436365_0340427 3300039437 Bacteria 11316
585 Ga0436365_1108063 3300039437 Bacteria 1634
586 Ga0436365_1744975 3300039437 Bacteria 17913
587 Ga0436365_1793855 3300039437 Bacteria 1997
588 Ga0436360_0620291 3300039438 Unclassified 1164
589 Ga0436363_0159755 3300039450 Bacteria 5310
590 Ga0436363_0547396 3300039450 Bacteria 1403
591 Ga0439448_0030523 3300042005 Bacteria 1710
592 Ga0466963_0040811 3300044694 Bacteria 3042
593 Ga0466963_0048614 3300044694 Bacteria 2803
594 Ga0453684_0030893 3300044712 Bacteria 7552
595 Ga0466971_0084811 3300044719 Bacteria 1447
596 Ga0466957_0264414 3300044842 Bacteria 1147
597 Ga0451576_0016162 3300045051 Bacteria 8246
598 Ga0466958_0175418 3300045836 Bacteria 1359
599 Ga0466967_0007437 3300045976 Bacteria 7900
600 Ga0466967_0447170 3300045976 Bacteria 1263
601 Ga0495617_049441 3300046452 Bacteria 1399
602 Ga0495592_0002638 3300046454 Bacteria 12675
603 Ga0495592_0010694 3300046454 Bacteria 6919
604 Ga0495592_0254498 3300046454 Bacteria 1159
605 Ga0495603_0015087 3300046455 Bacteria 4673
606 Ga0495629_0000908 3300046459 Bacteria 23774
607 Ga0495629_0008943 3300046459 Bacteria 7357
608 Ga0495629_0028960 3300046459 Bacteria 3930
609 Ga0495629_0065245 3300046459 Bacteria 2542
610 Ga0495629_0072282 3300046459 Bacteria 2407
611 Ga0495629_0091414 3300046459 Bacteria 2124
612 Ga0495641_0013745 3300046461 Bacteria 4424
613 Ga0495641_0068989 3300046461 Bacteria 1589
614 Ga0495651_0010375 3300046462 Bacteria 7157
615 Ga0495651_0015811 3300046462 Bacteria 5842
616 Ga0495651_0031843 3300046462 Bacteria 4111
617 Ga0495651_0035348 3300046462 Bacteria 3891
618 Ga0495651_0042107 3300046462 Bacteria 3546
619 Ga0495653_0161929 3300046463 Bacteria 1552
620 Ga0495580_0038175 3300046472 Bacteria 3441
621 Ga0495582_0013116 3300046473 Bacteria 4562
622 Ga0495662_0002314 3300046476 Bacteria 9607
623 Ga0495664_0019528 3300046477 Bacteria 3897
624 Ga0495664_0031623 3300046477 Bacteria 3103
625 Ga0495664_0056004 3300046477 Bacteria 2345
626 Ga0495585_0004760 3300046492 Bacteria 8737
627 Ga0495607_0016632 3300046501 Bacteria 4744
628 Ga0495606_0002132 3300046507 Bacteria 23896
629 Ga0495608_0010351 3300046511 Bacteria 6508
630 Ga0495608_0013583 3300046511 Bacteria 5648
631 Ga0495608_0029442 3300046511 Bacteria 3723
632 Ga0495618_0019969 3300046514 Bacteria 4123
633 Ga0495618_0086748 3300046514 Bacteria 2001
634 Ga0495628_0000115 3300046516 Bacteria 65159
635 Ga0495628_0048362 3300046516 Bacteria 3371
636 Ga0495628_0075930 3300046516 Bacteria 2616
637 Ga0495628_0343576 3300046516 Bacteria 1098
638 Ga0495630_0103854 3300046517 Bacteria 2150
639 Ga0495637_0052229 3300046520 Unclassified 1707
640 Ga0495644_0000983 3300046523 Bacteria 11834
641 Ga0495666_0012543 3300046526 Bacteria 4225
642 Ga0495652_0001117 3300046529 Bacteria 30393
643 Ga0495652_0007929 3300046529 Bacteria 9747
644 Ga0495652_0013930 3300046529 Bacteria 7229
645 Ga0495652_0027254 3300046529 Bacteria 5036
646 Ga0495665_0010075 3300046531 Bacteria 5121
647 Ga0495640_0035855 3300046533 Bacteria 3509
648 Ga0495640_0062405 3300046533 Bacteria 2527
649 Ga0495640_0110846 3300046533 Unclassified 1793
650 Ga0495586_0048068 3300046535 Bacteria 2304
651 Ga0495587_0006245 3300046536 Bacteria 7779
652 Ga0495587_0019798 3300046536 Bacteria 4160
653 Ga0495598_0020568 3300046537 Unclassified 1744
654 Ga0495609_0140321 3300046538 Bacteria 1031
655 Ga0495645_0010751 3300046543 Bacteria 6431
656 Ga0495645_0018002 3300046543 Bacteria 5069
657 Ga0495645_0113080 3300046543 Bacteria 1919
658 Ga0495622_0003333 3300046557 Bacteria 7587
659 Ga0495622_0071727 3300046557 Bacteria 1598
660 Ga0495633_0008234 3300046558 Bacteria 5898
661 Ga0495667_0000674 3300046559 Bacteria 21859
662 Ga0495667_0003600 3300046559 Bacteria 10422
663 Ga0495667_0017680 3300046559 Bacteria 4816
664 Ga0495667_0018730 3300046559 Bacteria 4674
665 Ga0495667_0026205 3300046559 Bacteria 3927
666 Ga0495656_0000789 3300046615 Bacteria 10214
667 Ga0495634_0038239 3300046642 Bacteria 3272
668 Ga0495634_0080129 3300046642 Bacteria 2137
669 Ga0495634_0099766 3300046642 Bacteria 1877
670 Ga0495625_0116833 3300046660 Bacteria 1819
671 Ga0495635_0002598 3300046663 Bacteria 12359
672 Ga0495635_0009000 3300046663 Bacteria 6965
673 Ga0495635_0025046 3300046663 Bacteria 4157
674 Ga0495635_0111734 3300046663 Bacteria 1866
675 Ga0495659_0005270 3300046664 Bacteria 4068
676 Ga0495588_0020105 3300046674 Bacteria 3276
677 Ga0495588_0198236 3300046674 Bacteria 1060
678 Ga0495657_0011216 3300046675 Bacteria 6713
679 Ga0495657_0014159 3300046675 Bacteria 5860
680 Ga0495599_0007091 3300046678 Bacteria 6786
681 Ga0495599_0031443 3300046678 Bacteria 3332
682 Ga0495623_0002539 3300046679 Bacteria 12066
683 Ga0495623_0021243 3300046679 Bacteria 4193
684 Ga0495646_0002845 3300046680 Bacteria 10710
685 Ga0495646_0020414 3300046680 Bacteria 4191
686 Ga0495646_0043834 3300046680 Bacteria 2737
687 Ga0495646_0118237 3300046680 Bacteria 1502
688 Ga0495647_0006115 3300046681 Bacteria 3969
689 Ga0495647_0008529 3300046681 Plasmid 3447
690 Ga0495658_0000673 3300046683 Bacteria 18551
691 Ga0495613_0058540 3300046689 Bacteria 2827
692 Ga0495613_0168647 3300046689 Bacteria 1554
693 Ga0495624_0004039 3300046690 Bacteria 10793
694 Ga0495624_0137077 3300046690 Bacteria 1500
695 Ga0495670_0000479 3300046691 Bacteria 18937
696 Ga0495671_0036634 3300046692 Bacteria 2484
697 Ga0495600_0000876 3300046809 Bacteria 16075
698 Ga0495600_0055592 3300046809 Bacteria 2585
699 Ga0495600_0077847 3300046809 Bacteria 2166
700 Ga0495600_0151915 3300046809 Bacteria 1499
701 Ga0495581_0006390 3300047315 Bacteria 6837
702 Ga0495604_0000619 3300047317 Bacteria 30531
703 Ga0495604_0001990 3300047317 Bacteria 16501
704 Ga0495604_0009299 3300047317 Bacteria 7781
705 Ga0495674_0005221 3300047319 Bacteria 12468
706 Ga0495674_0069477 3300047319 Bacteria 3045
707 Ga0495672_0119466 3300047320 Bacteria 1403
708 Ga0495676_0022034 3300047321 Bacteria 5552
709 Ga0495676_0206799 3300047321 Unclassified 1360
710 Ga0495680_0002310 3300047322 Bacteria 19589
711 Ga0495680_0002967 3300047322 Bacteria 16971
712 Ga0495680_0019825 3300047322 Bacteria 5670
713 Ga0495680_0026626 3300047322 Bacteria 4763
714 Ga0495675_0029011 3300047444 Bacteria 3527
715 Ga0495675_0075594 3300047444 Bacteria 2123
716 Ga0495684_0003464 3300047471 Bacteria 12344
717 Ga0495684_0071240 3300047471 Bacteria 2641
718 Ga0495684_0129934 3300047471 Bacteria 1893
719 Ga0495593_0003537 3300047673 Bacteria 9347
720 Ga0495593_0053418 3300047673 Bacteria 2133
721 Ga0495602_0003665 3300048088 Bacteria 15920
722 Ga0495602_0030986 3300048088 Bacteria 5063
723 Ga0495602_0078472 3300048088 Bacteria 2789
724 Ga0495602_0098047 3300048088 Bacteria 2413
725 Ga0496100_0004411 3300048903 Bacteria 7456
726 Ga0496100_0006203 3300048903 Bacteria 6501
727 Ga0496100_0064055 3300048903 Bacteria 2431
728 Ga0496100_0198714 3300048903 Bacteria 1460
729 Ga0496100_0249691 3300048903 Bacteria 1312
730 Ga0496101_0000464 3300048904 Bacteria 25674
731 Ga0496101_0009586 3300048904 Bacteria 6368
732 Ga0496101_0108048 3300048904 Bacteria 2091
733 Ga0496101_0341825 3300048904 Bacteria 1175
734 Ga0496102_0001120 3300048905 Bacteria 24582
735 Ga0496102_0032062 3300048905 Bacteria 4720
736 Ga0496102_0120448 3300048905 Bacteria 2450
737 Ga0496102_0221629 3300048905 Bacteria 1783
738 Ga0496102_0483063 3300048905 Bacteria 1160
739 Ga0496103_0000611 3300048906 Bacteria 27883
740 Ga0496103_0071919 3300048906 Bacteria 2165
741 Ga0496104_0000279 3300048907 Bacteria 45192
742 Ga0496104_0000299 3300048907 Bacteria 43965
743 Ga0496104_0004500 3300048907 Bacteria 12143
744 Ga0496104_0014336 3300048907 Bacteria 7158
745 Ga0496104_0022589 3300048907 Bacteria 5777
746 Ga0496104_0060191 3300048907 Bacteria 3597
747 Ga0496104_0105923 3300048907 Bacteria 2694
748 Ga0496104_0125360 3300048907 Bacteria 2466
749 Ga0496104_0239644 3300048907 Bacteria 1726
750 Ga0496104_0264810 3300048907 Bacteria 1631
751 Ga0496104_0385638 3300048907 Bacteria 1313
752 Ga0496104_0571857 3300048907 Bacteria 1040
753 Ga0496105_0000157 3300048908 Bacteria 45010
754 Ga0496105_0001270 3300048908 Bacteria 17643
755 Ga0496105_0052802 3300048908 Bacteria 3357
756 Ga0496105_0053668 3300048908 Bacteria 3329
757 Ga0496105_0114051 3300048908 Bacteria 2229
758 Ga0496106_0000541 3300048909 Bacteria 26824
759 Ga0496106_0041084 3300048909 Bacteria 3465
760 Ga0496106_0057223 3300048909 Bacteria 2948
761 Ga0496106_0147036 3300048909 Bacteria 1857
762 Ga0496107_0001684 3300048910 Bacteria 13835
763 Ga0496107_0003483 3300048910 Bacteria 10525
764 Ga0496107_0018855 3300048910 Bacteria 4863
765 Ga0496107_0041412 3300048910 Bacteria 3306
766 Ga0496108_0000660 3300048911 Bacteria 26581
767 Ga0496108_0000938 3300048911 Bacteria 22748
768 Ga0496108_0003134 3300048911 Bacteria 13290
769 Ga0496108_0020932 3300048911 Bacteria 5378
770 Ga0496108_0061584 3300048911 Bacteria 3158
771 Ga0496108_0187188 3300048911 Bacteria 1793
772 Ga0496108_0213856 3300048911 Bacteria 1674
773 Ga0496109_0000696 3300048912 Bacteria 27921
774 Ga0496109_0000977 3300048912 Bacteria 23646
775 Ga0496109_0001413 3300048912 Bacteria 19914
776 Ga0496109_0002804 3300048912 Bacteria 14591
777 Ga0496109_0012519 3300048912 Bacteria 7324
778 Ga0496110_0049690 3300048913 Bacteria 3680
779 Ga0496110_0051664 3300048913 Bacteria 3612
780 Ga0496110_0059567 3300048913 Bacteria 3366
781 Ga0496110_0100573 3300048913 Bacteria 2591
782 Ga0496110_0232299 3300048913 Bacteria 1677
783 Ga0496111_0039261 3300048914 Bacteria 3393
784 Ga0496112_0000045 3300048915 Bacteria 85873
785 Ga0496112_0000590 3300048915 Bacteria 24921
786 Ga0496112_0003700 3300048915 Bacteria 12756
787 Ga0496112_0004414 3300048915 Bacteria 11908
788 Ga0496112_0011347 3300048915 Bacteria 8133
789 Ga0496112_0015545 3300048915 Bacteria 7108
790 Ga0496112_0015661 3300048915 Bacteria 7081
791 Ga0496112_0110069 3300048915 Bacteria 2725
