F486462
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 946 | 381 | 1892 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300042438|Ga0439459_0104468|Ga0439459_0104468_36_344 |
| Length | 102 |
| Sequence | MPAPQTPAVHTRRIQQHMAVRIRLTRVGATKQPTYRVVVADARSARDSRAIETIGHYNPRTDPIELNIDAEKATAWLAKGAQPSDTVTRLLKTAGILPAEKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 111 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 223 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 260 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 261 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 264 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 265 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 266 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 267 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 7.19 |
| Rhizosphere | 91.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439459_0104468 | 3300042438 | Bacteria | 697 |
| 2 | rootH1_10150100 | 3300003323 | Unclassified | 1605 |
| 3 | Ga0058858_1319225 | 3300004785 | Bacteria | 693 |
| 4 | Ga0058859_11798597 | 3300004798 | Bacteria | 1757 |
| 5 | Ga0058860_11602357 | 3300004801 | Bacteria | 913 |
| 6 | Ga0058860_12147728 | 3300004801 | Bacteria | 1666 |
| 7 | Ga0070676_10477797 | 3300005328 | Unclassified | 881 |
| 8 | Ga0070676_10779353 | 3300005328 | Bacteria | 704 |
| 9 | Ga0070676_10871139 | 3300005328 | Bacteria | 669 |
| 10 | Ga0070670_100168862 | 3300005331 | Bacteria | 1897 |
| 11 | Ga0068869_100029630 | 3300005334 | Bacteria | 3836 |
| 12 | Ga0068869_100692321 | 3300005334 | Bacteria | 868 |
| 13 | Ga0070666_10790169 | 3300005335 | Bacteria | 699 |
| 14 | Ga0070680_101087949 | 3300005336 | Bacteria | 691 |
| 15 | Ga0070682_100054246 | 3300005337 | Unclassified | 2514 |
| 16 | Ga0070682_100125876 | 3300005337 | Bacteria | 1727 |
| 17 | Ga0070682_100202989 | 3300005337 | Bacteria | 1400 |
| 18 | Ga0068868_100039128 | 3300005338 | Bacteria | 3683 |
| 19 | Ga0068868_101070768 | 3300005338 | Bacteria | 741 |
| 20 | Ga0070660_100095997 | 3300005339 | Bacteria | 2344 |
| 21 | Ga0070689_100007428 | 3300005340 | Bacteria | 7661 |
| 22 | Ga0070689_100315883 | 3300005340 | Bacteria | 1303 |
| 23 | Ga0070689_100693607 | 3300005340 | Bacteria | 889 |
| 24 | Ga0070689_101478603 | 3300005340 | Bacteria | 615 |
| 25 | Ga0070691_10379478 | 3300005341 | Bacteria | 792 |
| 26 | Ga0070687_100031595 | 3300005343 | Bacteria | 2599 |
| 27 | Ga0070687_100381285 | 3300005343 | Bacteria | 919 |
| 28 | Ga0070687_101212615 | 3300005343 | Bacteria | 557 |
| 29 | Ga0070661_100317785 | 3300005344 | Bacteria | 1216 |
| 30 | Ga0070692_10144260 | 3300005345 | Bacteria | 1351 |
| 31 | Ga0070692_10254550 | 3300005345 | Bacteria | 1053 |
| 32 | Ga0070692_11358377 | 3300005345 | Bacteria | 512 |
| 33 | Ga0070668_100333397 | 3300005347 | Unclassified | 1280 |
| 34 | Ga0070668_100375317 | 3300005347 | Unclassified | 1209 |
| 35 | Ga0070669_100389474 | 3300005353 | Bacteria | 1138 |
| 36 | Ga0070669_100689170 | 3300005353 | Unclassified | 862 |
| 37 | Ga0070675_100004800 | 3300005354 | Bacteria | 10311 |
| 38 | Ga0070675_100769854 | 3300005354 | Bacteria | 879 |
| 39 | Ga0070671_100681309 | 3300005355 | Bacteria | 891 |
| 40 | Ga0070671_101033027 | 3300005355 | Bacteria | 721 |
| 41 | Ga0070674_100049528 | 3300005356 | Bacteria | 2888 |
| 42 | Ga0070674_100759849 | 3300005356 | Bacteria | 834 |
| 43 | Ga0070674_101871912 | 3300005356 | Bacteria | 545 |
| 44 | Ga0070673_100016754 | 3300005364 | Bacteria | 5192 |
| 45 | Ga0070673_101010232 | 3300005364 | Bacteria | 775 |
| 46 | Ga0070688_100008247 | 3300005365 | Bacteria | 5649 |
| 47 | Ga0070659_100008825 | 3300005366 | Bacteria | 7385 |
| 48 | Ga0070659_100437425 | 3300005366 | Bacteria | 1108 |
| 49 | Ga0070659_100512921 | 3300005366 | Bacteria | 1023 |
| 50 | Ga0070659_100987170 | 3300005366 | Bacteria | 739 |
| 51 | Ga0070667_100395589 | 3300005367 | Bacteria | 1257 |
| 52 | Ga0070667_100567158 | 3300005367 | Bacteria | 1044 |
| 53 | Ga0070667_100687932 | 3300005367 | Bacteria | 946 |
| 54 | Ga0070703_10079043 | 3300005406 | Bacteria | 1116 |
| 55 | Ga0070703_10491030 | 3300005406 | Bacteria | 551 |
| 56 | Ga0070709_10686996 | 3300005434 | Unclassified | 795 |
| 57 | Ga0070713_100096526 | 3300005436 | Bacteria | 2552 |
| 58 | Ga0070713_100210296 | 3300005436 | Bacteria | 1761 |
| 59 | Ga0070713_101254489 | 3300005436 | Bacteria | 718 |
| 60 | Ga0070710_10982995 | 3300005437 | Bacteria | 614 |
| 61 | Ga0070710_11529990 | 3300005437 | Bacteria | 502 |
| 62 | Ga0070701_10017530 | 3300005438 | Unclassified | 3348 |
| 63 | Ga0070701_10204086 | 3300005438 | Bacteria | 1170 |
| 64 | Ga0070701_10481805 | 3300005438 | Bacteria | 802 |
| 65 | Ga0070711_100567494 | 3300005439 | Bacteria | 943 |
| 66 | Ga0070711_100906045 | 3300005439 | Bacteria | 753 |
| 67 | Ga0070711_101930750 | 3300005439 | Bacteria | 519 |
| 68 | Ga0070705_100005505 | 3300005440 | Bacteria | 6174 |
| 69 | Ga0070705_100023330 | 3300005440 | Bacteria | 3321 |
| 70 | Ga0070705_100068951 | 3300005440 | Bacteria | 2131 |
| 71 | Ga0070705_100133444 | 3300005440 | Bacteria | 1623 |
| 72 | Ga0070705_100188069 | 3300005440 | Bacteria | 1405 |
| 73 | Ga0070705_100607398 | 3300005440 | Bacteria | 847 |
| 74 | Ga0070700_100011273 | 3300005441 | Bacteria | 4947 |
| 75 | Ga0070700_100499032 | 3300005441 | Bacteria | 936 |
| 76 | Ga0070700_100676233 | 3300005441 | Bacteria | 818 |
| 77 | Ga0070700_100739766 | 3300005441 | Bacteria | 786 |
| 78 | Ga0070694_100044880 | 3300005444 | Bacteria | 2959 |
| 79 | Ga0070694_100252498 | 3300005444 | Bacteria | 1335 |
| 80 | Ga0070694_100814076 | 3300005444 | Bacteria | 766 |
| 81 | Ga0070708_100206906 | 3300005445 | Bacteria | 1838 |
| 82 | Ga0070708_100512405 | 3300005445 | Bacteria | 1132 |
| 83 | Ga0070708_100574755 | 3300005445 | Unclassified | 1063 |
| 84 | Ga0070708_100709715 | 3300005445 | Bacteria | 946 |
| 85 | Ga0070708_101214673 | 3300005445 | Bacteria | 705 |
| 86 | Ga0070663_100036412 | 3300005455 | Bacteria | 3419 |
| 87 | Ga0070663_101820768 | 3300005455 | Unclassified | 546 |
| 88 | Ga0070678_100009086 | 3300005456 | Bacteria | 5994 |
| 89 | Ga0070678_100861432 | 3300005456 | Bacteria | 826 |
| 90 | Ga0070662_100004731 | 3300005457 | Bacteria | 8629 |
| 91 | Ga0070662_100201018 | 3300005457 | Unclassified | 1581 |
| 92 | Ga0070681_10138050 | 3300005458 | Bacteria | 2367 |
| 93 | Ga0068867_100235963 | 3300005459 | Unclassified | 1481 |
| 94 | Ga0068867_100571829 | 3300005459 | Bacteria | 982 |
| 95 | Ga0068867_101257270 | 3300005459 | Bacteria | 682 |
| 96 | Ga0070685_10341781 | 3300005466 | Unclassified | 1021 |
| 97 | Ga0070706_100000515 | 3300005467 | Bacteria | 45368 |
| 98 | Ga0070706_100030330 | 3300005467 | Bacteria | 4982 |
| 99 | Ga0070706_100168691 | 3300005467 | Bacteria | 2044 |
| 100 | Ga0070706_100331319 | 3300005467 | Bacteria | 1419 |
| 101 | Ga0070706_100505252 | 3300005467 | Bacteria | 1125 |
| 102 | Ga0070706_100751041 | 3300005467 | Bacteria | 904 |
| 103 | Ga0070706_100936694 | 3300005467 | Bacteria | 800 |
| 104 | Ga0070706_101651019 | 3300005467 | Unclassified | 584 |
| 105 | Ga0070707_100003133 | 3300005468 | Bacteria | 15642 |
| 106 | Ga0070707_100003769 | 3300005468 | Bacteria | 14292 |
| 107 | Ga0070707_100230298 | 3300005468 | Bacteria | 1804 |
| 108 | Ga0070707_100383314 | 3300005468 | Bacteria | 1366 |
| 109 | Ga0070707_100464152 | 3300005468 | Bacteria | 1227 |
| 110 | Ga0070707_100692156 | 3300005468 | Bacteria | 982 |
| 111 | Ga0070698_100180003 | 3300005471 | Bacteria | 2052 |
| 112 | Ga0070698_100450647 | 3300005471 | Bacteria | 1222 |
| 113 | Ga0070698_100456450 | 3300005471 | Bacteria | 1214 |
| 114 | Ga0070698_100543577 | 3300005471 | Bacteria | 1101 |
| 115 | Ga0070698_100806428 | 3300005471 | Unclassified | 883 |
| 116 | Ga0070698_101428179 | 3300005471 | Bacteria | 643 |
| 117 | Ga0070698_101661859 | 3300005471 | Unclassified | 591 |
| 118 | Ga0070698_102106382 | 3300005471 | Bacteria | 518 |
| 119 | Ga0070699_100004404 | 3300005518 | Bacteria | 12451 |
| 120 | Ga0070699_100008140 | 3300005518 | Bacteria | 9101 |
| 121 | Ga0070699_100454444 | 3300005518 | Bacteria | 1162 |
| 122 | Ga0070699_100976273 | 3300005518 | Bacteria | 777 |
| 123 | Ga0070699_101240776 | 3300005518 | Bacteria | 684 |
| 124 | Ga0070699_101684033 | 3300005518 | Unclassified | 581 |
| 125 | Ga0070699_101853074 | 3300005518 | Bacteria | 552 |
| 126 | Ga0070679_100628834 | 3300005530 | Bacteria | 1016 |
| 127 | Ga0070684_100124027 | 3300005535 | Bacteria | 2325 |
| 128 | Ga0070684_101047382 | 3300005535 | Unclassified | 766 |
| 129 | Ga0070684_101050311 | 3300005535 | Unclassified | 765 |
| 130 | Ga0070684_101672511 | 3300005535 | Unclassified | 600 |
| 131 | Ga0070697_100122590 | 3300005536 | Bacteria | 2175 |
| 132 | Ga0070697_100154139 | 3300005536 | Bacteria | 1938 |
| 133 | Ga0070697_101096446 | 3300005536 | Bacteria | 708 |
| 134 | Ga0068853_100480749 | 3300005539 | Bacteria | 1171 |
| 135 | Ga0068853_100940749 | 3300005539 | Bacteria | 831 |
| 136 | Ga0068853_101656741 | 3300005539 | Bacteria | 620 |
| 137 | Ga0070672_100192617 | 3300005543 | Bacteria | 1703 |
| 138 | Ga0070686_100160132 | 3300005544 | Bacteria | 1584 |
| 139 | Ga0070686_101072251 | 3300005544 | Bacteria | 664 |
| 140 | Ga0070695_100009622 | 3300005545 | Bacteria | 5756 |
| 141 | Ga0070695_100112936 | 3300005545 | Bacteria | 1847 |
| 142 | Ga0070695_100122556 | 3300005545 | Bacteria | 1781 |
| 143 | Ga0070695_100183264 | 3300005545 | Unclassified | 1485 |
| 144 | Ga0070695_100629516 | 3300005545 | Unclassified | 845 |
| 145 | Ga0070696_100002114 | 3300005546 | Bacteria | 13059 |
| 146 | Ga0070696_100033792 | 3300005546 | Bacteria | 3516 |
| 147 | Ga0070696_100317452 | 3300005546 | Unclassified | 1198 |
| 148 | Ga0070693_100169898 | 3300005547 | Bacteria | 1395 |
| 149 | Ga0070693_100553757 | 3300005547 | Bacteria | 824 |
| 150 | Ga0070693_101260529 | 3300005547 | Bacteria | 570 |
| 151 | Ga0070693_101265066 | 3300005547 | Bacteria | 569 |
| 152 | Ga0070665_100639567 | 3300005548 | Unclassified | 1077 |
| 153 | Ga0070704_100045205 | 3300005549 | Unclassified | 3063 |
| 154 | Ga0070704_100138515 | 3300005549 | Bacteria | 1897 |
| 155 | Ga0070704_100193221 | 3300005549 | Bacteria | 1638 |
| 156 | Ga0070704_100280275 | 3300005549 | Bacteria | 1381 |
| 157 | Ga0070704_101103978 | 3300005549 | Bacteria | 720 |
| 158 | Ga0068855_100337276 | 3300005563 | Bacteria | 1663 |
| 159 | Ga0068855_101013870 | 3300005563 | Bacteria | 872 |
| 160 | Ga0068855_101102000 | 3300005563 | Bacteria | 830 |
| 161 | Ga0068855_101206629 | 3300005563 | Bacteria | 786 |
| 162 | Ga0070664_100337924 | 3300005564 | Bacteria | 1367 |
| 163 | Ga0068857_100556836 | 3300005577 | Unclassified | 1081 |
| 164 | Ga0068857_101582384 | 3300005577 | Bacteria | 640 |
| 165 | Ga0068857_102182635 | 3300005577 | Unclassified | 544 |
| 166 | Ga0068854_100493463 | 3300005578 | Bacteria | 1030 |
| 167 | Ga0068854_101030663 | 3300005578 | Bacteria | 730 |
| 168 | Ga0068856_100187860 | 3300005614 | Bacteria | 2080 |
| 169 | Ga0068856_101542646 | 3300005614 | Unclassified | 678 |
| 170 | Ga0068856_101555665 | 3300005614 | Bacteria | 675 |
| 171 | Ga0070702_100623599 | 3300005615 | Bacteria | 812 |
| 172 | Ga0068852_100208667 | 3300005616 | Bacteria | 1852 |
| 173 | Ga0068852_101472673 | 3300005616 | Bacteria | 703 |
| 174 | Ga0068852_101740649 | 3300005616 | Unclassified | 646 |