792 Ga0496113_0000962 3300048916 Bacteria 15335
793 Ga0496113_0001231 3300048916 Bacteria 14077
794 Ga0496113_0119226 3300048916 Bacteria 2061
795 Ga0496113_0144907 3300048916 Bacteria 1870
796 Ga0496113_0351464 3300048916 Bacteria 1182
797 Ga0496114_0011491 3300048917 Bacteria 7076
798 Ga0496114_0014713 3300048917 Bacteria 6287
799 Ga0496114_0070041 3300048917 Bacteria 2945
800 Ga0496114_0286118 3300048917 Bacteria 1454
801 Ga0496115_0012499 3300048918 Bacteria 6391
802 Ga0496115_0016751 3300048918 Bacteria 5585
803 Ga0496115_0066908 3300048918 Bacteria 2904
804 Ga0496115_0099117 3300048918 Bacteria 2387
805 Ga0496115_0110381 3300048918 Bacteria 2259
806 Ga0496115_0171451 3300048918 Bacteria 1794
807 Ga0496115_0322032 3300048918 Bacteria 1264
808 Ga0496119_0004297 3300048922 Bacteria 14250
809 Ga0496126_0008548 3300048929 Bacteria 11032
810 Ga0496126_0063075 3300048929 Bacteria 3323
811 Ga0496126_0133298 3300048929 Bacteria 2145
812 Ga0496126_0238760 3300048929 Bacteria 1519
813 Ga0496126_0254895 3300048929 Bacteria 1461
814 Ga0501032_0013787 3300049569 Bacteria 5735
815 Ga0501032_0026425 3300049569 Bacteria 3992
816 Ga0501033_0026459 3300049570 Bacteria 4366
817 Ga0501033_0035781 3300049570 Bacteria 3722
818 Ga0501033_0094162 3300049570 Bacteria 2190
819 Ga0501033_0293446 3300049570 Bacteria 1146
820 Ga0501034_0000229 3300049571 Bacteria 105030
821 Ga0501034_0013020 3300049571 Bacteria 8573
822 Ga0501034_0023890 3300049571 Bacteria 6221
823 Ga0501034_0078705 3300049571 Bacteria 3300
824 Ga0501034_0095280 3300049571 Bacteria 2973
825 Ga0501034_0212294 3300049571 Bacteria 1890
826 Ga0501036_0001657 3300049572 Bacteria 17249
827 Ga0501036_0019768 3300049572 Bacteria 5654
828 Ga0501036_0110671 3300049572 Bacteria 2321
829 Ga0501037_0005935 3300049573 Bacteria 8917
830 Ga0501037_0018906 3300049573 Bacteria 5078
831 Ga0501038_0013215 3300049574 Bacteria 7529
832 Ga0501038_0172084 3300049574 Bacteria 1752
833 Ga0501039_0009233 3300049575 Bacteria 7515
834 Ga0501039_0194570 3300049575 Bacteria 1594
835 Ga0501039_0208799 3300049575 Bacteria 1535
836 Ga0501043_0002225 3300049579 Bacteria 16540
837 Ga0501043_0007079 3300049579 Bacteria 8927
838 Ga0501043_0011946 3300049579 Bacteria 6794
839 Ga0501043_0114917 3300049579 Bacteria 2112
840 Ga0501043_0277942 3300049579 Bacteria 1284
841 Ga0501046_0023812 3300049580 Bacteria 5031
842 Ga0501047_0000314 3300049581 Bacteria 55906
843 Ga0501047_0087590 3300049581 Bacteria 2991
844 Ga0501047_0132116 3300049581 Bacteria 2376
845 Ga0501047_0168876 3300049581 Bacteria 2057
846 Ga0501048_0002000 3300049582 Bacteria 15488
847 Ga0501068_0006446 3300049584 Bacteria 6470
848 Ga0501069_0083206 3300049585 Bacteria 1804
849 Ga0501069_0089368 3300049585 Bacteria 1741
850 Ga0501070_0006779 3300049586 Bacteria 9746
851 Ga0501070_0007677 3300049586 Bacteria 9150
852 Ga0501070_0008242 3300049586 Bacteria 8811
853 Ga0501070_0052152 3300049586 Bacteria 3395
854 Ga0501070_0062216 3300049586 Bacteria 3092
855 Ga0501070_0066421 3300049586 Bacteria 2987
856 Ga0501071_0067741 3300049587 Bacteria 2597
857 Ga0501072_0004407 3300049588 Bacteria 10689
858 Ga0501072_0096288 3300049588 Bacteria 2352
859 Ga0501072_0217227 3300049588 Bacteria 1524
860 Ga0501073_0007118 3300049589 Bacteria 8331
861 Ga0501073_0049770 3300049589 Bacteria 2937
862 Ga0501073_0226226 3300049589 Bacteria 1292
863 Ga0501074_0034191 3300049590 Bacteria 3685
864 Ga0501076_0087471 3300049592 Bacteria 2505
865 Ga0501076_0239841 3300049592 Bacteria 1483
866 Ga0501079_0079963 3300049741 Bacteria 2527
867 Ga0501080_0005419 3300049742 Bacteria 11382
868 Ga0501080_0126161 3300049742 Bacteria 2370
869 Ga0501083_0001743 3300049744 Bacteria 14830
870 Ga0501083_0046344 3300049744 Bacteria 2940
871 Ga0501083_0129738 3300049744 Bacteria 1652
872 Ga0501035_0000896 3300049822 Bacteria 31485
873 Ga0501035_0016102 3300049822 Bacteria 6899
874 Ga0501035_0030449 3300049822 Bacteria 4919
875 Ga0501035_0119923 3300049822 Bacteria 2300
876 Ga0501035_0262985 3300049822 Bacteria 1462
877 Ga0501035_0319828 3300049822 Bacteria 1304
878 Ga0501035_0409611 3300049822 Bacteria 1127
879 Ga0501044_0026016 3300049823 Bacteria 6198
880 Ga0501044_0028840 3300049823 Bacteria 5854
881 Ga0501044_0040259 3300049823 Bacteria 4870
882 Ga0501044_0068356 3300049823 Bacteria 3619
883 Ga0501044_0109276 3300049823 Bacteria 2774
884 Ga0501044_0167511 3300049823 Bacteria 2170
885 Ga0501044_0197844 3300049823 Bacteria 1969
886 Ga0501044_0250109 3300049823 Bacteria 1714
887 Ga0501044_0291460 3300049823 Bacteria 1563
888 nmdc:mga0yw44_47683_c1 3300050492 Bacteria 2580
889 nmdc:mga06z11_60782_c1 3300050494 Bacteria 1968
890 nmdc:mga07m45_136399_c1 3300050496 Bacteria 1420
891 nmdc:mga07m45_17418_c1 3300050496 Bacteria 3859
892 nmdc:mga05p37_133863_c1 3300050507 Bacteria 3041
893 nmdc:mga05p37_2697_c1 3300050507 Bacteria 19225
894 nmdc:mga09592_12303_c1 3300050508 Bacteria 6968
895 nmdc:mga0qj67_693_c1 3300050509 Bacteria 22941
896 nmdc:mga06r32_1056_c1 3300050510 Bacteria 24895
897 nmdc:mga08y16_119630_c1 3300050511 Bacteria 2741
898 nmdc:mga08y16_82727_c1 3300050511 Bacteria 3347
899 nmdc:mga0n895_159790_c1 3300050512 Bacteria 2285
900 nmdc:mga0n895_1654_c1 3300050512 Bacteria 16850
901 nmdc:mga0n895_206722_c1 3300050512 Bacteria 1994
902 nmdc:mga0n895_32994_c1 3300050512 Bacteria 4973
903 nmdc:mga0rr50_1013_c1 3300050513 Bacteria 15240
904 nmdc:mga0rr50_143061_c1 3300050513 Bacteria 1926
905 nmdc:mga0rr50_161499_c1 3300050513 Bacteria 1819
906 nmdc:mga0rr50_228131_c1 3300050513 Unclassified 1540
907 nmdc:mga08x19_96260_c1 3300050514 Bacteria 1959
908 nmdc:mga0a205_284340_c1 3300050515 Bacteria 1529
909 nmdc:mga0a205_467_c1 3300050515 Bacteria 29468
910 nmdc:mga0a205_6139_c1 3300050515 Bacteria 10841
911 Ga0495601_0000701 3300053077 Bacteria 17998
912 Ga0495601_0001682 3300053077 Bacteria 12202
913 Ga0495601_0003818 3300053077 Bacteria 8668
914 Ga0495601_0009237 3300053077 Bacteria 5828
915 Ga0495601_0024093 3300053077 Bacteria 3745
916 Ga0495601_0033370 3300053077 Bacteria 3207
917 Ga0495601_0050468 3300053077 Bacteria 2624
918 Ga0495612_0000478 3300053078 Bacteria 16063
919 Ga0495612_0001410 3300053078 Bacteria 9882
920 Ga0495612_0005755 3300053078 Bacteria 5119
921 Ga0495612_0012899 3300053078 Bacteria 3366
922 Ga0495612_0034083 3300053078 Bacteria 2061
923 Ga0495595_0000277 3300053084 Bacteria 20328
924 Ga0495595_0007089 3300053084 Bacteria 4579
925 Ga0495595_0010272 3300053084 Bacteria 3889
926 Ga0495595_0015012 3300053084 Bacteria 3296
927 Ga0495595_0015922 3300053084 Bacteria 3210
928 Ga0495595_0015962 3300053084 Bacteria 3207
929 Ga0495595_0141297 3300053084 Bacteria 1181
930 Ga0495619_0000159 3300053085 Bacteria 49689
931 Ga0495619_0000300 3300053085 Bacteria 34873
932 Ga0495619_0000628 3300053085 Bacteria 23297
933 Ga0495619_0004640 3300053085 Bacteria 8756
934 Ga0495619_0010923 3300053085 Bacteria 5715
935 Ga0495619_0035693 3300053085 Bacteria 3234
936 Ga0495619_0061653 3300053085 Bacteria 2495
937 Ga0495619_0135342 3300053085 Bacteria 1695
938 Ga0500643_003796 3300053087 Bacteria 7063
939 Ga0500644_0000375 3300053088 Bacteria 21830
940 Ga0500646_0048753 3300053090 Bacteria 1215
941 Ga0500566_0013664 3300053094 Bacteria 4774
942 Ga0500641_0016700 3300053096 Bacteria 2735
943 Ga0500595_000002 3300053119 Bacteria 1074388
944 Ga0500655_016549 3300053133 Bacteria 1359
945 Ga0500589_094636 3300053147 Bacteria 1308
946 Ga0500616_0000002 3300053153 Bacteria 1611257
947 Ga0500616_0000048 3300053153 Bacteria 313108
948 Ga0500637_0093139 3300053178 Bacteria 1746
949 Ga0500645_000252 3300053730 Bacteria 39375
950 Ga0500645_011250 3300053730 Bacteria 2928
951 Ga0501084_0260661 3300054114 Bacteria 1463
952 Ga0501082_0015464 3300060353 Bacteria 6568
953 Ga0501082_0026664 3300060353 Bacteria 4981
954 Ga0501082_0172306 3300060353 Bacteria 1881
955 Ga0501082_0250979 3300060353 Bacteria 1540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016548790 8016555369 193
2 3300053178 Ga0500637_0093139 Ga0500637_0093139_655_1608 235
3 3300035116 Ga0373945_0027667 Ga0373945_0027667_470_1327 238
4 iso_pu_bacteria 8016566248 8016571852 241
5 3300045836 Ga0466958_0175418 Ga0466958_0175418_93_1043 245
6 3300048929 Ga0496126_0238760 Ga0496126_0238760_465_1424 245
7 3300048907 Ga0496104_0264810 Ga0496104_0264810_89_1078 247
8 3300048911 Ga0496108_0000938 Ga0496108_0000938_21598_22587 247
9 3300005439 Ga0070711_100079140 Ga0070711_1000791401 250
10 3300006173 Ga0070716_100043704 Ga0070716_1000437043 250
11 3300025915 Ga0207693_10191176 Ga0207693_101911762 250
12 3300025916 Ga0207663_10083699 Ga0207663_100836992 250
13 3300048903 Ga0496100_0198714 Ga0496100_0198714_469_1434 250
14 3300048918 Ga0496115_0322032 Ga0496115_0322032_289_1254 250
15 3300005436 Ga0070713_100120238 Ga0070713_1001202383 251
16 3300005437 Ga0070710_10105489 Ga0070710_101054891 251
17 3300021358 Ga0213873_10014165 Ga0213873_100141652 251
18 3300021384 Ga0213876_10008652 Ga0213876_100086521 251
19 3300025898 Ga0207692_10081832 Ga0207692_100818322 251
20 3300025928 Ga0207700_10097830 Ga0207700_100978301 251
21 3300035119 Ga0373956_0072658 Ga0373956_0072658_236_1240 251
22 3300035172 Ga0373955_0015930 Ga0373955_0015930_781_1785 251
23 3300035725 Ga0373947_0048824 Ga0373947_0048824_463_1467 251
24 3300036401 Ga0373937_0026471 Ga0373937_0026471_4124_5128 251
25 3300037068 Ga0373925_0004912 Ga0373925_0004912_4632_5636 251
26 3300039437 Ga0436365_0340427 Ga0436365_0340427_844_1803 251
27 3300039450 Ga0436363_0547396 Ga0436363_0547396_304_1263 251
28 3300046454 Ga0495592_0002638 Ga0495592_0002638_2626_3630 251
29 3300046511 Ga0495608_0010351 Ga0495608_0010351_4287_5291 251
30 3300046516 Ga0495628_0000115 Ga0495628_0000115_15685_16689 251
31 3300046529 Ga0495652_0013930 Ga0495652_0013930_447_1451 251
32 3300046543 Ga0495645_0018002 Ga0495645_0018002_2277_3281 251
33 3300046559 Ga0495667_0000674 Ga0495667_0000674_9081_10085 251
34 3300046678 Ga0495599_0031443 Ga0495599_0031443_1013_2017 251
35 3300046679 Ga0495623_0021243 Ga0495623_0021243_2247_3251 251
36 3300046809 Ga0495600_0077847 Ga0495600_0077847_99_1103 251
37 3300047317 Ga0495604_0001990 Ga0495604_0001990_13420_14424 251
38 3300047444 Ga0495675_0029011 Ga0495675_0029011_1157_2161 251
39 3300047471 Ga0495684_0129934 Ga0495684_0129934_675_1679 251
40 3300048088 Ga0495602_0003665 Ga0495602_0003665_4564_5568 251
41 3300053077 Ga0495601_0000701 Ga0495601_0000701_3981_4985 251
42 3300053078 Ga0495612_0012899 Ga0495612_0012899_323_1327 251
43 3300053084 Ga0495595_0015922 Ga0495595_0015922_748_1752 251
44 3300053085 Ga0495619_0000159 Ga0495619_0000159_20025_21029 251
45 3300035112 Ga0373932_0034093 Ga0373932_0034093_426_1409 252
46 3300035691 Ga0373931_0012885 Ga0373931_0012885_2312_3295 252
47 3300048907 Ga0496104_0239644 Ga0496104_0239644_694_1677 252
48 3300005435 Ga0070714_100070473 Ga0070714_1000704732 253
49 3300005614 Ga0068856_100361373 Ga0068856_1003613732 253
50 3300025929 Ga0207664_10067530 Ga0207664_100675302 253
51 3300025972 Ga0207668_10103480 Ga0207668_101034801 253
52 3300048929 Ga0496126_0133298 Ga0496126_0133298_641_1591 253
53 3300049570 Ga0501033_0026459 Ga0501033_0026459_1563_2546 253
54 3300049572 Ga0501036_0110671 Ga0501036_0110671_687_1670 253
55 3300049574 Ga0501038_0172084 Ga0501038_0172084_334_1317 253
56 3300049586 Ga0501070_0066421 Ga0501070_0066421_523_1506 253
57 3300049822 Ga0501035_0030449 Ga0501035_0030449_757_1740 253
58 3300053096 Ga0500641_0016700 Ga0500641_0016700_1199_2158 253
59 3300006178 Ga0075367_10131271 Ga0075367_101312711 254
60 3300028558 Ga0265326_10055246 Ga0265326_100552461 254
61 3300050494 nmdc:mga06z11_60782_c1 nmdc:mga06z11_60782_c1_20_979 254
62 3300050496 nmdc:mga07m45_17418_c1 nmdc:mga07m45_17418_c1_1455_2414 254
63 3300053730 Ga0500645_011250 Ga0500645_011250_159_1118 254
64 3300005466 Ga0070685_10215413 Ga0070685_102154132 255
65 3300025939 Ga0207665_10213324 Ga0207665_102133241 255
66 3300031901 Ga0307406_10049692 Ga0307406_100496922 255
67 3300031995 Ga0307409_100061827 Ga0307409_1000618274 255
68 3300048910 Ga0496107_0003483 Ga0496107_0003483_8301_9290 255
69 3300048912 Ga0496109_0000977 Ga0496109_0000977_11222_12211 255
70 3300048913 Ga0496110_0049690 Ga0496110_0049690_652_1641 255
71 3300048915 Ga0496112_0000590 Ga0496112_0000590_15404_16393 255
72 3300005435 Ga0070714_100026305 Ga0070714_1000263054 256
73 3300005439 Ga0070711_100001638 Ga0070711_1000016382 256
74 3300014325 Ga0163163_10101927 Ga0163163_101019274 256
75 3300025928 Ga0207700_10165286 Ga0207700_101652861 256
76 3300025929 Ga0207664_10015064 Ga0207664_100150641 256
77 3300039437 Ga0436365_0276616 Ga0436365_0276616_1461_2408 256
78 3300048909 Ga0496106_0147036 Ga0496106_0147036_521_1504 256
79 3300048913 Ga0496110_0100573 Ga0496110_0100573_1107_2090 256
80 3300048915 Ga0496112_0015545 Ga0496112_0015545_1691_2674 256
81 3300053084 Ga0495595_0141297 Ga0495595_0141297_69_1037 256
82 3300009098 Ga0105245_10619033 Ga0105245_106190331 257
83 3300025941 Ga0207711_10011944 Ga0207711_100119445 258
84 3300027471 Ga0209995_1019384 Ga0209995_10193841 258
85 3300031344 Ga0265316_10171986 Ga0265316_101719862 258
86 3300035170 Ga0373943_0030538 Ga0373943_0030538_133_1098 258
87 3300035695 Ga0373927_0019295 Ga0373927_0019295_2708_3673 258
88 3300031239 Ga0265328_10053514 Ga0265328_100535142 259
89 3300031241 Ga0265325_10000026 Ga0265325_1000002682 259
90 3300031595 Ga0265313_10013073 Ga0265313_100130736 259
91 3300042005 Ga0439448_0030523 Ga0439448_0030523_667_1653 259
92 3300048908 Ga0496105_0052802 Ga0496105_0052802_394_1377 259
93 3300048911 Ga0496108_0061584 Ga0496108_0061584_2158_3141 259
94 3300006051 Ga0075364_10203629 Ga0075364_102036292 260
95 3300013102 Ga0157371_10141930 Ga0157371_101419302 260
96 3300031235 Ga0265330_10009899 Ga0265330_100098993 260
97 3300039437 Ga0436365_1793855 Ga0436365_1793855_432_1415 260
98 3300046507 Ga0495606_0002132 Ga0495606_0002132_19722_20690 260
99 3300046538 Ga0495609_0140321 Ga0495609_0140321_17_979 260
100 3300046559 Ga0495667_0018730 Ga0495667_0018730_193_1197 260
101 3300050492 nmdc:mga0yw44_47683_c1 nmdc:mga0yw44_47683_c1_1117_2073 260
102 3300014497 Ga0182008_10079253 Ga0182008_100792532 261
103 3300035119 Ga0373956_0039789 Ga0373956_0039789_371_1348 261
104 3300048905 Ga0496102_0483063 Ga0496102_0483063_30_971 261
105 3300048918 Ga0496115_0066908 Ga0496115_0066908_1896_2855 261
106 3300053730 Ga0500645_000252 Ga0500645_000252_13734_14744 261
107 3300005327 Ga0070658_10008040 Ga0070658_100080404 262
108 3300005434 Ga0070709_10000652 Ga0070709_100006529 262
109 3300005437 Ga0070710_10001787 Ga0070710_1000178713 262
110 3300005937 Ga0081455_10000596 Ga0081455_1000059653 262
111 3300006173 Ga0070716_100026935 Ga0070716_1000269352 262
112 3300006175 Ga0070712_100031048 Ga0070712_1000310482 262
113 3300009093 Ga0105240_10150755 Ga0105240_101507553 262
114 3300025898 Ga0207692_10001993 Ga0207692_100019933 262
115 3300025906 Ga0207699_10000253 Ga0207699_1000025311 262
116 3300025909 Ga0207705_10258921 Ga0207705_102589211 262
117 3300025912 Ga0207707_10036720 Ga0207707_100367205 262
118 3300025915 Ga0207693_10024218 Ga0207693_100242184 262
119 3300025916 Ga0207663_10014464 Ga0207663_100144642 262
120 3300025921 Ga0207652_10016404 Ga0207652_100164043 262
121 3300025939 Ga0207665_10011108 Ga0207665_100111082 262
122 3300026078 Ga0207702_10193556 Ga0207702_101935562 262
123 3300027907 Ga0207428_10301325 Ga0207428_103013251 262
124 3300046452 Ga0495617_049441 Ga0495617_049441_426_1385 262
125 3300048915 Ga0496112_0110069 Ga0496112_0110069_1726_2703 262
126 3300049571 Ga0501034_0078705 Ga0501034_0078705_293_1282 262
127 3300049579 Ga0501043_0277942 Ga0501043_0277942_97_1086 262
128 3300049823 Ga0501044_0068356 Ga0501044_0068356_2016_3005 262
129 3300050511 nmdc:mga08y16_119630_c1 nmdc:mga08y16_119630_c1_941_1897 262
130 3300053147 Ga0500589_094636 Ga0500589_094636_190_1149 262
131 3300005457 Ga0070662_100172258 Ga0070662_1001722581 263
132 3300025899 Ga0207642_10175617 Ga0207642_101756171 263
133 3300032126 Ga0307415_100103966 Ga0307415_1001039662 263
134 3300033180 Ga0307510_10005901 Ga0307510_100059016 263
135 3300046455 Ga0495603_0015087 Ga0495603_0015087_2884_3846 263
136 3300046557 Ga0495622_0071727 Ga0495622_0071727_445_1407 263
137 3300046660 Ga0495625_0116833 Ga0495625_0116833_295_1257 263
138 3300046692 Ga0495671_0036634 Ga0495671_0036634_481_1443 263
139 3300047320 Ga0495672_0119466 Ga0495672_0119466_148_1110 263
140 3300048929 Ga0496126_0008548 Ga0496126_0008548_652_1614 263
141 3300053085 Ga0495619_0135342 Ga0495619_0135342_187_1179 263
142 3300053090 Ga0500646_0048753 Ga0500646_0048753_182_1144 263
143 3300053133 Ga0500655_016549 Ga0500655_016549_298_1260 263
144 3300053153 Ga0500616_0000048 Ga0500616_0000048_2871_3863 263
145 3300005547 Ga0070693_100123149 Ga0070693_1001231492 264
146 3300005937 Ga0081455_10009848 Ga0081455_100098488 264
147 3300020082 Ga0206353_11779653 Ga0206353_117796531 264
148 3300031241 Ga0265325_10015162 Ga0265325_100151623 264
149 3300035118 Ga0373954_0004751 Ga0373954_0004751_2617_3621 264
150 3300035120 Ga0373957_0040020 Ga0373957_0040020_535_1539 264
151 3300035172 Ga0373955_0001006 Ga0373955_0001006_2423_3427 264
152 3300035695 Ga0373927_0014192 Ga0373927_0014192_4196_5200 264
153 3300035724 Ga0373933_0003044 Ga0373933_0003044_3455_4459 264
154 3300036401 Ga0373937_0003591 Ga0373937_0003591_2565_3569 264
155 3300046459 Ga0495629_0008943 Ga0495629_0008943_3321_4325 264
156 3300046462 Ga0495651_0010375 Ga0495651_0010375_4958_5962 264
157 3300046477 Ga0495664_0056004 Ga0495664_0056004_1024_2028 264
158 3300046529 Ga0495652_0001117 Ga0495652_0001117_26978_27982 264
159 3300046543 Ga0495645_0113080 Ga0495645_0113080_899_1903 264
160 3300046675 Ga0495657_0014159 Ga0495657_0014159_2378_3382 264
161 3300046680 Ga0495646_0020414 Ga0495646_0020414_3032_4036 264
162 3300047317 Ga0495604_0000619 Ga0495604_0000619_16518_17522 264
163 3300047319 Ga0495674_0005221 Ga0495674_0005221_8577_9581 264
164 3300047322 Ga0495680_0002310 Ga0495680_0002310_16186_17190 264
165 3300048088 Ga0495602_0030986 Ga0495602_0030986_2485_3489 264
166 3300048929 Ga0496126_0063075 Ga0496126_0063075_972_1919 264
167 3300049570 Ga0501033_0293446 Ga0501033_0293446_32_976 264
168 3300053077 Ga0495601_0001682 Ga0495601_0001682_3123_4127 264
169 3300053078 Ga0495612_0000478 Ga0495612_0000478_7420_8424 264
170 3300053084 Ga0495595_0000277 Ga0495595_0000277_16427_17431 264
171 3300053085 Ga0495619_0061653 Ga0495619_0061653_159_1163 264
172 3300005434 Ga0070709_10026083 Ga0070709_100260834 265
173 3300005436 Ga0070713_100020933 Ga0070713_1000209336 265
174 3300025906 Ga0207699_10006701 Ga0207699_100067013 265
175 3300025928 Ga0207700_10018517 Ga0207700_100185172 265
176 3300031239 Ga0265328_10016980 Ga0265328_100169802 265
177 3300031241 Ga0265325_10021617 Ga0265325_100216172 265
178 3300031249 Ga0265339_10000047 Ga0265339_1000004758 265
179 3300031250 Ga0265331_10001610 Ga0265331_100016102 265
180 3300031251 Ga0265327_10033231 Ga0265327_100332312 265
181 3300031344 Ga0265316_10182372 Ga0265316_101823722 265
182 3300031595 Ga0265313_10000069 Ga0265313_1000006943 265
183 3300039437 Ga0436365_1744975 Ga0436365_1744975_2434_3411 265
184 3300039438 Ga0436360_0620291 Ga0436360_0620291_131_1078 265
185 3300046516 Ga0495628_0048362 Ga0495628_0048362_1273_2280 265
186 3300005435 Ga0070714_100501986 Ga0070714_1005019861 266
187 3300025915 Ga0207693_10056378 Ga0207693_100563784 266
188 3300035114 Ga0373939_0011217 Ga0373939_0011217_753_1844 266
189 3300044694 Ga0466963_0040811 Ga0466963_0040811_1295_2305 266
190 3300044719 Ga0466971_0084811 Ga0466971_0084811_34_1044 266
191 3300048907 Ga0496104_0014336 Ga0496104_0014336_103_1137 266