| 175 | Ga0068859_100011307 | 3300005617 | Bacteria | 8982 |
| 176 | Ga0068859_100249310 | 3300005617 | Bacteria | 1866 |
| 177 | Ga0068859_101612114 | 3300005617 | Bacteria | 717 |
| 178 | Ga0068864_100014040 | 3300005618 | Bacteria | 6642 |
| 179 | Ga0068864_100160442 | 3300005618 | Bacteria | 2044 |
| 180 | Ga0068864_101081563 | 3300005618 | Bacteria | 798 |
| 181 | Ga0068864_101093702 | 3300005618 | Bacteria | 793 |
| 182 | Ga0068861_100530417 | 3300005719 | Bacteria | 1069 |
| 183 | Ga0068861_101574091 | 3300005719 | Bacteria | 647 |
| 184 | Ga0068861_102274990 | 3300005719 | Bacteria | 544 |
| 185 | Ga0068861_102409083 | 3300005719 | Bacteria | 529 |
| 186 | Ga0068851_10619688 | 3300005834 | Unclassified | 660 |
| 187 | Ga0068870_10066963 | 3300005840 | Unclassified | 1947 |
| 188 | Ga0068870_10568503 | 3300005840 | Bacteria | 766 |
| 189 | Ga0068863_100101962 | 3300005841 | Bacteria | 2729 |
| 190 | Ga0068863_100328295 | 3300005841 | Bacteria | 1487 |
| 191 | Ga0068863_101311645 | 3300005841 | Bacteria | 731 |
| 192 | Ga0068858_100040335 | 3300005842 | Bacteria | 4330 |
| 193 | Ga0068858_100439138 | 3300005842 | Bacteria | 1257 |
| 194 | Ga0068858_100858486 | 3300005842 | Bacteria | 887 |
| 195 | Ga0068860_100038329 | 3300005843 | Bacteria | 4584 |
| 196 | Ga0068860_100273632 | 3300005843 | Bacteria | 1649 |
| 197 | Ga0068860_100386744 | 3300005843 | Bacteria | 1382 |
| 198 | Ga0068860_100402055 | 3300005843 | Bacteria | 1355 |
| 199 | Ga0068860_100866228 | 3300005843 | Bacteria | 918 |
| 200 | Ga0068860_101592369 | 3300005843 | Bacteria | 675 |
| 201 | Ga0068860_102091559 | 3300005843 | Unclassified | 587 |
| 202 | Ga0068862_100366210 | 3300005844 | Bacteria | 1341 |
| 203 | Ga0068862_102580315 | 3300005844 | Bacteria | 520 |
| 204 | Ga0081455_10075381 | 3300005937 | Bacteria | 2783 |
| 205 | Ga0081538_10133475 | 3300005981 | Bacteria | 1161 |
| 206 | Ga0081539_10023255 | 3300005985 | Bacteria | 4066 |
| 207 | Ga0075365_10116163 | 3300006038 | Bacteria | 1842 |
| 208 | Ga0075364_10341604 | 3300006051 | Bacteria | 1020 |
| 209 | Ga0075432_10173023 | 3300006058 | Unclassified | 841 |
| 210 | Ga0070716_100069107 | 3300006173 | Bacteria | 2069 |
| 211 | Ga0070716_100308406 | 3300006173 | Bacteria | 1104 |
| 212 | Ga0070716_100463174 | 3300006173 | Unclassified | 927 |
| 213 | Ga0070716_101042881 | 3300006173 | Bacteria | 649 |
| 214 | Ga0070712_100400942 | 3300006175 | Bacteria | 1133 |
| 215 | Ga0070712_100922096 | 3300006175 | Bacteria | 754 |
| 216 | Ga0097621_100558486 | 3300006237 | Bacteria | 1043 |
| 217 | Ga0097621_102020471 | 3300006237 | Bacteria | 551 |
| 218 | Ga0075428_101120902 | 3300006844 | Unclassified | 831 |
| 219 | Ga0075428_102386869 | 3300006844 | Bacteria | 543 |
| 220 | Ga0075433_10090173 | 3300006852 | Unclassified | 2710 |
| 221 | Ga0075433_10491367 | 3300006852 | Unclassified | 1081 |
| 222 | Ga0075433_10513017 | 3300006852 | Bacteria | 1055 |
| 223 | Ga0075433_10581286 | 3300006852 | Bacteria | 984 |
| 224 | Ga0075434_100133922 | 3300006871 | Bacteria | 2498 |
| 225 | Ga0075434_100332882 | 3300006871 | Bacteria | 1539 |
| 226 | Ga0075434_100351625 | 3300006871 | Bacteria | 1495 |
| 227 | Ga0075434_101840444 | 3300006871 | Bacteria | 612 |
| 228 | Ga0075429_101268457 | 3300006880 | Unclassified | 643 |
| 229 | Ga0068865_100011184 | 3300006881 | Bacteria | 5609 |
| 230 | Ga0075436_100933332 | 3300006914 | Unclassified | 650 |
| 231 | Ga0097620_100011307 | 3300006931 | Bacteria | 8982 |
| 232 | Ga0097620_100249295 | 3300006931 | Bacteria | 1866 |
| 233 | Ga0097620_101612004 | 3300006931 | Bacteria | 717 |
| 234 | Ga0075435_100731226 | 3300007076 | Bacteria | 861 |
| 235 | Ga0075435_101927844 | 3300007076 | Unclassified | 519 |
| 236 | Ga0075435_102055553 | 3300007076 | Bacteria | 502 |
| 237 | Ga0099794_10391647 | 3300007265 | Unclassified | 725 |
| 238 | Ga0099795_10222917 | 3300007788 | Bacteria | 803 |
| 239 | Ga0105244_10074846 | 3300009036 | Bacteria | 1684 |
| 240 | Ga0105250_10341579 | 3300009092 | Bacteria | 654 |
| 241 | Ga0105240_10001350 | 3300009093 | Bacteria | 42116 |
| 242 | Ga0105240_10216838 | 3300009093 | Bacteria | 2232 |
| 243 | Ga0111539_10059856 | 3300009094 | Bacteria | 4515 |
| 244 | Ga0111539_10131194 | 3300009094 | Bacteria | 2934 |
| 245 | Ga0111539_10494097 | 3300009094 | Unclassified | 1425 |
| 246 | Ga0111539_10551856 | 3300009094 | Bacteria | 1342 |
| 247 | Ga0105245_10016016 | 3300009098 | Bacteria | 6533 |
| 248 | Ga0105245_10116529 | 3300009098 | Bacteria | 2491 |
| 249 | Ga0105245_10301711 | 3300009098 | Unclassified | 1572 |
| 250 | Ga0105245_10619359 | 3300009098 | Bacteria | 1110 |
| 251 | Ga0105245_10973645 | 3300009098 | Unclassified | 892 |
| 252 | Ga0105245_11124972 | 3300009098 | Bacteria | 832 |
| 253 | Ga0105245_11387424 | 3300009098 | Bacteria | 752 |
| 254 | Ga0105245_11678901 | 3300009098 | Bacteria | 687 |
| 255 | Ga0105245_12228238 | 3300009098 | Unclassified | 602 |
| 256 | Ga0114129_10043878 | 3300009147 | Bacteria | 6291 |
| 257 | Ga0114129_10098746 | 3300009147 | Bacteria | 4041 |
| 258 | Ga0114129_10279768 | 3300009147 | Bacteria | 2230 |
| 259 | Ga0114129_10469403 | 3300009147 | Bacteria | 1648 |
| 260 | Ga0114129_11829805 | 3300009147 | Bacteria | 738 |
| 261 | Ga0114129_12122149 | 3300009147 | Bacteria | 677 |
| 262 | Ga0105243_10007956 | 3300009148 | Bacteria | 8144 |
| 263 | Ga0105243_10118984 | 3300009148 | Bacteria | 2224 |
| 264 | Ga0105243_10279345 | 3300009148 | Archaea | 1503 |
| 265 | Ga0105243_10465185 | 3300009148 | Unclassified | 1190 |
| 266 | Ga0105243_10758322 | 3300009148 | Unclassified | 952 |
| 267 | Ga0105243_11320360 | 3300009148 | Bacteria | 739 |
| 268 | Ga0105243_11919073 | 3300009148 | Bacteria | 625 |
| 269 | Ga0105241_10551096 | 3300009174 | Bacteria | 1035 |
| 270 | Ga0105241_10551914 | 3300009174 | Bacteria | 1035 |
| 271 | Ga0105241_11470946 | 3300009174 | Bacteria | 655 |
| 272 | Ga0105242_10103209 | 3300009176 | Unclassified | 2419 |
| 273 | Ga0105242_10311405 | 3300009176 | Bacteria | 1441 |
| 274 | Ga0105242_10484374 | 3300009176 | Bacteria | 1173 |
| 275 | Ga0105242_10890266 | 3300009176 | Bacteria | 889 |
| 276 | Ga0105242_11474267 | 3300009176 | Bacteria | 710 |
| 277 | Ga0105242_11485266 | 3300009176 | Bacteria | 708 |
| 278 | Ga0105242_11824846 | 3300009176 | Bacteria | 647 |
| 279 | Ga0105248_10031021 | 3300009177 | Bacteria | 5972 |
| 280 | Ga0105248_10410394 | 3300009177 | Bacteria | 1525 |
| 281 | Ga0105248_11419981 | 3300009177 | Unclassified | 785 |
| 282 | Ga0105248_11510348 | 3300009177 | Bacteria | 761 |
| 283 | Ga0105248_12797890 | 3300009177 | Bacteria | 556 |
| 284 | Ga0105248_13110859 | 3300009177 | Bacteria | 528 |
| 285 | Ga0105237_10271304 | 3300009545 | Bacteria | 1699 |
| 286 | Ga0105237_11470380 | 3300009545 | Unclassified | 688 |
| 287 | Ga0105238_10146988 | 3300009551 | Bacteria | 2333 |
| 288 | Ga0105238_11112927 | 3300009551 | Bacteria | 813 |
| 289 | Ga0105238_11760804 | 3300009551 | Bacteria | 651 |
| 290 | Ga0105238_11777725 | 3300009551 | Bacteria | 648 |
| 291 | Ga0105238_11867277 | 3300009551 | Unclassified | 633 |
| 292 | Ga0105249_10010583 | 3300009553 | Bacteria | 8105 |
| 293 | Ga0105249_10024438 | 3300009553 | Bacteria | 5430 |
| 294 | Ga0105249_10253673 | 3300009553 | Bacteria | 1745 |
| 295 | Ga0105249_10556053 | 3300009553 | Bacteria | 1198 |
| 296 | Ga0105249_10627366 | 3300009553 | Bacteria | 1131 |
| 297 | Ga0105249_11386283 | 3300009553 | Bacteria | 775 |
| 298 | Ga0105249_12374943 | 3300009553 | Bacteria | 603 |
| 299 | Ga0099796_10097019 | 3300010159 | Bacteria | 1104 |
| 300 | Ga0105239_10053647 | 3300010375 | Bacteria | 4421 |
| 301 | Ga0105239_10657642 | 3300010375 | Bacteria | 1197 |
| 302 | Ga0105239_11313620 | 3300010375 | Bacteria | 834 |
| 303 | Ga0105239_12114256 | 3300010375 | Bacteria | 654 |
| 304 | Ga0105246_10475325 | 3300011119 | Unclassified | 1056 |
| 305 | Ga0105246_11008321 | 3300011119 | Bacteria | 754 |
| 306 | Ga0105246_11114916 | 3300011119 | Bacteria | 721 |
| 307 | Ga0105246_11352226 | 3300011119 | Bacteria | 662 |
| 308 | Ga0105246_12589770 | 3300011119 | Unclassified | 501 |
| 309 | Ga0157329_1020367 | 3300012491 | Bacteria | 616 |
| 310 | Ga0157326_1069203 | 3300012513 | Unclassified | 556 |
| 311 | Ga0157373_10337419 | 3300013100 | Bacteria | 1074 |
| 312 | Ga0157373_10698583 | 3300013100 | Unclassified | 743 |
| 313 | Ga0157371_11079257 | 3300013102 | Bacteria | 615 |
| 314 | Ga0157370_10216201 | 3300013104 | Bacteria | 1776 |
| 315 | Ga0157369_10578854 | 3300013105 | Bacteria | 1160 |
| 316 | Ga0157374_10858802 | 3300013296 | Bacteria | 924 |
| 317 | Ga0157374_12517790 | 3300013296 | Unclassified | 542 |
| 318 | Ga0157378_10162379 | 3300013297 | Bacteria | 2090 |
| 319 | Ga0157378_10181120 | 3300013297 | Unclassified | 1982 |
| 320 | Ga0157378_10407682 | 3300013297 | Bacteria | 1341 |
| 321 | Ga0157378_10489231 | 3300013297 | Bacteria | 1227 |
| 322 | Ga0157378_10967862 | 3300013297 | Bacteria | 884 |
| 323 | Ga0157378_11178315 | 3300013297 | Bacteria | 805 |
| 324 | Ga0157378_11593458 | 3300013297 | Unclassified | 699 |
| 325 | Ga0157378_11992432 | 3300013297 | Bacteria | 630 |
| 326 | Ga0163162_10173787 | 3300013306 | Unclassified | 2279 |
| 327 | Ga0163162_10696857 | 3300013306 | Bacteria | 1137 |
| 328 | Ga0163162_11800278 | 3300013306 | Bacteria | 700 |
| 329 | Ga0163162_12066554 | 3300013306 | Bacteria | 653 |
| 330 | Ga0157372_10547728 | 3300013307 | Bacteria | 1349 |
| 331 | Ga0157375_10001358 | 3300013308 | Bacteria | 21125 |
| 332 | Ga0157375_10883134 | 3300013308 | Unclassified | 1039 |
| 333 | Ga0157375_13460727 | 3300013308 | Unclassified | 525 |
| 334 | Ga0163163_10035902 | 3300014325 | Bacteria | 4812 |
| 335 | Ga0163163_10051703 | 3300014325 | Bacteria | 4051 |
| 336 | Ga0163163_10173934 | 3300014325 | Bacteria | 2200 |
| 337 | Ga0163163_10379076 | 3300014325 | Bacteria | 1472 |
| 338 | Ga0163163_10633905 | 3300014325 | Bacteria | 1132 |
| 339 | Ga0163163_12180278 | 3300014325 | Unclassified | 613 |
| 340 | Ga0157380_10032691 | 3300014326 | Bacteria | 4004 |
| 341 | Ga0157380_10084549 | 3300014326 | Bacteria | 2602 |
| 342 | Ga0157380_10201710 | 3300014326 | Unclassified | 1765 |
| 343 | Ga0157380_10294971 | 3300014326 | Unclassified | 1491 |
| 344 | Ga0182008_10074494 | 3300014497 | Unclassified | 1670 |
| 345 | Ga0182008_10119518 | 3300014497 | Bacteria | 1309 |
| 346 | Ga0182008_10844245 | 3300014497 | Unclassified | 535 |
| 347 | Ga0157377_10007497 | 3300014745 | Bacteria | 5272 |
| 348 | Ga0157379_10073018 | 3300014968 | Bacteria | 3071 |
| 349 | Ga0157379_10147431 | 3300014968 | Bacteria | 2122 |
| 350 | Ga0157379_10217751 | 3300014968 | Bacteria | 1730 |
| 351 | Ga0157379_10254722 | 3300014968 | Bacteria | 1594 |
| 352 | Ga0157379_10853545 | 3300014968 | Bacteria | 862 |
| 353 | Ga0157379_11453021 | 3300014968 | Bacteria | 666 |
| 354 | Ga0157379_11863658 | 3300014968 | Bacteria | 592 |
| 355 | Ga0157376_10112050 | 3300014969 | Bacteria | 2403 |
| 356 | Ga0157376_12001934 | 3300014969 | Bacteria | 617 |
| 357 | Ga0157376_12134508 | 3300014969 | Unclassified | 599 |
| 358 | Ga0157376_12506530 | 3300014969 | Bacteria | 555 |
| 359 | Ga0163161_10022251 | 3300017792 | Bacteria | 4462 |
| 360 | Ga0163161_10187552 | 3300017792 | Bacteria | 1588 |
| 361 | Ga0163161_10561681 | 3300017792 | Bacteria | 937 |
| 362 | Ga0163161_11448255 | 3300017792 | Bacteria | 601 |
| 363 | Ga0206356_11706952 | 3300020070 | Unclassified | 1039 |