192 3300048922 Ga0496119_0004297 Ga0496119_0004297_7067_8029 266
193 3300048929 Ga0496126_0254895 Ga0496126_0254895_39_998 266
194 3300049571 Ga0501034_0000229 Ga0501034_0000229_52838_53836 266
195 3300005327 Ga0070658_10034116 Ga0070658_100341164 267
196 3300005336 Ga0070680_100008016 Ga0070680_1000080168 267
197 3300005530 Ga0070679_100510947 Ga0070679_1005109471 267
198 3300005563 Ga0068855_100155675 Ga0068855_1001556754 267
199 3300025909 Ga0207705_10012927 Ga0207705_100129276 267
200 3300025919 Ga0207657_10223741 Ga0207657_102237412 267
201 3300025949 Ga0207667_10219249 Ga0207667_102192491 267
202 3300028800 Ga0265338_10045038 Ga0265338_100450385 267
203 3300031595 Ga0265313_10024594 Ga0265313_100245943 267
204 3300031595 Ga0265313_10093900 Ga0265313_100939002 267
205 3300031712 Ga0265342_10000502 Ga0265342_1000050238 267
206 3300032168 Ga0316593_10089675 Ga0316593_100896751 267
207 3300037418 Ga0395900_0065578 Ga0395900_0065578_2096_3094 267
208 3300037466 Ga0395898_0053996 Ga0395898_0053996_1375_2373 267
209 3300039450 Ga0436363_0159755 Ga0436363_0159755_1526_2476 267
210 3300044694 Ga0466963_0048614 Ga0466963_0048614_177_1172 267
211 3300045976 Ga0466967_0007437 Ga0466967_0007437_4137_5132 267
212 3300048907 Ga0496104_0000279 Ga0496104_0000279_41783_42745 267
213 3300048908 Ga0496105_0000157 Ga0496105_0000157_8450_9412 267
214 3300048915 Ga0496112_0000045 Ga0496112_0000045_65114_66073 267
215 3300048917 Ga0496114_0286118 Ga0496114_0286118_91_1053 267
216 3300049581 Ga0501047_0087590 Ga0501047_0087590_428_1426 267
217 3300049588 Ga0501072_0004407 Ga0501072_0004407_4968_5984 267
218 3300005436 Ga0070713_100024488 Ga0070713_1000244884 268
219 3300005455 Ga0070663_100199561 Ga0070663_1001995612 268
220 3300006237 Ga0097621_100201324 Ga0097621_1002013242 268
221 3300013308 Ga0157375_10054765 Ga0157375_100547654 268
222 3300025915 Ga0207693_10002835 Ga0207693_100028357 268
223 3300025915 Ga0207693_10208285 Ga0207693_102082852 268
224 3300025933 Ga0207706_10023762 Ga0207706_100237626 268
225 3300035086 Ga0373934_0031646 Ga0373934_0031646_159_1166 268
226 3300035117 Ga0373953_0004398 Ga0373953_0004398_206_1213 268
227 3300035118 Ga0373954_0016066 Ga0373954_0016066_212_1219 268
228 3300035172 Ga0373955_0003538 Ga0373955_0003538_2613_3620 268
229 3300036401 Ga0373937_0001830 Ga0373937_0001830_2543_3550 268
230 3300046462 Ga0495651_0042107 Ga0495651_0042107_2527_3534 268
231 3300046511 Ga0495608_0029442 Ga0495608_0029442_91_1098 268
232 3300046514 Ga0495618_0019969 Ga0495618_0019969_985_1992 268
233 3300046529 Ga0495652_0027254 Ga0495652_0027254_12_1019 268
234 3300046543 Ga0495645_0010751 Ga0495645_0010751_1288_2295 268
235 3300046559 Ga0495667_0003600 Ga0495667_0003600_6137_7144 268
236 3300046663 Ga0495635_0009000 Ga0495635_0009000_164_1171 268
237 3300046675 Ga0495657_0011216 Ga0495657_0011216_4836_5843 268
238 3300046679 Ga0495623_0002539 Ga0495623_0002539_3736_4743 268
239 3300046680 Ga0495646_0043834 Ga0495646_0043834_744_1751 268
240 3300046689 Ga0495613_0168647 Ga0495613_0168647_30_1037 268
241 3300048904 Ga0496101_0108048 Ga0496101_0108048_691_1650 268
242 3300048907 Ga0496104_0060191 Ga0496104_0060191_2606_3565 268
243 3300048907 Ga0496104_0571857 Ga0496104_0571857_33_992 268
244 3300048913 Ga0496110_0051664 Ga0496110_0051664_259_1218 268
245 3300048915 Ga0496112_0003700 Ga0496112_0003700_850_1809 268
246 3300048916 Ga0496113_0000962 Ga0496113_0000962_12029_12988 268
247 3300049569 Ga0501032_0026425 Ga0501032_0026425_2641_3624 268
248 3300049570 Ga0501033_0035781 Ga0501033_0035781_1761_2744 268
249 3300049571 Ga0501034_0212294 Ga0501034_0212294_94_1077 268
250 3300049572 Ga0501036_0019768 Ga0501036_0019768_1836_2819 268
251 3300049575 Ga0501039_0009233 Ga0501039_0009233_4620_5603 268
252 3300049579 Ga0501043_0007079 Ga0501043_0007079_4301_5284 268
253 3300049584 Ga0501068_0006446 Ga0501068_0006446_2135_3118 268
254 3300049585 Ga0501069_0083206 Ga0501069_0083206_433_1416 268
255 3300049586 Ga0501070_0052152 Ga0501070_0052152_814_1797 268
256 3300049588 Ga0501072_0096288 Ga0501072_0096288_810_1793 268
257 3300049589 Ga0501073_0007118 Ga0501073_0007118_3891_4874 268
258 3300049741 Ga0501079_0079963 Ga0501079_0079963_1184_2167 268
259 3300049742 Ga0501080_0126161 Ga0501080_0126161_74_1057 268
260 3300049822 Ga0501035_0016102 Ga0501035_0016102_3669_4652 268
261 3300049823 Ga0501044_0026016 Ga0501044_0026016_1557_2540 268
262 3300053077 Ga0495601_0033370 Ga0495601_0033370_987_1994 268
263 3300053078 Ga0495612_0001410 Ga0495612_0001410_7201_8208 268
264 3300053084 Ga0495595_0010272 Ga0495595_0010272_1133_2131 268
265 3300053085 Ga0495619_0035693 Ga0495619_0035693_987_1994 268
266 3300005336 Ga0070680_100050316 Ga0070680_1000503164 269
267 3300005458 Ga0070681_10042512 Ga0070681_100425125 269
268 3300005530 Ga0070679_100230727 Ga0070679_1002307271 269
269 3300006871 Ga0075434_100067393 Ga0075434_1000673934 269
270 3300009147 Ga0114129_10035354 Ga0114129_100353542 269
271 3300014325 Ga0163163_10002439 Ga0163163_100024393 269
272 3300028556 Ga0265337_1014277 Ga0265337_10142771 269
273 3300031824 Ga0307413_10268530 Ga0307413_102685302 269
274 3300037312 Ga0395899_0055599 Ga0395899_0055599_1771_2787 269
275 3300037418 Ga0395900_0014500 Ga0395900_0014500_5270_6286 269
276 3300048905 Ga0496102_0032062 Ga0496102_0032062_3636_4637 269
277 3300048907 Ga0496104_0004500 Ga0496104_0004500_11113_12114 269
278 3300048908 Ga0496105_0053668 Ga0496105_0053668_2281_3285 269
279 3300048911 Ga0496108_0000660 Ga0496108_0000660_9979_10980 269
280 3300048912 Ga0496109_0001413 Ga0496109_0001413_3236_4237 269
281 3300048913 Ga0496110_0232299 Ga0496110_0232299_634_1635 269
282 3300048914 Ga0496111_0039261 Ga0496111_0039261_634_1635 269
283 3300048915 Ga0496112_0004414 Ga0496112_0004414_2793_3794 269
284 3300048916 Ga0496113_0001231 Ga0496113_0001231_4771_5772 269
285 3300048918 Ga0496115_0016751 Ga0496115_0016751_2438_3439 269
286 3300050507 nmdc:mga05p37_133863_c1 nmdc:mga05p37_133863_c1_1939_2919 269
287 3300050512 nmdc:mga0n895_159790_c1 nmdc:mga0n895_159790_c1_122_1102 269
288 3300053088 Ga0500644_0000375 Ga0500644_0000375_17924_18943 269
289 3300053153 Ga0500616_0000002 Ga0500616_0000002_970531_971514 269
290 iso_pu_bacteria 2935769743 2935771213 269
291 3300005290 Ga0065712_10069678 Ga0065712_100696787 270
292 3300005440 Ga0070705_100061455 Ga0070705_1000614552 270
293 3300005564 Ga0070664_100465762 Ga0070664_1004657622 270
294 3300005617 Ga0068859_100202501 Ga0068859_1002025012 270
295 3300005842 Ga0068858_100258516 Ga0068858_1002585161 270
296 3300006353 Ga0075370_10139642 Ga0075370_101396421 270
297 3300006931 Ga0097620_100202511 Ga0097620_1002025112 270
298 3300009177 Ga0105248_10248698 Ga0105248_102486983 270
299 3300013296 Ga0157374_10040397 Ga0157374_100403974 270
300 3300014325 Ga0163163_10001266 Ga0163163_1000126612 270
301 3300014968 Ga0157379_10004953 Ga0157379_1000495312 270
302 3300025900 Ga0207710_10009956 Ga0207710_100099565 270
303 3300025925 Ga0207650_10133430 Ga0207650_101334302 270
304 3300026078 Ga0207702_10238400 Ga0207702_102384001 270
305 3300026095 Ga0207676_10450453 Ga0207676_104504531 270
306 3300048911 Ga0496108_0003134 Ga0496108_0003134_3284_4270 270
307 3300048912 Ga0496109_0002804 Ga0496109_0002804_5123_6109 270
308 3300048915 Ga0496112_0011347 Ga0496112_0011347_6762_7748 270
309 3300048916 Ga0496113_0119226 Ga0496113_0119226_692_1678 270
310 3300049587 Ga0501071_0067741 Ga0501071_0067741_1517_2515 270
311 3300049588 Ga0501072_0217227 Ga0501072_0217227_373_1371 270
312 3300049592 Ga0501076_0239841 Ga0501076_0239841_64_1062 270
313 3300050496 nmdc:mga07m45_136399_c1 nmdc:mga07m45_136399_c1_346_1332 270
314 3300060353 Ga0501082_0026664 Ga0501082_0026664_2414_3412 270
315 3300003203 JGI25406J46586_10000018 JGI25406J46586_100000189 271
316 3300005336 Ga0070680_100170530 Ga0070680_1001705301 271
317 3300005530 Ga0070679_100185671 Ga0070679_1001856712 271
318 3300005985 Ga0081539_10000003 Ga0081539_10000003390 271
319 3300025921 Ga0207652_10234747 Ga0207652_102347472 271
320 3300031247 Ga0265340_10023909 Ga0265340_100239094 271
321 3300049575 Ga0501039_0194570 Ga0501039_0194570_584_1576 271
322 3300053087 Ga0500643_003796 Ga0500643_003796_3134_4117 271
323 3300053094 Ga0500566_0013664 Ga0500566_0013664_2192_3175 271
324 3300053119 Ga0500595_000002 Ga0500595_000002_863724_864707 271
325 3300005337 Ga0070682_100088047 Ga0070682_1000880472 272
326 3300005356 Ga0070674_100010763 Ga0070674_1000107635 272
327 3300005364 Ga0070673_100244183 Ga0070673_1002441832 272
328 3300005458 Ga0070681_10022181 Ga0070681_100221814 272
329 3300005539 Ga0068853_100224896 Ga0068853_1002248962 272
330 3300005546 Ga0070696_100031040 Ga0070696_1000310403 272
331 3300005547 Ga0070693_100071161 Ga0070693_1000711612 272
332 3300005937 Ga0081455_10000007 Ga0081455_1000000753 272
333 3300005983 Ga0081540_1001222 Ga0081540_100122217 272
334 3300009174 Ga0105241_10085108 Ga0105241_100851083 272
335 3300009553 Ga0105249_10136831 Ga0105249_101368313 272
336 3300025938 Ga0207704_10070427 Ga0207704_100704273 272
337 3300025961 Ga0207712_10117974 Ga0207712_101179742 272
338 3300026041 Ga0207639_10171693 Ga0207639_101716931 272
339 3300031595 Ga0265313_10000794 Ga0265313_1000079426 272
340 3300046459 Ga0495629_0091414 Ga0495629_0091414_894_1901 272
341 3300046477 Ga0495664_0019528 Ga0495664_0019528_1588_2595 272
342 3300046533 Ga0495640_0062405 Ga0495640_0062405_627_1634 272
343 3300046536 Ga0495587_0006245 Ga0495587_0006245_2228_3235 272
344 3300046536 Ga0495587_0019798 Ga0495587_0019798_1196_2173 272
345 3300046642 Ga0495634_0099766 Ga0495634_0099766_449_1456 272
346 3300046690 Ga0495624_0137077 Ga0495624_0137077_477_1472 272
347 3300047322 Ga0495680_0002967 Ga0495680_0002967_2030_3034 272
348 3300048909 Ga0496106_0057223 Ga0496106_0057223_654_1640 272
349 3300048918 Ga0496115_0099117 Ga0496115_0099117_714_1700 272
350 3300049744 Ga0501083_0046344 Ga0501083_0046344_1734_2720 272
351 3300053084 Ga0495595_0015012 Ga0495595_0015012_2131_3138 272
352 3300031595 Ga0265313_10069204 Ga0265313_100692042 273
353 3300005458 Ga0070681_10109584 Ga0070681_101095842 274
354 3300005530 Ga0070679_100060424 Ga0070679_1000604242 274
355 3300006852 Ga0075433_10151919 Ga0075433_101519191 274
356 3300006871 Ga0075434_100055769 Ga0075434_1000557693 274
357 3300025912 Ga0207707_10116020 Ga0207707_101160203 274
358 3300031241 Ga0265325_10036642 Ga0265325_100366424 274
359 3300031595 Ga0265313_10020093 Ga0265313_100200934 274
360 3300031595 Ga0265313_10053103 Ga0265313_100531031 274
361 3300044842 Ga0466957_0264414 Ga0466957_0264414_113_1120 274
362 3300046462 Ga0495651_0035348 Ga0495651_0035348_2519_3496 274
363 3300048088 Ga0495602_0078472 Ga0495602_0078472_1443_2420 274
364 3300050515 nmdc:mga0a205_284340_c1 nmdc:mga0a205_284340_c1_114_1094 274
365 3300028800 Ga0265338_10035840 Ga0265338_100358405 275
366 3300035120 Ga0373957_0002588 Ga0373957_0002588_2095_3072 275
367 3300035172 Ga0373955_0001974 Ga0373955_0001974_4032_5009 275
368 3300046454 Ga0495592_0254498 Ga0495592_0254498_58_1035 275
369 3300046459 Ga0495629_0028960 Ga0495629_0028960_2389_3375 275
370 3300046472 Ga0495580_0038175 Ga0495580_0038175_2004_2990 275
371 3300046526 Ga0495666_0012543 Ga0495666_0012543_1189_2175 275
372 3300053077 Ga0495601_0009237 Ga0495601_0009237_3916_4893 275
373 3300053078 Ga0495612_0034083 Ga0495612_0034083_856_1833 275
374 3300060353 Ga0501082_0172306 Ga0501082_0172306_272_1267 275
375 3300049571 Ga0501034_0013020 Ga0501034_0013020_3339_4352 276
376 3300005355 Ga0070671_100223422 Ga0070671_1002234221 278
377 3300005435 Ga0070714_100025604 Ga0070714_1000256043 278
378 3300005437 Ga0070710_10035536 Ga0070710_100355364 278
379 3300005545 Ga0070695_100029515 Ga0070695_1000295152 278
380 3300006028 Ga0070717_10136105 Ga0070717_101361052 278
381 3300006175 Ga0070712_100086846 Ga0070712_1000868463 278
382 3300009176 Ga0105242_10052448 Ga0105242_100524484 278
383 3300010375 Ga0105239_10389036 Ga0105239_103890361 278
384 3300014968 Ga0157379_10140761 Ga0157379_101407611 278
385 3300025898 Ga0207692_10020685 Ga0207692_100206853 278
386 3300025915 Ga0207693_10170006 Ga0207693_101700062 278
387 3300025927 Ga0207687_10025507 Ga0207687_100255074 278
388 3300025929 Ga0207664_10029498 Ga0207664_100294982 278
389 3300025931 Ga0207644_10088757 Ga0207644_100887572 278
390 3300025939 Ga0207665_10019210 Ga0207665_100192105 278
391 3300025945 Ga0207679_10052994 Ga0207679_100529943 278
392 3300025986 Ga0207658_10086998 Ga0207658_100869982 278
393 3300031691 Ga0316579_10087297 Ga0316579_100872971 278
394 3300035724 Ga0373933_0014720 Ga0373933_0014720_155_1156 278
395 3300036401 Ga0373937_0003746 Ga0373937_0003746_8122_9123 278
396 3300038443 Ga0395901_0019085 Ga0395901_0019085_2099_3112 278
397 3300046459 Ga0495629_0065245 Ga0495629_0065245_897_1898 278
398 3300046462 Ga0495651_0015811 Ga0495651_0015811_3238_4239 278
399 3300046516 Ga0495628_0343576 Ga0495628_0343576_10_1011 278
400 3300046533 Ga0495640_0035855 Ga0495640_0035855_2495_3496 278
401 3300046559 Ga0495667_0026205 Ga0495667_0026205_2131_3132 278
402 3300046663 Ga0495635_0025046 Ga0495635_0025046_707_1708 278
403 3300046680 Ga0495646_0118237 Ga0495646_0118237_298_1299 278
404 3300046809 Ga0495600_0055592 Ga0495600_0055592_338_1339 278
405 3300047317 Ga0495604_0009299 Ga0495604_0009299_5672_6673 278
406 3300047322 Ga0495680_0026626 Ga0495680_0026626_1269_2270 278
407 3300047673 Ga0495593_0053418 Ga0495593_0053418_864_1865 278
408 3300048088 Ga0495602_0098047 Ga0495602_0098047_394_1395 278
409 3300048903 Ga0496100_0064055 Ga0496100_0064055_688_1680 278
410 3300048903 Ga0496100_0249691 Ga0496100_0249691_148_1128 278
411 3300048904 Ga0496101_0009586 Ga0496101_0009586_2104_3096 278
412 3300048906 Ga0496103_0071919 Ga0496103_0071919_607_1599 278
413 3300048907 Ga0496104_0105923 Ga0496104_0105923_1013_2005 278
414 3300049586 Ga0501070_0008242 Ga0501070_0008242_106_1095 278
415 3300049823 Ga0501044_0197844 Ga0501044_0197844_903_1898 278
416 3300053077 Ga0495601_0003818 Ga0495601_0003818_5208_6209 278
417 3300053084 Ga0495595_0015962 Ga0495595_0015962_1673_2674 278
418 3300053085 Ga0495619_0000628 Ga0495619_0000628_6877_7878 278
419 3300005434 Ga0070709_10029506 Ga0070709_100295062 279
420 3300035170 Ga0373943_0019971 Ga0373943_0019971_709_1695 279
421 3300035692 Ga0373935_0074363 Ga0373935_0074363_692_1678 279
422 3300039437 Ga0436365_1108063 Ga0436365_1108063_453_1451 279
423 3300046463 Ga0495653_0161929 Ga0495653_0161929_167_1153 279
424 3300046514 Ga0495618_0086748 Ga0495618_0086748_411_1397 279
425 3300046517 Ga0495630_0103854 Ga0495630_0103854_566_1552 279
426 3300046642 Ga0495634_0080129 Ga0495634_0080129_217_1203 279
427 3300046663 Ga0495635_0111734 Ga0495635_0111734_13_999 279
428 3300046674 Ga0495588_0198236 Ga0495588_0198236_30_1016 279
429 3300047319 Ga0495674_0069477 Ga0495674_0069477_1059_2045 279
430 3300047321 Ga0495676_0022034 Ga0495676_0022034_2255_3241 279
431 3300047471 Ga0495684_0071240 Ga0495684_0071240_1283_2269 279
432 3300048918 Ga0496115_0110381 Ga0496115_0110381_232_1218 279
433 3300049822 Ga0501035_0000896 Ga0501035_0000896_12282_13268 279
434 3300053077 Ga0495601_0024093 Ga0495601_0024093_1546_2532 279
435 3300053078 Ga0495612_0005755 Ga0495612_0005755_2801_3787 279
436 3300053085 Ga0495619_0004640 Ga0495619_0004640_4112_5098 279
437 3300054114 Ga0501084_0260661 Ga0501084_0260661_292_1302 279
438 3300006177 Ga0075362_10001028 Ga0075362_100010283 280
439 3300006178 Ga0075367_10026404 Ga0075367_100264043 280
440 3300013105 Ga0157369_10438364 Ga0157369_104383642 280
441 3300049581 Ga0501047_0168876 Ga0501047_0168876_756_1733 280
442 3300049586 Ga0501070_0007677 Ga0501070_0007677_7434_8411 280
443 3300049589 Ga0501073_0049770 Ga0501073_0049770_385_1362 280
444 3300049822 Ga0501035_0409611 Ga0501035_0409611_89_1072 280
445 3300049823 Ga0501044_0291460 Ga0501044_0291460_38_1015 280
446 3300009094 Ga0111539_10013785 Ga0111539_100137854 281
447 3300027876 Ga0209974_10002661 Ga0209974_100026611 281
448 3300048908 Ga0496105_0114051 Ga0496105_0114051_521_1516 281
449 3300053077 Ga0495601_0050468 Ga0495601_0050468_1539_2534 281
450 3300053085 Ga0495619_0010923 Ga0495619_0010923_1628_2623 281
451 3300005439 Ga0070711_100071211 Ga0070711_1000712114 282
452 3300013102 Ga0157371_10013856 Ga0157371_100138564 282
453 3300025916 Ga0207663_10033471 Ga0207663_100334713 282
454 3300046492 Ga0495585_0004760 Ga0495585_0004760_6418_7398 282
455 3300046501 Ga0495607_0016632 Ga0495607_0016632_2998_3978 282
456 3300046520 Ga0495637_0052229 Ga0495637_0052229_17_997 282
457 3300046523 Ga0495644_0000983 Ga0495644_0000983_3694_4674 282
458 3300046537 Ga0495598_0020568 Ga0495598_0020568_80_1060 282
459 3300046558 Ga0495633_0008234 Ga0495633_0008234_3235_4215 282
460 3300046615 Ga0495656_0000789 Ga0495656_0000789_8069_9049 282
461 3300046664 Ga0495659_0005270 Ga0495659_0005270_552_1532 282
462 3300046691 Ga0495670_0000479 Ga0495670_0000479_15180_16160 282
463 3300048907 Ga0496104_0000299 Ga0496104_0000299_21919_22914 282
464 3300048908 Ga0496105_0001270 Ga0496105_0001270_16255_17250 282
465 3300048917 Ga0496114_0070041 Ga0496114_0070041_901_1896 282
466 3300049569 Ga0501032_0013787 Ga0501032_0013787_1722_2720 282
467 3300049570 Ga0501033_0094162 Ga0501033_0094162_398_1384 282
468 3300049571 Ga0501034_0023890 Ga0501034_0023890_4448_5446 282
469 3300049572 Ga0501036_0001657 Ga0501036_0001657_12145_13143 282
470 3300049573 Ga0501037_0005935 Ga0501037_0005935_7168_8148 282
471 3300049573 Ga0501037_0018906 Ga0501037_0018906_681_1679 282
472 3300049574 Ga0501038_0013215 Ga0501038_0013215_4133_5113 282
473 3300049575 Ga0501039_0208799 Ga0501039_0208799_469_1455 282
474 3300049579 Ga0501043_0002225 Ga0501043_0002225_11061_12059 282
475 3300049579 Ga0501043_0011946 Ga0501043_0011946_98_1078 282
476 3300049579 Ga0501043_0114917 Ga0501043_0114917_219_1205 282
477 3300049580 Ga0501046_0023812 Ga0501046_0023812_3964_4962 282
478 3300049581 Ga0501047_0000314 Ga0501047_0000314_4434_5432 282
479 3300049582 Ga0501048_0002000 Ga0501048_0002000_3530_4528 282
480 3300049585 Ga0501069_0089368 Ga0501069_0089368_678_1664 282
481 3300049586 Ga0501070_0062216 Ga0501070_0062216_2030_3028 282
482 3300049590 Ga0501074_0034191 Ga0501074_0034191_908_1906 282
483 3300049592 Ga0501076_0087471 Ga0501076_0087471_146_1132 282
484 3300049742 Ga0501080_0005419 Ga0501080_0005419_5947_6945 282
485 3300049744 Ga0501083_0001743 Ga0501083_0001743_4479_5477 282
486 3300049744 Ga0501083_0129738 Ga0501083_0129738_469_1455 282
487 3300049822 Ga0501035_0119923 Ga0501035_0119923_961_1941 282
488 3300049823 Ga0501044_0028840 Ga0501044_0028840_520_1518 282
489 3300049823 Ga0501044_0040259 Ga0501044_0040259_432_1418 282
490 3300049823 Ga0501044_0167511 Ga0501044_0167511_396_1376 282
491 3300003659 JGI25404J52841_10006788 JGI25404J52841_100067883 283
492 3300005341 Ga0070691_10009402 Ga0070691_100094022 283
493 3300005435 Ga0070714_100027072 Ga0070714_1000270723 283
494 3300005435 Ga0070714_100093437 Ga0070714_1000934374 283
495 3300005459 Ga0068867_100017453 Ga0068867_1000174535 283
496 3300005546 Ga0070696_100008593 Ga0070696_1000085936 283
497 3300005549 Ga0070704_100018272 Ga0070704_1000182725 283
498 3300005563 Ga0068855_100053416 Ga0068855_1000534164 283
499 3300005616 Ga0068852_100011300 Ga0068852_1000113003 283
500 3300005983 Ga0081540_1000007 Ga0081540_1000007118 283
501 3300006175 Ga0070712_100083487 Ga0070712_1000834871 283
502 3300009093 Ga0105240_10234711 Ga0105240_102347112 283
503 3300009551 Ga0105238_10094377 Ga0105238_100943772 283
504 3300013306 Ga0163162_10075749 Ga0163162_100757494 283
505 3300025904 Ga0207647_10006899 Ga0207647_100068998 283