| 364 | Ga0207653_10069717 | 3300025885 | Unclassified | 1200 |
| 365 | Ga0207642_10034970 | 3300025899 | Unclassified | 2141 |
| 366 | Ga0207688_10066025 | 3300025901 | Unclassified | 2046 |
| 367 | Ga0207688_10392423 | 3300025901 | Bacteria | 860 |
| 368 | Ga0207680_11157058 | 3300025903 | Bacteria | 552 |
| 369 | Ga0207645_10422903 | 3300025907 | Unclassified | 898 |
| 370 | Ga0207645_10512508 | 3300025907 | Bacteria | 813 |
| 371 | Ga0207643_10001805 | 3300025908 | Bacteria | 11905 |
| 372 | Ga0207705_10589324 | 3300025909 | Bacteria | 864 |
| 373 | Ga0207684_10004220 | 3300025910 | Bacteria | 13641 |
| 374 | Ga0207684_10106355 | 3300025910 | Unclassified | 2400 |
| 375 | Ga0207684_10150340 | 3300025910 | Bacteria | 2004 |
| 376 | Ga0207684_10337323 | 3300025910 | Bacteria | 1298 |
| 377 | Ga0207684_10517272 | 3300025910 | Bacteria | 1022 |
| 378 | Ga0207684_10947247 | 3300025910 | Bacteria | 722 |
| 379 | Ga0207654_10393838 | 3300025911 | Bacteria | 962 |
| 380 | Ga0207695_10022614 | 3300025913 | Bacteria | 7130 |
| 381 | Ga0207695_10208382 | 3300025913 | Bacteria | 1867 |
| 382 | Ga0207671_11251718 | 3300025914 | Bacteria | 579 |
| 383 | Ga0207693_10417094 | 3300025915 | Bacteria | 1049 |
| 384 | Ga0207693_10815682 | 3300025915 | Unclassified | 719 |
| 385 | Ga0207693_11179435 | 3300025915 | Bacteria | 578 |
| 386 | Ga0207663_10434338 | 3300025916 | Bacteria | 1010 |
| 387 | Ga0207663_10681618 | 3300025916 | Bacteria | 813 |
| 388 | Ga0207660_10633149 | 3300025917 | Bacteria | 872 |
| 389 | Ga0207660_11010853 | 3300025917 | Bacteria | 678 |
| 390 | Ga0207662_10007483 | 3300025918 | Bacteria | 5946 |
| 391 | Ga0207662_10511873 | 3300025918 | Bacteria | 828 |
| 392 | Ga0207657_10280403 | 3300025919 | Bacteria | 1323 |
| 393 | Ga0207657_10652654 | 3300025919 | Bacteria | 819 |
| 394 | Ga0207649_10179558 | 3300025920 | Bacteria | 1481 |
| 395 | Ga0207652_11108914 | 3300025921 | Unclassified | 692 |
| 396 | Ga0207652_11159109 | 3300025921 | Bacteria | 674 |
| 397 | Ga0207646_10002447 | 3300025922 | Bacteria | 21917 |
| 398 | Ga0207646_10004406 | 3300025922 | Bacteria | 15306 |
| 399 | Ga0207646_10015078 | 3300025922 | Bacteria | 7312 |
| 400 | Ga0207646_10105828 | 3300025922 | Bacteria | 2523 |
| 401 | Ga0207646_10249594 | 3300025922 | Bacteria | 1603 |
| 402 | Ga0207646_10502449 | 3300025922 | Bacteria | 1092 |
| 403 | Ga0207646_11910516 | 3300025922 | Unclassified | 506 |
| 404 | Ga0207681_10643942 | 3300025923 | Bacteria | 878 |
| 405 | Ga0207694_10096920 | 3300025924 | Bacteria | 2333 |
| 406 | Ga0207650_10642352 | 3300025925 | Unclassified | 894 |
| 407 | Ga0207650_11526130 | 3300025925 | Bacteria | 568 |
| 408 | Ga0207650_11827164 | 3300025925 | Bacteria | 514 |
| 409 | Ga0207659_10377017 | 3300025926 | Bacteria | 1182 |
| 410 | Ga0207687_10032802 | 3300025927 | Bacteria | 3519 |
| 411 | Ga0207687_10331452 | 3300025927 | Bacteria | 1235 |
| 412 | Ga0207687_10368504 | 3300025927 | Bacteria | 1174 |
| 413 | Ga0207700_10330993 | 3300025928 | Bacteria | 1322 |
| 414 | Ga0207700_10738334 | 3300025928 | Bacteria | 880 |
| 415 | Ga0207664_10451150 | 3300025929 | Unclassified | 1148 |
| 416 | Ga0207690_10104860 | 3300025932 | Unclassified | 2026 |
| 417 | Ga0207690_10194372 | 3300025932 | Bacteria | 1537 |
| 418 | Ga0207690_11436569 | 3300025932 | Bacteria | 577 |
| 419 | Ga0207706_10007415 | 3300025933 | Bacteria | 10141 |
| 420 | Ga0207706_10103413 | 3300025933 | Bacteria | 2506 |
| 421 | Ga0207706_10468530 | 3300025933 | Bacteria | 1089 |
| 422 | Ga0207686_10040140 | 3300025934 | Bacteria | 2844 |
| 423 | Ga0207686_10468494 | 3300025934 | Bacteria | 972 |
| 424 | Ga0207686_10865160 | 3300025934 | Unclassified | 728 |
| 425 | Ga0207686_11703577 | 3300025934 | Bacteria | 521 |
| 426 | Ga0207686_11842274 | 3300025934 | Unclassified | 501 |
| 427 | Ga0207709_10030741 | 3300025935 | Bacteria | 3127 |
| 428 | Ga0207709_10053844 | 3300025935 | Unclassified | 2478 |
| 429 | Ga0207709_10333158 | 3300025935 | Bacteria | 1140 |
| 430 | Ga0207670_10040478 | 3300025936 | Bacteria | 3059 |
| 431 | Ga0207670_10280746 | 3300025936 | Bacteria | 1298 |
| 432 | Ga0207670_10315324 | 3300025936 | Bacteria | 1229 |
| 433 | Ga0207669_11287636 | 3300025937 | Bacteria | 621 |
| 434 | Ga0207665_10208420 | 3300025939 | Bacteria | 1427 |
| 435 | Ga0207665_10429122 | 3300025939 | Bacteria | 1011 |
| 436 | Ga0207665_10916456 | 3300025939 | Bacteria | 695 |
| 437 | Ga0207691_10005391 | 3300025940 | Bacteria | 12349 |
| 438 | Ga0207711_10595926 | 3300025941 | Bacteria | 1031 |
| 439 | Ga0207711_11942771 | 3300025941 | Unclassified | 531 |
| 440 | Ga0207689_10094292 | 3300025942 | Bacteria | 2458 |
| 441 | Ga0207689_10204325 | 3300025942 | Bacteria | 1631 |
| 442 | Ga0207661_10735895 | 3300025944 | Unclassified | 907 |
| 443 | Ga0207661_11448357 | 3300025944 | Bacteria | 630 |
| 444 | Ga0207679_10419508 | 3300025945 | Bacteria | 1181 |
| 445 | Ga0207679_12195722 | 3300025945 | Bacteria | 501 |
| 446 | Ga0207667_10873331 | 3300025949 | Bacteria | 893 |
| 447 | Ga0207667_11522265 | 3300025949 | Unclassified | 639 |
| 448 | Ga0207651_10029953 | 3300025960 | Bacteria | 3458 |
| 449 | Ga0207651_11103092 | 3300025960 | Bacteria | 711 |
| 450 | Ga0207712_10107343 | 3300025961 | Unclassified | 2087 |
| 451 | Ga0207712_10183217 | 3300025961 | Bacteria | 1647 |
| 452 | Ga0207712_10765322 | 3300025961 | Bacteria | 847 |
| 453 | Ga0207712_10922457 | 3300025961 | Unclassified | 773 |
| 454 | Ga0207668_10346233 | 3300025972 | Bacteria | 1241 |
| 455 | Ga0207668_10384169 | 3300025972 | Unclassified | 1183 |
| 456 | Ga0207640_10651756 | 3300025981 | Bacteria | 897 |
| 457 | Ga0207640_12200617 | 3300025981 | Bacteria | 500 |
| 458 | Ga0207658_10301955 | 3300025986 | Bacteria | 1380 |
| 459 | Ga0207658_10502584 | 3300025986 | Bacteria | 1080 |
| 460 | Ga0207658_10955905 | 3300025986 | Bacteria | 781 |
| 461 | Ga0207677_10184589 | 3300026023 | Bacteria | 1644 |
| 462 | Ga0207677_10773993 | 3300026023 | Bacteria | 857 |
| 463 | Ga0207677_11820113 | 3300026023 | Unclassified | 565 |
| 464 | Ga0207703_10128393 | 3300026035 | Unclassified | 2186 |
| 465 | Ga0207703_10522672 | 3300026035 | Bacteria | 1116 |
| 466 | Ga0207703_11276830 | 3300026035 | Bacteria | 706 |
| 467 | Ga0207639_10630029 | 3300026041 | Unclassified | 991 |
| 468 | Ga0207639_11465418 | 3300026041 | Bacteria | 641 |
| 469 | Ga0207678_10008985 | 3300026067 | Bacteria | 8795 |
| 470 | Ga0207678_10346494 | 3300026067 | Bacteria | 1281 |
| 471 | Ga0207708_10001286 | 3300026075 | Bacteria | 18856 |
| 472 | Ga0207708_10459524 | 3300026075 | Bacteria | 1062 |
| 473 | Ga0207708_10595963 | 3300026075 | Unclassified | 936 |
| 474 | Ga0207708_11125072 | 3300026075 | Bacteria | 685 |
| 475 | Ga0207702_10186263 | 3300026078 | Bacteria | 1914 |
| 476 | Ga0207702_11097252 | 3300026078 | Bacteria | 790 |
| 477 | Ga0207702_11445762 | 3300026078 | Unclassified | 681 |
| 478 | Ga0207641_10149531 | 3300026088 | Bacteria | 2114 |
| 479 | Ga0207641_10587798 | 3300026088 | Bacteria | 1089 |
| 480 | Ga0207641_11141199 | 3300026088 | Unclassified | 778 |
| 481 | Ga0207641_11970409 | 3300026088 | Bacteria | 585 |
| 482 | Ga0207648_10002950 | 3300026089 | Bacteria | 17994 |
| 483 | Ga0207648_10579837 | 3300026089 | Unclassified | 1032 |
| 484 | Ga0207648_12188068 | 3300026089 | Unclassified | 514 |
| 485 | Ga0207676_10441803 | 3300026095 | Bacteria | 1224 |
| 486 | Ga0207676_10713619 | 3300026095 | Bacteria | 973 |
| 487 | Ga0207676_11564869 | 3300026095 | Bacteria | 657 |
| 488 | Ga0207676_11965151 | 3300026095 | Bacteria | 584 |
| 489 | Ga0207674_10011251 | 3300026116 | Bacteria | 10059 |
| 490 | Ga0207674_11684805 | 3300026116 | Bacteria | 602 |
| 491 | Ga0207675_101497174 | 3300026118 | Bacteria | 696 |
| 492 | Ga0207675_102257156 | 3300026118 | Unclassified | 559 |
| 493 | Ga0207683_10007488 | 3300026121 | Bacteria | 9362 |
| 494 | Ga0207683_10596626 | 3300026121 | Bacteria | 1022 |
| 495 | Ga0207698_10789875 | 3300026142 | Bacteria | 951 |
| 496 | Ga0207698_10983955 | 3300026142 | Bacteria | 854 |
| 497 | Ga0207698_11948406 | 3300026142 | Unclassified | 602 |
| 498 | Ga0209969_1068678 | 3300027360 | Bacteria | 563 |
| 499 | Ga0209981_1080085 | 3300027378 | Unclassified | 508 |
| 500 | Ga0209970_1080931 | 3300027614 | Archaea | 610 |
| 501 | Ga0209983_1027004 | 3300027665 | Bacteria | 1215 |
| 502 | Ga0209983_1090111 | 3300027665 | Unclassified | 690 |
| 503 | Ga0209966_1106255 | 3300027695 | Bacteria | 637 |
| 504 | Ga0209998_10036388 | 3300027717 | Bacteria | 1106 |
| 505 | Ga0209974_10026820 | 3300027876 | Unclassified | 1905 |
| 506 | Ga0207428_10037242 | 3300027907 | Bacteria | 3959 |
| 507 | Ga0207428_10367835 | 3300027907 | Bacteria | 1056 |
| 508 | Ga0207428_10504932 | 3300027907 | Bacteria | 878 |
| 509 | Ga0268266_10102583 | 3300028379 | Unclassified | 2524 |
| 510 | Ga0268265_10096341 | 3300028380 | Bacteria | 2378 |
| 511 | Ga0268265_10711047 | 3300028380 | Bacteria | 972 |
| 512 | Ga0268265_12361523 | 3300028380 | Bacteria | 538 |
| 513 | Ga0268264_10051808 | 3300028381 | Bacteria | 3421 |
| 514 | Ga0268264_10292530 | 3300028381 | Bacteria | 1530 |
| 515 | Ga0268264_10580847 | 3300028381 | Bacteria | 1102 |
| 516 | Ga0268264_10649075 | 3300028381 | Bacteria | 1044 |
| 517 | Ga0265326_10007265 | 3300028558 | Bacteria | 3407 |
| 518 | Ga0265326_10014894 | 3300028558 | Bacteria | 2261 |
| 519 | Ga0265334_10021849 | 3300028573 | Bacteria | 2612 |
| 520 | Ga0265322_10031794 | 3300028654 | Bacteria | 1506 |
| 521 | Ga0265322_10074612 | 3300028654 | Bacteria | 962 |
| 522 | Ga0265336_10231996 | 3300028666 | Unclassified | 548 |
| 523 | Ga0265338_10277787 | 3300028800 | Unclassified | 1225 |
| 524 | Ga0265324_10049072 | 3300029957 | Bacteria | 1452 |
| 525 | Ga0265332_10035487 | 3300031238 | Bacteria | 2165 |
| 526 | Ga0265328_10040392 | 3300031239 | Bacteria | 1719 |
| 527 | Ga0265320_10052818 | 3300031240 | Bacteria | 1966 |
| 528 | Ga0265329_10000636 | 3300031242 | Bacteria | 17909 |
| 529 | Ga0265316_10022340 | 3300031344 | Bacteria | 5336 |
| 530 | Ga0265316_10082439 | 3300031344 | Bacteria | 2464 |
| 531 | Ga0307408_100923703 | 3300031548 | Bacteria | 800 |
| 532 | Ga0265314_10000340 | 3300031711 | Bacteria | 65215 |
| 533 | Ga0265314_10094715 | 3300031711 | Bacteria | 1935 |
| 534 | Ga0265342_10278441 | 3300031712 | Bacteria | 886 |
| 535 | Ga0316576_10891406 | 3300031727 | Bacteria | 637 |
| 536 | Ga0307405_10112600 | 3300031731 | Bacteria | 1846 |
| 537 | Ga0316577_10001043 | 3300031733 | Bacteria | 12518 |
| 538 | Ga0307410_10221477 | 3300031852 | Bacteria | 1456 |
| 539 | Ga0307406_10055263 | 3300031901 | Bacteria | 2537 |
| 540 | Ga0307407_10668890 | 3300031903 | Bacteria | 779 |
| 541 | Ga0307412_10664461 | 3300031911 | Bacteria | 890 |
| 542 | Ga0307409_100055729 | 3300031995 | Bacteria | 3054 |
| 543 | Ga0307409_101007616 | 3300031995 | Bacteria | 851 |
| 544 | Ga0307409_101514084 | 3300031995 | Unclassified | 698 |
| 545 | Ga0307416_100069740 | 3300032002 | Bacteria | 2911 |
| 546 | Ga0307416_100108237 | 3300032002 | Bacteria | 2441 |
| 547 | Ga0307416_102045219 | 3300032002 | Bacteria | 675 |
| 548 | Ga0307416_102047498 | 3300032002 | Bacteria | 675 |
| 549 | Ga0307411_10020285 | 3300032005 | Bacteria | 3862 |
| 550 | Ga0307411_10296725 | 3300032005 | Bacteria | 1294 |
| 551 | Ga0307415_100039313 | 3300032126 | Bacteria | 3125 |
| 552 | Ga0307415_101161229 | 3300032126 | Bacteria | 726 |
| 553 | Ga0307415_101193337 | 3300032126 | Unclassified | 717 |