506 3300025915 Ga0207693_10108204 Ga0207693_101082042 283
507 3300025919 Ga0207657_10012419 Ga0207657_100124198 283
508 3300025924 Ga0207694_10083458 Ga0207694_100834582 283
509 3300025928 Ga0207700_10093579 Ga0207700_100935792 283
510 3300025949 Ga0207667_10337495 Ga0207667_103374952 283
511 3300026078 Ga0207702_10163742 Ga0207702_101637422 283
512 3300027717 Ga0209998_10000862 Ga0209998_100008625 283
513 3300031250 Ga0265331_10018492 Ga0265331_100184924 283
514 3300031711 Ga0265314_10022387 Ga0265314_100223876 283
515 2209111006 2214656053 2213681319 284
516 3300000041 ARcpr5oldR_c000226 ARcpr5oldR_00022610 284
517 3300000042 ARSoilYngRDRAFT_c00122 ARSoilYngRDRAFT_0012211 284
518 3300000043 ARcpr5yngRDRAFT_c000316 ARcpr5yngRDRAFT_0003167 284
519 3300000044 ARSoilOldRDRAFT_c000054 ARSoilOldRDRAFT_00005421 284
520 3300000652 ARCol0yngRDRAFT_1000054 ARCol0yngRDRAFT_100005416 284
521 3300001430 JGI24032J14994_100197 JGI24032J14994_1001973 284
522 3300001977 JGI24746J21847_1004760 JGI24746J21847_10047602 284
523 3300001978 JGI24747J21853_1000617 JGI24747J21853_10006173 284
524 3300001979 JGI24740J21852_10019512 JGI24740J21852_100195122 284
525 3300001989 JGI24739J22299_10001041 JGI24739J22299_100010415 284
526 3300001990 JGI24737J22298_10000776 JGI24737J22298_100007763 284
527 3300001990 JGI24737J22298_10000959 JGI24737J22298_100009595 284
528 3300002070 JGI24750J21931_1000558 JGI24750J21931_10005585 284
529 3300002075 JGI24738J21930_10000571 JGI24738J21930_100005715 284
530 3300002076 JGI24749J21850_1000591 JGI24749J21850_10005914 284
531 3300002126 JGI24035J26624_1000164 JGI24035J26624_10001645 284
532 3300002239 JGI24034J26672_10000323 JGI24034J26672_100003235 284
533 3300002244 JGI24742J22300_10000080 JGI24742J22300_1000008011 284
534 3300005277 Ga0065716_1001726 Ga0065716_10017262 284
535 3300005290 Ga0065712_10009732 Ga0065712_100097322 284
536 3300005293 Ga0065715_10001633 Ga0065715_100016337 284
537 3300005329 Ga0070683_100000289 Ga0070683_10000028918 284
538 3300005329 Ga0070683_100064495 Ga0070683_1000644953 284
539 3300005330 Ga0070690_100006047 Ga0070690_1000060474 284
540 3300005330 Ga0070690_100010825 Ga0070690_1000108256 284
541 3300005331 Ga0070670_100027675 Ga0070670_1000276754 284
542 3300005331 Ga0070670_100108118 Ga0070670_1001081183 284
543 3300005333 Ga0070677_10000043 Ga0070677_1000004311 284
544 3300005334 Ga0068869_100002554 Ga0068869_1000025545 284
545 3300005335 Ga0070666_10013513 Ga0070666_100135134 284
546 3300005336 Ga0070680_100016633 Ga0070680_1000166337 284
547 3300005336 Ga0070680_100035810 Ga0070680_1000358101 284
548 3300005337 Ga0070682_100000528 Ga0070682_10000052810 284
549 3300005337 Ga0070682_100040250 Ga0070682_1000402502 284
550 3300005338 Ga0068868_100000408 Ga0068868_10000040822 284
551 3300005338 Ga0068868_100040736 Ga0068868_1000407362 284
552 3300005339 Ga0070660_100011422 Ga0070660_1000114224 284
553 3300005339 Ga0070660_100037116 Ga0070660_1000371164 284
554 3300005340 Ga0070689_100000819 Ga0070689_10000081917 284
555 3300005340 Ga0070689_100008559 Ga0070689_1000085595 284
556 3300005340 Ga0070689_100068676 Ga0070689_1000686763 284
557 3300005343 Ga0070687_100000950 Ga0070687_1000009506 284
558 3300005344 Ga0070661_100000314 Ga0070661_10000031425 284
559 3300005344 Ga0070661_100008178 Ga0070661_1000081787 284
560 3300005345 Ga0070692_10000310 Ga0070692_100003106 284
561 3300005345 Ga0070692_10037572 Ga0070692_100375722 284
562 3300005347 Ga0070668_100000857 Ga0070668_1000008577 284
563 3300005353 Ga0070669_100005664 Ga0070669_1000056649 284
564 3300005353 Ga0070669_100047495 Ga0070669_1000474953 284
565 3300005354 Ga0070675_100004259 Ga0070675_1000042593 284
566 3300005354 Ga0070675_100031348 Ga0070675_1000313482 284
567 3300005355 Ga0070671_100000598 Ga0070671_10000059826 284
568 3300005355 Ga0070671_100031256 Ga0070671_1000312564 284
569 3300005356 Ga0070674_100404834 Ga0070674_1004048341 284
570 3300005364 Ga0070673_100000289 Ga0070673_10000028915 284
571 3300005365 Ga0070688_100000189 Ga0070688_1000001896 284
572 3300005365 Ga0070688_100005181 Ga0070688_1000051814 284
573 3300005365 Ga0070688_100041426 Ga0070688_1000414262 284
574 3300005366 Ga0070659_100075797 Ga0070659_1000757974 284
575 3300005367 Ga0070667_100000436 Ga0070667_10000043617 284
576 3300005367 Ga0070667_100016498 Ga0070667_1000164987 284
577 3300005367 Ga0070667_100164712 Ga0070667_1001647122 284
578 3300005406 Ga0070703_10002551 Ga0070703_100025514 284
579 3300005434 Ga0070709_10001788 Ga0070709_100017882 284
580 3300005435 Ga0070714_100037701 Ga0070714_1000377015 284
581 3300005436 Ga0070713_100001448 Ga0070713_1000014489 284
582 3300005438 Ga0070701_10000106 Ga0070701_1000010622 284
583 3300005438 Ga0070701_10009951 Ga0070701_100099515 284
584 3300005438 Ga0070701_10071269 Ga0070701_100712692 284
585 3300005439 Ga0070711_100023208 Ga0070711_1000232082 284
586 3300005440 Ga0070705_100000781 Ga0070705_1000007814 284
587 3300005441 Ga0070700_100001610 Ga0070700_1000016109 284
588 3300005444 Ga0070694_100003956 Ga0070694_10000395611 284
589 3300005444 Ga0070694_100005440 Ga0070694_1000054407 284
590 3300005455 Ga0070663_100000297 Ga0070663_10000029713 284
591 3300005455 Ga0070663_100050692 Ga0070663_1000506922 284
592 3300005456 Ga0070678_100001470 Ga0070678_1000014705 284
593 3300005456 Ga0070678_100011789 Ga0070678_1000117892 284
594 3300005457 Ga0070662_100035544 Ga0070662_1000355444 284
595 3300005457 Ga0070662_100065036 Ga0070662_1000650361 284
596 3300005458 Ga0070681_10000645 Ga0070681_1000064528 284
597 3300005466 Ga0070685_10034634 Ga0070685_100346342 284
598 3300005530 Ga0070679_100115293 Ga0070679_1001152934 284
599 3300005535 Ga0070684_100006705 Ga0070684_1000067059 284
600 3300005535 Ga0070684_100015951 Ga0070684_1000159514 284
601 3300005535 Ga0070684_100043054 Ga0070684_1000430545 284
602 3300005539 Ga0068853_100007059 Ga0068853_1000070598 284
603 3300005543 Ga0070672_100000106 Ga0070672_10000010628 284
604 3300005543 Ga0070672_100126117 Ga0070672_1001261171 284
605 3300005544 Ga0070686_100000615 Ga0070686_10000061517 284
606 3300005544 Ga0070686_100015365 Ga0070686_1000153653 284
607 3300005545 Ga0070695_100001248 Ga0070695_10000124811 284
608 3300005545 Ga0070695_100017930 Ga0070695_1000179302 284
609 3300005545 Ga0070695_100145569 Ga0070695_1001455691 284
610 3300005546 Ga0070696_100059408 Ga0070696_1000594084 284
611 3300005546 Ga0070696_100071909 Ga0070696_1000719092 284
612 3300005549 Ga0070704_100004997 Ga0070704_1000049975 284
613 3300005564 Ga0070664_100017797 Ga0070664_1000177976 284
614 3300005577 Ga0068857_100000047 Ga0068857_10000004745 284
615 3300005578 Ga0068854_100000502 Ga0068854_1000005022 284
616 3300005578 Ga0068854_100059417 Ga0068854_1000594173 284
617 3300005614 Ga0068856_100001905 Ga0068856_1000019056 284
618 3300005615 Ga0070702_100004825 Ga0070702_1000048253 284
619 3300005615 Ga0070702_100031385 Ga0070702_1000313853 284
620 3300005617 Ga0068859_100005879 Ga0068859_1000058798 284
621 3300005617 Ga0068859_100024931 Ga0068859_1000249314 284
622 3300005618 Ga0068864_100000931 Ga0068864_10000093118 284
623 3300005618 Ga0068864_100116167 Ga0068864_1001161673 284
624 3300005718 Ga0068866_10000077 Ga0068866_1000007719 284
625 3300005718 Ga0068866_10014674 Ga0068866_100146743 284
626 3300005719 Ga0068861_100011038 Ga0068861_1000110383 284
627 3300005840 Ga0068870_10001017 Ga0068870_100010176 284
628 3300005841 Ga0068863_100000543 Ga0068863_10000054324 284
629 3300005841 Ga0068863_100036826 Ga0068863_1000368262 284
630 3300005842 Ga0068858_100002073 Ga0068858_10000207318 284
631 3300005842 Ga0068858_100028716 Ga0068858_1000287165 284
632 3300005842 Ga0068858_100040985 Ga0068858_1000409853 284
633 3300005843 Ga0068860_100005115 Ga0068860_1000051156 284
634 3300005843 Ga0068860_100034229 Ga0068860_1000342294 284
635 3300005844 Ga0068862_100000879 Ga0068862_10000087917 284
636 3300005844 Ga0068862_100013544 Ga0068862_1000135444 284
637 3300006028 Ga0070717_10000287 Ga0070717_1000028721 284
638 3300006042 Ga0075368_10067462 Ga0075368_100674622 284
639 3300006058 Ga0075432_10000660 Ga0075432_100006608 284
640 3300006163 Ga0070715_10000989 Ga0070715_1000098910 284
641 3300006175 Ga0070712_100174265 Ga0070712_1001742652 284
642 3300006237 Ga0097621_100000416 Ga0097621_10000041623 284
643 3300006237 Ga0097621_100007350 Ga0097621_1000073502 284
644 3300006358 Ga0068871_100000249 Ga0068871_10000024927 284
645 3300006358 Ga0068871_100004813 Ga0068871_1000048139 284
646 3300006844 Ga0075428_100047718 Ga0075428_1000477185 284
647 3300006846 Ga0075430_100002807 Ga0075430_1000028076 284
648 3300006847 Ga0075431_100013028 Ga0075431_1000130281 284
649 3300006852 Ga0075433_10001150 Ga0075433_1000115012 284
650 3300006871 Ga0075434_100003092 Ga0075434_10000309216 284
651 3300006871 Ga0075434_100003158 Ga0075434_1000031586 284
652 3300006880 Ga0075429_100001089 Ga0075429_10000108913 284
653 3300006881 Ga0068865_100000248 Ga0068865_10000024817 284
654 3300006881 Ga0068865_100065099 Ga0068865_1000650993 284
655 3300006914 Ga0075436_100015431 Ga0075436_1000154317 284
656 3300006914 Ga0075436_100069651 Ga0075436_1000696512 284
657 3300006931 Ga0097620_100005879 Ga0097620_1000058799 284
658 3300006931 Ga0097620_100024931 Ga0097620_1000249314 284
659 3300007076 Ga0075435_100040427 Ga0075435_1000404273 284
660 3300007076 Ga0075435_100211730 Ga0075435_1002117302 284
661 3300007076 Ga0075435_100258996 Ga0075435_1002589962 284
662 3300007788 Ga0099795_10004304 Ga0099795_100043042 284
663 3300009011 Ga0105251_10019615 Ga0105251_100196152 284
664 3300009011 Ga0105251_10028839 Ga0105251_100288393 284
665 3300009093 Ga0105240_10034168 Ga0105240_100341687 284
666 3300009094 Ga0111539_10002489 Ga0111539_1000248924 284
667 3300009094 Ga0111539_10002685 Ga0111539_1000268513 284
668 3300009098 Ga0105245_10016985 Ga0105245_100169855 284