| 554 | Ga0316585_10265633 | 3300032137 | Bacteria | 569 |
| 555 | Ga0316593_10248793 | 3300032168 | Bacteria | 665 |
| 556 | Ga0373950_0081298 | 3300034818 | Unclassified | 677 |
| 557 | Ga0373958_0108270 | 3300034819 | Unclassified | 660 |
| 558 | Ga0373938_0114451 | 3300034957 | Archaea | 690 |
| 559 | Ga0373938_0117799 | 3300034957 | Unclassified | 682 |
| 560 | Ga0373926_0039632 | 3300035083 | Bacteria | 1680 |
| 561 | Ga0373926_0428246 | 3300035083 | Bacteria | 524 |
| 562 | Ga0373926_0431016 | 3300035083 | Bacteria | 522 |
| 563 | Ga0373928_0177376 | 3300035084 | Bacteria | 604 |
| 564 | Ga0373944_0196375 | 3300035089 | Bacteria | 729 |
| 565 | Ga0373944_0242412 | 3300035089 | Unclassified | 663 |
| 566 | Ga0373952_0049521 | 3300035092 | Unclassified | 997 |
| 567 | Ga0373932_0117501 | 3300035112 | Unclassified | 884 |
| 568 | Ga0373932_0136953 | 3300035112 | Bacteria | 830 |
| 569 | Ga0373932_0279457 | 3300035112 | Unclassified | 617 |
| 570 | Ga0373936_0619161 | 3300035113 | Bacteria | 509 |
| 571 | Ga0373939_0105461 | 3300035114 | Unclassified | 974 |
| 572 | Ga0373939_0152723 | 3300035114 | Unclassified | 842 |
| 573 | Ga0373939_0305104 | 3300035114 | Archaea | 636 |
| 574 | Ga0373941_0184598 | 3300035115 | Unclassified | 785 |
| 575 | Ga0373941_0221861 | 3300035115 | Unclassified | 727 |
| 576 | Ga0373945_0436339 | 3300035116 | Bacteria | 578 |
| 577 | Ga0373945_0491717 | 3300035116 | Bacteria | 546 |
| 578 | Ga0373954_0268388 | 3300035118 | Bacteria | 841 |
| 579 | Ga0373960_0026919 | 3300035121 | Bacteria | 1575 |
| 580 | Ga0373943_0123923 | 3300035170 | Bacteria | 1376 |
| 581 | Ga0373943_0236754 | 3300035170 | Bacteria | 1022 |
| 582 | Ga0373946_0309467 | 3300035171 | Bacteria | 783 |
| 583 | Ga0373942_0276339 | 3300035207 | Archaea | 577 |
| 584 | Ga0373961_0281135 | 3300035241 | Bacteria | 610 |
| 585 | Ga0373962_0080800 | 3300035242 | Bacteria | 986 |
| 586 | Ga0373962_0115019 | 3300035242 | Bacteria | 853 |
| 587 | Ga0373962_0332312 | 3300035242 | Unclassified | 545 |
| 588 | Ga0373931_0140079 | 3300035691 | Bacteria | 1400 |
| 589 | Ga0373931_0163399 | 3300035691 | Bacteria | 1307 |
| 590 | Ga0373931_0347704 | 3300035691 | Bacteria | 927 |
| 591 | Ga0373931_0603392 | 3300035691 | Unclassified | 718 |
| 592 | Ga0373935_0220917 | 3300035692 | Bacteria | 1316 |
| 593 | Ga0373935_0624868 | 3300035692 | Unclassified | 789 |
| 594 | Ga0373935_1311775 | 3300035692 | Unclassified | 540 |
| 595 | Ga0373927_0002704 | 3300035695 | Bacteria | 12924 |
| 596 | Ga0373927_0243630 | 3300035695 | Bacteria | 1182 |
| 597 | Ga0373927_0933018 | 3300035695 | Bacteria | 573 |
| 598 | Ga0373947_0118107 | 3300035725 | Bacteria | 1683 |
| 599 | Ga0373947_1170156 | 3300035725 | Bacteria | 524 |
| 600 | Ga0373937_0412287 | 3300036401 | Bacteria | 1282 |
| 601 | Ga0373937_0824696 | 3300036401 | Bacteria | 876 |
| 602 | Ga0316582_0432928 | 3300036647 | Bacteria | 906 |
| 603 | Ga0316584_0007685 | 3300036712 | Bacteria | 7397 |
| 604 | Ga0373925_0018310 | 3300037068 | Bacteria | 5090 |
| 605 | Ga0373925_0359456 | 3300037068 | Bacteria | 1183 |
| 606 | Ga0373925_0462251 | 3300037068 | Bacteria | 1040 |
| 607 | Ga0373925_0754665 | 3300037068 | Bacteria | 802 |
| 608 | Ga0373925_1035788 | 3300037068 | Bacteria | 676 |
| 609 | Ga0373925_1754501 | 3300037068 | Bacteria | 506 |
| 610 | Ga0395905_1400956 | 3300037471 | Unclassified | 603 |
| 611 | Ga0395905_1833529 | 3300037471 | Unclassified | 512 |
| 612 | Ga0316581_0023971 | 3300037588 | Bacteria | 1807 |
| 613 | Ga0395901_0333846 | 3300038443 | Unclassified | 1567 |
| 614 | Ga0395901_0442107 | 3300038443 | Bacteria | 1331 |
| 615 | Ga0242420_049816 | 3300038996 | Unclassified | 817 |
| 616 | Ga0242420_092684 | 3300038996 | Bacteria | 636 |
| 617 | Ga0436365_1412982 | 3300039437 | Bacteria | 738 |
| 618 | Ga0436362_1153239 | 3300039453 | Bacteria | 749 |
| 619 | Ga0451802_0468077 | 3300041460 | Bacteria | 518 |
| 620 | Ga0451804_1114298 | 3300041463 | Bacteria | 557 |
| 621 | Ga0451835_0707314 | 3300041492 | Bacteria | 758 |
| 622 | Ga0451845_0556828 | 3300041501 | Bacteria | 537 |
| 623 | Ga0451849_0313022 | 3300041505 | Bacteria | 839 |
| 624 | Ga0451853_0920180 | 3300041512 | Bacteria | 1029 |
| 625 | Ga0451853_4060573 | 3300041512 | Unclassified | 779 |
| 626 | Ga0439431_0181722 | 3300041997 | Bacteria | 607 |
| 627 | Ga0439441_001644 | 3300042001 | Bacteria | 2988 |
| 628 | Ga0439455_0174146 | 3300042012 | Bacteria | 618 |
| 629 | Ga0450920_107793 | 3300042122 | Bacteria | 581 |
| 630 | Ga0439435_0153458 | 3300042436 | Bacteria | 740 |
| 631 | Ga0451577_0675546 | 3300042876 | Bacteria | 936 |
| 632 | Ga0466964_0394315 | 3300044706 | Bacteria | 722 |
| 633 | Ga0453684_1337501 | 3300044712 | Unclassified | 746 |
| 634 | Ga0453684_1457291 | 3300044712 | Bacteria | 708 |
| 635 | Ga0451576_0101832 | 3300045051 | Unclassified | 2987 |
| 636 | Ga0451576_0106527 | 3300045051 | Bacteria | 2917 |
| 637 | Ga0451576_0155114 | 3300045051 | Bacteria | 2388 |
| 638 | Ga0451576_0162127 | 3300045051 | Bacteria | 2334 |
| 639 | Ga0451576_0690676 | 3300045051 | Bacteria | 1072 |
| 640 | Ga0451576_0708538 | 3300045051 | Bacteria | 1058 |
| 641 | Ga0451576_1243631 | 3300045051 | Bacteria | 777 |
| 642 | Ga0451576_1600349 | 3300045051 | Bacteria | 676 |
| 643 | Ga0451576_2215047 | 3300045051 | Unclassified | 564 |
| 644 | Ga0495592_0145238 | 3300046454 | Bacteria | 1646 |
| 645 | Ga0495590_0186303 | 3300046457 | Unclassified | 760 |
| 646 | Ga0495629_0282046 | 3300046459 | Unclassified | 1140 |
| 647 | Ga0495629_0689270 | 3300046459 | Bacteria | 679 |
| 648 | Ga0495629_0934737 | 3300046459 | Bacteria | 567 |
| 649 | Ga0495641_0225045 | 3300046461 | Bacteria | 842 |
| 650 | Ga0495641_0229928 | 3300046461 | Bacteria | 832 |
| 651 | Ga0495651_0143152 | 3300046462 | Bacteria | 1731 |
| 652 | Ga0495651_0612327 | 3300046462 | Unclassified | 686 |
| 653 | Ga0495653_0405965 | 3300046463 | Unclassified | 865 |
| 654 | Ga0495580_0411368 | 3300046472 | Bacteria | 911 |
| 655 | Ga0495582_0627904 | 3300046473 | Bacteria | 622 |
| 656 | Ga0495639_0477607 | 3300046475 | Bacteria | 635 |
| 657 | Ga0495639_0530798 | 3300046475 | Unclassified | 602 |
| 658 | Ga0495664_0331263 | 3300046477 | Bacteria | 918 |
| 659 | Ga0495594_0401542 | 3300046499 | Bacteria | 780 |
| 660 | Ga0495594_0560209 | 3300046499 | Bacteria | 648 |
| 661 | Ga0495594_0766334 | 3300046499 | Unclassified | 544 |
| 662 | Ga0495608_0487986 | 3300046511 | Unclassified | 747 |
| 663 | Ga0495608_0763949 | 3300046511 | Bacteria | 572 |
| 664 | Ga0495628_0515234 | 3300046516 | Bacteria | 862 |
| 665 | Ga0495628_1003735 | 3300046516 | Bacteria | 574 |
| 666 | Ga0495630_0006981 | 3300046517 | Bacteria | 8051 |
| 667 | Ga0495630_0386227 | 3300046517 | Bacteria | 1072 |
| 668 | Ga0495630_0551338 | 3300046517 | Bacteria | 884 |
| 669 | Ga0495631_0270580 | 3300046518 | Bacteria | 724 |
| 670 | Ga0495631_0426303 | 3300046518 | Bacteria | 565 |
| 671 | Ga0495644_0412371 | 3300046523 | Bacteria | 535 |
| 672 | Ga0495666_0483262 | 3300046526 | Bacteria | 554 |
| 673 | Ga0495652_0292524 | 3300046529 | Unclassified | 1188 |
| 674 | Ga0495640_0070809 | 3300046533 | Bacteria | 2342 |
| 675 | Ga0495640_0547499 | 3300046533 | Bacteria | 702 |
| 676 | Ga0495586_0404687 | 3300046535 | Bacteria | 785 |
| 677 | Ga0495586_0464463 | 3300046535 | Bacteria | 730 |
| 678 | Ga0495587_0075091 | 3300046536 | Bacteria | 1963 |
| 679 | Ga0495587_0507141 | 3300046536 | Unclassified | 667 |
| 680 | Ga0495621_0432991 | 3300046539 | Bacteria | 561 |
| 681 | Ga0495645_0030835 | 3300046543 | Bacteria | 3906 |
| 682 | Ga0495645_0302751 | 3300046543 | Unclassified | 1044 |
| 683 | Ga0495645_0531712 | 3300046543 | Unclassified | 731 |
| 684 | Ga0495667_0143395 | 3300046559 | Unclassified | 1539 |
| 685 | Ga0495634_0306685 | 3300046642 | Unclassified | 959 |
| 686 | Ga0495634_0887118 | 3300046642 | Bacteria | 505 |
| 687 | Ga0495635_0735267 | 3300046663 | Bacteria | 638 |
| 688 | Ga0495659_0095174 | 3300046664 | Bacteria | 1148 |
| 689 | Ga0495657_0134323 | 3300046675 | Bacteria | 1547 |
| 690 | Ga0495657_0566514 | 3300046675 | Bacteria | 659 |
| 691 | Ga0495599_0513382 | 3300046678 | Unclassified | 704 |
| 692 | Ga0495623_0555543 | 3300046679 | Bacteria | 600 |
| 693 | Ga0495646_0400333 | 3300046680 | Unclassified | 714 |
| 694 | Ga0495646_0586860 | 3300046680 | Bacteria | 567 |
| 695 | Ga0495658_0400608 | 3300046683 | Bacteria | 875 |
| 696 | Ga0495658_0534857 | 3300046683 | Bacteria | 750 |
| 697 | Ga0495624_0506942 | 3300046690 | Bacteria | 722 |
| 698 | Ga0495624_0649470 | 3300046690 | Bacteria | 628 |
| 699 | Ga0495670_0476939 | 3300046691 | Bacteria | 677 |
| 700 | Ga0495589_0460161 | 3300046794 | Bacteria | 582 |
| 701 | Ga0495600_0229735 | 3300046809 | Unclassified | 1185 |
| 702 | Ga0495600_0541185 | 3300046809 | Bacteria | 712 |
| 703 | Ga0495660_0470464 | 3300046810 | Unclassified | 541 |
| 704 | Ga0495604_0647309 | 3300047317 | Bacteria | 674 |
| 705 | Ga0495674_0240865 | 3300047319 | Bacteria | 1491 |
| 706 | Ga0495674_0286899 | 3300047319 | Bacteria | 1347 |
| 707 | Ga0495674_0400620 | 3300047319 | Bacteria | 1108 |
| 708 | Ga0495674_0742238 | 3300047319 | Bacteria | 767 |
| 709 | Ga0495676_0077643 | 3300047321 | Bacteria | 2532 |
| 710 | Ga0495676_0100091 | 3300047321 | Bacteria | 2147 |
| 711 | Ga0495676_0983756 | 3300047321 | Unclassified | 539 |
| 712 | Ga0495680_1005267 | 3300047322 | Unclassified | 532 |
| 713 | Ga0495675_0157608 | 3300047444 | Bacteria | 1399 |
| 714 | Ga0495684_0927857 | 3300047471 | Unclassified | 559 |
| 715 | Ga0495684_0966929 | 3300047471 | Unclassified | 543 |
| 716 | Ga0495602_0111700 | 3300048088 | Bacteria | 2219 |
| 717 | Ga0496100_0015810 | 3300048903 | Bacteria | 4415 |
| 718 | Ga0496100_0305872 | 3300048903 | Bacteria | 1191 |
| 719 | Ga0496100_0422836 | 3300048903 | Bacteria | 1018 |
| 720 | Ga0496100_1207725 | 3300048903 | Unclassified | 596 |
| 721 | Ga0496101_0171027 | 3300048904 | Bacteria | 1670 |
| 722 | Ga0496101_0183240 | 3300048904 | Unclassified | 1613 |
| 723 | Ga0496101_0739389 | 3300048904 | Bacteria | 776 |
| 724 | Ga0496101_1479757 | 3300048904 | Unclassified | 529 |
| 725 | Ga0496102_0004243 | 3300048905 | Bacteria | 12119 |
| 726 | Ga0496102_0100386 | 3300048905 | Unclassified | 2688 |
| 727 | Ga0496102_0125104 | 3300048905 | Bacteria | 2403 |
| 728 | Ga0496102_0282089 | 3300048905 | Bacteria | 1566 |
| 729 | Ga0496102_0311368 | 3300048905 | Bacteria | 1484 |
| 730 | Ga0496102_1658243 | 3300048905 | Bacteria | 557 |
| 731 | Ga0496103_0276365 | 3300048906 | Bacteria | 1080 |
| 732 | Ga0496103_0316217 | 3300048906 | Bacteria | 1004 |
| 733 | Ga0496104_0006414 | 3300048907 | Bacteria | 10347 |
| 734 | Ga0496104_0046043 | 3300048907 | Bacteria | 4105 |
| 735 | Ga0496104_0261563 | 3300048907 | Bacteria | 1643 |
| 736 | Ga0496104_0786847 | 3300048907 | Unclassified | 858 |
| 737 | Ga0496105_0131346 | 3300048908 | Bacteria | 2064 |
| 738 | Ga0496105_0168339 | 3300048908 | Unclassified | 1797 |
| 739 | Ga0496105_1197169 | 3300048908 | Bacteria | 559 |
| 740 | Ga0496106_0387176 | 3300048909 | Bacteria | 1123 |
| 741 | Ga0496106_0909811 | 3300048909 | Bacteria | 694 |
| 742 | Ga0496106_1014192 | 3300048909 | Unclassified | 652 |
| 743 | Ga0496107_0046601 | 3300048910 | Unclassified | 3120 |
| 744 | Ga0496107_0229857 | 3300048910 | Bacteria | 1380 |
| 745 | Ga0496107_0238506 | 3300048910 | Bacteria | 1353 |