669 3300009101 Ga0105247_10000908 Ga0105247_1000090817 284
670 3300009147 Ga0114129_10094866 Ga0114129_100948665 284
671 3300009148 Ga0105243_10001705 Ga0105243_1000170521 284
672 3300009148 Ga0105243_10022992 Ga0105243_100229924 284
673 3300009174 Ga0105241_10002306 Ga0105241_1000230613 284
674 3300009176 Ga0105242_10001376 Ga0105242_100013766 284
675 3300009176 Ga0105242_10232853 Ga0105242_102328531 284
676 3300009177 Ga0105248_10016671 Ga0105248_100166714 284
677 3300009545 Ga0105237_10002245 Ga0105237_1000224519 284
678 3300009545 Ga0105237_10041271 Ga0105237_100412715 284
679 3300009545 Ga0105237_10089865 Ga0105237_100898653 284
680 3300009553 Ga0105249_10000476 Ga0105249_1000047622 284
681 3300009553 Ga0105249_10032161 Ga0105249_100321616 284
682 3300009553 Ga0105249_10398243 Ga0105249_103982432 284
683 3300010159 Ga0099796_10000894 Ga0099796_100008942 284
684 3300010375 Ga0105239_10015033 Ga0105239_100150339 284
685 3300010375 Ga0105239_10179657 Ga0105239_101796573 284
686 3300011119 Ga0105246_10000057 Ga0105246_100000577 284
687 3300012515 Ga0157338_1000271 Ga0157338_10002712 284
688 3300013296 Ga0157374_10032430 Ga0157374_100324303 284
689 3300013297 Ga0157378_10146161 Ga0157378_101461612 284
690 3300013306 Ga0163162_10001937 Ga0163162_100019376 284
691 3300013308 Ga0157375_10001755 Ga0157375_100017555 284
692 3300013308 Ga0157375_10069926 Ga0157375_100699264 284
693 3300013308 Ga0157375_10551290 Ga0157375_105512901 284
694 3300014325 Ga0163163_10003757 Ga0163163_1000375713 284
695 3300014326 Ga0157380_10002615 Ga0157380_1000261511 284
696 3300014745 Ga0157377_10002633 Ga0157377_1000263310 284
697 3300014745 Ga0157377_10019882 Ga0157377_100198825 284
698 3300014968 Ga0157379_10000293 Ga0157379_1000029319 284
699 3300014968 Ga0157379_10062321 Ga0157379_100623213 284
700 3300014968 Ga0157379_10084734 Ga0157379_100847342 284
701 3300014969 Ga0157376_10000531 Ga0157376_1000053118 284
702 3300014969 Ga0157376_10349106 Ga0157376_103491062 284
703 3300017792 Ga0163161_10000209 Ga0163161_100002094 284
704 3300025271 Ga0207666_1000353 Ga0207666_10003535 284
705 3300025315 Ga0207697_10000044 Ga0207697_1000004418 284
706 3300025315 Ga0207697_10011939 Ga0207697_100119394 284
707 3300025885 Ga0207653_10011921 Ga0207653_100119213 284
708 3300025893 Ga0207682_10000260 Ga0207682_1000026011 284
709 3300025898 Ga0207692_10001125 Ga0207692_100011259 284
710 3300025899 Ga0207642_10000807 Ga0207642_100008079 284
711 3300025900 Ga0207710_10003110 Ga0207710_100031109 284
712 3300025901 Ga0207688_10012079 Ga0207688_100120793 284
713 3300025904 Ga0207647_10004419 Ga0207647_1000441910 284
714 3300025907 Ga0207645_10000344 Ga0207645_1000034436 284
715 3300025908 Ga0207643_10000012 Ga0207643_1000001211 284
716 3300025911 Ga0207654_10036113 Ga0207654_100361134 284
717 3300025912 Ga0207707_10018209 Ga0207707_100182093 284
718 3300025913 Ga0207695_10077441 Ga0207695_100774413 284
719 3300025914 Ga0207671_10022324 Ga0207671_100223244 284
720 3300025915 Ga0207693_10000861 Ga0207693_1000086118 284
721 3300025917 Ga0207660_10000992 Ga0207660_1000099218 284
722 3300025918 Ga0207662_10000216 Ga0207662_1000021622 284
723 3300025918 Ga0207662_10004775 Ga0207662_100047757 284
724 3300025918 Ga0207662_10158640 Ga0207662_101586401 284
725 3300025919 Ga0207657_10000358 Ga0207657_1000035811 284
726 3300025919 Ga0207657_10036149 Ga0207657_100361493 284
727 3300025920 Ga0207649_10000545 Ga0207649_1000054523 284
728 3300025921 Ga0207652_10012964 Ga0207652_100129647 284
729 3300025923 Ga0207681_10000684 Ga0207681_1000068419 284
730 3300025923 Ga0207681_10173205 Ga0207681_101732052 284
731 3300025924 Ga0207694_10280239 Ga0207694_102802391 284
732 3300025925 Ga0207650_10016372 Ga0207650_100163727 284
733 3300025926 Ga0207659_10000023 Ga0207659_10000023109 284
734 3300025926 Ga0207659_10008259 Ga0207659_100082593 284
735 3300025927 Ga0207687_10000149 Ga0207687_1000014925 284
736 3300025928 Ga0207700_10011168 Ga0207700_100111685 284
737 3300025929 Ga0207664_10005618 Ga0207664_100056182 284
738 3300025931 Ga0207644_10007018 Ga0207644_100070186 284
739 3300025932 Ga0207690_10000203 Ga0207690_1000020343 284
740 3300025932 Ga0207690_10034350 Ga0207690_100343503 284
741 3300025932 Ga0207690_10307345 Ga0207690_103073451 284
742 3300025933 Ga0207706_10002188 Ga0207706_100021886 284
743 3300025933 Ga0207706_10008175 Ga0207706_1000817510 284
744 3300025934 Ga0207686_10001306 Ga0207686_100013067 284
745 3300025934 Ga0207686_10004009 Ga0207686_100040094 284
746 3300025935 Ga0207709_10000852 Ga0207709_1000085219 284
747 3300025936 Ga0207670_10005646 Ga0207670_100056465 284
748 3300025937 Ga0207669_10000357 Ga0207669_1000035718 284
749 3300025937 Ga0207669_10108343 Ga0207669_101083433 284
750 3300025938 Ga0207704_10002400 Ga0207704_100024007 284
751 3300025939 Ga0207665_10000259 Ga0207665_1000025910 284
752 3300025940 Ga0207691_10000256 Ga0207691_1000025639 284
753 3300025940 Ga0207691_10328719 Ga0207691_103287191 284
754 3300025941 Ga0207711_10020618 Ga0207711_100206185 284
755 3300025942 Ga0207689_10000565 Ga0207689_1000056532 284
756 3300025942 Ga0207689_10028355 Ga0207689_100283554 284
757 3300025944 Ga0207661_10000104 Ga0207661_1000010427 284
758 3300025945 Ga0207679_10000196 Ga0207679_1000019618 284
759 3300025945 Ga0207679_10392934 Ga0207679_103929341 284
760 3300025949 Ga0207667_10032029 Ga0207667_100320293 284
761 3300025960 Ga0207651_10001138 Ga0207651_1000113811 284
762 3300025961 Ga0207712_10000967 Ga0207712_1000096716 284
763 3300025961 Ga0207712_10027564 Ga0207712_100275644 284
764 3300025972 Ga0207668_10000251 Ga0207668_100002517 284
765 3300025981 Ga0207640_10000157 Ga0207640_100001574 284
766 3300025981 Ga0207640_10099634 Ga0207640_100996342 284
767 3300025986 Ga0207658_10010507 Ga0207658_100105077 284
768 3300025986 Ga0207658_10031355 Ga0207658_100313555 284
769 3300025986 Ga0207658_10119225 Ga0207658_101192252 284
770 3300026023 Ga0207677_10000609 Ga0207677_1000060921 284
771 3300026035 Ga0207703_10007245 Ga0207703_1000724510 284
772 3300026035 Ga0207703_10044502 Ga0207703_100445023 284
773 3300026041 Ga0207639_10002440 Ga0207639_1000244013 284
774 3300026041 Ga0207639_10113773 Ga0207639_101137732 284
775 3300026067 Ga0207678_10001125 Ga0207678_1000112522 284
776 3300026067 Ga0207678_10055203 Ga0207678_100552035 284
777 3300026075 Ga0207708_10000365 Ga0207708_1000036533 284
778 3300026075 Ga0207708_10015747 Ga0207708_100157475 284
779 3300026078 Ga0207702_10003955 Ga0207702_100039556 284
780 3300026078 Ga0207702_10281855 Ga0207702_102818551 284
781 3300026088 Ga0207641_10002938 Ga0207641_100029389 284
782 3300026089 Ga0207648_10000341 Ga0207648_100003415 284
783 3300026089 Ga0207648_10023831 Ga0207648_100238313 284
784 3300026089 Ga0207648_10154534 Ga0207648_101545342 284
785 3300026095 Ga0207676_10004494 Ga0207676_1000449411 284
786 3300026095 Ga0207676_10012794 Ga0207676_100127947 284
787 3300026116 Ga0207674_10001078 Ga0207674_1000107833 284
788 3300026118 Ga0207675_100003271 Ga0207675_10000327116 284
789 3300026118 Ga0207675_100072959 Ga0207675_1000729592 284
790 3300026118 Ga0207675_100160135 Ga0207675_1001601353 284
791 3300026121 Ga0207683_10000006 Ga0207683_10000006112 284
792 3300027695 Ga0209966_1001700 Ga0209966_10017003 284
793 3300027695 Ga0209966_1002101 Ga0209966_10021014 284
794 3300027717 Ga0209998_10001803 Ga0209998_100018032 284
795 3300027717 Ga0209998_10043599 Ga0209998_100435991 284
796 3300027876 Ga0209974_10067284 Ga0209974_100672842 284
797 3300027907 Ga0207428_10000165 Ga0207428_1000016576 284
798 3300027907 Ga0207428_10000446 Ga0207428_1000044621 284
799 3300027907 Ga0207428_10001251 Ga0207428_1000125113 284
800 3300028379 Ga0268266_10016010 Ga0268266_100160104 284
801 3300028380 Ga0268265_10001687 Ga0268265_1000168718 284
802 3300028380 Ga0268265_10036385 Ga0268265_100363854 284
803 3300028381 Ga0268264_10002029 Ga0268264_1000202919 284
804 3300028381 Ga0268264_10018354 Ga0268264_100183543 284
805 3300031711 Ga0265314_10005328 Ga0265314_100053285 284
806 3300034816 Ga0373930_0002826 Ga0373930_0002826_1504_2490 284
807 3300034817 Ga0373948_0000248 Ga0373948_0000248_1495_2478 284
808 3300034818 Ga0373950_0022322 Ga0373950_0022322_100_1080 284
809 3300034819 Ga0373958_0000204 Ga0373958_0000204_2264_3247 284
810 3300034819 Ga0373958_0001259 Ga0373958_0001259_906_1886 284
811 3300034819 Ga0373958_0003604 Ga0373958_0003604_1176_2162 284
812 3300034820 Ga0373959_0004004 Ga0373959_0004004_1320_2306 284
813 3300034820 Ga0373959_0004649 Ga0373959_0004649_536_1519 284
814 3300034957 Ga0373938_0000103 Ga0373938_0000103_5424_6407 284
815 3300034957 Ga0373938_0001026 Ga0373938_0001026_1816_2796 284
816 3300035084 Ga0373928_0001804 Ga0373928_0001804_1718_2704 284
817 3300035084 Ga0373928_0002065 Ga0373928_0002065_1849_2832 284
818 3300035085 Ga0373929_0002152 Ga0373929_0002152_2180_3163 284
819 3300035085 Ga0373929_0009691 Ga0373929_0009691_604_1584 284
820 3300035089 Ga0373944_0002070 Ga0373944_0002070_1971_2951 284
821 3300035090 Ga0373949_0002185 Ga0373949_0002185_3190_4176 284
822 3300035090 Ga0373949_0009483 Ga0373949_0009483_217_1200 284
823 3300035091 Ga0373951_0001067 Ga0373951_0001067_328_1311 284
824 3300035091 Ga0373951_0001578 Ga0373951_0001578_1652_2632 284
825 3300035091 Ga0373951_0004467 Ga0373951_0004467_1388_2374 284
826 3300035092 Ga0373952_0002272 Ga0373952_0002272_933_1916 284
827 3300035092 Ga0373952_0004667 Ga0373952_0004667_539_1519 284
828 3300035092 Ga0373952_0007374 Ga0373952_0007374_894_1880 284
829 3300035112 Ga0373932_0000763 Ga0373932_0000763_4037_5023 284
830 3300035112 Ga0373932_0002253 Ga0373932_0002253_3095_4078 284
831 3300035113 Ga0373936_0002079 Ga0373936_0002079_387_1367 284
832 3300035114 Ga0373939_0000538 Ga0373939_0000538_600_1583 284
833 3300035114 Ga0373939_0001474 Ga0373939_0001474_1995_2981 284
834 3300035114 Ga0373939_0004190 Ga0373939_0004190_1831_2811 284