| 746 | Ga0496107_0970962 | 3300048910 | Unclassified | 617 |
| 747 | Ga0496107_1059619 | 3300048910 | Bacteria | 587 |
| 748 | Ga0496107_1102310 | 3300048910 | Bacteria | 573 |
| 749 | Ga0496107_1121383 | 3300048910 | Unclassified | 568 |
| 750 | Ga0496107_1201778 | 3300048910 | Bacteria | 545 |
| 751 | Ga0496108_0008003 | 3300048911 | Bacteria | 8577 |
| 752 | Ga0496108_0042512 | 3300048911 | Bacteria | 3794 |
| 753 | Ga0496108_0130829 | 3300048911 | Bacteria | 2157 |
| 754 | Ga0496108_0569121 | 3300048911 | Unclassified | 988 |
| 755 | Ga0496108_0945119 | 3300048911 | Bacteria | 738 |
| 756 | Ga0496109_0118423 | 3300048912 | Bacteria | 2465 |
| 757 | Ga0496109_0160937 | 3300048912 | Bacteria | 2103 |
| 758 | Ga0496109_0381240 | 3300048912 | Unclassified | 1332 |
| 759 | Ga0496109_0973272 | 3300048912 | Unclassified | 786 |
| 760 | Ga0496109_1137899 | 3300048912 | Unclassified | 717 |
| 761 | Ga0496110_0004816 | 3300048913 | Bacteria | 10514 |
| 762 | Ga0496110_0075197 | 3300048913 | Bacteria | 3001 |
| 763 | Ga0496110_0572832 | 3300048913 | Bacteria | 1025 |
| 764 | Ga0496110_0649647 | 3300048913 | Unclassified | 955 |
| 765 | Ga0496110_0862199 | 3300048913 | Bacteria | 811 |
| 766 | Ga0496110_0893811 | 3300048913 | Unclassified | 794 |
| 767 | Ga0496111_0038153 | 3300048914 | Bacteria | 3441 |
| 768 | Ga0496111_0434475 | 3300048914 | Unclassified | 969 |
| 769 | Ga0496111_0646881 | 3300048914 | Bacteria | 771 |
| 770 | Ga0496112_0118813 | 3300048915 | Bacteria | 2613 |
| 771 | Ga0496112_0184307 | 3300048915 | Bacteria | 2051 |
| 772 | Ga0496112_0185479 | 3300048915 | Bacteria | 2044 |
| 773 | Ga0496112_0963847 | 3300048915 | Unclassified | 774 |
| 774 | Ga0496112_1215922 | 3300048915 | Unclassified | 670 |
| 775 | Ga0496113_0035141 | 3300048916 | Bacteria | 3663 |
| 776 | Ga0496113_0467482 | 3300048916 | Bacteria | 1013 |
| 777 | Ga0496113_1161921 | 3300048916 | Unclassified | 604 |
| 778 | Ga0496114_0013811 | 3300048917 | Bacteria | 6473 |
| 779 | Ga0496114_0117231 | 3300048917 | Bacteria | 2287 |
| 780 | Ga0496114_0399618 | 3300048917 | Bacteria | 1217 |
| 781 | Ga0496114_1270713 | 3300048917 | Bacteria | 623 |
| 782 | Ga0496115_0651925 | 3300048918 | Bacteria | 832 |
| 783 | Ga0501315_093808 | 3300049531 | Unclassified | 523 |
| 784 | Ga0501031_0086445 | 3300049568 | Bacteria | 2044 |
| 785 | Ga0501031_0108678 | 3300049568 | Bacteria | 1811 |
| 786 | Ga0501032_0069333 | 3300049569 | Bacteria | 2353 |
| 787 | Ga0501032_0431667 | 3300049569 | Unclassified | 845 |
| 788 | Ga0501032_0583563 | 3300049569 | Bacteria | 712 |
| 789 | Ga0501033_0291074 | 3300049570 | Bacteria | 1151 |
| 790 | Ga0501034_0186118 | 3300049571 | Bacteria | 2040 |
| 791 | Ga0501034_1634505 | 3300049571 | Bacteria | 517 |
| 792 | Ga0501036_0088815 | 3300049572 | Bacteria | 2612 |
| 793 | Ga0501036_0153023 | 3300049572 | Bacteria | 1945 |
| 794 | Ga0501036_0253774 | 3300049572 | Bacteria | 1473 |
| 795 | Ga0501036_1259711 | 3300049572 | Bacteria | 602 |
| 796 | Ga0501036_1550061 | 3300049572 | Unclassified | 535 |
| 797 | Ga0501037_0064252 | 3300049573 | Bacteria | 2675 |
| 798 | Ga0501037_0163033 | 3300049573 | Bacteria | 1589 |
| 799 | Ga0501037_0322701 | 3300049573 | Bacteria | 1069 |
| 800 | Ga0501038_0123328 | 3300049574 | Bacteria | 2134 |
| 801 | Ga0501038_0159695 | 3300049574 | Bacteria | 1833 |
| 802 | Ga0501038_0479211 | 3300049574 | Unclassified | 954 |
| 803 | Ga0501038_0524949 | 3300049574 | Bacteria | 903 |
| 804 | Ga0501038_0623679 | 3300049574 | Unclassified | 814 |
| 805 | Ga0501039_0124610 | 3300049575 | Unclassified | 2021 |
| 806 | Ga0501039_0172182 | 3300049575 | Bacteria | 1702 |
| 807 | Ga0501039_0349659 | 3300049575 | Bacteria | 1161 |
| 808 | Ga0501039_1032383 | 3300049575 | Bacteria | 638 |
| 809 | Ga0501039_1083248 | 3300049575 | Bacteria | 621 |
| 810 | Ga0501040_0128121 | 3300049576 | Bacteria | 1783 |
| 811 | Ga0501040_0181306 | 3300049576 | Bacteria | 1493 |
| 812 | Ga0501040_0926128 | 3300049576 | Bacteria | 631 |
| 813 | Ga0501041_0145156 | 3300049577 | Bacteria | 1480 |
| 814 | Ga0501041_0537500 | 3300049577 | Unclassified | 744 |
| 815 | Ga0501042_0120587 | 3300049578 | Bacteria | 1888 |
| 816 | Ga0501042_0168041 | 3300049578 | Bacteria | 1582 |
| 817 | Ga0501042_0356022 | 3300049578 | Bacteria | 1059 |
| 818 | Ga0501042_0503038 | 3300049578 | Unclassified | 880 |
| 819 | Ga0501042_0662059 | 3300049578 | Unclassified | 759 |
| 820 | Ga0501042_1325388 | 3300049578 | Unclassified | 525 |
| 821 | Ga0501043_0176298 | 3300049579 | Bacteria | 1666 |
| 822 | Ga0501043_0749636 | 3300049579 | Unclassified | 710 |
| 823 | Ga0501046_0007752 | 3300049580 | Bacteria | 9418 |
| 824 | Ga0501046_0279589 | 3300049580 | Bacteria | 1223 |
| 825 | Ga0501048_0063950 | 3300049582 | Bacteria | 2602 |
| 826 | Ga0501048_0141483 | 3300049582 | Bacteria | 1701 |
| 827 | Ga0501048_0231406 | 3300049582 | Unclassified | 1311 |
| 828 | Ga0501048_0295846 | 3300049582 | Bacteria | 1151 |
| 829 | Ga0501067_0055957 | 3300049583 | Bacteria | 2186 |
| 830 | Ga0501067_0126943 | 3300049583 | Bacteria | 1419 |
| 831 | Ga0501068_0009403 | 3300049584 | Bacteria | 5468 |
| 832 | Ga0501068_0039731 | 3300049584 | Bacteria | 2822 |
| 833 | Ga0501068_0254865 | 3300049584 | Unclassified | 1119 |
| 834 | Ga0501068_0418517 | 3300049584 | Bacteria | 865 |
| 835 | Ga0501068_0442266 | 3300049584 | Bacteria | 840 |
| 836 | Ga0501068_0959543 | 3300049584 | Bacteria | 563 |
| 837 | Ga0501069_0012108 | 3300049585 | Bacteria | 4581 |
| 838 | Ga0501069_0118685 | 3300049585 | Bacteria | 1510 |
| 839 | Ga0501069_0123715 | 3300049585 | Bacteria | 1478 |
| 840 | Ga0501069_0135806 | 3300049585 | Bacteria | 1410 |
| 841 | Ga0501069_0515107 | 3300049585 | Bacteria | 714 |
| 842 | Ga0501069_0626114 | 3300049585 | Bacteria | 647 |
| 843 | Ga0501069_0796128 | 3300049585 | Unclassified | 573 |
| 844 | Ga0501070_0170906 | 3300049586 | Bacteria | 1790 |
| 845 | Ga0501070_0907147 | 3300049586 | Unclassified | 687 |
| 846 | Ga0501071_0067069 | 3300049587 | Bacteria | 2609 |
| 847 | Ga0501071_0182686 | 3300049587 | Bacteria | 1571 |
| 848 | Ga0501071_0350860 | 3300049587 | Bacteria | 1123 |
| 849 | Ga0501071_0731898 | 3300049587 | Bacteria | 762 |
| 850 | Ga0501072_0023170 | 3300049588 | Bacteria | 4821 |
| 851 | Ga0501072_0368474 | 3300049588 | Bacteria | 1140 |
| 852 | Ga0501072_0854899 | 3300049588 | Bacteria | 711 |
| 853 | Ga0501072_1093578 | 3300049588 | Bacteria | 620 |
| 854 | Ga0501072_1442062 | 3300049588 | Unclassified | 532 |
| 855 | Ga0501073_0420947 | 3300049589 | Bacteria | 923 |
| 856 | Ga0501073_0774359 | 3300049589 | Bacteria | 661 |
| 857 | Ga0501073_1183218 | 3300049589 | Unclassified | 525 |
| 858 | Ga0501074_0186417 | 3300049590 | Bacteria | 1479 |
| 859 | Ga0501074_0607671 | 3300049590 | Bacteria | 773 |
| 860 | Ga0501074_1254572 | 3300049590 | Unclassified | 519 |
| 861 | Ga0501075_0018010 | 3300049591 | Bacteria | 5106 |
| 862 | Ga0501075_0067041 | 3300049591 | Bacteria | 2709 |
| 863 | Ga0501075_0125900 | 3300049591 | Unclassified | 1951 |
| 864 | Ga0501075_0136060 | 3300049591 | Unclassified | 1872 |
| 865 | Ga0501075_0192948 | 3300049591 | Bacteria | 1553 |
| 866 | Ga0501075_0449078 | 3300049591 | Unclassified | 983 |
| 867 | Ga0501076_0011238 | 3300049592 | Bacteria | 6663 |
| 868 | Ga0501076_0063734 | 3300049592 | Bacteria | 2937 |
| 869 | Ga0501076_0080199 | 3300049592 | Bacteria | 2619 |
| 870 | Ga0501076_0116940 | 3300049592 | Bacteria | 2158 |
| 871 | Ga0501076_0266703 | 3300049592 | Unclassified | 1402 |
| 872 | Ga0501076_0951722 | 3300049592 | Bacteria | 708 |
| 873 | Ga0501076_0993704 | 3300049592 | Bacteria | 691 |
| 874 | Ga0501076_1596643 | 3300049592 | Unclassified | 535 |
| 875 | Ga0501077_0119765 | 3300049593 | Bacteria | 1668 |
| 876 | Ga0501077_0157080 | 3300049593 | Bacteria | 1444 |
| 877 | Ga0501077_0164140 | 3300049593 | Bacteria | 1410 |
| 878 | Ga0501077_0507251 | 3300049593 | Unclassified | 773 |
| 879 | Ga0501221_033115 | 3300049704 | Bacteria | 1089 |
| 880 | Ga0501079_0034303 | 3300049741 | Bacteria | 3905 |
| 881 | Ga0501079_0143303 | 3300049741 | Bacteria | 1862 |
| 882 | Ga0501079_0163957 | 3300049741 | Bacteria | 1733 |
| 883 | Ga0501079_0199026 | 3300049741 | Bacteria | 1564 |
| 884 | Ga0501079_0351313 | 3300049741 | Bacteria | 1155 |
| 885 | Ga0501079_1666735 | 3300049741 | Bacteria | 501 |
| 886 | Ga0501080_0057581 | 3300049742 | Bacteria | 3618 |
| 887 | Ga0501080_0165807 | 3300049742 | Bacteria | 2039 |
| 888 | Ga0501081_0059639 | 3300049743 | Bacteria | 2642 |
| 889 | Ga0501081_0125954 | 3300049743 | Bacteria | 1827 |
| 890 | Ga0501081_0233372 | 3300049743 | Bacteria | 1340 |
| 891 | Ga0501081_0378574 | 3300049743 | Bacteria | 1046 |
| 892 | Ga0501081_0500955 | 3300049743 | Bacteria | 905 |
| 893 | Ga0501081_0769716 | 3300049743 | Bacteria | 724 |
| 894 | Ga0501081_1250495 | 3300049743 | Unclassified | 563 |
| 895 | Ga0501083_0357529 | 3300049744 | Bacteria | 949 |
| 896 | Ga0501083_0373258 | 3300049744 | Bacteria | 928 |
| 897 | Ga0501035_0159320 | 3300049822 | Bacteria | 1955 |
| 898 | Ga0501035_0209258 | 3300049822 | Bacteria | 1669 |
| 899 | Ga0501035_0637404 | 3300049822 | Unclassified | 865 |
| 900 | Ga0501044_0283527 | 3300049823 | Bacteria | 1589 |
| 901 | Ga0501045_0258310 | 3300049824 | Bacteria | 1296 |
| 902 | Ga0501045_0559334 | 3300049824 | Unclassified | 848 |
| 903 | nmdc:mga0yw44_107924_c1 | 3300050492 | Bacteria | 1169 |
| 904 | nmdc:mga05p37_14607_c1 | 3300050507 | Bacteria | 9433 |
| 905 | nmdc:mga05p37_340111_c1 | 3300050507 | Bacteria | 1770 |
| 906 | nmdc:mga05p37_382688_c1 | 3300050507 | Bacteria | 1648 |
| 907 | nmdc:mga09592_1394579_c1 | 3300050508 | Unclassified | 573 |
| 908 | nmdc:mga08y16_165423_c1 | 3300050511 | Bacteria | 2298 |
| 909 | nmdc:mga08y16_255334_c1 | 3300050511 | Bacteria | 1811 |
| 910 | nmdc:mga08y16_813141_c1 | 3300050511 | Unclassified | 927 |
| 911 | nmdc:mga0n895_161538_c1 | 3300050512 | Bacteria | 2272 |
| 912 | nmdc:mga0n895_325959_c1 | 3300050512 | Bacteria | 1556 |
| 913 | nmdc:mga0rr50_911222_c1 | 3300050513 | Bacteria | 749 |
| 914 | nmdc:mga0rr50_944229_c1 | 3300050513 | Unclassified | 735 |
| 915 | nmdc:mga08x19_702875_c1 | 3300050514 | Bacteria | 717 |
| 916 | nmdc:mga08x19_821432_c1 | 3300050514 | Bacteria | 660 |
| 917 | nmdc:mga0a205_127472_c1 | 3300050515 | Unclassified | 2445 |
| 918 | nmdc:mga0a205_324810_c1 | 3300050515 | Bacteria | 1409 |
| 919 | nmdc:mga0a205_486173_c1 | 3300050515 | Unclassified | 1092 |
| 920 | Ga0495601_0039144 | 3300053077 | Bacteria | 2968 |
| 921 | Ga0495601_0425973 | 3300053077 | Bacteria | 859 |
| 922 | Ga0495612_0005172 | 3300053078 | Bacteria | 5390 |
| 923 | Ga0495612_0176618 | 3300053078 | Bacteria | 937 |
| 924 | Ga0495655_0229762 | 3300053083 | Bacteria | 617 |
| 925 | Ga0495595_0227434 | 3300053084 | Bacteria | 931 |
| 926 | Ga0495619_0409863 | 3300053085 | Bacteria | 935 |
| 927 | Ga0495619_0511555 | 3300053085 | Bacteria | 825 |
| 928 | Ga0495619_0539844 | 3300053085 | Bacteria | 800 |
| 929 | Ga0495619_1016899 | 3300053085 | Unclassified | 554 |
| 930 | Ga0501084_0051538 | 3300054114 | Bacteria | 3444 |
| 931 | Ga0501084_0060076 | 3300054114 | Bacteria | 3183 |
| 932 | Ga0501084_0139877 | 3300054114 | Bacteria | 2038 |
| 933 | Ga0501084_0147032 | 3300054114 | Bacteria | 1985 |
| 934 | Ga0501084_0212179 | 3300054114 | Bacteria | 1633 |
| 935 | Ga0501084_1763774 | 3300054114 | Bacteria | 517 |
| 936 | Ga0501082_0151976 | 3300060353 | Bacteria | 2011 |