835 3300035114 Ga0373939_0006376 Ga0373939_0006376_1332_2324 284
836 3300035115 Ga0373941_0003546 Ga0373941_0003546_387_1373 284
837 3300035116 Ga0373945_0004056 Ga0373945_0004056_1085_2065 284
838 3300035118 Ga0373954_0003827 Ga0373954_0003827_1838_2818 284
839 3300035119 Ga0373956_0007108 Ga0373956_0007108_2776_3756 284
840 3300035121 Ga0373960_0000016 Ga0373960_0000016_2839_3822 284
841 3300035170 Ga0373943_0010246 Ga0373943_0010246_267_1247 284
842 3300035170 Ga0373943_0031519 Ga0373943_0031519_709_1689 284
843 3300035171 Ga0373946_0000794 Ga0373946_0000794_6668_7648 284
844 3300035171 Ga0373946_0040304 Ga0373946_0040304_78_1058 284
845 3300035172 Ga0373955_0024053 Ga0373955_0024053_1435_2415 284
846 3300035207 Ga0373942_0001481 Ga0373942_0001481_1034_2017 284
847 3300035207 Ga0373942_0004423 Ga0373942_0004423_266_1252 284
848 3300035241 Ga0373961_0003830 Ga0373961_0003830_1415_2398 284
849 3300035241 Ga0373961_0003885 Ga0373961_0003885_543_1523 284
850 3300035241 Ga0373961_0005277 Ga0373961_0005277_594_1580 284
851 3300035242 Ga0373962_0000149 Ga0373962_0000149_4080_5066 284
852 3300035242 Ga0373962_0000620 Ga0373962_0000620_808_1791 284
853 3300035242 Ga0373962_0001044 Ga0373962_0001044_5231_6211 284
854 3300035410 Ga0373924_0001761 Ga0373924_0001761_3494_4474 284
855 3300035691 Ga0373931_0002359 Ga0373931_0002359_5217_6197 284
856 3300035691 Ga0373931_0004026 Ga0373931_0004026_3203_4189 284
857 3300035691 Ga0373931_0035211 Ga0373931_0035211_758_1741 284
858 3300035692 Ga0373935_0003725 Ga0373935_0003725_2254_3234 284
859 3300035695 Ga0373927_0022483 Ga0373927_0022483_1527_2507 284
860 3300035724 Ga0373933_0007407 Ga0373933_0007407_3392_4372 284
861 3300035725 Ga0373947_0058914 Ga0373947_0058914_435_1415 284
862 3300036401 Ga0373937_0018802 Ga0373937_0018802_3654_4634 284
863 3300037418 Ga0395900_0001539 Ga0395900_0001539_7220_8245 284
864 3300037466 Ga0395898_0018398 Ga0395898_0018398_4599_5624 284
865 3300044712 Ga0453684_0030893 Ga0453684_0030893_5154_6137 284
866 3300045051 Ga0451576_0016162 Ga0451576_0016162_3218_4201 284
867 3300045976 Ga0466967_0447170 Ga0466967_0447170_177_1169 284
868 3300046454 Ga0495592_0010694 Ga0495592_0010694_3529_4509 284
869 3300046459 Ga0495629_0000908 Ga0495629_0000908_7056_8036 284
870 3300046459 Ga0495629_0072282 Ga0495629_0072282_918_1898 284
871 3300046461 Ga0495641_0013745 Ga0495641_0013745_24_1004 284
872 3300046461 Ga0495641_0068989 Ga0495641_0068989_136_1116 284
873 3300046462 Ga0495651_0031843 Ga0495651_0031843_1904_2884 284
874 3300046473 Ga0495582_0013116 Ga0495582_0013116_1308_2288 284
875 3300046476 Ga0495662_0002314 Ga0495662_0002314_1546_2526 284
876 3300046477 Ga0495664_0031623 Ga0495664_0031623_562_1542 284
877 3300046511 Ga0495608_0013583 Ga0495608_0013583_749_1729 284
878 3300046516 Ga0495628_0075930 Ga0495628_0075930_720_1700 284
879 3300046529 Ga0495652_0007929 Ga0495652_0007929_3863_4843 284
880 3300046531 Ga0495665_0010075 Ga0495665_0010075_855_1844 284
881 3300046533 Ga0495640_0110846 Ga0495640_0110846_24_1004 284
882 3300046535 Ga0495586_0048068 Ga0495586_0048068_918_1898 284
883 3300046557 Ga0495622_0003333 Ga0495622_0003333_6099_7079 284
884 3300046559 Ga0495667_0017680 Ga0495667_0017680_2274_3254 284
885 3300046642 Ga0495634_0038239 Ga0495634_0038239_1336_2316 284
886 3300046663 Ga0495635_0002598 Ga0495635_0002598_9576_10556 284
887 3300046674 Ga0495588_0020105 Ga0495588_0020105_827_1807 284
888 3300046678 Ga0495599_0007091 Ga0495599_0007091_2447_3427 284
889 3300046680 Ga0495646_0002845 Ga0495646_0002845_7920_8900 284
890 3300046681 Ga0495647_0006115 Ga0495647_0006115_1504_2484 284
891 3300046681 Ga0495647_0008529 Ga0495647_0008529_759_1739 284
892 3300046683 Ga0495658_0000673 Ga0495658_0000673_6744_7724 284
893 3300046689 Ga0495613_0058540 Ga0495613_0058540_1028_2008 284
894 3300046690 Ga0495624_0004039 Ga0495624_0004039_3287_4267 284
895 3300046809 Ga0495600_0000876 Ga0495600_0000876_5356_6336 284
896 3300046809 Ga0495600_0151915 Ga0495600_0151915_495_1475 284
897 3300047315 Ga0495581_0006390 Ga0495581_0006390_5490_6470 284
898 3300047321 Ga0495676_0206799 Ga0495676_0206799_357_1337 284
899 3300047322 Ga0495680_0019825 Ga0495680_0019825_2274_3254 284
900 3300047444 Ga0495675_0075594 Ga0495675_0075594_271_1251 284
901 3300047471 Ga0495684_0003464 Ga0495684_0003464_2631_3611 284
902 3300047673 Ga0495593_0003537 Ga0495593_0003537_218_1198 284
903 3300048903 Ga0496100_0004411 Ga0496100_0004411_3265_4251 284
904 3300048903 Ga0496100_0006203 Ga0496100_0006203_4771_5751 284
905 3300048904 Ga0496101_0000464 Ga0496101_0000464_8890_9876 284
906 3300048904 Ga0496101_0341825 Ga0496101_0341825_98_1078 284
907 3300048905 Ga0496102_0001120 Ga0496102_0001120_23369_24355 284
908 3300048905 Ga0496102_0120448 Ga0496102_0120448_166_1146 284
909 3300048905 Ga0496102_0221629 Ga0496102_0221629_629_1612 284
910 3300048906 Ga0496103_0000611 Ga0496103_0000611_24495_25481 284
911 3300048907 Ga0496104_0022589 Ga0496104_0022589_3548_4528 284
912 3300048907 Ga0496104_0125360 Ga0496104_0125360_708_1694 284
913 3300048907 Ga0496104_0385638 Ga0496104_0385638_72_1052 284
914 3300048909 Ga0496106_0000541 Ga0496106_0000541_2470_3456 284
915 3300048909 Ga0496106_0041084 Ga0496106_0041084_634_1617 284
916 3300048910 Ga0496107_0001684 Ga0496107_0001684_4126_5112 284
917 3300048910 Ga0496107_0018855 Ga0496107_0018855_1847_2830 284
918 3300048910 Ga0496107_0041412 Ga0496107_0041412_455_1435 284
919 3300048911 Ga0496108_0020932 Ga0496108_0020932_1924_2910 284
920 3300048911 Ga0496108_0187188 Ga0496108_0187188_767_1747 284
921 3300048911 Ga0496108_0213856 Ga0496108_0213856_652_1635 284
922 3300048912 Ga0496109_0000696 Ga0496109_0000696_23730_24716 284
923 3300048912 Ga0496109_0012519 Ga0496109_0012519_1546_2532 284
924 3300048913 Ga0496110_0059567 Ga0496110_0059567_147_1130 284
925 3300048915 Ga0496112_0015661 Ga0496112_0015661_967_1947 284
926 3300048916 Ga0496113_0144907 Ga0496113_0144907_47_1027 284
927 3300048916 Ga0496113_0351464 Ga0496113_0351464_85_1065 284
928 3300048917 Ga0496114_0011491 Ga0496114_0011491_5265_6245 284
929 3300048917 Ga0496114_0014713 Ga0496114_0014713_2015_3001 284
930 3300048918 Ga0496115_0012499 Ga0496115_0012499_3270_4256 284
931 3300048918 Ga0496115_0171451 Ga0496115_0171451_718_1698 284
932 3300049571 Ga0501034_0095280 Ga0501034_0095280_556_1548 284
933 3300049581 Ga0501047_0132116 Ga0501047_0132116_532_1524 284
934 3300049586 Ga0501070_0006779 Ga0501070_0006779_6523_7515 284
935 3300049589 Ga0501073_0226226 Ga0501073_0226226_25_1020 284
936 3300049822 Ga0501035_0262985 Ga0501035_0262985_152_1144 284
937 3300049822 Ga0501035_0319828 Ga0501035_0319828_67_1059 284
938 3300049823 Ga0501044_0109276 Ga0501044_0109276_750_1742 284
939 3300049823 Ga0501044_0250109 Ga0501044_0250109_698_1690 284
940 3300050507 nmdc:mga05p37_2697_c1 nmdc:mga05p37_2697_c1_9516_10490 284
941 3300050508 nmdc:mga09592_12303_c1 nmdc:mga09592_12303_c1_1081_2055 284
942 3300050509 nmdc:mga0qj67_693_c1 nmdc:mga0qj67_693_c1_5171_6145 284
943 3300050510 nmdc:mga06r32_1056_c1 nmdc:mga06r32_1056_c1_8736_9710 284
944 3300050511 nmdc:mga08y16_82727_c1 nmdc:mga08y16_82727_c1_803_1789 284
945 3300050512 nmdc:mga0n895_1654_c1 nmdc:mga0n895_1654_c1_9516_10490 284
946 3300050512 nmdc:mga0n895_206722_c1 nmdc:mga0n895_206722_c1_600_1580 284
947 3300050512 nmdc:mga0n895_32994_c1 nmdc:mga0n895_32994_c1_1519_2505 284
948 3300050513 nmdc:mga0rr50_1013_c1 nmdc:mga0rr50_1013_c1_10330_11304 284
949 3300050513 nmdc:mga0rr50_143061_c1 nmdc:mga0rr50_143061_c1_688_1668 284
950 3300050513 nmdc:mga0rr50_161499_c1 nmdc:mga0rr50_161499_c1_267_1253 284
951 3300050513 nmdc:mga0rr50_228131_c1 nmdc:mga0rr50_228131_c1_193_1173 284
952 3300050514 nmdc:mga08x19_96260_c1 nmdc:mga08x19_96260_c1_908_1894 284
953 3300050515 nmdc:mga0a205_467_c1 nmdc:mga0a205_467_c1_19730_20716 284
954 3300050515 nmdc:mga0a205_6139_c1 nmdc:mga0a205_6139_c1_4497_5471 284
955 3300053084 Ga0495595_0007089 Ga0495595_0007089_2736_3716 284
956 3300053085 Ga0495619_0000300 Ga0495619_0000300_27523_28503 284
957 3300060353 Ga0501082_0015464 Ga0501082_0015464_3106_4098 284
958 3300060353 Ga0501082_0250979 Ga0501082_0250979_312_1310 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

3

65

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

157

303

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j7z-assembly6.cif.gz_F thermus thermophilus dnaj j- and g/f-domains 0.9706 3 65
8fe2-assembly2.cif.gz_B structure of j-pkac chimera complexed with aplithianine a 0.9451 3 67
2ctr-assembly1.cif.gz_A solution structure of j-domain from human dnaj subfamily b menber 9 0.9412 1 66
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9344 3 66
8glv-assembly1.cif.gz_KA 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.9269 3 66
ID Description Score Start End Superfamily
af_P36659_200_276_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9805 181 257 2.60.260.20
af_Q921R4_436_526_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9789 4 67 1.10.287.110
af_I1NG96_25_126_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9764 3 67 1.10.287.110
af_K7N008_53_137_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9763 3 67 1.10.287.110
af_Q8CHS2_271_339_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.976 4 57 1.10.287.110
ID Description Score Start End GO Terms
AF-M1CD84-F1-model_v4 DnaJ 0.9683 140 257 GO:0006457
GO:0031072
GO:0046872
GO:0051082
AF-A0A2E1Z000-F1-model_v4 deleted 0.9586 1 76
AF-A0A3M0XWA6-F1-model_v4 J domain-containing protein 0.9583 154 283 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A4Y9J712-F1-model_v4 deleted 0.9544 144 263
AF-A0A6V8NMM0-F1-model_v4 Molecular chaperone DnaJ 0.9469 162 253 GO:0005737
GO:0042026
GO:0051082
GO:0051085

Feature Viewer

pLDDT pTM Quality
84.3 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map