| 937 | Ga0501082_0163758 | 3300060353 | Bacteria | 1932 |
| 938 | Ga0501082_0412563 | 3300060353 | Bacteria | 1179 |
| 939 | Ga0501082_0425888 | 3300060353 | Unclassified | 1159 |
| 940 | Ga0501082_0793686 | 3300060353 | Unclassified | 828 |
| 941 | Ga0501082_1564653 | 3300060353 | Bacteria | 576 |
| 942 | Ga0530510_0001918 | 3300061734 | Bacteria | 14228 |
| 943 | Ga0530510_0071743 | 3300061734 | Bacteria | 2514 |
| 944 | Ga0530510_0106674 | 3300061734 | Bacteria | 2050 |
| 945 | Ga0530510_0258340 | 3300061734 | Bacteria | 1298 |
| 946 | Ga0530510_1090276 | 3300061734 | Bacteria | 612 |
| 947 | Ga0439459_0104468 | |||
| 948 | rootH1_10150100 | |||
| 949 | Ga0058858_1319225 | |||
| 950 | Ga0058859_11798597 | |||
| 951 | Ga0058860_11602357 | |||
| 952 | Ga0058860_12147728 | |||
| 953 | Ga0070676_10477797 | |||
| 954 | Ga0070676_10779353 | |||
| 955 | Ga0070676_10871139 | |||
| 956 | Ga0070670_100168862 | |||
| 957 | Ga0068869_100029630 | |||
| 958 | Ga0068869_100692321 | |||
| 959 | Ga0070666_10790169 | |||
| 960 | Ga0070680_101087949 | |||
| 961 | Ga0070682_100054246 | |||
| 962 | Ga0070682_100125876 | |||
| 963 | Ga0070682_100202989 | |||
| 964 | Ga0068868_100039128 | |||
| 965 | Ga0068868_101070768 | |||
| 966 | Ga0070660_100095997 | |||
| 967 | Ga0070689_100007428 | |||
| 968 | Ga0070689_100315883 | |||
| 969 | Ga0070689_100693607 | |||
| 970 | Ga0070689_101478603 | |||
| 971 | Ga0070691_10379478 | |||
| 972 | Ga0070687_100031595 | |||
| 973 | Ga0070687_100381285 | |||
| 974 | Ga0070687_101212615 | |||
| 975 | Ga0070661_100317785 | |||
| 976 | Ga0070692_10144260 | |||
| 977 | Ga0070692_10254550 | |||
| 978 | Ga0070692_11358377 | |||
| 979 | Ga0070668_100333397 | |||
| 980 | Ga0070668_100375317 | |||
| 981 | Ga0070669_100389474 | |||
| 982 | Ga0070669_100689170 | |||
| 983 | Ga0070675_100004800 | |||
| 984 | Ga0070675_100769854 | |||
| 985 | Ga0070671_100681309 | |||
| 986 | Ga0070671_101033027 | |||
| 987 | Ga0070674_100049528 | |||
| 988 | Ga0070674_100759849 | |||
| 989 | Ga0070674_101871912 | |||
| 990 | Ga0070673_100016754 | |||
| 991 | Ga0070673_101010232 | |||
| 992 | Ga0070688_100008247 | |||
| 993 | Ga0070659_100008825 | |||
| 994 | Ga0070659_100437425 | |||
| 995 | Ga0070659_100512921 | |||
| 996 | Ga0070659_100987170 | |||
| 997 | Ga0070667_100395589 | |||
| 998 | Ga0070667_100567158 | |||
| 999 | Ga0070667_100687932 | |||
| 1000 | Ga0070703_10079043 | |||
| 1001 | Ga0070703_10491030 | |||
| 1002 | Ga0070709_10686996 | |||
| 1003 | Ga0070713_100096526 | |||
| 1004 | Ga0070713_100210296 | |||
| 1005 | Ga0070713_101254489 | |||
| 1006 | Ga0070710_10982995 | |||
| 1007 | Ga0070710_11529990 | |||
| 1008 | Ga0070701_10017530 | |||
| 1009 | Ga0070701_10204086 | |||
| 1010 | Ga0070701_10481805 | |||
| 1011 | Ga0070711_100567494 | |||
| 1012 | Ga0070711_100906045 | |||
| 1013 | Ga0070711_101930750 | |||
| 1014 | Ga0070705_100005505 | |||
| 1015 | Ga0070705_100023330 | |||
| 1016 | Ga0070705_100068951 | |||
| 1017 | Ga0070705_100133444 | |||
| 1018 | Ga0070705_100188069 | |||
| 1019 | Ga0070705_100607398 | |||
| 1020 | Ga0070700_100011273 | |||
| 1021 | Ga0070700_100499032 | |||
| 1022 | Ga0070700_100676233 | |||
| 1023 | Ga0070700_100739766 | |||
| 1024 | Ga0070694_100044880 | |||
| 1025 | Ga0070694_100252498 | |||
| 1026 | Ga0070694_100814076 | |||
| 1027 | Ga0070708_100206906 | |||
| 1028 | Ga0070708_100512405 | |||
| 1029 | Ga0070708_100574755 | |||
| 1030 | Ga0070708_100709715 | |||
| 1031 | Ga0070708_101214673 | |||
| 1032 | Ga0070663_100036412 | |||
| 1033 | Ga0070663_101820768 | |||
| 1034 | Ga0070678_100009086 | |||
| 1035 | Ga0070678_100861432 | |||
| 1036 | Ga0070662_100004731 | |||
| 1037 | Ga0070662_100201018 | |||
| 1038 | Ga0070681_10138050 | |||
| 1039 | Ga0068867_100235963 | |||
| 1040 | Ga0068867_100571829 | |||
| 1041 | Ga0068867_101257270 | |||
| 1042 | Ga0070685_10341781 | |||
| 1043 | Ga0070706_100000515 | |||
| 1044 | Ga0070706_100030330 | |||
| 1045 | Ga0070706_100168691 | |||
| 1046 | Ga0070706_100331319 | |||
| 1047 | Ga0070706_100505252 | |||
| 1048 | Ga0070706_100751041 | |||
| 1049 | Ga0070706_100936694 | |||
| 1050 | Ga0070706_101651019 | |||
| 1051 | Ga0070707_100003133 | |||
| 1052 | Ga0070707_100003769 | |||
| 1053 | Ga0070707_100230298 | |||
| 1054 | Ga0070707_100383314 | |||
| 1055 | Ga0070707_100464152 | |||
| 1056 | Ga0070707_100692156 | |||
| 1057 | Ga0070698_100180003 | |||
| 1058 | Ga0070698_100450647 | |||
| 1059 | Ga0070698_100456450 | |||
| 1060 | Ga0070698_100543577 | |||
| 1061 | Ga0070698_100806428 | |||
| 1062 | Ga0070698_101428179 | |||
| 1063 | Ga0070698_101661859 | |||
| 1064 | Ga0070698_102106382 | |||
| 1065 | Ga0070699_100004404 | |||
| 1066 | Ga0070699_100008140 | |||
| 1067 | Ga0070699_100454444 | |||
| 1068 | Ga0070699_100976273 | |||
| 1069 | Ga0070699_101240776 | |||
| 1070 | Ga0070699_101684033 | |||
| 1071 | Ga0070699_101853074 | |||
| 1072 | Ga0070679_100628834 | |||
| 1073 | Ga0070684_100124027 | |||
| 1074 | Ga0070684_101047382 | |||
| 1075 | Ga0070684_101050311 | |||
| 1076 | Ga0070684_101672511 | |||
| 1077 | Ga0070697_100122590 | |||
| 1078 | Ga0070697_100154139 | |||
| 1079 | Ga0070697_101096446 | |||
| 1080 | Ga0068853_100480749 | |||
| 1081 | Ga0068853_100940749 | |||
| 1082 | Ga0068853_101656741 | |||
| 1083 | Ga0070672_100192617 | |||
| 1084 | Ga0070686_100160132 | |||
| 1085 | Ga0070686_101072251 | |||
| 1086 | Ga0070695_100009622 | |||
| 1087 | Ga0070695_100112936 | |||
| 1088 | Ga0070695_100122556 | |||
| 1089 | Ga0070695_100183264 | |||
| 1090 | Ga0070695_100629516 | |||
| 1091 | Ga0070696_100002114 | |||
| 1092 | Ga0070696_100033792 | |||
| 1093 | Ga0070696_100317452 | |||
| 1094 | Ga0070693_100169898 | |||
| 1095 | Ga0070693_100553757 | |||
| 1096 | Ga0070693_101260529 | |||
| 1097 | Ga0070693_101265066 | |||
| 1098 | Ga0070665_100639567 | |||
| 1099 | Ga0070704_100045205 | |||
| 1100 | Ga0070704_100138515 | |||
| 1101 | Ga0070704_100193221 | |||
| 1102 | Ga0070704_100280275 | |||
| 1103 | Ga0070704_101103978 | |||
| 1104 | Ga0068855_100337276 | |||
| 1105 | Ga0068855_101013870 | |||
| 1106 | Ga0068855_101102000 | |||
| 1107 | Ga0068855_101206629 | |||
| 1108 | Ga0070664_100337924 | |||
| 1109 | Ga0068857_100556836 | |||
| 1110 | Ga0068857_101582384 | |||
| 1111 | Ga0068857_102182635 | |||
| 1112 | Ga0068854_100493463 | |||
| 1113 | Ga0068854_101030663 | |||
| 1114 | Ga0068856_100187860 | |||
| 1115 | Ga0068856_101542646 | |||
| 1116 | Ga0068856_101555665 | |||
| 1117 | Ga0070702_100623599 | |||
| 1118 | Ga0068852_100208667 | |||
| 1119 | Ga0068852_101472673 | |||
| 1120 | Ga0068852_101740649 | |||
| 1121 | Ga0068859_100011307 | |||
| 1122 | Ga0068859_100249310 | |||
| 1123 | Ga0068859_101612114 | |||
| 1124 | Ga0068864_100014040 | |||
| 1125 | Ga0068864_100160442 | |||
| 1126 | Ga0068864_101081563 | |||
| 1127 | Ga0068864_101093702 | |||
| 1128 | Ga0068861_100530417 | |||
| 1129 | Ga0068861_101574091 | |||
| 1130 | Ga0068861_102274990 | |||
| 1131 | Ga0068861_102409083 | |||
| 1132 | Ga0068851_10619688 | |||
| 1133 | Ga0068870_10066963 | |||
| 1134 | Ga0068870_10568503 | |||
| 1135 | Ga0068863_100101962 | |||
| 1136 | Ga0068863_100328295 | |||
| 1137 | Ga0068863_101311645 | |||
| 1138 | Ga0068858_100040335 | |||
| 1139 | Ga0068858_100439138 | |||
| 1140 | Ga0068858_100858486 | |||
| 1141 | Ga0068860_100038329 | |||
| 1142 | Ga0068860_100273632 | |||
| 1143 | Ga0068860_100386744 | |||
| 1144 | Ga0068860_100402055 | |||
| 1145 | Ga0068860_100866228 | |||
| 1146 | Ga0068860_101592369 | |||
| 1147 | Ga0068860_102091559 | |||
| 1148 | Ga0068862_100366210 | |||
| 1149 | Ga0068862_102580315 | |||
| 1150 | Ga0081455_10075381 | |||
| 1151 | Ga0081538_10133475 | |||
| 1152 | Ga0081539_10023255 | |||
| 1153 | Ga0075365_10116163 | |||
| 1154 | Ga0075364_10341604 | |||
| 1155 | Ga0075432_10173023 | |||
| 1156 | Ga0070716_100069107 | |||
| 1157 | Ga0070716_100308406 | |||
| 1158 | Ga0070716_100463174 | |||
| 1159 | Ga0070716_101042881 | |||
| 1160 | Ga0070712_100400942 | |||
| 1161 | Ga0070712_100922096 | |||
| 1162 | Ga0097621_100558486 | |||
| 1163 | Ga0097621_102020471 | |||
| 1164 | Ga0075428_101120902 | |||
| 1165 | Ga0075428_102386869 | |||
| 1166 | Ga0075433_10090173 | |||
| 1167 | Ga0075433_10491367 | |||
| 1168 | Ga0075433_10513017 | |||
| 1169 | Ga0075433_10581286 | |||
| 1170 | Ga0075434_100133922 | |||
| 1171 | Ga0075434_100332882 | |||
| 1172 | Ga0075434_100351625 | |||
| 1173 | Ga0075434_101840444 | |||
| 1174 | Ga0075429_101268457 | |||
| 1175 | Ga0068865_100011184 | |||
| 1176 | Ga0075436_100933332 | |||
| 1177 | Ga0097620_100011307 | |||
| 1178 | Ga0097620_100249295 | |||
| 1179 | Ga0097620_101612004 | |||
| 1180 | Ga0075435_100731226 | |||
| 1181 | Ga0075435_101927844 | |||
| 1182 | Ga0075435_102055553 | |||
| 1183 | Ga0099794_10391647 | |||
| 1184 | Ga0099795_10222917 | |||
| 1185 | Ga0105244_10074846 | |||
| 1186 | Ga0105250_10341579 | |||
| 1187 | Ga0105240_10001350 | |||
| 1188 | Ga0105240_10216838 | |||
| 1189 | Ga0111539_10059856 | |||
| 1190 | Ga0111539_10131194 | |||
| 1191 | Ga0111539_10494097 | |||
| 1192 | Ga0111539_10551856 | |||
| 1193 | Ga0105245_10016016 | |||
| 1194 | Ga0105245_10116529 | |||
| 1195 | Ga0105245_10301711 | |||
| 1196 | Ga0105245_10619359 | |||
| 1197 | Ga0105245_10973645 | |||
| 1198 | Ga0105245_11124972 | |||
| 1199 | Ga0105245_11387424 | |||
| 1200 | Ga0105245_11678901 | |||
| 1201 | Ga0105245_12228238 | |||
| 1202 | Ga0114129_10043878 | |||
| 1203 | Ga0114129_10098746 | |||
| 1204 | Ga0114129_10279768 | |||
| 1205 | Ga0114129_10469403 | |||
| 1206 | Ga0114129_11829805 | |||
| 1207 | Ga0114129_12122149 | |||
| 1208 | Ga0105243_10007956 | |||
| 1209 | Ga0105243_10118984 | |||
| 1210 | Ga0105243_10279345 | |||
| 1211 | Ga0105243_10465185 | |||
| 1212 | Ga0105243_10758322 | |||
| 1213 | Ga0105243_11320360 | |||
| 1214 | Ga0105243_11919073 | |||
| 1215 | Ga0105241_10551096 | |||
| 1216 | Ga0105241_10551914 | |||
| 1217 | Ga0105241_11470946 | |||
| 1218 | Ga0105242_10103209 | |||
| 1219 | Ga0105242_10311405 | |||
| 1220 | Ga0105242_10484374 | |||
| 1221 | Ga0105242_10890266 | |||
| 1222 | Ga0105242_11474267 | |||
| 1223 | Ga0105242_11485266 | |||
| 1224 | Ga0105242_11824846 | |||
| 1225 | Ga0105248_10031021 | |||
| 1226 | Ga0105248_10410394 | |||
| 1227 | Ga0105248_11419981 | |||
| 1228 | Ga0105248_11510348 | |||
| 1229 | Ga0105248_12797890 | |||
| 1230 | Ga0105248_13110859 | |||
| 1231 | Ga0105237_10271304 | |||
| 1232 | Ga0105237_11470380 | |||
| 1233 | Ga0105238_10146988 | |||
| 1234 | Ga0105238_11112927 | |||
| 1235 | Ga0105238_11760804 | |||
| 1236 | Ga0105238_11777725 | |||
| 1237 | Ga0105238_11867277 | |||
| 1238 | Ga0105249_10010583 | |||
| 1239 | Ga0105249_10024438 | |||
| 1240 | Ga0105249_10253673 | |||
| 1241 | Ga0105249_10556053 | |||
| 1242 | Ga0105249_10627366 | |||
| 1243 | Ga0105249_11386283 | |||
| 1244 | Ga0105249_12374943 | |||
| 1245 | Ga0099796_10097019 | |||
| 1246 | Ga0105239_10053647 | |||
| 1247 | Ga0105239_10657642 | |||
| 1248 | Ga0105239_11313620 | |||
| 1249 | Ga0105239_12114256 | |||
| 1250 | Ga0105246_10475325 | |||
| 1251 | Ga0105246_11008321 | |||
| 1252 | Ga0105246_11114916 | |||
| 1253 | Ga0105246_11352226 | |||
| 1254 | Ga0105246_12589770 | |||
| 1255 | Ga0157329_1020367 | |||
| 1256 | Ga0157326_1069203 | |||
| 1257 | Ga0157373_10337419 | |||
| 1258 | Ga0157373_10698583 | |||
| 1259 | Ga0157371_11079257 | |||
| 1260 | Ga0157370_10216201 | |||
| 1261 | Ga0157369_10578854 | |||
| 1262 | Ga0157374_10858802 | |||
| 1263 | Ga0157374_12517790 | |||
| 1264 | Ga0157378_10162379 | |||
| 1265 | Ga0157378_10181120 | |||
| 1266 | Ga0157378_10407682 | |||
| 1267 | Ga0157378_10489231 | |||
| 1268 | Ga0157378_10967862 | |||
| 1269 | Ga0157378_11178315 | |||
| 1270 | Ga0157378_11593458 | |||
| 1271 | Ga0157378_11992432 | |||
| 1272 | Ga0163162_10173787 | |||
| 1273 | Ga0163162_10696857 | |||
| 1274 | Ga0163162_11800278 | |||
| 1275 | Ga0163162_12066554 | |||
| 1276 | Ga0157372_10547728 | |||
| 1277 | Ga0157375_10001358 | |||
| 1278 | Ga0157375_10883134 | |||
| 1279 | Ga0157375_13460727 | |||
| 1280 | Ga0163163_10035902 | |||
| 1281 | Ga0163163_10051703 | |||
| 1282 | Ga0163163_10173934 | |||
| 1283 | Ga0163163_10379076 | |||
| 1284 | Ga0163163_10633905 | |||
| 1285 | Ga0163163_12180278 | |||
| 1286 | Ga0157380_10032691 | |||
| 1287 | Ga0157380_10084549 | |||
| 1288 | Ga0157380_10201710 | |||
| 1289 | Ga0157380_10294971 | |||
| 1290 | Ga0182008_10074494 | |||
| 1291 | Ga0182008_10119518 | |||
| 1292 | Ga0182008_10844245 | |||
| 1293 | Ga0157377_10007497 | |||
| 1294 | Ga0157379_10073018 | |||
| 1295 | Ga0157379_10147431 | |||
| 1296 | Ga0157379_10217751 | |||
| 1297 | Ga0157379_10254722 | |||
| 1298 | Ga0157379_10853545 | |||
| 1299 | Ga0157379_11453021 | |||
| 1300 | Ga0157379_11863658 | |||
| 1301 | Ga0157376_10112050 | |||
| 1302 | Ga0157376_12001934 | |||
| 1303 | Ga0157376_12134508 | |||
| 1304 | Ga0157376_12506530 | |||
| 1305 | Ga0163161_10022251 | |||
| 1306 | Ga0163161_10187552 | |||
| 1307 | Ga0163161_10561681 | |||
| 1308 | Ga0163161_11448255 | |||
| 1309 | Ga0206356_11706952 | |||
| 1310 | Ga0207653_10069717 | |||
| 1311 | Ga0207642_10034970 | |||
| 1312 | Ga0207688_10066025 | |||
| 1313 | Ga0207688_10392423 | |||
| 1314 | Ga0207680_11157058 | |||
| 1315 | Ga0207645_10422903 | |||
| 1316 | Ga0207645_10512508 | |||
| 1317 | Ga0207643_10001805 | |||
| 1318 | Ga0207705_10589324 | |||
| 1319 | Ga0207684_10004220 | |||
| 1320 | Ga0207684_10106355 | |||
| 1321 | Ga0207684_10150340 | |||
| 1322 | Ga0207684_10337323 | |||
| 1323 | Ga0207684_10517272 | |||
| 1324 | Ga0207684_10947247 | |||
| 1325 | Ga0207654_10393838 | |||
| 1326 | Ga0207695_10022614 | |||
| 1327 | Ga0207695_10208382 | |||
| 1328 | Ga0207671_11251718 | |||
| 1329 | Ga0207693_10417094 | |||
| 1330 | Ga0207693_10815682 | |||
| 1331 | Ga0207693_11179435 | |||
| 1332 | Ga0207663_10434338 | |||
| 1333 | Ga0207663_10681618 | |||
| 1334 | Ga0207660_10633149 | |||
| 1335 | Ga0207660_11010853 | |||
| 1336 | Ga0207662_10007483 | |||
| 1337 | Ga0207662_10511873 | |||
| 1338 | Ga0207657_10280403 | |||
| 1339 | Ga0207657_10652654 | |||
| 1340 | Ga0207649_10179558 | |||
| 1341 | Ga0207652_11108914 | |||
| 1342 | Ga0207652_11159109 | |||
| 1343 | Ga0207646_10002447 | |||
| 1344 | Ga0207646_10004406 | |||
| 1345 | Ga0207646_10015078 | |||
| 1346 | Ga0207646_10105828 | |||
| 1347 | Ga0207646_10249594 | |||
| 1348 | Ga0207646_10502449 | |||
| 1349 | Ga0207646_11910516 | |||
| 1350 | Ga0207681_10643942 | |||
| 1351 | Ga0207694_10096920 | |||
| 1352 | Ga0207650_10642352 | |||
| 1353 | Ga0207650_11526130 | |||
| 1354 | Ga0207650_11827164 | |||
| 1355 | Ga0207659_10377017 | |||
| 1356 | Ga0207687_10032802 | |||
| 1357 | Ga0207687_10331452 | |||
| 1358 | Ga0207687_10368504 | |||
| 1359 | Ga0207700_10330993 | |||
| 1360 | Ga0207700_10738334 | |||
| 1361 | Ga0207664_10451150 | |||
| 1362 | Ga0207690_10104860 | |||
| 1363 | Ga0207690_10194372 | |||
| 1364 | Ga0207690_11436569 | |||
| 1365 | Ga0207706_10007415 | |||
| 1366 | Ga0207706_10103413 | |||
| 1367 | Ga0207706_10468530 | |||
| 1368 | Ga0207686_10040140 | |||
| 1369 | Ga0207686_10468494 | |||
| 1370 | Ga0207686_10865160 | |||
| 1371 | Ga0207686_11703577 | |||
| 1372 | Ga0207686_11842274 | |||
| 1373 | Ga0207709_10030741 | |||
| 1374 | Ga0207709_10053844 | |||
| 1375 | Ga0207709_10333158 | |||
| 1376 | Ga0207670_10040478 | |||
| 1377 | Ga0207670_10280746 | |||
| 1378 | Ga0207670_10315324 | |||
| 1379 | Ga0207669_11287636 | |||
| 1380 | Ga0207665_10208420 | |||
| 1381 | Ga0207665_10429122 | |||
| 1382 | Ga0207665_10916456 | |||
| 1383 | Ga0207691_10005391 | |||
| 1384 | Ga0207711_10595926 | |||
| 1385 | Ga0207711_11942771 | |||
| 1386 | Ga0207689_10094292 | |||
| 1387 | Ga0207689_10204325 | |||
| 1388 | Ga0207661_10735895 | |||
| 1389 | Ga0207661_11448357 | |||
| 1390 | Ga0207679_10419508 | |||
| 1391 | Ga0207679_12195722 | |||
| 1392 | Ga0207667_10873331 | |||
| 1393 | Ga0207667_11522265 | |||
| 1394 | Ga0207651_10029953 | |||
| 1395 | Ga0207651_11103092 | |||
| 1396 | Ga0207712_10107343 | |||
| 1397 | Ga0207712_10183217 | |||
| 1398 | Ga0207712_10765322 | |||
| 1399 | Ga0207712_10922457 | |||
| 1400 | Ga0207668_10346233 | |||
| 1401 | Ga0207668_10384169 | |||
| 1402 | Ga0207640_10651756 | |||
| 1403 | Ga0207640_12200617 | |||
| 1404 | Ga0207658_10301955 | |||
| 1405 | Ga0207658_10502584 | |||
| 1406 | Ga0207658_10955905 | |||
| 1407 | Ga0207677_10184589 | |||
| 1408 | Ga0207677_10773993 | |||
| 1409 | Ga0207677_11820113 | |||
| 1410 | Ga0207703_10128393 | |||
| 1411 | Ga0207703_10522672 | |||
| 1412 | Ga0207703_11276830 | |||
| 1413 | Ga0207639_10630029 | |||
| 1414 | Ga0207639_11465418 | |||
| 1415 | Ga0207678_10008985 | |||
| 1416 | Ga0207678_10346494 | |||
| 1417 | Ga0207708_10001286 | |||
| 1418 | Ga0207708_10459524 | |||
| 1419 | Ga0207708_10595963 | |||
| 1420 | Ga0207708_11125072 | |||
| 1421 | Ga0207702_10186263 | |||
| 1422 | Ga0207702_11097252 | |||
| 1423 | Ga0207702_11445762 | |||
| 1424 | Ga0207641_10149531 | |||
| 1425 | Ga0207641_10587798 | |||
| 1426 | Ga0207641_11141199 | |||
| 1427 | Ga0207641_11970409 | |||
| 1428 | Ga0207648_10002950 | |||
| 1429 | Ga0207648_10579837 | |||
| 1430 | Ga0207648_12188068 | |||
| 1431 | Ga0207676_10441803 | |||
| 1432 | Ga0207676_10713619 | |||
| 1433 | Ga0207676_11564869 | |||
| 1434 | Ga0207676_11965151 | |||
| 1435 | Ga0207674_10011251 | |||
| 1436 | Ga0207674_11684805 | |||
| 1437 | Ga0207675_101497174 | |||
| 1438 | Ga0207675_102257156 | |||
| 1439 | Ga0207683_10007488 | |||
| 1440 | Ga0207683_10596626 | |||
| 1441 | Ga0207698_10789875 | |||
| 1442 | Ga0207698_10983955 | |||
| 1443 | Ga0207698_11948406 | |||
| 1444 | Ga0209969_1068678 | |||
| 1445 | Ga0209981_1080085 | |||
| 1446 | Ga0209970_1080931 | |||
| 1447 | Ga0209983_1027004 | |||
| 1448 | Ga0209983_1090111 | |||
| 1449 | Ga0209966_1106255 | |||
| 1450 | Ga0209998_10036388 | |||
| 1451 | Ga0209974_10026820 | |||
| 1452 | Ga0207428_10037242 | |||
| 1453 | Ga0207428_10367835 | |||
| 1454 | Ga0207428_10504932 | |||
| 1455 | Ga0268266_10102583 | |||
| 1456 | Ga0268265_10096341 | |||
| 1457 | Ga0268265_10711047 | |||
| 1458 | Ga0268265_12361523 | |||
| 1459 | Ga0268264_10051808 | |||
| 1460 | Ga0268264_10292530 | |||
| 1461 | Ga0268264_10580847 | |||
| 1462 | Ga0268264_10649075 | |||
| 1463 | Ga0265326_10007265 | |||
| 1464 | Ga0265326_10014894 | |||
| 1465 | Ga0265334_10021849 | |||
| 1466 | Ga0265322_10031794 | |||
| 1467 | Ga0265322_10074612 | |||
| 1468 | Ga0265336_10231996 | |||
| 1469 | Ga0265338_10277787 | |||
| 1470 | Ga0265324_10049072 | |||
| 1471 | Ga0265332_10035487 | |||
| 1472 | Ga0265328_10040392 | |||
| 1473 | Ga0265320_10052818 | |||
| 1474 | Ga0265329_10000636 | |||
| 1475 | Ga0265316_10022340 | |||
| 1476 | Ga0265316_10082439 | |||
| 1477 | Ga0307408_100923703 | |||
| 1478 | Ga0265314_10000340 | |||
| 1479 | Ga0265314_10094715 | |||
| 1480 | Ga0265342_10278441 | |||
| 1481 | Ga0316576_10891406 | |||
| 1482 | Ga0307405_10112600 | |||
| 1483 | Ga0316577_10001043 | |||
| 1484 | Ga0307410_10221477 | |||
| 1485 | Ga0307406_10055263 | |||
| 1486 | Ga0307407_10668890 | |||
| 1487 | Ga0307412_10664461 | |||
| 1488 | Ga0307409_100055729 | |||
| 1489 | Ga0307409_101007616 | |||
| 1490 | Ga0307409_101514084 | |||
| 1491 | Ga0307416_100069740 | |||
| 1492 | Ga0307416_100108237 | |||
| 1493 | Ga0307416_102045219 | |||
| 1494 | Ga0307416_102047498 | |||
| 1495 | Ga0307411_10020285 | |||
| 1496 | Ga0307411_10296725 | |||
| 1497 | Ga0307415_100039313 | |||
| 1498 | Ga0307415_101161229 | |||
| 1499 | Ga0307415_101193337 | |||
| 1500 | Ga0316585_10265633 | |||
| 1501 | Ga0316593_10248793 | |||
| 1502 | Ga0373950_0081298 | |||
| 1503 | Ga0373958_0108270 | |||
| 1504 | Ga0373938_0114451 | |||
| 1505 | Ga0373938_0117799 | |||
| 1506 | Ga0373926_0039632 | |||
| 1507 | Ga0373926_0428246 | |||
| 1508 | Ga0373926_0431016 | |||
| 1509 | Ga0373928_0177376 | |||
| 1510 | Ga0373944_0196375 | |||
| 1511 | Ga0373944_0242412 | |||
| 1512 | Ga0373952_0049521 | |||
| 1513 | Ga0373932_0117501 | |||
| 1514 | Ga0373932_0136953 | |||
| 1515 | Ga0373932_0279457 | |||
| 1516 | Ga0373936_0619161 | |||
| 1517 | Ga0373939_0105461 | |||
| 1518 | Ga0373939_0152723 | |||
| 1519 | Ga0373939_0305104 | |||
| 1520 | Ga0373941_0184598 | |||
| 1521 | Ga0373941_0221861 | |||
| 1522 | Ga0373945_0436339 | |||
| 1523 | Ga0373945_0491717 | |||
| 1524 | Ga0373954_0268388 | |||
| 1525 | Ga0373960_0026919 | |||
| 1526 | Ga0373943_0123923 | |||
| 1527 | Ga0373943_0236754 | |||
| 1528 | Ga0373946_0309467 | |||
| 1529 | Ga0373942_0276339 | |||
| 1530 | Ga0373961_0281135 | |||
| 1531 | Ga0373962_0080800 | |||
| 1532 | Ga0373962_0115019 | |||
| 1533 | Ga0373962_0332312 | |||
| 1534 | Ga0373931_0140079 | |||
| 1535 | Ga0373931_0163399 | |||
| 1536 | Ga0373931_0347704 | |||
| 1537 | Ga0373931_0603392 | |||
| 1538 | Ga0373935_0220917 | |||
| 1539 | Ga0373935_0624868 | |||
| 1540 | Ga0373935_1311775 | |||
| 1541 | Ga0373927_0002704 | |||
| 1542 | Ga0373927_0243630 | |||
| 1543 | Ga0373927_0933018 | |||
| 1544 | Ga0373947_0118107 | |||
| 1545 | Ga0373947_1170156 | |||
| 1546 | Ga0373937_0412287 | |||
| 1547 | Ga0373937_0824696 | |||
| 1548 | Ga0316582_0432928 | |||
| 1549 | Ga0316584_0007685 | |||
| 1550 | Ga0373925_0018310 | |||
| 1551 | Ga0373925_0359456 | |||
| 1552 | Ga0373925_0462251 | |||
| 1553 | Ga0373925_0754665 | |||
| 1554 | Ga0373925_1035788 | |||
| 1555 | Ga0373925_1754501 | |||
| 1556 | Ga0395905_1400956 | |||
| 1557 | Ga0395905_1833529 | |||
| 1558 | Ga0316581_0023971 | |||
| 1559 | Ga0395901_0333846 | |||
| 1560 | Ga0395901_0442107 | |||
| 1561 | Ga0242420_049816 | |||
| 1562 | Ga0242420_092684 | |||
| 1563 | Ga0436365_1412982 | |||
| 1564 | Ga0436362_1153239 | |||
| 1565 | Ga0451802_0468077 | |||
| 1566 | Ga0451804_1114298 | |||
| 1567 | Ga0451835_0707314 | |||
| 1568 | Ga0451845_0556828 | |||
| 1569 | Ga0451849_0313022 | |||
| 1570 | Ga0451853_0920180 | |||
| 1571 | Ga0451853_4060573 | |||
| 1572 | Ga0439431_0181722 | |||
| 1573 | Ga0439441_001644 | |||
| 1574 | Ga0439455_0174146 | |||
| 1575 | Ga0450920_107793 | |||
| 1576 | Ga0439435_0153458 | |||
| 1577 | Ga0451577_0675546 | |||
| 1578 | Ga0466964_0394315 | |||
| 1579 | Ga0453684_1337501 | |||
| 1580 | Ga0453684_1457291 | |||
| 1581 | Ga0451576_0101832 | |||
| 1582 | Ga0451576_0106527 | |||
| 1583 | Ga0451576_0155114 | |||
| 1584 | Ga0451576_0162127 | |||
| 1585 | Ga0451576_0690676 | |||
| 1586 | Ga0451576_0708538 | |||
| 1587 | Ga0451576_1243631 | |||
| 1588 | Ga0451576_1600349 | |||
| 1589 | Ga0451576_2215047 | |||
| 1590 | Ga0495592_0145238 | |||
| 1591 | Ga0495590_0186303 | |||
| 1592 | Ga0495629_0282046 | |||
| 1593 | Ga0495629_0689270 | |||
| 1594 | Ga0495629_0934737 | |||
| 1595 | Ga0495641_0225045 | |||
| 1596 | Ga0495641_0229928 | |||
| 1597 | Ga0495651_0143152 | |||
| 1598 | Ga0495651_0612327 | |||
| 1599 | Ga0495653_0405965 | |||
| 1600 | Ga0495580_0411368 | |||
| 1601 | Ga0495582_0627904 | |||
| 1602 | Ga0495639_0477607 | |||
| 1603 | Ga0495639_0530798 | |||
| 1604 | Ga0495664_0331263 | |||
| 1605 | Ga0495594_0401542 | |||
| 1606 | Ga0495594_0560209 | |||
| 1607 | Ga0495594_0766334 | |||
| 1608 | Ga0495608_0487986 | |||
| 1609 | Ga0495608_0763949 | |||
| 1610 | Ga0495628_0515234 | |||
| 1611 | Ga0495628_1003735 | |||
| 1612 | Ga0495630_0006981 | |||
| 1613 | Ga0495630_0386227 | |||
| 1614 | Ga0495630_0551338 | |||
| 1615 | Ga0495631_0270580 | |||
| 1616 | Ga0495631_0426303 | |||
| 1617 | Ga0495644_0412371 | |||
| 1618 | Ga0495666_0483262 | |||
| 1619 | Ga0495652_0292524 | |||
| 1620 | Ga0495640_0070809 | |||
| 1621 | Ga0495640_0547499 | |||
| 1622 | Ga0495586_0404687 | |||
| 1623 | Ga0495586_0464463 | |||
| 1624 | Ga0495587_0075091 | |||
| 1625 | Ga0495587_0507141 | |||
| 1626 | Ga0495621_0432991 | |||
| 1627 | Ga0495645_0030835 | |||
| 1628 | Ga0495645_0302751 | |||
| 1629 | Ga0495645_0531712 | |||
| 1630 | Ga0495667_0143395 | |||
| 1631 | Ga0495634_0306685 | |||
| 1632 | Ga0495634_0887118 | |||
| 1633 | Ga0495635_0735267 | |||
| 1634 | Ga0495659_0095174 | |||
| 1635 | Ga0495657_0134323 | |||
| 1636 | Ga0495657_0566514 | |||
| 1637 | Ga0495599_0513382 | |||
| 1638 | Ga0495623_0555543 | |||
| 1639 | Ga0495646_0400333 | |||
| 1640 | Ga0495646_0586860 | |||
| 1641 | Ga0495658_0400608 | |||
| 1642 | Ga0495658_0534857 | |||
| 1643 | Ga0495624_0506942 | |||
| 1644 | Ga0495624_0649470 | |||
| 1645 | Ga0495670_0476939 | |||
| 1646 | Ga0495589_0460161 | |||
| 1647 | Ga0495600_0229735 | |||
| 1648 | Ga0495600_0541185 | |||
| 1649 | Ga0495660_0470464 | |||
| 1650 | Ga0495604_0647309 | |||
| 1651 | Ga0495674_0240865 | |||
| 1652 | Ga0495674_0286899 | |||
| 1653 | Ga0495674_0400620 | |||
| 1654 | Ga0495674_0742238 | |||
| 1655 | Ga0495676_0077643 | |||
| 1656 | Ga0495676_0100091 | |||
| 1657 | Ga0495676_0983756 | |||
| 1658 | Ga0495680_1005267 | |||
| 1659 | Ga0495675_0157608 | |||
| 1660 | Ga0495684_0927857 | |||
| 1661 | Ga0495684_0966929 | |||
| 1662 | Ga0495602_0111700 | |||
| 1663 | Ga0496100_0015810 | |||
| 1664 | Ga0496100_0305872 | |||
| 1665 | Ga0496100_0422836 | |||
| 1666 | Ga0496100_1207725 | |||
| 1667 | Ga0496101_0171027 | |||
| 1668 | Ga0496101_0183240 | |||
| 1669 | Ga0496101_0739389 | |||
| 1670 | Ga0496101_1479757 | |||
| 1671 | Ga0496102_0004243 | |||
| 1672 | Ga0496102_0100386 | |||
| 1673 | Ga0496102_0125104 | |||
| 1674 | Ga0496102_0282089 | |||
| 1675 | Ga0496102_0311368 | |||
| 1676 | Ga0496102_1658243 | |||
| 1677 | Ga0496103_0276365 | |||
| 1678 | Ga0496103_0316217 | |||
| 1679 | Ga0496104_0006414 | |||
| 1680 | Ga0496104_0046043 | |||
| 1681 | Ga0496104_0261563 | |||
| 1682 | Ga0496104_0786847 | |||
| 1683 | Ga0496105_0131346 | |||
| 1684 | Ga0496105_0168339 | |||
| 1685 | Ga0496105_1197169 | |||
| 1686 | Ga0496106_0387176 | |||
| 1687 | Ga0496106_0909811 | |||
| 1688 | Ga0496106_1014192 | |||
| 1689 | Ga0496107_0046601 | |||
| 1690 | Ga0496107_0229857 | |||
| 1691 | Ga0496107_0238506 | |||
| 1692 | Ga0496107_0970962 | |||
| 1693 | Ga0496107_1059619 | |||
| 1694 | Ga0496107_1102310 | |||
| 1695 | Ga0496107_1121383 | |||
| 1696 | Ga0496107_1201778 | |||
| 1697 | Ga0496108_0008003 | |||
| 1698 | Ga0496108_0042512 | |||
| 1699 | Ga0496108_0130829 | |||
| 1700 | Ga0496108_0569121 | |||
| 1701 | Ga0496108_0945119 | |||
| 1702 | Ga0496109_0118423 | |||
| 1703 | Ga0496109_0160937 | |||
| 1704 | Ga0496109_0381240 | |||
| 1705 | Ga0496109_0973272 | |||
| 1706 | Ga0496109_1137899 | |||
| 1707 | Ga0496110_0004816 | |||
| 1708 | Ga0496110_0075197 | |||
| 1709 | Ga0496110_0572832 | |||
| 1710 | Ga0496110_0649647 | |||
| 1711 | Ga0496110_0862199 | |||
| 1712 | Ga0496110_0893811 | |||
| 1713 | Ga0496111_0038153 | |||
| 1714 | Ga0496111_0434475 | |||
| 1715 | Ga0496111_0646881 | |||
| 1716 | Ga0496112_0118813 | |||
| 1717 | Ga0496112_0184307 | |||
| 1718 | Ga0496112_0185479 | |||
| 1719 | Ga0496112_0963847 | |||
| 1720 | Ga0496112_1215922 | |||
| 1721 | Ga0496113_0035141 | |||
| 1722 | Ga0496113_0467482 | |||
| 1723 | Ga0496113_1161921 | |||
| 1724 | Ga0496114_0013811 | |||
| 1725 | Ga0496114_0117231 | |||
| 1726 | Ga0496114_0399618 | |||
| 1727 | Ga0496114_1270713 | |||
| 1728 | Ga0496115_0651925 | |||
| 1729 | Ga0501315_093808 | |||
| 1730 | Ga0501031_0086445 | |||
| 1731 | Ga0501031_0108678 | |||
| 1732 | Ga0501032_0069333 | |||
| 1733 | Ga0501032_0431667 | |||
| 1734 | Ga0501032_0583563 | |||
| 1735 | Ga0501033_0291074 | |||
| 1736 | Ga0501034_0186118 | |||
| 1737 | Ga0501034_1634505 | |||
| 1738 | Ga0501036_0088815 | |||
| 1739 | Ga0501036_0153023 | |||
| 1740 | Ga0501036_0253774 | |||
| 1741 | Ga0501036_1259711 | |||
| 1742 | Ga0501036_1550061 | |||
| 1743 | Ga0501037_0064252 | |||
| 1744 | Ga0501037_0163033 | |||
| 1745 | Ga0501037_0322701 | |||
| 1746 | Ga0501038_0123328 | |||
| 1747 | Ga0501038_0159695 | |||
| 1748 | Ga0501038_0479211 | |||
| 1749 | Ga0501038_0524949 | |||
| 1750 | Ga0501038_0623679 | |||
| 1751 | Ga0501039_0124610 | |||
| 1752 | Ga0501039_0172182 | |||
| 1753 | Ga0501039_0349659 | |||
| 1754 | Ga0501039_1032383 | |||
| 1755 | Ga0501039_1083248 | |||
| 1756 | Ga0501040_0128121 | |||
| 1757 | Ga0501040_0181306 | |||
| 1758 | Ga0501040_0926128 | |||
| 1759 | Ga0501041_0145156 | |||
| 1760 | Ga0501041_0537500 | |||
| 1761 | Ga0501042_0120587 | |||
| 1762 | Ga0501042_0168041 | |||
| 1763 | Ga0501042_0356022 | |||
| 1764 | Ga0501042_0503038 | |||
| 1765 | Ga0501042_0662059 | |||
| 1766 | Ga0501042_1325388 | |||
| 1767 | Ga0501043_0176298 | |||
| 1768 | Ga0501043_0749636 | |||
| 1769 | Ga0501046_0007752 | |||
| 1770 | Ga0501046_0279589 | |||
| 1771 | Ga0501048_0063950 | |||
| 1772 | Ga0501048_0141483 | |||
| 1773 | Ga0501048_0231406 | |||
| 1774 | Ga0501048_0295846 | |||
| 1775 | Ga0501067_0055957 | |||
| 1776 | Ga0501067_0126943 | |||
| 1777 | Ga0501068_0009403 | |||
| 1778 | Ga0501068_0039731 | |||
| 1779 | Ga0501068_0254865 | |||
| 1780 | Ga0501068_0418517 | |||
| 1781 | Ga0501068_0442266 | |||
| 1782 | Ga0501068_0959543 | |||
| 1783 | Ga0501069_0012108 | |||
| 1784 | Ga0501069_0118685 | |||
| 1785 | Ga0501069_0123715 | |||
| 1786 | Ga0501069_0135806 | |||
| 1787 | Ga0501069_0515107 | |||
| 1788 | Ga0501069_0626114 | |||
| 1789 | Ga0501069_0796128 | |||
| 1790 | Ga0501070_0170906 | |||
| 1791 | Ga0501070_0907147 | |||
| 1792 | Ga0501071_0067069 | |||
| 1793 | Ga0501071_0182686 | |||
| 1794 | Ga0501071_0350860 | |||
| 1795 | Ga0501071_0731898 | |||
| 1796 | Ga0501072_0023170 | |||
| 1797 | Ga0501072_0368474 | |||
| 1798 | Ga0501072_0854899 | |||
| 1799 | Ga0501072_1093578 | |||
| 1800 | Ga0501072_1442062 | |||
| 1801 | Ga0501073_0420947 | |||
| 1802 | Ga0501073_0774359 | |||
| 1803 | Ga0501073_1183218 | |||
| 1804 | Ga0501074_0186417 | |||
| 1805 | Ga0501074_0607671 | |||
| 1806 | Ga0501074_1254572 | |||
| 1807 | Ga0501075_0018010 | |||
| 1808 | Ga0501075_0067041 | |||
| 1809 | Ga0501075_0125900 | |||
| 1810 | Ga0501075_0136060 | |||
| 1811 | Ga0501075_0192948 | |||
| 1812 | Ga0501075_0449078 | |||
| 1813 | Ga0501076_0011238 | |||
| 1814 | Ga0501076_0063734 | |||
| 1815 | Ga0501076_0080199 | |||
| 1816 | Ga0501076_0116940 | |||
| 1817 | Ga0501076_0266703 | |||
| 1818 | Ga0501076_0951722 | |||
| 1819 | Ga0501076_0993704 | |||
| 1820 | Ga0501076_1596643 | |||
| 1821 | Ga0501077_0119765 | |||
| 1822 | Ga0501077_0157080 | |||
| 1823 | Ga0501077_0164140 | |||
| 1824 | Ga0501077_0507251 | |||
| 1825 | Ga0501221_033115 | |||
| 1826 | Ga0501079_0034303 | |||
| 1827 | Ga0501079_0143303 | |||
| 1828 | Ga0501079_0163957 | |||
| 1829 | Ga0501079_0199026 | |||
| 1830 | Ga0501079_0351313 | |||
| 1831 | Ga0501079_1666735 | |||
| 1832 | Ga0501080_0057581 | |||
| 1833 | Ga0501080_0165807 | |||
| 1834 | Ga0501081_0059639 | |||
| 1835 | Ga0501081_0125954 | |||
| 1836 | Ga0501081_0233372 | |||
| 1837 | Ga0501081_0378574 | |||
| 1838 | Ga0501081_0500955 | |||
| 1839 | Ga0501081_0769716 | |||
| 1840 | Ga0501081_1250495 | |||
| 1841 | Ga0501083_0357529 | |||
| 1842 | Ga0501083_0373258 | |||
| 1843 | Ga0501035_0159320 | |||
| 1844 | Ga0501035_0209258 | |||
| 1845 | Ga0501035_0637404 | |||
| 1846 | Ga0501044_0283527 | |||
| 1847 | Ga0501045_0258310 | |||
| 1848 | Ga0501045_0559334 | |||
| 1849 | nmdc:mga0yw44_107924_c1 | |||
| 1850 | nmdc:mga05p37_14607_c1 | |||
| 1851 | nmdc:mga05p37_340111_c1 | |||
| 1852 | nmdc:mga05p37_382688_c1 | |||
| 1853 | nmdc:mga09592_1394579_c1 | |||
| 1854 | nmdc:mga08y16_165423_c1 | |||
| 1855 | nmdc:mga08y16_255334_c1 | |||
| 1856 | nmdc:mga08y16_813141_c1 | |||
| 1857 | nmdc:mga0n895_161538_c1 | |||
| 1858 | nmdc:mga0n895_325959_c1 | |||
| 1859 | nmdc:mga0rr50_911222_c1 | |||
| 1860 | nmdc:mga0rr50_944229_c1 | |||
| 1861 | nmdc:mga08x19_702875_c1 | |||
| 1862 | nmdc:mga08x19_821432_c1 | |||
| 1863 | nmdc:mga0a205_127472_c1 | |||
| 1864 | nmdc:mga0a205_324810_c1 | |||
| 1865 | nmdc:mga0a205_486173_c1 | |||
| 1866 | Ga0495601_0039144 | |||
| 1867 | Ga0495601_0425973 | |||
| 1868 | Ga0495612_0005172 | |||
| 1869 | Ga0495612_0176618 | |||
| 1870 | Ga0495655_0229762 | |||
| 1871 | Ga0495595_0227434 | |||
| 1872 | Ga0495619_0409863 | |||
| 1873 | Ga0495619_0511555 | |||
| 1874 | Ga0495619_0539844 | |||
| 1875 | Ga0495619_1016899 | |||
| 1876 | Ga0501084_0051538 | |||
| 1877 | Ga0501084_0060076 | |||
| 1878 | Ga0501084_0139877 | |||
| 1879 | Ga0501084_0147032 | |||
| 1880 | Ga0501084_0212179 | |||
| 1881 | Ga0501084_1763774 | |||
| 1882 | Ga0501082_0151976 | |||
| 1883 | Ga0501082_0163758 | |||
| 1884 | Ga0501082_0412563 | |||
| 1885 | Ga0501082_0425888 | |||
| 1886 | Ga0501082_0793686 | |||
| 1887 | Ga0501082_1564653 | |||
| 1888 | Ga0530510_0001918 | |||
| 1889 | Ga0530510_0071743 | |||
| 1890 | Ga0530510_0106674 | |||
| 1891 | Ga0530510_0258340 | |||
| 1892 | Ga0530510_1090276 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7msc-assembly1.cif.gz_p | mtb 70sic in complex with mtbetta at pre_r0 state | 0.9408 | 2 | 79 |
| 5zeb-assembly1.cif.gz_p | m. smegmatis p/p state 70s ribosome structure | 0.9404 | 2 | 79 |
| 7sfr-assembly1.cif.gz_p | unmethylated mtb ribosome 50s with seq-9 | 0.939 | 2 | 79 |
| 8cdv-assembly1.cif.gz_P | rnase r bound to a 30s degradation intermediate (state ii) | 0.9378 | 2 | 79 |
| 8fr8-assembly1.cif.gz_q | structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex | 0.9364 | 2 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ45_1_91_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9236 | 1 | 79 | 3.30.1320.10 |
| af_A0A0R0FN90_1_75_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9154 | 17 | 79 | 3.30.1320.10 |
| af_P56806_1_79_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9121 | 3 | 82 | 3.30.1320.10 |
| af_Q0J0I9_1_104_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9069 | 1 | 80 | 3.30.1320.10 |
| 5x8rp00 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9049 | 3 | 80 | 3.30.1320.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9ENF9-F1-model_v4 | Small ribosomal subunit protein bS16 | 0.9626 | 3 | 79 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |
| AF-A0A6L8JDA5-F1-model_v4 | deleted | 0.9624 | 1 | 79 |
|
| AF-A0A6G0A785-F1-model_v4 | Small ribosomal subunit protein bS16 | 0.9591 | 1 | 79 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |
| AF-A0A6B1B373-F1-model_v4 | Small ribosomal subunit protein bS16 | 0.9589 | 1 | 79 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |
| AF-C7H957-F1-model_v4 | Small ribosomal subunit protein bS16 | 0.9587 | 2 | 80 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |