F486408
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 944 | 416 | 1888 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300042127|Ga0450890_010081|Ga0450890_010081_231_977 |
| Length | 248 |
| Sequence | MRVSARIRHGTAEETTSMEFYHFVVNFFRDGGFFLYPLAAIFVVGVAIAIERFIYLSIETTSNRRLWGQVVPLINAGNFKQVVAITSKSRAAIATVLNYGIARLASARRRDDVEKAMDESLLEIIPRMEKRTHYLSALANIGMLTGLLGTVIGLISAFASIAQANPAEKASLLAASISVAMNNTASGLLCAITLLLAHMFLEAKTTKLIDSLEIAAVKFLNSVVERRQEVDAGDEHPAPRGRTAHGIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 216 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 217 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 218 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 255 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 256 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 257 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 264 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 265 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 272 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 275 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 276 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 277 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 278 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 279 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 280 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 281 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 282 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 283 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 284 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 285 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 286 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 287 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 288 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 289 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 290 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 399 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 402 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 406 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 408 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 410 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 411 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 413 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.65 |
| Nodule | 0.21 |
| Rhizoplane | 4.77 |
| Rhizosphere | 87.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450890_010081 | 3300042127 | Bacteria | 1215 |
| 2 | JGI25406J46586_10008835 | 3300003203 | Bacteria | 4537 |
| 3 | Ga0065704_10004545 | 3300005289 | Bacteria | 4449 |
| 4 | Ga0065712_10077288 | 3300005290 | Bacteria | 3519 |
| 5 | Ga0065712_10125840 | 3300005290 | Unclassified | 1606 |
| 6 | Ga0065712_10188647 | 3300005290 | Bacteria | 1158 |
| 7 | Ga0065715_10095587 | 3300005293 | Bacteria | 4050 |
| 8 | Ga0065707_10084023 | 3300005295 | Bacteria | 7813 |
| 9 | Ga0065707_10085501 | 3300005295 | Bacteria | 6105 |
| 10 | Ga0065707_10109522 | 3300005295 | Bacteria | 2466 |
| 11 | Ga0070683_100109268 | 3300005329 | Unclassified | 2608 |
| 12 | Ga0070690_100000437 | 3300005330 | Bacteria | 21097 |
| 13 | Ga0070690_100002279 | 3300005330 | Bacteria | 10288 |
| 14 | Ga0070690_100002749 | 3300005330 | Bacteria | 9495 |
| 15 | Ga0070670_100130094 | 3300005331 | Unclassified | 2173 |
| 16 | Ga0070670_100243825 | 3300005331 | Bacteria | 1565 |
| 17 | Ga0070677_10163826 | 3300005333 | Bacteria | 1045 |
| 18 | Ga0068869_100028646 | 3300005334 | Bacteria | 3895 |
| 19 | Ga0068869_100038481 | 3300005334 | Unclassified | 3410 |
| 20 | Ga0068869_100112978 | 3300005334 | Bacteria | 2068 |
| 21 | Ga0068869_100127769 | 3300005334 | Bacteria | 1951 |
| 22 | Ga0068869_100181680 | 3300005334 | Bacteria | 1649 |
| 23 | Ga0068869_100345267 | 3300005334 | Bacteria | 1212 |
| 24 | Ga0068869_100466909 | 3300005334 | Bacteria | 1049 |
| 25 | Ga0068869_100631088 | 3300005334 | Unclassified | 908 |
| 26 | Ga0070666_10000825 | 3300005335 | Bacteria | 18805 |
| 27 | Ga0070666_10037127 | 3300005335 | Unclassified | 3238 |
| 28 | Ga0070666_10131731 | 3300005335 | Bacteria | 1738 |
| 29 | Ga0070680_100042749 | 3300005336 | Unclassified | 3678 |
| 30 | Ga0070680_100145663 | 3300005336 | Bacteria | 1987 |
| 31 | Ga0070682_100119573 | 3300005337 | Bacteria | 1766 |
| 32 | Ga0070682_100143291 | 3300005337 | Bacteria | 1631 |
| 33 | Ga0070682_100571473 | 3300005337 | Bacteria | 888 |
| 34 | Ga0068868_100001561 | 3300005338 | Bacteria | 15635 |
| 35 | Ga0068868_100164613 | 3300005338 | Bacteria | 1833 |
| 36 | Ga0068868_100318330 | 3300005338 | Bacteria | 1325 |
| 37 | Ga0070689_100002333 | 3300005340 | Bacteria | 12359 |
| 38 | Ga0070689_100017990 | 3300005340 | Bacteria | 5198 |
| 39 | Ga0070689_100357976 | 3300005340 | Bacteria | 1225 |
| 40 | Ga0070689_100662675 | 3300005340 | Bacteria | 909 |
| 41 | Ga0070691_10054009 | 3300005341 | Bacteria | 1923 |
| 42 | Ga0070691_10275208 | 3300005341 | Bacteria | 911 |
| 43 | Ga0070687_100002779 | 3300005343 | Bacteria | 6652 |
| 44 | Ga0070687_100037251 | 3300005343 | Bacteria | 2430 |
| 45 | Ga0070661_100006843 | 3300005344 | Bacteria | 7860 |
| 46 | Ga0070661_100397443 | 3300005344 | Bacteria | 1089 |
| 47 | Ga0070692_10426255 | 3300005345 | Bacteria | 843 |
| 48 | Ga0070668_100009275 | 3300005347 | Bacteria | 7297 |
| 49 | Ga0070668_100222942 | 3300005347 | Bacteria | 1556 |
| 50 | Ga0070668_100568578 | 3300005347 | Bacteria | 988 |
| 51 | Ga0070669_100043812 | 3300005353 | Bacteria | 3260 |
| 52 | Ga0070669_100089936 | 3300005353 | Bacteria | 2300 |
| 53 | Ga0070669_100124426 | 3300005353 | Bacteria | 1971 |
| 54 | Ga0070675_100001094 | 3300005354 | Bacteria | 19521 |
| 55 | Ga0070675_100410450 | 3300005354 | Bacteria | 1209 |
| 56 | Ga0070675_100559138 | 3300005354 | Bacteria | 1035 |
| 57 | Ga0070675_100599948 | 3300005354 | Bacteria | 998 |
| 58 | Ga0070671_100010657 | 3300005355 | Bacteria | 7378 |
| 59 | Ga0070671_100048018 | 3300005355 | Bacteria | 3549 |
| 60 | Ga0070674_100449309 | 3300005356 | Bacteria | 1063 |
| 61 | Ga0070673_100010863 | 3300005364 | Bacteria | 6189 |
| 62 | Ga0070673_100013882 | 3300005364 | Bacteria | 5591 |
| 63 | Ga0070673_100072075 | 3300005364 | Bacteria | 2777 |
| 64 | Ga0070673_100186562 | 3300005364 | Unclassified | 1778 |
| 65 | Ga0070688_100038936 | 3300005365 | Bacteria | 2907 |
| 66 | Ga0070667_100000116 | 3300005367 | Bacteria | 102137 |
| 67 | Ga0070667_100009226 | 3300005367 | Bacteria | 8170 |
| 68 | Ga0070667_100018866 | 3300005367 | Bacteria | 5719 |
| 69 | Ga0070667_100248024 | 3300005367 | Bacteria | 1591 |
| 70 | Ga0070667_101117844 | 3300005367 | Bacteria | 737 |
| 71 | Ga0070709_10003761 | 3300005434 | Bacteria | 8159 |
| 72 | Ga0070709_10264156 | 3300005434 | Bacteria | 1245 |
| 73 | Ga0070714_100018526 | 3300005435 | Bacteria | 5658 |
| 74 | Ga0070714_100030181 | 3300005435 | Bacteria | 4511 |
| 75 | Ga0070714_100129633 | 3300005435 | Bacteria | 2253 |
| 76 | Ga0070713_100003775 | 3300005436 | Bacteria | 10029 |
| 77 | Ga0070713_100032889 | 3300005436 | Bacteria | 4148 |
| 78 | Ga0070713_100267146 | 3300005436 | Bacteria | 1565 |
| 79 | Ga0070713_100321270 | 3300005436 | Unclassified | 1430 |
| 80 | Ga0070713_100412134 | 3300005436 | Bacteria | 1264 |
| 81 | Ga0070710_10004080 | 3300005437 | Bacteria | 6937 |
| 82 | Ga0070710_10083708 | 3300005437 | Bacteria | 1868 |
| 83 | Ga0070710_10153485 | 3300005437 | Bacteria | 1422 |
| 84 | Ga0070710_10311972 | 3300005437 | Bacteria | 1030 |
| 85 | Ga0070701_10033333 | 3300005438 | Bacteria | 2573 |
| 86 | Ga0070701_10056927 | 3300005438 | Bacteria | 2047 |
| 87 | Ga0070701_10144827 | 3300005438 | Bacteria | 1362 |
| 88 | Ga0070701_10228673 | 3300005438 | Unclassified | 1113 |
| 89 | Ga0070711_100000263 | 3300005439 | Bacteria | 26963 |
| 90 | Ga0070711_100184071 | 3300005439 | Bacteria | 1601 |
| 91 | Ga0070711_100301664 | 3300005439 | Unclassified | 1274 |
| 92 | Ga0070705_100033993 | 3300005440 | Bacteria | 2846 |
| 93 | Ga0070705_100037268 | 3300005440 | Bacteria | 2741 |
| 94 | Ga0070705_100056840 | 3300005440 | Bacteria | 2305 |
| 95 | Ga0070700_100011500 | 3300005441 | Bacteria | 4905 |
| 96 | Ga0070700_100027541 | 3300005441 | Bacteria | 3370 |
| 97 | Ga0070700_100112755 | 3300005441 | Bacteria | 1811 |
| 98 | Ga0070700_100298151 | 3300005441 | Bacteria | 1175 |
| 99 | Ga0070694_100009910 | 3300005444 | Bacteria | 5854 |
| 100 | Ga0070694_100163081 | 3300005444 | Bacteria | 1637 |
| 101 | Ga0070694_100391544 | 3300005444 | Bacteria | 1086 |
| 102 | Ga0070663_100119430 | 3300005455 | Bacteria | 1990 |
| 103 | Ga0070678_100000129 | 3300005456 | Bacteria | 30238 |
| 104 | Ga0070678_100247524 | 3300005456 | Bacteria | 1493 |
| 105 | Ga0070678_100310997 | 3300005456 | Bacteria | 1342 |
| 106 | Ga0070678_100413340 | 3300005456 | Unclassified | 1174 |
| 107 | Ga0070662_100053831 | 3300005457 | Bacteria | 2914 |
| 108 | Ga0070662_100429863 | 3300005457 | Bacteria | 1094 |
| 109 | Ga0070681_10005968 | 3300005458 | Bacteria | 11796 |
| 110 | Ga0070681_10014820 | 3300005458 | Bacteria | 7752 |
| 111 | Ga0070681_10020355 | 3300005458 | Bacteria | 6650 |
| 112 | Ga0070681_10026771 | 3300005458 | Bacteria | 5798 |
| 113 | Ga0070681_10173564 | 3300005458 | Bacteria | 2077 |
| 114 | Ga0070681_10186302 | 3300005458 | Unclassified | 1996 |
| 115 | Ga0068867_100107488 | 3300005459 | Bacteria | 2138 |
| 116 | Ga0068867_100309857 | 3300005459 | Bacteria | 1304 |
| 117 | Ga0070685_10000838 | 3300005466 | Bacteria | 16763 |
| 118 | Ga0070685_10124810 | 3300005466 | Bacteria | 1602 |
| 119 | Ga0070685_10471487 | 3300005466 | Bacteria | 883 |
| 120 | Ga0070698_100087908 | 3300005471 | Bacteria | 3093 |
| 121 | Ga0070699_100065193 | 3300005518 | Bacteria | 3160 |
| 122 | Ga0070679_100012012 | 3300005530 | Bacteria | 8265 |
| 123 | Ga0070679_100022486 | 3300005530 | Bacteria | 6162 |
| 124 | Ga0070679_100061488 | 3300005530 | Unclassified | 3743 |
| 125 | Ga0070679_100150044 | 3300005530 | Unclassified | 2308 |
| 126 | Ga0070679_100399391 | 3300005530 | Bacteria | 1321 |
| 127 | Ga0070684_100003572 | 3300005535 | Bacteria | 11700 |
| 128 | Ga0070684_100025558 | 3300005535 | Unclassified | 4966 |
| 129 | Ga0070684_100190952 | 3300005535 | Bacteria | 1864 |
| 130 | Ga0070684_100903162 | 3300005535 | Bacteria | 827 |
| 131 | Ga0070672_100012307 | 3300005543 | Bacteria | 6000 |
| 132 | Ga0070672_100128316 | 3300005543 | Unclassified | 2082 |
| 133 | Ga0070672_100189866 | 3300005543 | Unclassified | 1715 |
| 134 | Ga0070686_100008668 | 3300005544 | Bacteria | 5698 |
| 135 | Ga0070686_100098261 | 3300005544 | Bacteria | 1972 |
| 136 | Ga0070695_100088224 | 3300005545 | Bacteria | 2065 |
| 137 | Ga0070695_100244501 | 3300005545 | Bacteria | 1303 |
| 138 | Ga0070696_100002775 | 3300005546 | Bacteria | 11624 |
| 139 | Ga0070696_100043730 | 3300005546 | Bacteria | 3100 |
| 140 | Ga0070693_100022003 | 3300005547 | Bacteria | 3384 |
| 141 | Ga0070693_100037104 | 3300005547 | Bacteria | 2715 |
| 142 | Ga0070693_100469419 | 3300005547 | Bacteria | 887 |
| 143 | Ga0070665_100005507 | 3300005548 | Bacteria | 13034 |
| 144 | Ga0070665_100005902 | 3300005548 | Bacteria | 12546 |
| 145 | Ga0070665_100009357 | 3300005548 | Bacteria | 9915 |
| 146 | Ga0070665_100013754 | 3300005548 | Bacteria | 8144 |
| 147 | Ga0070665_100168388 | 3300005548 | Bacteria | 2193 |
| 148 | Ga0070704_100011065 | 3300005549 | Bacteria | 5509 |
| 149 | Ga0068855_100001037 | 3300005563 | Bacteria | 34574 |
| 150 | Ga0068855_100004460 | 3300005563 | Bacteria | 17110 |
| 151 | Ga0068855_100025633 | 3300005563 | Bacteria | 7053 |
| 152 | Ga0070664_100004740 | 3300005564 | Bacteria | 10905 |
| 153 | Ga0070664_100015641 | 3300005564 | Bacteria | 6208 |
| 154 | Ga0068857_100010063 | 3300005577 | Bacteria | 8215 |
| 155 | Ga0068857_100523662 | 3300005577 | Bacteria | 1114 |
| 156 | Ga0068857_100579821 | 3300005577 | Bacteria | 1059 |
| 157 | Ga0068856_100015079 | 3300005614 | Bacteria | 7467 |
| 158 | Ga0068856_100018387 | 3300005614 | Bacteria | 6773 |
| 159 | Ga0068856_100533600 | 3300005614 | Bacteria | 1195 |
| 160 | Ga0070702_100000806 | 3300005615 | Bacteria | 11985 |
| 161 | Ga0070702_100039124 | 3300005615 | Bacteria | 2645 |
| 162 | Ga0070702_100060423 | 3300005615 | Bacteria | 2203 |
| 163 | Ga0068852_100146946 | 3300005616 | Bacteria | 2188 |
| 164 | Ga0068852_100363709 | 3300005616 | Bacteria | 1416 |
| 165 | Ga0068852_100404747 | 3300005616 | Bacteria | 1343 |
| 166 | Ga0068859_100000196 | 3300005617 | Bacteria | 59010 |
| 167 | Ga0068859_100010536 | 3300005617 | Bacteria | 9305 |
| 168 | Ga0068859_100030531 | 3300005617 | Bacteria | 5409 |
| 169 | Ga0068859_100169788 | 3300005617 | Bacteria | 2262 |
| 170 | Ga0068859_100239951 | 3300005617 | Bacteria | 1901 |
| 171 | Ga0068859_100389821 | 3300005617 | Unclassified | 1489 |
| 172 | Ga0068859_100754853 | 3300005617 | Bacteria | 1062 |
| 173 | Ga0068859_100819380 | 3300005617 | Unclassified | 1018 |
| 174 | Ga0068864_100003638 | 3300005618 | Bacteria | 12744 |
| 175 | Ga0068864_100342137 | 3300005618 | Bacteria | 1410 |
| 176 | Ga0068866_10001569 | 3300005718 | Bacteria | 9713 |
| 177 | Ga0068866_10023641 | 3300005718 | Bacteria | 2861 |
| 178 | Ga0068866_10108239 | 3300005718 | Bacteria | 1546 |
| 179 | Ga0068861_100002494 | 3300005719 | Bacteria | 12007 |
| 180 | Ga0068861_100004230 | 3300005719 | Bacteria | 9631 |
| 181 | Ga0068861_100026201 | 3300005719 | Bacteria | 4237 |
| 182 | Ga0068861_100290037 | 3300005719 | Bacteria | 1413 |
| 183 | Ga0068861_100327671 | 3300005719 | Bacteria | 1336 |
| 184 | Ga0068861_100474596 | 3300005719 | Bacteria | 1126 |
| 185 | Ga0068861_100569726 | 3300005719 | Bacteria | 1035 |
| 186 | Ga0068861_100673141 | 3300005719 | Bacteria | 958 |
| 187 | Ga0068870_10130446 | 3300005840 | Bacteria | 1459 |
| 188 | Ga0068870_10276687 | 3300005840 | Bacteria | 1051 |
| 189 | Ga0068863_100001617 | 3300005841 | Bacteria | 22268 |
| 190 | Ga0068863_100005705 | 3300005841 | Bacteria | 12222 |
| 191 | Ga0068863_100230281 | 3300005841 | Bacteria | 1787 |
| 192 | Ga0068858_100004518 | 3300005842 | Bacteria | 13641 |
| 193 | Ga0068858_100006646 | 3300005842 | Bacteria | 11246 |
| 194 | Ga0068858_100007638 | 3300005842 | Bacteria | 10445 |
| 195 | Ga0068858_100290660 | 3300005842 | Bacteria | 1558 |
| 196 | Ga0068858_100330101 | 3300005842 | Bacteria | 1459 |
| 197 | Ga0068858_100332826 | 3300005842 | Bacteria | 1452 |
| 198 | Ga0068858_100578836 | 3300005842 | Bacteria | 1088 |
| 199 | Ga0068858_100643611 | 3300005842 | Bacteria | 1030 |
| 200 | Ga0068858_100697456 | 3300005842 | Bacteria | 988 |
| 201 | Ga0068860_100005516 | 3300005843 | Bacteria | 12806 |
| 202 | Ga0068860_100006186 | 3300005843 | Bacteria | 12043 |
| 203 | Ga0068860_100039434 | 3300005843 | Bacteria | 4518 |
| 204 | Ga0068860_100265949 | 3300005843 | Bacteria | 1672 |
| 205 | Ga0068860_100360396 | 3300005843 | Unclassified | 1432 |
| 206 | Ga0068860_100650719 | 3300005843 | Bacteria | 1062 |
| 207 | Ga0068862_100002447 | 3300005844 | Bacteria | 16471 |
| 208 | Ga0068862_100045778 | 3300005844 | Bacteria | 3733 |
| 209 | Ga0068862_100153540 | 3300005844 | Bacteria | 2050 |
| 210 | Ga0068862_100210437 | 3300005844 | Bacteria | 1757 |
| 211 | Ga0068862_100331576 | 3300005844 | Bacteria | 1407 |
| 212 | Ga0081455_10000057 | 3300005937 | Bacteria | 119751 |
| 213 | Ga0081455_10007780 | 3300005937 | Bacteria | 11234 |
| 214 | Ga0081538_10152088 | 3300005981 | Bacteria | 1046 |
| 215 | Ga0081540_1024941 | 3300005983 | Bacteria | 3456 |
| 216 | Ga0081539_10000038 | 3300005985 | Bacteria | 296079 |
| 217 | Ga0070717_10001180 | 3300006028 | Bacteria | 17675 |
| 218 | Ga0070715_10006658 | 3300006163 | Bacteria | 3942 |
| 219 | Ga0070715_10102026 | 3300006163 | Bacteria | 1340 |
| 220 | Ga0070716_100027399 | 3300006173 | Bacteria | 3061 |
| 221 | Ga0070712_100006678 | 3300006175 | Bacteria | 7170 |
| 222 | Ga0070712_100070870 | 3300006175 | Bacteria | 2492 |
| 223 | Ga0097621_100012611 | 3300006237 | Bacteria | 6271 |
| 224 | Ga0097621_100088595 | 3300006237 | Bacteria | 2586 |
| 225 | Ga0097621_100136346 | 3300006237 | Bacteria | 2093 |
| 226 | Ga0097621_100146289 | 3300006237 | Bacteria | 2023 |
| 227 | Ga0097621_100280060 | 3300006237 | Bacteria | 1468 |
| 228 | Ga0068871_100023046 | 3300006358 | Bacteria | 4808 |
| 229 | Ga0068871_100035627 | 3300006358 | Bacteria | 3956 |
| 230 | Ga0068871_100112934 | 3300006358 | Bacteria | 2287 |
| 231 | Ga0068871_100555598 | 3300006358 | Bacteria | 1040 |
| 232 | Ga0075428_100002803 | 3300006844 | Bacteria | 18969 |
| 233 | Ga0075428_100002930 | 3300006844 | Bacteria | 18602 |
| 234 | Ga0075428_100525214 | 3300006844 | Bacteria | 1266 |
| 235 | Ga0075428_100985824 | 3300006844 | Bacteria | 892 |
| 236 | Ga0075430_100001231 | 3300006846 | Bacteria | 20603 |
| 237 | Ga0075430_100199497 | 3300006846 | Bacteria | 1662 |
| 238 | Ga0075430_100256577 | 3300006846 | Unclassified | 1448 |
| 239 | Ga0075431_100000015 | 3300006847 | Bacteria | 85838 |
| 240 | Ga0075431_100004022 | 3300006847 | Bacteria | 14330 |
| 241 | Ga0075431_100189046 | 3300006847 | Bacteria | 2110 |
| 242 | Ga0075431_100366586 | 3300006847 | Bacteria | 1446 |
| 243 | Ga0075433_10000413 | 3300006852 | Bacteria | 27217 |
| 244 | Ga0075433_10719423 | 3300006852 | Unclassified | 874 |
| 245 | Ga0075434_100000289 | 3300006871 | Bacteria | 35759 |
| 246 | Ga0075434_100416609 | 3300006871 | Bacteria | 1364 |
| 247 | Ga0075429_100001559 | 3300006880 | Bacteria | 18833 |
| 248 | Ga0075429_100312178 | 3300006880 | Bacteria | 1376 |
| 249 | Ga0068865_100070116 | 3300006881 | Bacteria | 2483 |
| 250 | Ga0068865_100070351 | 3300006881 | Bacteria | 2479 |
| 251 | Ga0068865_100102271 | 3300006881 | Bacteria | 2100 |
| 252 | Ga0068865_100113016 | 3300006881 | Unclassified | 2007 |
| 253 | Ga0075436_100201194 | 3300006914 | Bacteria | 1411 |
| 254 | Ga0097620_100000196 | 3300006931 | Bacteria | 59010 |
| 255 | Ga0097620_100010536 | 3300006931 | Bacteria | 9305 |
| 256 | Ga0097620_100030531 | 3300006931 | Bacteria | 5409 |
| 257 | Ga0097620_100169786 | 3300006931 | Bacteria | 2262 |
| 258 | Ga0097620_100239961 | 3300006931 | Bacteria | 1901 |
| 259 | Ga0097620_100389821 | 3300006931 | Unclassified | 1489 |
| 260 | Ga0097620_100754854 | 3300006931 | Bacteria | 1062 |
| 261 | Ga0097620_100819324 | 3300006931 | Unclassified | 1018 |
| 262 | Ga0099826_10037321 | 3300006948 | Unclassified | 3425 |
| 263 | Ga0075435_100050996 | 3300007076 | Bacteria | 3332 |
| 264 | Ga0099795_10000136 | 3300007788 | Bacteria | 12084 |
| 265 | Ga0099795_10031558 | 3300007788 | Bacteria | 1825 |
| 266 | Ga0099795_10056557 | 3300007788 | Bacteria | 1443 |
| 267 | Ga0105250_10000006 | 3300009092 | Bacteria | 390071 |
| 268 | Ga0105250_10075354 | 3300009092 | Bacteria | 1365 |
| 269 | Ga0105250_10089984 | 3300009092 | Bacteria | 1247 |
| 270 | Ga0105240_10001059 | 3300009093 | Bacteria | 48690 |
| 271 | Ga0105240_10002425 | 3300009093 | Bacteria | 29968 |
| 272 | Ga0105240_10148269 | 3300009093 | Bacteria | 2797 |
| 273 | Ga0105240_10259107 | 3300009093 | Bacteria | 2007 |
| 274 | Ga0105240_10378024 | 3300009093 | Bacteria | 1600 |
| 275 | Ga0105240_10536954 | 3300009093 | Bacteria | 1296 |
| 276 | Ga0111539_10003339 | 3300009094 | Bacteria | 21193 |
| 277 | Ga0111539_10034262 | 3300009094 | Bacteria | 6160 |
| 278 | Ga0111539_10054228 | 3300009094 | Bacteria | 4770 |
| 279 | Ga0111539_10588316 | 3300009094 | Bacteria | 1296 |
| 280 | Ga0111539_10826653 | 3300009094 | Bacteria | 1078 |
| 281 | Ga0105245_10011723 | 3300009098 | Bacteria | 7628 |
| 282 | Ga0105245_10301345 | 3300009098 | Bacteria | 1573 |
| 283 | Ga0105245_10541640 | 3300009098 | Bacteria | 1185 |
| 284 | Ga0105245_10882194 | 3300009098 | Bacteria | 936 |
| 285 | Ga0105247_10000558 | 3300009101 | Bacteria | 30299 |
| 286 | Ga0105247_10007392 | 3300009101 | Bacteria | 6744 |
| 287 | Ga0105247_10029035 | 3300009101 | Bacteria | 3349 |
| 288 | Ga0105247_10426175 | 3300009101 | Bacteria | 951 |
| 289 | Ga0114129_10000147 | 3300009147 | Bacteria | 74181 |
| 290 | Ga0114129_10012362 | 3300009147 | Bacteria | 12152 |
| 291 | Ga0114129_10352535 | 3300009147 | Bacteria | 1949 |
| 292 | Ga0105243_10056100 | 3300009148 | Bacteria | 3131 |
| 293 | Ga0105241_10105262 | 3300009174 | Unclassified | 2250 |
| 294 | Ga0105241_10119362 | 3300009174 | Viruses | 2121 |
| 295 | Ga0105241_10135191 | 3300009174 | Bacteria | 2001 |
| 296 | Ga0105241_11212498 | 3300009174 | Bacteria | 715 |
| 297 | Ga0105242_10001505 | 3300009176 | Bacteria | 18312 |
| 298 | Ga0105242_10051581 | 3300009176 | Bacteria | 3353 |
| 299 | Ga0105242_10511764 | 3300009176 | Bacteria | 1144 |
| 300 | Ga0105242_10661451 | 3300009176 | Bacteria | 1017 |
| 301 | Ga0105248_10010045 | 3300009177 | Bacteria | 10424 |
| 302 | Ga0105248_10010440 | 3300009177 | Bacteria | 10229 |
| 303 | Ga0105248_10011023 | 3300009177 | Bacteria | 9971 |
| 304 | Ga0105248_10064643 | 3300009177 | Bacteria | 4107 |
| 305 | Ga0105248_10109384 | 3300009177 | Bacteria | 3116 |
| 306 | Ga0105248_10494946 | 3300009177 | Bacteria | 1378 |
| 307 | Ga0105248_11045535 | 3300009177 | Bacteria | 923 |
| 308 | Ga0105237_10048217 | 3300009545 | Bacteria | 4281 |
| 309 | Ga0105237_10257101 | 3300009545 | Bacteria | 1749 |
| 310 | Ga0105237_10324379 | 3300009545 | Bacteria | 1544 |
| 311 | Ga0105237_10734826 | 3300009545 | Unclassified | 993 |
| 312 | Ga0105238_10000966 | 3300009551 | Bacteria | 29470 |
| 313 | Ga0105238_10104264 | 3300009551 | Bacteria | 2817 |
| 314 | Ga0105238_10111586 | 3300009551 | Unclassified | 2714 |
| 315 | Ga0105238_10208142 | 3300009551 | Unclassified | 1932 |
| 316 | Ga0105238_10940450 | 3300009551 | Bacteria | 884 |
| 317 | Ga0105249_10015712 | 3300009553 | Bacteria | 6704 |
| 318 | Ga0105249_10152038 | 3300009553 | Bacteria | 2229 |
| 319 | Ga0105249_10353188 | 3300009553 | Unclassified | 1490 |
| 320 | Ga0099796_10000573 | 3300010159 | Bacteria | 6338 |
| 321 | Ga0099796_10056617 | 3300010159 | Unclassified | 1376 |
| 322 | Ga0105239_10019609 | 3300010375 | Bacteria | 7464 |
| 323 | Ga0105239_10031025 | 3300010375 | Bacteria | 5880 |
| 324 | Ga0105239_10250767 | 3300010375 | Unclassified | 1988 |
| 325 | Ga0105239_10521546 | 3300010375 | Bacteria | 1352 |
| 326 | Ga0105239_10550924 | 3300010375 | Bacteria | 1313 |
| 327 | Ga0105239_10806530 | 3300010375 | Bacteria | 1076 |
| 328 | Ga0105246_10152178 | 3300011119 | Bacteria | 1752 |
| 329 | Ga0105246_10358051 | 3300011119 | Bacteria | 1198 |
| 330 | Ga0157373_10154910 | 3300013100 | Bacteria | 1612 |
| 331 | Ga0157370_10004643 | 3300013104 | Bacteria | 15700 |
| 332 | Ga0157369_10148671 | 3300013105 | Unclassified | 2476 |
| 333 | Ga0157369_10175295 | 3300013105 | Bacteria | 2258 |
| 334 | Ga0157369_10203429 | 3300013105 | Unclassified | 2078 |
| 335 | Ga0157369_10957828 | 3300013105 | Bacteria | 877 |
| 336 | Ga0157374_10001326 | 3300013296 | Bacteria | 21038 |
| 337 | Ga0157374_10082079 | 3300013296 | Bacteria | 3060 |
| 338 | Ga0157374_10212342 | 3300013296 | Bacteria | 1898 |
| 339 | Ga0157374_10287270 | 3300013296 | Bacteria | 1625 |
| 340 | Ga0157378_10001014 | 3300013297 | Bacteria | 25676 |
| 341 | Ga0163162_10004789 | 3300013306 | Bacteria | 13062 |
| 342 | Ga0163162_10034437 | 3300013306 | Bacteria | 5040 |
| 343 | Ga0163162_10094887 | 3300013306 | Bacteria | 3069 |
| 344 | Ga0157372_10512868 | 3300013307 | Bacteria | 1398 |
| 345 | Ga0157372_10527579 | 3300013307 | Unclassified | 1376 |
| 346 | Ga0157372_10693658 | 3300013307 | Bacteria | 1185 |
| 347 | Ga0157375_10007164 | 3300013308 | Bacteria | 9747 |
| 348 | Ga0157375_10046996 | 3300013308 | Bacteria | 4212 |
| 349 | Ga0157375_10062319 | 3300013308 | Bacteria | 3705 |
| 350 | Ga0157375_10625998 | 3300013308 | Bacteria | 1234 |
| 351 | Ga0157375_10956488 | 3300013308 | Bacteria | 998 |
| 352 | Ga0157375_11030877 | 3300013308 | Unclassified | 961 |
| 353 | Ga0163163_10002283 | 3300014325 | Bacteria | 16167 |
| 354 | Ga0163163_10182766 | 3300014325 | Bacteria | 2144 |
| 355 | Ga0163163_10253750 | 3300014325 | Bacteria | 1810 |
| 356 | Ga0163163_10417531 | 3300014325 | Unclassified | 1400 |
| 357 | Ga0163163_10850410 | 3300014325 | Bacteria | 976 |
| 358 | Ga0163163_11043974 | 3300014325 | Bacteria | 880 |
| 359 | Ga0157380_10000564 | 3300014326 | Bacteria | 22772 |
| 360 | Ga0157380_10004485 | 3300014326 | Bacteria | 9675 |
| 361 | Ga0157380_10049861 | 3300014326 | Bacteria | 3304 |
| 362 | Ga0157380_10395023 | 3300014326 | Bacteria | 1310 |
| 363 | Ga0157380_10690312 | 3300014326 | Unclassified | 1024 |
| 364 | Ga0157379_10007290 | 3300014968 | Bacteria | 9573 |
| 365 | Ga0157379_10179704 | 3300014968 | Bacteria | 1911 |
| 366 | Ga0157379_10186075 | 3300014968 | Bacteria | 1877 |
| 367 | Ga0157376_10087877 | 3300014969 | Bacteria | 2683 |
| 368 | Ga0157376_10088985 | 3300014969 | Bacteria | 2669 |
| 369 | Ga0157376_10134875 | 3300014969 | Bacteria | 2208 |
| 370 | Ga0157376_10303922 | 3300014969 | Bacteria | 1511 |
| 371 | Ga0163161_10094961 | 3300017792 | Unclassified | 2211 |
| 372 | Ga0163161_10190472 | 3300017792 | Bacteria | 1577 |
| 373 | Ga0163161_10311968 | 3300017792 | Bacteria | 1241 |
| 374 | Ga0206352_10606286 | 3300020078 | Bacteria | 1182 |
| 375 | Ga0206354_10982706 | 3300020081 | Bacteria | 1176 |
| 376 | Ga0213873_10034400 | 3300021358 | Bacteria | 1277 |
| 377 | Ga0213872_10217657 | 3300021361 | Bacteria | 814 |
| 378 | Ga0213874_10008195 | 3300021377 | Bacteria | 2539 |
| 379 | Ga0213876_10025709 | 3300021384 | Bacteria | 3105 |
| 380 | Ga0213871_10047548 | 3300021441 | Bacteria | 1167 |
| 381 | Ga0224712_10089782 | 3300022467 | Bacteria | 1285 |
| 382 | Ga0207696_1000233 | 3300025711 | Bacteria | 77984 |
| 383 | Ga0207682_10016743 | 3300025893 | Bacteria | 2860 |
| 384 | Ga0207682_10154025 | 3300025893 | Unclassified | 1038 |
| 385 | Ga0207682_10220271 | 3300025893 | Bacteria | 877 |
| 386 | Ga0207692_10274734 | 3300025898 | Bacteria | 1017 |
| 387 | Ga0207642_10104614 | 3300025899 | Bacteria | 1429 |
| 388 | Ga0207642_10114923 | 3300025899 | Bacteria | 1378 |
| 389 | Ga0207710_10000134 | 3300025900 | Bacteria | 87269 |
| 390 | Ga0207688_10011204 | 3300025901 | Bacteria | 4881 |
| 391 | Ga0207688_10089417 | 3300025901 | Bacteria | 1767 |
| 392 | Ga0207680_10022394 | 3300025903 | Bacteria | 3435 |
| 393 | Ga0207680_10044186 | 3300025903 | Bacteria | 2618 |
| 394 | Ga0207680_10094026 | 3300025903 | Bacteria | 1913 |
| 395 | Ga0207685_10056257 | 3300025905 | Bacteria | 1539 |
| 396 | Ga0207685_10056342 | 3300025905 | Bacteria | 1538 |
| 397 | Ga0207699_10006505 | 3300025906 | Bacteria | 5664 |
| 398 | Ga0207699_10068219 | 3300025906 | Bacteria | 2165 |
| 399 | Ga0207699_10129750 | 3300025906 | Bacteria | 1643 |
| 400 | Ga0207645_10021062 | 3300025907 | Bacteria | 4256 |
| 401 | Ga0207643_10023419 | 3300025908 | Bacteria | 3404 |
| 402 | Ga0207643_10081320 | 3300025908 | Bacteria | 1878 |
| 403 | Ga0207654_10073944 | 3300025911 | Viruses | 2033 |
| 404 | Ga0207654_10141750 | 3300025911 | Bacteria | 1534 |
| 405 | Ga0207707_10001543 | 3300025912 | Bacteria | 21211 |
| 406 | Ga0207707_10003173 | 3300025912 | Bacteria | 14592 |
| 407 | Ga0207707_10028857 | 3300025912 | Bacteria | 4849 |
| 408 | Ga0207707_10051661 | 3300025912 | Bacteria | 3580 |
| 409 | Ga0207707_10088373 | 3300025912 | Bacteria | 2707 |
| 410 | Ga0207707_10212549 | 3300025912 | Unclassified | 1685 |
| 411 | Ga0207695_10016760 | 3300025913 | Bacteria | 8555 |
| 412 | Ga0207695_10019323 | 3300025913 | Bacteria | 7846 |
| 413 | Ga0207695_10056194 | 3300025913 | Bacteria | 4097 |
| 414 | Ga0207695_10083519 | 3300025913 | Bacteria | 3226 |
| 415 | Ga0207695_10272462 | 3300025913 | Unclassified | 1588 |
| 416 | Ga0207695_10518111 | 3300025913 | Bacteria | 1074 |
| 417 | Ga0207671_10085610 | 3300025914 | Bacteria | 2369 |
| 418 | Ga0207671_10111624 | 3300025914 | Bacteria | 2080 |
| 419 | Ga0207671_10422539 | 3300025914 | Unclassified | 1060 |
| 420 | Ga0207693_10000060 | 3300025915 | Bacteria | 93715 |
| 421 | Ga0207693_10150327 | 3300025915 | Bacteria | 1831 |
| 422 | Ga0207663_10039149 | 3300025916 | Bacteria | 2871 |
| 423 | Ga0207663_10112541 | 3300025916 | Bacteria | 1849 |
| 424 | Ga0207663_10196252 | 3300025916 | Bacteria | 1453 |
| 425 | Ga0207663_10352115 | 3300025916 | Bacteria | 1115 |
| 426 | Ga0207663_10439002 | 3300025916 | Bacteria | 1005 |
| 427 | Ga0207660_10008463 | 3300025917 | Bacteria | 6655 |
| 428 | Ga0207660_10081294 | 3300025917 | Bacteria | 2381 |
| 429 | Ga0207662_10001837 | 3300025918 | Bacteria | 10436 |
| 430 | Ga0207662_10021449 | 3300025918 | Bacteria | 3693 |
| 431 | Ga0207662_10153545 | 3300025918 | Bacteria | 1466 |
| 432 | Ga0207657_10183600 | 3300025919 | Unclassified | 1690 |
| 433 | Ga0207657_10199272 | 3300025919 | Unclassified | 1611 |
| 434 | Ga0207649_10003228 | 3300025920 | Bacteria | 8933 |
| 435 | Ga0207652_10004353 | 3300025921 | Bacteria | 11541 |
| 436 | Ga0207652_10010556 | 3300025921 | Bacteria | 7434 |
| 437 | Ga0207652_10015264 | 3300025921 | Bacteria | 6234 |
| 438 | Ga0207652_10088628 | 3300025921 | Bacteria | 2715 |
| 439 | Ga0207652_10411630 | 3300025921 | Bacteria | 1220 |
| 440 | Ga0207652_10432539 | 3300025921 | Bacteria | 1187 |
| 441 | Ga0207681_10005399 | 3300025923 | Bacteria | 7850 |
| 442 | Ga0207681_10008472 | 3300025923 | Bacteria | 6284 |
| 443 | Ga0207681_10108548 | 3300025923 | Bacteria | 2015 |
| 444 | Ga0207694_10007297 | 3300025924 | Bacteria | 8388 |
| 445 | Ga0207694_10090347 | 3300025924 | Bacteria | 2416 |
| 446 | Ga0207694_10129750 | 3300025924 | Unclassified | 2020 |
| 447 | Ga0207694_10475975 | 3300025924 | Bacteria | 1044 |
| 448 | Ga0207694_10494674 | 3300025924 | Bacteria | 1024 |
| 449 | Ga0207694_10516337 | 3300025924 | Bacteria | 1001 |
| 450 | Ga0207650_10218765 | 3300025925 | Unclassified | 1532 |
| 451 | Ga0207659_10007724 | 3300025926 | Bacteria | 6638 |
| 452 | Ga0207659_10128001 | 3300025926 | Bacteria | 1955 |
| 453 | Ga0207687_10020018 | 3300025927 | Bacteria | 4438 |
| 454 | Ga0207687_10249586 | 3300025927 | Bacteria | 1410 |
| 455 | Ga0207700_10178543 | 3300025928 | Bacteria | 1776 |
| 456 | Ga0207700_10338562 | 3300025928 | Bacteria | 1307 |
| 457 | Ga0207664_10026898 | 3300025929 | Bacteria | 4354 |
| 458 | Ga0207664_10119366 | 3300025929 | Bacteria | 2205 |
| 459 | Ga0207664_10166820 | 3300025929 | Bacteria | 1882 |
| 460 | Ga0207664_10486794 | 3300025929 | Bacteria | 1104 |
| 461 | Ga0207644_10005621 | 3300025931 | Bacteria | 8166 |
| 462 | Ga0207644_10028162 | 3300025931 | Bacteria | 3886 |
| 463 | Ga0207644_10108544 | 3300025931 | Bacteria | 2095 |
| 464 | Ga0207644_10545815 | 3300025931 | Bacteria | 959 |
| 465 | Ga0207706_10063149 | 3300025933 | Bacteria | 3261 |
| 466 | Ga0207706_10221399 | 3300025933 | Unclassified | 1657 |
| 467 | Ga0207686_10029965 | 3300025934 | Bacteria | 3216 |
| 468 | Ga0207686_10174231 | 3300025934 | Bacteria | 1520 |
| 469 | Ga0207709_10058782 | 3300025935 | Bacteria | 2391 |
| 470 | Ga0207709_10089429 | 3300025935 | Bacteria | 2008 |
| 471 | Ga0207670_10001069 | 3300025936 | Bacteria | 14430 |
| 472 | Ga0207670_10007447 | 3300025936 | Bacteria | 6108 |
| 473 | Ga0207669_10121798 | 3300025937 | Bacteria | 1772 |
| 474 | Ga0207704_10035222 | 3300025938 | Bacteria | 2866 |
| 475 | Ga0207704_10035590 | 3300025938 | Unclassified | 2855 |
| 476 | Ga0207704_10104958 | 3300025938 | Bacteria | 1894 |
| 477 | Ga0207665_10106806 | 3300025939 | Bacteria | 1962 |
| 478 | Ga0207665_10129106 | 3300025939 | Unclassified | 1792 |
| 479 | Ga0207691_10041098 | 3300025940 | Bacteria | 4271 |
| 480 | Ga0207691_10054401 | 3300025940 | Unclassified | 3651 |
| 481 | Ga0207691_10092622 | 3300025940 | Bacteria | 2706 |
| 482 | Ga0207691_10349931 | 3300025940 | Bacteria | 1264 |
| 483 | Ga0207691_10374239 | 3300025940 | Unclassified | 1216 |
| 484 | Ga0207711_10021029 | 3300025941 | Bacteria | 5449 |
| 485 | Ga0207711_10033562 | 3300025941 | Bacteria | 4344 |
| 486 | Ga0207689_10003184 | 3300025942 | Bacteria | 15054 |
| 487 | Ga0207689_10005643 | 3300025942 | Bacteria | 11149 |
| 488 | Ga0207689_10034667 | 3300025942 | Bacteria | 4191 |
| 489 | Ga0207689_10058002 | 3300025942 | Unclassified | 3184 |
| 490 | Ga0207689_10102823 | 3300025942 | Bacteria | 2347 |
| 491 | Ga0207689_10608249 | 3300025942 | Unclassified | 920 |
| 492 | Ga0207661_10152182 | 3300025944 | Unclassified | 2000 |
| 493 | Ga0207679_10004338 | 3300025945 | Bacteria | 8821 |
| 494 | Ga0207667_10016427 | 3300025949 | Bacteria | 8367 |
| 495 | Ga0207667_10058510 | 3300025949 | Bacteria | 4041 |
| 496 | Ga0207667_10100314 | 3300025949 | Unclassified | 2986 |
| 497 | Ga0207651_10011314 | 3300025960 | Bacteria | 4991 |
| 498 | Ga0207651_10194290 | 3300025960 | Bacteria | 1621 |
| 499 | Ga0207712_10028335 | 3300025961 | Bacteria | 3745 |
| 500 | Ga0207712_10088051 | 3300025961 | Bacteria | 2279 |
| 501 | Ga0207712_10214280 | 3300025961 | Bacteria | 1536 |
| 502 | Ga0207668_10006314 | 3300025972 | Bacteria | 7007 |
| 503 | Ga0207668_10062012 | 3300025972 | Bacteria | 2632 |
| 504 | Ga0207668_10417258 | 3300025972 | Bacteria | 1138 |
| 505 | Ga0207640_10228084 | 3300025981 | Bacteria | 1431 |
| 506 | Ga0207658_10000746 | 3300025986 | Bacteria | 27992 |
| 507 | Ga0207658_10035725 | 3300025986 | Bacteria | 3560 |
| 508 | Ga0207658_10080406 | 3300025986 | Bacteria | 2496 |
| 509 | Ga0207677_10307895 | 3300026023 | Bacteria | 1311 |
| 510 | Ga0207677_10394144 | 3300026023 | Bacteria | 1172 |
| 511 | Ga0207703_10006491 | 3300026035 | Bacteria | 9337 |
| 512 | Ga0207703_10023005 | 3300026035 | Bacteria | 4892 |
| 513 | Ga0207703_10273757 | 3300026035 | Bacteria | 1531 |
| 514 | Ga0207703_10325660 | 3300026035 | Bacteria | 1408 |
| 515 | Ga0207678_10117262 | 3300026067 | Bacteria | 2272 |
| 516 | Ga0207678_10186751 | 3300026067 | Bacteria | 1771 |
| 517 | Ga0207678_10491082 | 3300026067 | Unclassified | 1070 |
| 518 | Ga0207708_10002930 | 3300026075 | Bacteria | 12576 |
| 519 | Ga0207708_10019921 | 3300026075 | Bacteria | 5057 |
| 520 | Ga0207708_10052608 | 3300026075 | Bacteria | 3101 |
| 521 | Ga0207702_10468499 | 3300026078 | Unclassified | 1224 |
| 522 | Ga0207641_10020854 | 3300026088 | Bacteria | 5386 |
| 523 | Ga0207641_10032206 | 3300026088 | Bacteria | 4352 |
| 524 | Ga0207641_10080947 | 3300026088 | Bacteria | 2819 |
| 525 | Ga0207641_10124033 | 3300026088 | Bacteria | 2309 |
| 526 | Ga0207641_10220871 | 3300026088 | Bacteria | 1757 |
| 527 | Ga0207648_10033506 | 3300026089 | Bacteria | 4531 |
| 528 | Ga0207648_10056227 | 3300026089 | Bacteria | 3435 |
| 529 | Ga0207648_10062537 | 3300026089 | Bacteria | 3245 |
| 530 | Ga0207648_10195170 | 3300026089 | Bacteria | 1795 |
| 531 | Ga0207648_10235027 | 3300026089 | Bacteria | 1631 |
| 532 | Ga0207676_10030831 | 3300026095 | Bacteria | 4028 |
| 533 | Ga0207676_10054459 | 3300026095 | Bacteria | 3135 |
| 534 | Ga0207674_10002937 | 3300026116 | Bacteria | 21181 |
| 535 | Ga0207674_10044200 | 3300026116 | Bacteria | 4589 |
| 536 | Ga0207674_10136730 | 3300026116 | Bacteria | 2412 |
| 537 | Ga0207674_10444513 | 3300026116 | Bacteria | 1253 |
| 538 | Ga0207675_100012082 | 3300026118 | Bacteria | 8068 |
| 539 | Ga0207675_100014060 | 3300026118 | Bacteria | 7464 |
| 540 | Ga0207675_100039748 | 3300026118 | Bacteria | 4390 |
| 541 | Ga0207675_100071244 | 3300026118 | Bacteria | 3249 |
| 542 | Ga0207675_100073376 | 3300026118 | Bacteria | 3202 |
| 543 | Ga0207675_100169855 | 3300026118 | Bacteria | 2084 |
| 544 | Ga0207675_100184546 | 3300026118 | Unclassified | 1999 |
| 545 | Ga0207683_10000725 | 3300026121 | Bacteria | 29989 |
| 546 | Ga0207683_10016355 | 3300026121 | Bacteria | 6315 |
| 547 | Ga0207683_10098606 | 3300026121 | Bacteria | 2607 |
| 548 | Ga0207698_10353178 | 3300026142 | Bacteria | 1389 |
| 549 | Ga0207698_10441365 | 3300026142 | Bacteria | 1254 |
| 550 | Ga0207698_10546310 | 3300026142 | Bacteria | 1135 |
| 551 | Ga0209996_1027205 | 3300027395 | Bacteria | 822 |
| 552 | Ga0209179_1004192 | 3300027512 | Unclassified | 2157 |
| 553 | Ga0209968_1014943 | 3300027526 | Bacteria | 1225 |
| 554 | Ga0209970_1006836 | 3300027614 | Bacteria | 1873 |
| 555 | Ga0209983_1022019 | 3300027665 | Bacteria | 1334 |
| 556 | Ga0209282_1124346 | 3300027666 | Unclassified | 1285 |
| 557 | Ga0209588_1006407 | 3300027671 | Unclassified | 3419 |
| 558 | Ga0209971_1024572 | 3300027682 | Bacteria | 1439 |
| 559 | Ga0207428_10003346 | 3300027907 | Bacteria | 15583 |
| 560 | Ga0207428_10010873 | 3300027907 | Bacteria | 8104 |
| 561 | Ga0207428_10029673 | 3300027907 | Bacteria | 4529 |
| 562 | Ga0207428_10072216 | 3300027907 | Bacteria | 2709 |
| 563 | Ga0265354_1000452 | 3300028016 | Bacteria | 7122 |
| 564 | Ga0268266_10000379 | 3300028379 | Bacteria | 67802 |
| 565 | Ga0268266_10012525 | 3300028379 | Bacteria | 7329 |
| 566 | Ga0268266_10028183 | 3300028379 | Bacteria | 4775 |
| 567 | Ga0268266_10059617 | 3300028379 | Unclassified | 3288 |
| 568 | Ga0268266_10088237 | 3300028379 | Bacteria | 2714 |
| 569 | Ga0268266_10141977 | 3300028379 | Bacteria | 2156 |
| 570 | Ga0268265_10001420 | 3300028380 | Bacteria | 20275 |
| 571 | Ga0268265_10003956 | 3300028380 | Bacteria | 10438 |
| 572 | Ga0268265_10201552 | 3300028380 | Bacteria | 1727 |
| 573 | Ga0268265_10207141 | 3300028380 | Bacteria | 1706 |
| 574 | Ga0268265_10324277 | 3300028380 | Bacteria | 1396 |
| 575 | Ga0268265_10697643 | 3300028380 | Bacteria | 980 |
| 576 | Ga0268264_10100553 | 3300028381 | Bacteria | 2512 |
| 577 | Ga0268264_10219637 | 3300028381 | Bacteria | 1749 |
| 578 | Ga0265336_10062451 | 3300028666 | Unclassified | 1117 |
| 579 | Ga0265338_10577724 | 3300028800 | Bacteria | 784 |
| 580 | Ga0307511_10000205 | 3300030521 | Bacteria | 59754 |
| 581 | Ga0265771_1000877 | 3300031010 | Bacteria | 1285 |
| 582 | Ga0265760_10006824 | 3300031090 | Bacteria | 3271 |
| 583 | Ga0265760_10032528 | 3300031090 | Bacteria | 1540 |
| 584 | Ga0265328_10005536 | 3300031239 | Bacteria | 5405 |
| 585 | Ga0265340_10170232 | 3300031247 | Unclassified | 987 |
| 586 | Ga0265331_10003719 | 3300031250 | Bacteria | 9697 |
| 587 | Ga0265316_10200203 | 3300031344 | Unclassified | 1481 |
| 588 | Ga0307513_10004439 | 3300031456 | Bacteria | 18733 |
| 589 | Ga0307513_10023132 | 3300031456 | Bacteria | 7271 |
| 590 | Ga0307513_10117908 | 3300031456 | Unclassified | 2630 |
| 591 | Ga0307513_10240229 | 3300031456 | Unclassified | 1617 |
| 592 | Ga0307509_10003290 | 3300031507 | Bacteria | 24811 |
| 593 | Ga0307509_10074603 | 3300031507 | Unclassified | 3527 |
| 594 | Ga0307509_10176404 | 3300031507 | Bacteria | 2009 |
| 595 | Ga0307509_10291038 | 3300031507 | Bacteria | 1388 |
| 596 | Ga0307408_100007954 | 3300031548 | Bacteria | 7012 |
| 597 | Ga0307408_100067805 | 3300031548 | Bacteria | 2625 |
| 598 | Ga0307408_100573572 | 3300031548 | Bacteria | 999 |
| 599 | Ga0307408_100801003 | 3300031548 | Bacteria | 855 |
| 600 | Ga0265313_10191223 | 3300031595 | Unclassified | 855 |
| 601 | Ga0307514_10070352 | 3300031649 | Bacteria | 2628 |
| 602 | Ga0316579_10096331 | 3300031691 | Bacteria | 1415 |
| 603 | Ga0316576_10004220 | 3300031727 | Bacteria | 8582 |
| 604 | Ga0316576_10006006 | 3300031727 | Bacteria | 7502 |
| 605 | Ga0316576_10051064 | 3300031727 | Bacteria | 3009 |
| 606 | Ga0316576_10058792 | 3300031727 | Bacteria | 2813 |
| 607 | Ga0316576_10130493 | 3300031727 | Unclassified | 1891 |
| 608 | Ga0316578_10038327 | 3300031728 | Bacteria | 2764 |
| 609 | Ga0316578_10049058 | 3300031728 | Bacteria | 2467 |
| 610 | Ga0307516_10001444 | 3300031730 | Bacteria | 32817 |
| 611 | Ga0307516_10313022 | 3300031730 | Bacteria | 1243 |
| 612 | Ga0307405_10113685 | 3300031731 | Bacteria | 1838 |
| 613 | Ga0307405_10343766 | 3300031731 | Bacteria | 1148 |
| 614 | Ga0307405_10377969 | 3300031731 | Bacteria | 1102 |
| 615 | Ga0316577_10190139 | 3300031733 | Bacteria | 1160 |
| 616 | Ga0316577_10237451 | 3300031733 | Unclassified | 1031 |
| 617 | Ga0307413_10052850 | 3300031824 | Bacteria | 2456 |
| 618 | Ga0307413_10089667 | 3300031824 | Bacteria | 1998 |
| 619 | Ga0307413_10145928 | 3300031824 | Bacteria | 1642 |
| 620 | Ga0307413_10617671 | 3300031824 | Bacteria | 889 |
| 621 | Ga0307410_10010276 | 3300031852 | Bacteria | 5291 |
| 622 | Ga0307410_10016545 | 3300031852 | Bacteria | 4401 |
| 623 | Ga0307410_10240322 | 3300031852 | Bacteria | 1403 |
| 624 | Ga0307410_10541973 | 3300031852 | Bacteria | 963 |
| 625 | Ga0307406_10010078 | 3300031901 | Bacteria | 5321 |
| 626 | Ga0307407_10030054 | 3300031903 | Unclassified | 2926 |
| 627 | Ga0307407_10100645 | 3300031903 | Bacteria | 1793 |
| 628 | Ga0307407_10139467 | 3300031903 | Bacteria | 1562 |
| 629 | Ga0307407_10470458 | 3300031903 | Bacteria | 916 |
| 630 | Ga0307412_10020499 | 3300031911 | Bacteria | 4024 |
| 631 | Ga0307409_100008024 | 3300031995 | Bacteria | 6366 |
| 632 | Ga0307409_100011112 | 3300031995 | Bacteria | 5652 |
| 633 | Ga0307409_100034857 | 3300031995 | Bacteria | 3682 |
| 634 | Ga0307409_100047572 | 3300031995 | Bacteria | 3257 |
| 635 | Ga0307409_100117408 | 3300031995 | Unclassified | 2245 |
| 636 | Ga0307416_100002338 | 3300032002 | Bacteria | 10841 |
| 637 | Ga0307416_100011041 | 3300032002 | Bacteria | 6001 |
| 638 | Ga0307416_100454438 | 3300032002 | Bacteria | 1334 |
| 639 | Ga0307416_101109709 | 3300032002 | Unclassified | 896 |
| 640 | Ga0307414_10026624 | 3300032004 | Bacteria | 3725 |
| 641 | Ga0307411_10001695 | 3300032005 | Bacteria | 9244 |
| 642 | Ga0307411_10011621 | 3300032005 | Unclassified | 4763 |
| 643 | Ga0307411_10013463 | 3300032005 | Bacteria | 4514 |
| 644 | Ga0307415_100001478 | 3300032126 | Bacteria | 11259 |
| 645 | Ga0307415_100205961 | 3300032126 | Unclassified | 1565 |
| 646 | Ga0307415_100467538 | 3300032126 | Bacteria | 1094 |
| 647 | Ga0307510_10000009 | 3300033180 | Bacteria | 409702 |
| 648 | Ga0373948_0038589 | 3300034817 | Bacteria | 991 |
| 649 | Ga0373958_0052080 | 3300034819 | Bacteria | 867 |
| 650 | Ga0373928_0061227 | 3300035084 | Bacteria | 911 |
| 651 | Ga0373940_0015761 | 3300035088 | Bacteria | 1863 |
| 652 | Ga0373936_0016115 | 3300035113 | Unclassified | 2871 |
| 653 | Ga0373939_0116197 | 3300035114 | Bacteria | 938 |
| 654 | Ga0373943_0179037 | 3300035170 | Bacteria | 1164 |
| 655 | Ga0373946_0140342 | 3300035171 | Bacteria | 1120 |
| 656 | Ga0373942_0093196 | 3300035207 | Bacteria | 911 |
| 657 | Ga0316574_0000207 | 3300035398 | Bacteria | 20739 |
| 658 | Ga0316574_0032511 | 3300035398 | Bacteria | 3171 |
| 659 | Ga0316574_0143602 | 3300035398 | Bacteria | 1538 |
| 660 | Ga0316574_0214450 | 3300035398 | Bacteria | 1235 |
| 661 | Ga0373931_0065594 | 3300035691 | Bacteria | 1968 |
| 662 | Ga0373931_0206291 | 3300035691 | Bacteria | 1177 |
| 663 | Ga0373935_0179044 | 3300035692 | Bacteria | 1455 |
| 664 | Ga0373935_0380516 | 3300035692 | Bacteria | 1011 |
| 665 | Ga0373927_0049029 | 3300035695 | Bacteria | 2731 |
| 666 | Ga0373933_0170731 | 3300035724 | Bacteria | 1384 |
| 667 | Ga0373933_0365360 | 3300035724 | Unclassified | 939 |
| 668 | Ga0373947_0289294 | 3300035725 | Bacteria | 1091 |
| 669 | Ga0373937_0041078 | 3300036401 | Bacteria | 4219 |
| 670 | Ga0373937_0228110 | 3300036401 | Bacteria | 1753 |
| 671 | Ga0316584_0055222 | 3300036712 | Bacteria | 2974 |
| 672 | Ga0316584_0059102 | 3300036712 | Bacteria | 2871 |
| 673 | Ga0316584_0155374 | 3300036712 | Bacteria | 1701 |
| 674 | Ga0316584_0513131 | 3300036712 | Bacteria | 841 |
| 675 | Ga0373925_0125185 | 3300037068 | Bacteria | 1999 |
| 676 | Ga0373925_0248624 | 3300037068 | Unclassified | 1426 |
| 677 | Ga0373925_0452040 | 3300037068 | Bacteria | 1052 |
| 678 | Ga0395898_0001660 | 3300037466 | Bacteria | 29878 |
| 679 | Ga0395905_0983593 | 3300037471 | Bacteria | 747 |
| 680 | Ga0436364_1486386 | 3300037853 | Bacteria | 1365 |
| 681 | Ga0400490_25125 | 3300038726 | Bacteria | 2074 |
| 682 | Ga0400491_25862 | 3300038727 | Bacteria | 2220 |
| 683 | Ga0400488_07793 | 3300038741 | Bacteria | 2288 |
| 684 | Ga0400487_37126 | 3300039110 | Bacteria | 2115 |
| 685 | Ga0436365_0124606 | 3300039437 | Bacteria | 3087 |
| 686 | Ga0436365_0738787 | 3300039437 | Bacteria | 7867 |
| 687 | Ga0436365_1419348 | 3300039437 | Bacteria | 2275 |
| 688 | Ga0436365_1481439 | 3300039437 | Bacteria | 1367 |
| 689 | Ga0436360_0186635 | 3300039438 | Bacteria | 1579 |
| 690 | Ga0436360_1334710 | 3300039438 | Bacteria | 2049 |
| 691 | Ga0436361_0288482 | 3300039447 | Bacteria | 1178 |
| 692 | Ga0436361_0701045 | 3300039447 | Bacteria | 1429 |
| 693 | Ga0436363_0138643 | 3300039450 | Bacteria | 8554 |
| 694 | Ga0436363_0534818 | 3300039450 | Bacteria | 1208 |
| 695 | Ga0436363_0886114 | 3300039450 | Bacteria | 1429 |
| 696 | Ga0436363_0993770 | 3300039450 | Bacteria | 1750 |
| 697 | Ga0436363_1121322 | 3300039450 | Bacteria | 7625 |
| 698 | Ga0436362_1039113 | 3300039453 | Bacteria | 2496 |
| 699 | Ga0436362_1099453 | 3300039453 | Bacteria | 985 |
| 700 | Ga0439436_0032660 | 3300041404 | Bacteria | 1509 |
| 701 | Ga0439453_0025863 | 3300041408 | Bacteria | 1085 |
| 702 | Ga0451789_0597622 | 3300041443 | Bacteria | 1152 |
| 703 | Ga0451793_1537572 | 3300041452 | Bacteria | 1520 |
| 704 | Ga0451793_1883906 | 3300041452 | Bacteria | 866 |
| 705 | Ga0451797_0849944 | 3300041453 | Bacteria | 2757 |
| 706 | Ga0451798_0432427 | 3300041458 | Unclassified | 1591 |
| 707 | Ga0451800_0647490 | 3300041459 | Bacteria | 1181 |
| 708 | Ga0451800_1186171 | 3300041459 | Bacteria | 1485 |
| 709 | Ga0451807_1566691 | 3300041486 | Bacteria | 3725 |
| 710 | Ga0451841_0202325 | 3300041498 | Bacteria | 2660 |
| 711 | Ga0451851_0634362 | 3300041507 | Bacteria | 762 |
| 712 | Ga0451853_3901512 | 3300041512 | Bacteria | 1316 |
| 713 | Ga0439441_035253 | 3300042001 | Bacteria | 986 |
| 714 | Ga0439456_059445 | 3300042013 | Bacteria | 839 |
| 715 | Ga0439463_044737 | 3300042016 | Bacteria | 1128 |
| 716 | Ga0450921_000860 | 3300042123 | Bacteria | 1646 |
| 717 | Ga0450923_000137 | 3300042125 | Bacteria | 6376 |
| 718 | Ga0450894_002178 | 3300042131 | Bacteria | 2665 |
| 719 | Ga0450896_000317 | 3300042133 | Bacteria | 4589 |
| 720 | Ga0450898_001506 | 3300042134 | Bacteria | 3084 |
| 721 | Ga0450910_005064 | 3300042147 | Bacteria | 1792 |
| 722 | Ga0439446_0004572 | 3300042156 | Bacteria | 3508 |
| 723 | Ga0439446_0011559 | 3300042156 | Bacteria | 2399 |
| 724 | Ga0439446_0138533 | 3300042156 | Bacteria | 794 |
| 725 | Ga0450908_002586 | 3300042184 | Bacteria | 3546 |
| 726 | Ga0439434_0000568 | 3300042435 | Bacteria | 10648 |
| 727 | Ga0439435_0010755 | 3300042436 | Bacteria | 2180 |
| 728 | Ga0439444_0000334 | 3300042437 | Bacteria | 4955 |
| 729 | Ga0439444_0031488 | 3300042437 | Bacteria | 998 |
| 730 | Ga0439459_0016993 | 3300042438 | Bacteria | 1351 |
| 731 | Ga0439460_0003028 | 3300042461 | Bacteria | 4056 |
| 732 | Ga0450916_008956 | 3300042530 | Bacteria | 1229 |
| 733 | Ga0451577_0036730 | 3300042876 | Bacteria | 4410 |
| 734 | Ga0466969_0083705 | 3300044656 | Bacteria | 1519 |
| 735 | Ga0466966_0026246 | 3300044684 | Bacteria | 3804 |
| 736 | Ga0466966_0372522 | 3300044684 | Bacteria | 858 |
| 737 | Ga0453684_0295348 | 3300044712 | Bacteria | 1843 |
| 738 | Ga0466957_0784532 | 3300044842 | Bacteria | 676 |
| 739 | Ga0466960_0030401 | 3300044901 | Bacteria | 2485 |
| 740 | Ga0466959_0006207 | 3300045049 | Bacteria | 8260 |
| 741 | Ga0466959_0009242 | 3300045049 | Bacteria | 7005 |
| 742 | Ga0466959_0042845 | 3300045049 | Bacteria | 3338 |
| 743 | Ga0466959_0070811 | 3300045049 | Bacteria | 2526 |
| 744 | Ga0451576_0034057 | 3300045051 | Bacteria | 5411 |
| 745 | Ga0495590_0134962 | 3300046457 | Bacteria | 889 |
| 746 | Ga0495591_045564 | 3300046458 | Bacteria | 1222 |
| 747 | Ga0495629_0363109 | 3300046459 | Bacteria | 987 |
| 748 | Ga0495638_0001279 | 3300046460 | Bacteria | 23471 |
| 749 | Ga0495580_0450157 | 3300046472 | Bacteria | 864 |
| 750 | Ga0495582_0183720 | 3300046473 | Bacteria | 1192 |
| 751 | Ga0495639_0243144 | 3300046475 | Bacteria | 888 |
| 752 | Ga0495664_0115219 | 3300046477 | Bacteria | 1624 |
| 753 | Ga0495584_0067299 | 3300046491 | Bacteria | 1801 |
| 754 | Ga0495596_0080818 | 3300046500 | Unclassified | 1262 |
| 755 | Ga0495616_0006051 | 3300046513 | Bacteria | 7372 |
| 756 | Ga0495618_0185442 | 3300046514 | Bacteria | 1321 |
| 757 | Ga0495628_0071937 | 3300046516 | Bacteria | 2695 |
| 758 | Ga0495630_0033559 | 3300046517 | Bacteria | 3829 |
| 759 | Ga0495630_0262314 | 3300046517 | Bacteria | 1320 |
| 760 | Ga0495630_0532580 | 3300046517 | Unclassified | 901 |
| 761 | Ga0495632_0043607 | 3300046519 | Bacteria | 2241 |
| 762 | Ga0495632_0061014 | 3300046519 | Bacteria | 1831 |
| 763 | Ga0495632_0068367 | 3300046519 | Bacteria | 1712 |
| 764 | Ga0495648_0145103 | 3300046524 | Bacteria | 1245 |
| 765 | Ga0495654_0073726 | 3300046530 | Unclassified | 1614 |
| 766 | Ga0495640_0234724 | 3300046533 | Bacteria | 1153 |
| 767 | Ga0495586_0157365 | 3300046535 | Bacteria | 1280 |
| 768 | Ga0495587_0295000 | 3300046536 | Bacteria | 907 |
| 769 | Ga0495622_0085692 | 3300046557 | Bacteria | 1449 |
| 770 | Ga0495633_0074390 | 3300046558 | Bacteria | 1583 |
| 771 | Ga0495656_0065987 | 3300046615 | Unclassified | 1593 |
| 772 | Ga0495668_0142910 | 3300046616 | Bacteria | 1310 |
| 773 | Ga0495668_0231927 | 3300046616 | Unclassified | 1011 |
| 774 | Ga0495611_0158022 | 3300046648 | Bacteria | 1059 |
| 775 | Ga0495625_0001239 | 3300046660 | Bacteria | 32208 |
| 776 | Ga0495625_0186302 | 3300046660 | Bacteria | 1377 |
| 777 | Ga0495635_0356150 | 3300046663 | Unclassified | 976 |
| 778 | Ga0495599_0173505 | 3300046678 | Bacteria | 1330 |
| 779 | Ga0495647_0087215 | 3300046681 | Bacteria | 1274 |
| 780 | Ga0495658_0588444 | 3300046683 | Bacteria | 713 |
| 781 | Ga0495671_0010128 | 3300046692 | Bacteria | 5241 |
| 782 | Ga0495671_0065823 | 3300046692 | Bacteria | 1784 |
| 783 | Ga0495671_0243937 | 3300046692 | Bacteria | 868 |
| 784 | Ga0495649_0099653 | 3300046694 | Bacteria | 1545 |
| 785 | Ga0495674_0067917 | 3300047319 | Bacteria | 3087 |
| 786 | Ga0495674_0176591 | 3300047319 | Bacteria | 1780 |
| 787 | Ga0495672_0077199 | 3300047320 | Unclassified | 1868 |
| 788 | Ga0495686_0203801 | 3300047472 | Bacteria | 1134 |
| 789 | Ga0495686_0220284 | 3300047472 | Unclassified | 1080 |
| 790 | Ga0496100_0004572 | 3300048903 | Bacteria | 7355 |
| 791 | Ga0496100_0205037 | 3300048903 | Bacteria | 1439 |
| 792 | Ga0496101_0002164 | 3300048904 | Bacteria | 12007 |
| 793 | Ga0496101_0180353 | 3300048904 | Bacteria | 1626 |
| 794 | Ga0496101_0532760 | 3300048904 | Bacteria | 928 |
| 795 | Ga0496102_0007024 | 3300048905 | Bacteria | 9614 |
| 796 | Ga0496102_0067437 | 3300048905 | Bacteria | 3282 |
| 797 | Ga0496102_0084368 | 3300048905 | Bacteria | 2932 |
| 798 | Ga0496102_0108790 | 3300048905 | Bacteria | 2582 |
| 799 | Ga0496102_0601944 | 3300048905 | Bacteria | 1022 |
| 800 | Ga0496103_0131504 | 3300048906 | Bacteria | 1598 |
| 801 | Ga0496103_0507447 | 3300048906 | Bacteria | 771 |
| 802 | Ga0496104_0016553 | 3300048907 | Bacteria | 6700 |
| 803 | Ga0496105_0011414 | 3300048908 | Bacteria | 7017 |
| 804 | Ga0496105_0020813 | 3300048908 | Bacteria | 5304 |
| 805 | Ga0496106_0003997 | 3300048909 | Bacteria | 11020 |
| 806 | Ga0496106_0049060 | 3300048909 | Bacteria | 3180 |
| 807 | Ga0496107_0009320 | 3300048910 | Bacteria | 6804 |
| 808 | Ga0496107_0193292 | 3300048910 | Bacteria | 1512 |
| 809 | Ga0496108_0006755 | 3300048911 | Bacteria | 9287 |
| 810 | Ga0496108_0392611 | 3300048911 | Bacteria | 1212 |
| 811 | Ga0496108_0431769 | 3300048911 | Bacteria | 1151 |
| 812 | Ga0496109_0001391 | 3300048912 | Bacteria | 20067 |
| 813 | Ga0496109_0156598 | 3300048912 | Bacteria | 2134 |
| 814 | Ga0496110_0005095 | 3300048913 | Bacteria | 10264 |
| 815 | Ga0496110_0048188 | 3300048913 | Bacteria | 3735 |
| 816 | Ga0496111_0003948 | 3300048914 | Bacteria | 9307 |
| 817 | Ga0496112_0094457 | 3300048915 | Bacteria | 2961 |
| 818 | Ga0496112_0208483 | 3300048915 | Bacteria | 1912 |
| 819 | Ga0496113_0014370 | 3300048916 | Bacteria | 5400 |
| 820 | Ga0496113_0089788 | 3300048916 | Bacteria | 2366 |
| 821 | Ga0496114_0003345 | 3300048917 | Bacteria | 12326 |
| 822 | Ga0496114_0581430 | 3300048917 | Bacteria | 988 |
| 823 | Ga0496115_0008741 | 3300048918 | Bacteria | 7508 |
| 824 | Ga0496115_0037484 | 3300048918 | Bacteria | 3841 |
| 825 | Ga0496115_0389434 | 3300048918 | Bacteria | 1132 |
| 826 | Ga0496115_0824483 | 3300048918 | Bacteria | 720 |
| 827 | Ga0496117_0000099 | 3300048920 | Bacteria | 194987 |
| 828 | Ga0496118_0000105 | 3300048921 | Bacteria | 156739 |
| 829 | Ga0496119_0022550 | 3300048922 | Bacteria | 4501 |
| 830 | Ga0496119_0356042 | 3300048922 | Bacteria | 708 |
| 831 | Ga0496120_0057067 | 3300048923 | Bacteria | 2199 |
| 832 | Ga0496120_0244554 | 3300048923 | Bacteria | 845 |
| 833 | Ga0496121_0000772 | 3300048924 | Bacteria | 58665 |
| 834 | Ga0496121_0038922 | 3300048924 | Unclassified | 4201 |
| 835 | Ga0496121_0089235 | 3300048924 | Bacteria | 2414 |
| 836 | Ga0496124_0053017 | 3300048927 | Bacteria | 3441 |
| 837 | Ga0496125_0001407 | 3300048928 | Bacteria | 35110 |
| 838 | Ga0496125_0015680 | 3300048928 | Bacteria | 7310 |
| 839 | Ga0496126_0001705 | 3300048929 | Bacteria | 32640 |
| 840 | Ga0496126_0045294 | 3300048929 | Bacteria | 4044 |
| 841 | Ga0501299_007008 | 3300049522 | Bacteria | 1784 |
| 842 | Ga0501032_0022084 | 3300049569 | Bacteria | 4417 |
| 843 | Ga0501034_0361212 | 3300049571 | Bacteria | 1379 |
| 844 | Ga0501034_0720714 | 3300049571 | Bacteria | 895 |
| 845 | Ga0501036_0008935 | 3300049572 | Bacteria | 8237 |
| 846 | Ga0501038_0026078 | 3300049574 | Bacteria | 5206 |
| 847 | Ga0501038_0338404 | 3300049574 | Bacteria | 1174 |
| 848 | Ga0501038_0389330 | 3300049574 | Bacteria | 1080 |
| 849 | Ga0501039_0003228 | 3300049575 | Bacteria | 12192 |
| 850 | Ga0501039_0567414 | 3300049575 | Bacteria | 890 |
| 851 | Ga0501040_0003733 | 3300049576 | Bacteria | 9873 |
| 852 | Ga0501040_0166380 | 3300049576 | Bacteria | 1560 |
| 853 | Ga0501041_0313382 | 3300049577 | Bacteria | 989 |
| 854 | Ga0501042_0107371 | 3300049578 | Bacteria | 2010 |
| 855 | Ga0501042_0416106 | 3300049578 | Unclassified | 974 |
| 856 | Ga0501048_0287717 | 3300049582 | Bacteria | 1169 |
| 857 | Ga0501067_0023647 | 3300049583 | Bacteria | 3406 |
| 858 | Ga0501068_0014527 | 3300049584 | Bacteria | 4503 |
| 859 | Ga0501068_0091577 | 3300049584 | Unclassified | 1876 |
| 860 | Ga0501070_0358712 | 3300049586 | Bacteria | 1183 |
| 861 | Ga0501071_0000497 | 3300049587 | Bacteria | 19949 |
| 862 | Ga0501071_0003420 | 3300049587 | Bacteria | 9921 |
| 863 | Ga0501071_0190450 | 3300049587 | Bacteria | 1538 |
| 864 | Ga0501071_0197132 | 3300049587 | Bacteria | 1512 |
| 865 | Ga0501072_0056549 | 3300049588 | Bacteria | 3091 |
| 866 | Ga0501072_0059319 | 3300049588 | Bacteria | 3017 |
| 867 | Ga0501072_0165848 | 3300049588 | Bacteria | 1762 |
| 868 | Ga0501072_0257420 | 3300049588 | Bacteria | 1390 |
| 869 | Ga0501073_0003564 | 3300049589 | Bacteria | 11699 |
| 870 | Ga0501073_0009069 | 3300049589 | Bacteria | 7343 |
| 871 | Ga0501073_0141368 | 3300049589 | Unclassified | 1668 |
| 872 | Ga0501073_0153826 | 3300049589 | Unclassified | 1594 |
| 873 | Ga0501074_0011114 | 3300049590 | Bacteria | 6538 |
| 874 | Ga0501074_0288634 | 3300049590 | Unclassified | 1166 |
| 875 | Ga0501075_0017587 | 3300049591 | Bacteria | 5163 |
| 876 | Ga0501075_0058296 | 3300049591 | Bacteria | 2908 |
| 877 | Ga0501075_0308300 | 3300049591 | Bacteria | 1206 |
| 878 | Ga0501076_0004515 | 3300049592 | Bacteria | 9908 |
| 879 | Ga0501076_0089815 | 3300049592 | Bacteria | 2470 |
| 880 | Ga0501077_0001025 | 3300049593 | Bacteria | 16864 |
| 881 | Ga0501077_0055665 | 3300049593 | Bacteria | 2511 |
| 882 | Ga0501079_0004155 | 3300049741 | Bacteria | 10726 |
| 883 | Ga0501079_0277096 | 3300049741 | Bacteria | 1311 |
| 884 | Ga0501080_0005088 | 3300049742 | Bacteria | 11719 |
| 885 | Ga0501080_0009460 | 3300049742 | Bacteria | 8889 |
| 886 | Ga0501080_0117354 | 3300049742 | Bacteria | 2467 |
| 887 | Ga0501081_0041701 | 3300049743 | Bacteria | 3144 |
| 888 | Ga0501083_0025130 | 3300049744 | Bacteria | 4125 |
| 889 | Ga0501083_0051954 | 3300049744 | Bacteria | 2755 |
| 890 | Ga0501083_0278070 | 3300049744 | Unclassified | 1089 |
| 891 | Ga0501035_0917575 | 3300049822 | Bacteria | 693 |
| 892 | nmdc:mga05p37_168_c1 | 3300050507 | Bacteria | 63904 |
| 893 | nmdc:mga05p37_29033_c2 | 3300050507 | Bacteria | 5723 |
| 894 | nmdc:mga09592_10179_c1 | 3300050508 | Bacteria | 7654 |
| 895 | nmdc:mga09592_504_c1 | 3300050508 | Bacteria | 29517 |
| 896 | nmdc:mga0qj67_280627_c1 | 3300050509 | Bacteria | 1350 |
| 897 | nmdc:mga0qj67_5835_c1 | 3300050509 | Bacteria | 9015 |
| 898 | nmdc:mga06r32_344365_c1 | 3300050510 | Bacteria | 1475 |
| 899 | nmdc:mga06r32_90_c1 | 3300050510 | Bacteria | 62738 |
| 900 | nmdc:mga06r32_9_c1 | 3300050510 | Bacteria | 115522 |
| 901 | nmdc:mga08y16_1158_c1 | 3300050511 | Bacteria | 25986 |
| 902 | nmdc:mga08y16_179769_c1 | 3300050511 | Unclassified | 2196 |
| 903 | nmdc:mga08y16_59465_c1 | 3300050511 | Bacteria | 3991 |
| 904 | nmdc:mga08y16_616515_c1 | 3300050511 | Bacteria | 1092 |
| 905 | nmdc:mga08y16_64510_c1 | 3300050511 | Unclassified | 3825 |
| 906 | nmdc:mga0n895_87_c1 | 3300050512 | Bacteria | 53157 |
| 907 | nmdc:mga0rr50_842550_c1 | 3300050513 | Bacteria | 782 |
| 908 | nmdc:mga0rr50_9835_c1 | 3300050513 | Bacteria | 6039 |
| 909 | nmdc:mga08x19_122046_c1 | 3300050514 | Bacteria | 1747 |
| 910 | nmdc:mga0a205_73_c1 | 3300050515 | Bacteria | 55159 |
| 911 | Ga0495612_0072104 | 3300053078 | Bacteria | 1442 |
| 912 | Ga0495655_0013271 | 3300053083 | Bacteria | 1701 |
| 913 | Ga0500578_0272086 | 3300053086 | Bacteria | 1013 |
| 914 | Ga0500644_0130816 | 3300053088 | Bacteria | 988 |
| 915 | Ga0500583_0009635 | 3300053092 | Bacteria | 3542 |
| 916 | Ga0500651_0115122 | 3300053093 | Bacteria | 1638 |
| 917 | Ga0500651_0209733 | 3300053093 | Bacteria | 1146 |
| 918 | Ga0500641_0013838 | 3300053096 | Bacteria | 2968 |
| 919 | Ga0500556_0000174 | 3300053104 | Bacteria | 52844 |
| 920 | Ga0500556_0047263 | 3300053104 | Bacteria | 1543 |
| 921 | Ga0500556_0136022 | 3300053104 | Bacteria | 965 |
| 922 | Ga0500594_0043115 | 3300053118 | Bacteria | 1243 |
| 923 | Ga0500617_015195 | 3300053124 | Bacteria | 3301 |
| 924 | Ga0500655_004693 | 3300053133 | Bacteria | 2457 |
| 925 | Ga0500658_0028219 | 3300053134 | Bacteria | 2176 |
| 926 | Ga0500658_0131769 | 3300053134 | Bacteria | 1116 |
| 927 | Ga0500568_0119886 | 3300053139 | Bacteria | 980 |
| 928 | Ga0500588_0001164 | 3300053146 | Bacteria | 4850 |
| 929 | Ga0500588_0004234 | 3300053146 | Bacteria | 3093 |
| 930 | Ga0500604_0012558 | 3300053151 | Bacteria | 2288 |
| 931 | Ga0500622_0039171 | 3300053156 | Bacteria | 2471 |
| 932 | Ga0500627_0184996 | 3300053158 | Bacteria | 937 |
| 933 | Ga0500630_059666 | 3300053159 | Bacteria | 1825 |
| 934 | Ga0500639_018575 | 3300053163 | Unclassified | 3670 |
| 935 | Ga0500636_0136875 | 3300053177 | Bacteria | 1359 |
| 936 | Ga0500637_0104350 | 3300053178 | Unclassified | 1644 |
| 937 | Ga0500637_0302596 | 3300053178 | Bacteria | 871 |
| 938 | Ga0501084_0000568 | 3300054114 | Bacteria | 28216 |
| 939 | Ga0501084_0347563 | 3300054114 | Unclassified | 1253 |
| 940 | Ga0587077_063278 | 3300059493 | Bacteria | 808 |
| 941 | Ga0501082_0009537 | 3300060353 | Bacteria | 8354 |
| 942 | Ga0501082_0077167 | 3300060353 | Bacteria | 2872 |
| 943 | Ga0501082_0147269 | 3300060353 | Bacteria | 2044 |
| 944 | Ga0530510_0361235 | 3300061734 | Bacteria | 1091 |
| 945 | Ga0450890_010081 | |||
| 946 | JGI25406J46586_10008835 | |||
| 947 | Ga0065704_10004545 | |||
| 948 | Ga0065712_10077288 | |||
| 949 | Ga0065712_10125840 | |||
| 950 | Ga0065712_10188647 | |||
| 951 | Ga0065715_10095587 | |||
| 952 | Ga0065707_10084023 | |||
| 953 | Ga0065707_10085501 | |||
| 954 | Ga0065707_10109522 | |||
| 955 | Ga0070683_100109268 | |||
| 956 | Ga0070690_100000437 | |||
| 957 | Ga0070690_100002279 | |||
| 958 | Ga0070690_100002749 | |||
| 959 | Ga0070670_100130094 | |||
| 960 | Ga0070670_100243825 | |||
| 961 | Ga0070677_10163826 | |||
| 962 | Ga0068869_100028646 | |||
| 963 | Ga0068869_100038481 | |||
| 964 | Ga0068869_100112978 | |||
| 965 | Ga0068869_100127769 | |||
| 966 | Ga0068869_100181680 | |||
| 967 | Ga0068869_100345267 | |||
| 968 | Ga0068869_100466909 | |||
| 969 | Ga0068869_100631088 | |||
| 970 | Ga0070666_10000825 | |||
| 971 | Ga0070666_10037127 | |||
| 972 | Ga0070666_10131731 | |||
| 973 | Ga0070680_100042749 | |||
| 974 | Ga0070680_100145663 | |||
| 975 | Ga0070682_100119573 | |||
| 976 | Ga0070682_100143291 | |||
| 977 | Ga0070682_100571473 | |||
| 978 | Ga0068868_100001561 | |||
| 979 | Ga0068868_100164613 | |||
| 980 | Ga0068868_100318330 | |||
| 981 | Ga0070689_100002333 | |||
| 982 | Ga0070689_100017990 | |||
| 983 | Ga0070689_100357976 | |||
| 984 | Ga0070689_100662675 | |||
| 985 | Ga0070691_10054009 | |||
| 986 | Ga0070691_10275208 | |||
| 987 | Ga0070687_100002779 | |||
| 988 | Ga0070687_100037251 | |||
| 989 | Ga0070661_100006843 | |||
| 990 | Ga0070661_100397443 | |||
| 991 | Ga0070692_10426255 | |||
| 992 | Ga0070668_100009275 | |||
| 993 | Ga0070668_100222942 | |||
| 994 | Ga0070668_100568578 | |||
| 995 | Ga0070669_100043812 | |||
| 996 | Ga0070669_100089936 | |||
| 997 | Ga0070669_100124426 | |||
| 998 | Ga0070675_100001094 | |||
| 999 | Ga0070675_100410450 | |||
| 1000 | Ga0070675_100559138 | |||
| 1001 | Ga0070675_100599948 | |||
| 1002 | Ga0070671_100010657 | |||
| 1003 | Ga0070671_100048018 | |||
| 1004 | Ga0070674_100449309 | |||
| 1005 | Ga0070673_100010863 | |||
| 1006 | Ga0070673_100013882 | |||
| 1007 | Ga0070673_100072075 | |||
| 1008 | Ga0070673_100186562 | |||
| 1009 | Ga0070688_100038936 | |||
| 1010 | Ga0070667_100000116 | |||
| 1011 | Ga0070667_100009226 | |||
| 1012 | Ga0070667_100018866 | |||
| 1013 | Ga0070667_100248024 | |||
| 1014 | Ga0070667_101117844 | |||
| 1015 | Ga0070709_10003761 | |||
| 1016 | Ga0070709_10264156 | |||
| 1017 | Ga0070714_100018526 | |||
| 1018 | Ga0070714_100030181 | |||
| 1019 | Ga0070714_100129633 | |||
| 1020 | Ga0070713_100003775 | |||
| 1021 | Ga0070713_100032889 | |||
| 1022 | Ga0070713_100267146 | |||
| 1023 | Ga0070713_100321270 | |||
| 1024 | Ga0070713_100412134 | |||
| 1025 | Ga0070710_10004080 | |||
| 1026 | Ga0070710_10083708 | |||
| 1027 | Ga0070710_10153485 | |||
| 1028 | Ga0070710_10311972 | |||
| 1029 | Ga0070701_10033333 | |||
| 1030 | Ga0070701_10056927 | |||
| 1031 | Ga0070701_10144827 | |||
| 1032 | Ga0070701_10228673 | |||
| 1033 | Ga0070711_100000263 | |||
| 1034 | Ga0070711_100184071 | |||
| 1035 | Ga0070711_100301664 | |||
| 1036 | Ga0070705_100033993 | |||
| 1037 | Ga0070705_100037268 | |||
| 1038 | Ga0070705_100056840 | |||
| 1039 | Ga0070700_100011500 | |||
| 1040 | Ga0070700_100027541 | |||
| 1041 | Ga0070700_100112755 | |||
| 1042 | Ga0070700_100298151 | |||
| 1043 | Ga0070694_100009910 | |||
| 1044 | Ga0070694_100163081 | |||
| 1045 | Ga0070694_100391544 | |||
| 1046 | Ga0070663_100119430 | |||
| 1047 | Ga0070678_100000129 | |||
| 1048 | Ga0070678_100247524 | |||
| 1049 | Ga0070678_100310997 | |||
| 1050 | Ga0070678_100413340 | |||
| 1051 | Ga0070662_100053831 | |||
| 1052 | Ga0070662_100429863 | |||
| 1053 | Ga0070681_10005968 | |||
| 1054 | Ga0070681_10014820 | |||
| 1055 | Ga0070681_10020355 | |||
| 1056 | Ga0070681_10026771 | |||
| 1057 | Ga0070681_10173564 | |||
| 1058 | Ga0070681_10186302 | |||
| 1059 | Ga0068867_100107488 | |||
| 1060 | Ga0068867_100309857 | |||
| 1061 | Ga0070685_10000838 | |||
| 1062 | Ga0070685_10124810 | |||
| 1063 | Ga0070685_10471487 | |||
| 1064 | Ga0070698_100087908 | |||
| 1065 | Ga0070699_100065193 | |||
| 1066 | Ga0070679_100012012 | |||
| 1067 | Ga0070679_100022486 | |||
| 1068 | Ga0070679_100061488 | |||
| 1069 | Ga0070679_100150044 | |||
| 1070 | Ga0070679_100399391 | |||
| 1071 | Ga0070684_100003572 | |||
| 1072 | Ga0070684_100025558 | |||
| 1073 | Ga0070684_100190952 | |||
| 1074 | Ga0070684_100903162 | |||
| 1075 | Ga0070672_100012307 | |||
| 1076 | Ga0070672_100128316 | |||
| 1077 | Ga0070672_100189866 | |||
| 1078 | Ga0070686_100008668 | |||
| 1079 | Ga0070686_100098261 | |||
| 1080 | Ga0070695_100088224 | |||
| 1081 | Ga0070695_100244501 | |||
| 1082 | Ga0070696_100002775 | |||
| 1083 | Ga0070696_100043730 | |||
| 1084 | Ga0070693_100022003 | |||
| 1085 | Ga0070693_100037104 | |||
| 1086 | Ga0070693_100469419 | |||
| 1087 | Ga0070665_100005507 | |||
| 1088 | Ga0070665_100005902 | |||
| 1089 | Ga0070665_100009357 | |||
| 1090 | Ga0070665_100013754 | |||
| 1091 | Ga0070665_100168388 | |||
| 1092 | Ga0070704_100011065 | |||
| 1093 | Ga0068855_100001037 | |||
| 1094 | Ga0068855_100004460 | |||
| 1095 | Ga0068855_100025633 | |||
| 1096 | Ga0070664_100004740 | |||
| 1097 | Ga0070664_100015641 | |||
| 1098 | Ga0068857_100010063 | |||
| 1099 | Ga0068857_100523662 | |||
| 1100 | Ga0068857_100579821 | |||
| 1101 | Ga0068856_100015079 | |||
| 1102 | Ga0068856_100018387 | |||
| 1103 | Ga0068856_100533600 | |||
| 1104 | Ga0070702_100000806 | |||
| 1105 | Ga0070702_100039124 | |||
| 1106 | Ga0070702_100060423 | |||
| 1107 | Ga0068852_100146946 | |||
| 1108 | Ga0068852_100363709 | |||
| 1109 | Ga0068852_100404747 | |||
| 1110 | Ga0068859_100000196 | |||
| 1111 | Ga0068859_100010536 | |||
| 1112 | Ga0068859_100030531 | |||
| 1113 | Ga0068859_100169788 | |||
| 1114 | Ga0068859_100239951 | |||
| 1115 | Ga0068859_100389821 | |||
| 1116 | Ga0068859_100754853 | |||
| 1117 | Ga0068859_100819380 | |||
| 1118 | Ga0068864_100003638 | |||
| 1119 | Ga0068864_100342137 | |||
| 1120 | Ga0068866_10001569 | |||
| 1121 | Ga0068866_10023641 | |||
| 1122 | Ga0068866_10108239 | |||
| 1123 | Ga0068861_100002494 | |||
| 1124 | Ga0068861_100004230 | |||
| 1125 | Ga0068861_100026201 | |||
| 1126 | Ga0068861_100290037 | |||
| 1127 | Ga0068861_100327671 | |||
| 1128 | Ga0068861_100474596 | |||
| 1129 | Ga0068861_100569726 | |||
| 1130 | Ga0068861_100673141 | |||
| 1131 | Ga0068870_10130446 | |||
| 1132 | Ga0068870_10276687 | |||
| 1133 | Ga0068863_100001617 | |||
| 1134 | Ga0068863_100005705 | |||
| 1135 | Ga0068863_100230281 | |||
| 1136 | Ga0068858_100004518 | |||
| 1137 | Ga0068858_100006646 | |||
| 1138 | Ga0068858_100007638 | |||
| 1139 | Ga0068858_100290660 | |||
| 1140 | Ga0068858_100330101 | |||
| 1141 | Ga0068858_100332826 | |||
| 1142 | Ga0068858_100578836 | |||
| 1143 | Ga0068858_100643611 | |||
| 1144 | Ga0068858_100697456 | |||
| 1145 | Ga0068860_100005516 | |||
| 1146 | Ga0068860_100006186 | |||
| 1147 | Ga0068860_100039434 | |||
| 1148 | Ga0068860_100265949 | |||
| 1149 | Ga0068860_100360396 | |||
| 1150 | Ga0068860_100650719 | |||
| 1151 | Ga0068862_100002447 | |||
| 1152 | Ga0068862_100045778 | |||
| 1153 | Ga0068862_100153540 | |||
| 1154 | Ga0068862_100210437 | |||
| 1155 | Ga0068862_100331576 | |||
| 1156 | Ga0081455_10000057 | |||
| 1157 | Ga0081455_10007780 | |||
| 1158 | Ga0081538_10152088 | |||
| 1159 | Ga0081540_1024941 | |||
| 1160 | Ga0081539_10000038 | |||
| 1161 | Ga0070717_10001180 | |||
| 1162 | Ga0070715_10006658 | |||
| 1163 | Ga0070715_10102026 | |||
| 1164 | Ga0070716_100027399 | |||
| 1165 | Ga0070712_100006678 | |||
| 1166 | Ga0070712_100070870 | |||
| 1167 | Ga0097621_100012611 | |||
| 1168 | Ga0097621_100088595 | |||
| 1169 | Ga0097621_100136346 | |||
| 1170 | Ga0097621_100146289 | |||
| 1171 | Ga0097621_100280060 | |||
| 1172 | Ga0068871_100023046 | |||
| 1173 | Ga0068871_100035627 | |||
| 1174 | Ga0068871_100112934 | |||
| 1175 | Ga0068871_100555598 | |||
| 1176 | Ga0075428_100002803 | |||
| 1177 | Ga0075428_100002930 | |||
| 1178 | Ga0075428_100525214 | |||
| 1179 | Ga0075428_100985824 | |||
| 1180 | Ga0075430_100001231 | |||
| 1181 | Ga0075430_100199497 | |||
| 1182 | Ga0075430_100256577 | |||
| 1183 | Ga0075431_100000015 | |||
| 1184 | Ga0075431_100004022 | |||
| 1185 | Ga0075431_100189046 | |||
| 1186 | Ga0075431_100366586 | |||
| 1187 | Ga0075433_10000413 | |||
| 1188 | Ga0075433_10719423 | |||
| 1189 | Ga0075434_100000289 | |||
| 1190 | Ga0075434_100416609 | |||
| 1191 | Ga0075429_100001559 | |||
| 1192 | Ga0075429_100312178 | |||
| 1193 | Ga0068865_100070116 | |||
| 1194 | Ga0068865_100070351 | |||
| 1195 | Ga0068865_100102271 | |||
| 1196 | Ga0068865_100113016 | |||
| 1197 | Ga0075436_100201194 | |||
| 1198 | Ga0097620_100000196 | |||
| 1199 | Ga0097620_100010536 | |||
| 1200 | Ga0097620_100030531 | |||
| 1201 | Ga0097620_100169786 | |||
| 1202 | Ga0097620_100239961 | |||
| 1203 | Ga0097620_100389821 | |||
| 1204 | Ga0097620_100754854 | |||
| 1205 | Ga0097620_100819324 | |||
| 1206 | Ga0099826_10037321 | |||
| 1207 | Ga0075435_100050996 | |||
| 1208 | Ga0099795_10000136 | |||
| 1209 | Ga0099795_10031558 | |||
| 1210 | Ga0099795_10056557 | |||
| 1211 | Ga0105250_10000006 | |||
| 1212 | Ga0105250_10075354 | |||
| 1213 | Ga0105250_10089984 | |||
| 1214 | Ga0105240_10001059 | |||
| 1215 | Ga0105240_10002425 | |||
| 1216 | Ga0105240_10148269 | |||
| 1217 | Ga0105240_10259107 | |||
| 1218 | Ga0105240_10378024 | |||
| 1219 | Ga0105240_10536954 | |||
| 1220 | Ga0111539_10003339 | |||
| 1221 | Ga0111539_10034262 | |||
| 1222 | Ga0111539_10054228 | |||
| 1223 | Ga0111539_10588316 | |||
| 1224 | Ga0111539_10826653 | |||
| 1225 | Ga0105245_10011723 | |||
| 1226 | Ga0105245_10301345 | |||
| 1227 | Ga0105245_10541640 | |||
| 1228 | Ga0105245_10882194 | |||
| 1229 | Ga0105247_10000558 | |||
| 1230 | Ga0105247_10007392 | |||
| 1231 | Ga0105247_10029035 | |||
| 1232 | Ga0105247_10426175 | |||
| 1233 | Ga0114129_10000147 | |||
| 1234 | Ga0114129_10012362 | |||
| 1235 | Ga0114129_10352535 | |||
| 1236 | Ga0105243_10056100 | |||
| 1237 | Ga0105241_10105262 | |||
| 1238 | Ga0105241_10119362 | |||
| 1239 | Ga0105241_10135191 | |||
| 1240 | Ga0105241_11212498 | |||
| 1241 | Ga0105242_10001505 | |||
| 1242 | Ga0105242_10051581 | |||
| 1243 | Ga0105242_10511764 | |||
| 1244 | Ga0105242_10661451 | |||
| 1245 | Ga0105248_10010045 | |||
| 1246 | Ga0105248_10010440 | |||
| 1247 | Ga0105248_10011023 | |||
| 1248 | Ga0105248_10064643 | |||
| 1249 | Ga0105248_10109384 | |||
| 1250 | Ga0105248_10494946 | |||
| 1251 | Ga0105248_11045535 | |||
| 1252 | Ga0105237_10048217 | |||
| 1253 | Ga0105237_10257101 | |||
| 1254 | Ga0105237_10324379 | |||
| 1255 | Ga0105237_10734826 | |||
| 1256 | Ga0105238_10000966 | |||
| 1257 | Ga0105238_10104264 | |||
| 1258 | Ga0105238_10111586 | |||
| 1259 | Ga0105238_10208142 | |||
| 1260 | Ga0105238_10940450 | |||
| 1261 | Ga0105249_10015712 | |||
| 1262 | Ga0105249_10152038 | |||
| 1263 | Ga0105249_10353188 | |||
| 1264 | Ga0099796_10000573 | |||
| 1265 | Ga0099796_10056617 | |||
| 1266 | Ga0105239_10019609 | |||
| 1267 | Ga0105239_10031025 | |||
| 1268 | Ga0105239_10250767 | |||
| 1269 | Ga0105239_10521546 | |||
| 1270 | Ga0105239_10550924 | |||
| 1271 | Ga0105239_10806530 | |||
| 1272 | Ga0105246_10152178 | |||
| 1273 | Ga0105246_10358051 | |||
| 1274 | Ga0157373_10154910 | |||
| 1275 | Ga0157370_10004643 | |||
| 1276 | Ga0157369_10148671 | |||
| 1277 | Ga0157369_10175295 | |||
| 1278 | Ga0157369_10203429 | |||
| 1279 | Ga0157369_10957828 | |||
| 1280 | Ga0157374_10001326 | |||
| 1281 | Ga0157374_10082079 | |||
| 1282 | Ga0157374_10212342 | |||
| 1283 | Ga0157374_10287270 | |||
| 1284 | Ga0157378_10001014 | |||
| 1285 | Ga0163162_10004789 | |||
| 1286 | Ga0163162_10034437 | |||
| 1287 | Ga0163162_10094887 | |||
| 1288 | Ga0157372_10512868 | |||
| 1289 | Ga0157372_10527579 | |||
| 1290 | Ga0157372_10693658 | |||
| 1291 | Ga0157375_10007164 | |||
| 1292 | Ga0157375_10046996 | |||
| 1293 | Ga0157375_10062319 | |||
| 1294 | Ga0157375_10625998 | |||
| 1295 | Ga0157375_10956488 | |||
| 1296 | Ga0157375_11030877 | |||
| 1297 | Ga0163163_10002283 | |||
| 1298 | Ga0163163_10182766 | |||
| 1299 | Ga0163163_10253750 | |||
| 1300 | Ga0163163_10417531 | |||
| 1301 | Ga0163163_10850410 | |||
| 1302 | Ga0163163_11043974 | |||
| 1303 | Ga0157380_10000564 | |||
| 1304 | Ga0157380_10004485 | |||
| 1305 | Ga0157380_10049861 | |||
| 1306 | Ga0157380_10395023 | |||
| 1307 | Ga0157380_10690312 | |||
| 1308 | Ga0157379_10007290 | |||
| 1309 | Ga0157379_10179704 | |||
| 1310 | Ga0157379_10186075 | |||
| 1311 | Ga0157376_10087877 | |||
| 1312 | Ga0157376_10088985 | |||
| 1313 | Ga0157376_10134875 | |||
| 1314 | Ga0157376_10303922 | |||
| 1315 | Ga0163161_10094961 | |||
| 1316 | Ga0163161_10190472 | |||
| 1317 | Ga0163161_10311968 | |||
| 1318 | Ga0206352_10606286 | |||
| 1319 | Ga0206354_10982706 | |||
| 1320 | Ga0213873_10034400 | |||
| 1321 | Ga0213872_10217657 | |||
| 1322 | Ga0213874_10008195 | |||
| 1323 | Ga0213876_10025709 | |||
| 1324 | Ga0213871_10047548 | |||
| 1325 | Ga0224712_10089782 | |||
| 1326 | Ga0207696_1000233 | |||
| 1327 | Ga0207682_10016743 | |||
| 1328 | Ga0207682_10154025 | |||
| 1329 | Ga0207682_10220271 | |||
| 1330 | Ga0207692_10274734 | |||
| 1331 | Ga0207642_10104614 | |||
| 1332 | Ga0207642_10114923 | |||
| 1333 | Ga0207710_10000134 | |||
| 1334 | Ga0207688_10011204 | |||
| 1335 | Ga0207688_10089417 | |||
| 1336 | Ga0207680_10022394 | |||
| 1337 | Ga0207680_10044186 | |||
| 1338 | Ga0207680_10094026 | |||
| 1339 | Ga0207685_10056257 | |||
| 1340 | Ga0207685_10056342 | |||
| 1341 | Ga0207699_10006505 | |||
| 1342 | Ga0207699_10068219 | |||
| 1343 | Ga0207699_10129750 | |||
| 1344 | Ga0207645_10021062 | |||
| 1345 | Ga0207643_10023419 | |||
| 1346 | Ga0207643_10081320 | |||
| 1347 | Ga0207654_10073944 | |||
| 1348 | Ga0207654_10141750 | |||
| 1349 | Ga0207707_10001543 | |||
| 1350 | Ga0207707_10003173 | |||
| 1351 | Ga0207707_10028857 | |||
| 1352 | Ga0207707_10051661 | |||
| 1353 | Ga0207707_10088373 | |||
| 1354 | Ga0207707_10212549 | |||
| 1355 | Ga0207695_10016760 | |||
| 1356 | Ga0207695_10019323 | |||
| 1357 | Ga0207695_10056194 | |||
| 1358 | Ga0207695_10083519 | |||
| 1359 | Ga0207695_10272462 | |||
| 1360 | Ga0207695_10518111 | |||
| 1361 | Ga0207671_10085610 | |||
| 1362 | Ga0207671_10111624 | |||
| 1363 | Ga0207671_10422539 | |||
| 1364 | Ga0207693_10000060 | |||
| 1365 | Ga0207693_10150327 | |||
| 1366 | Ga0207663_10039149 | |||
| 1367 | Ga0207663_10112541 | |||
| 1368 | Ga0207663_10196252 | |||
| 1369 | Ga0207663_10352115 | |||
| 1370 | Ga0207663_10439002 | |||
| 1371 | Ga0207660_10008463 | |||
| 1372 | Ga0207660_10081294 | |||
| 1373 | Ga0207662_10001837 | |||
| 1374 | Ga0207662_10021449 | |||
| 1375 | Ga0207662_10153545 | |||
| 1376 | Ga0207657_10183600 | |||
| 1377 | Ga0207657_10199272 | |||
| 1378 | Ga0207649_10003228 | |||
| 1379 | Ga0207652_10004353 | |||
| 1380 | Ga0207652_10010556 | |||
| 1381 | Ga0207652_10015264 | |||
| 1382 | Ga0207652_10088628 | |||
| 1383 | Ga0207652_10411630 | |||
| 1384 | Ga0207652_10432539 | |||
| 1385 | Ga0207681_10005399 | |||
| 1386 | Ga0207681_10008472 | |||
| 1387 | Ga0207681_10108548 | |||
| 1388 | Ga0207694_10007297 | |||
| 1389 | Ga0207694_10090347 | |||
| 1390 | Ga0207694_10129750 | |||
| 1391 | Ga0207694_10475975 | |||
| 1392 | Ga0207694_10494674 | |||
| 1393 | Ga0207694_10516337 | |||
| 1394 | Ga0207650_10218765 | |||
| 1395 | Ga0207659_10007724 | |||
| 1396 | Ga0207659_10128001 | |||
| 1397 | Ga0207687_10020018 | |||
| 1398 | Ga0207687_10249586 | |||
| 1399 | Ga0207700_10178543 | |||
| 1400 | Ga0207700_10338562 | |||
| 1401 | Ga0207664_10026898 | |||
| 1402 | Ga0207664_10119366 | |||
| 1403 | Ga0207664_10166820 | |||
| 1404 | Ga0207664_10486794 | |||
| 1405 | Ga0207644_10005621 | |||
| 1406 | Ga0207644_10028162 | |||
| 1407 | Ga0207644_10108544 | |||
| 1408 | Ga0207644_10545815 | |||
| 1409 | Ga0207706_10063149 | |||
| 1410 | Ga0207706_10221399 | |||
| 1411 | Ga0207686_10029965 | |||
| 1412 | Ga0207686_10174231 | |||
| 1413 | Ga0207709_10058782 | |||
| 1414 | Ga0207709_10089429 | |||
| 1415 | Ga0207670_10001069 | |||
| 1416 | Ga0207670_10007447 | |||
| 1417 | Ga0207669_10121798 | |||
| 1418 | Ga0207704_10035222 | |||
| 1419 | Ga0207704_10035590 | |||
| 1420 | Ga0207704_10104958 | |||
| 1421 | Ga0207665_10106806 | |||
| 1422 | Ga0207665_10129106 | |||
| 1423 | Ga0207691_10041098 | |||
| 1424 | Ga0207691_10054401 | |||
| 1425 | Ga0207691_10092622 | |||
| 1426 | Ga0207691_10349931 | |||
| 1427 | Ga0207691_10374239 | |||
| 1428 | Ga0207711_10021029 | |||
| 1429 | Ga0207711_10033562 | |||
| 1430 | Ga0207689_10003184 | |||
| 1431 | Ga0207689_10005643 | |||
| 1432 | Ga0207689_10034667 | |||
| 1433 | Ga0207689_10058002 | |||
| 1434 | Ga0207689_10102823 | |||
| 1435 | Ga0207689_10608249 | |||
| 1436 | Ga0207661_10152182 | |||
| 1437 | Ga0207679_10004338 | |||
| 1438 | Ga0207667_10016427 | |||
| 1439 | Ga0207667_10058510 | |||
| 1440 | Ga0207667_10100314 | |||
| 1441 | Ga0207651_10011314 | |||
| 1442 | Ga0207651_10194290 | |||
| 1443 | Ga0207712_10028335 | |||
| 1444 | Ga0207712_10088051 | |||
| 1445 | Ga0207712_10214280 | |||
| 1446 | Ga0207668_10006314 | |||
| 1447 | Ga0207668_10062012 | |||
| 1448 | Ga0207668_10417258 | |||
| 1449 | Ga0207640_10228084 | |||
| 1450 | Ga0207658_10000746 | |||
| 1451 | Ga0207658_10035725 | |||
| 1452 | Ga0207658_10080406 | |||
| 1453 | Ga0207677_10307895 | |||
| 1454 | Ga0207677_10394144 | |||
| 1455 | Ga0207703_10006491 | |||
| 1456 | Ga0207703_10023005 | |||
| 1457 | Ga0207703_10273757 | |||
| 1458 | Ga0207703_10325660 | |||
| 1459 | Ga0207678_10117262 | |||
| 1460 | Ga0207678_10186751 | |||
| 1461 | Ga0207678_10491082 | |||
| 1462 | Ga0207708_10002930 | |||
| 1463 | Ga0207708_10019921 | |||
| 1464 | Ga0207708_10052608 | |||
| 1465 | Ga0207702_10468499 | |||
| 1466 | Ga0207641_10020854 | |||
| 1467 | Ga0207641_10032206 | |||
| 1468 | Ga0207641_10080947 | |||
| 1469 | Ga0207641_10124033 | |||
| 1470 | Ga0207641_10220871 | |||
| 1471 | Ga0207648_10033506 | |||
| 1472 | Ga0207648_10056227 | |||
| 1473 | Ga0207648_10062537 | |||
| 1474 | Ga0207648_10195170 | |||
| 1475 | Ga0207648_10235027 | |||
| 1476 | Ga0207676_10030831 | |||
| 1477 | Ga0207676_10054459 | |||
| 1478 | Ga0207674_10002937 | |||
| 1479 | Ga0207674_10044200 | |||
| 1480 | Ga0207674_10136730 | |||
| 1481 | Ga0207674_10444513 | |||
| 1482 | Ga0207675_100012082 | |||
| 1483 | Ga0207675_100014060 | |||
| 1484 | Ga0207675_100039748 | |||
| 1485 | Ga0207675_100071244 | |||
| 1486 | Ga0207675_100073376 | |||
| 1487 | Ga0207675_100169855 | |||
| 1488 | Ga0207675_100184546 | |||
| 1489 | Ga0207683_10000725 | |||
| 1490 | Ga0207683_10016355 | |||
| 1491 | Ga0207683_10098606 | |||
| 1492 | Ga0207698_10353178 | |||
| 1493 | Ga0207698_10441365 | |||
| 1494 | Ga0207698_10546310 | |||
| 1495 | Ga0209996_1027205 | |||
| 1496 | Ga0209179_1004192 | |||
| 1497 | Ga0209968_1014943 | |||
| 1498 | Ga0209970_1006836 | |||
| 1499 | Ga0209983_1022019 | |||
| 1500 | Ga0209282_1124346 | |||
| 1501 | Ga0209588_1006407 | |||
| 1502 | Ga0209971_1024572 | |||
| 1503 | Ga0207428_10003346 | |||
| 1504 | Ga0207428_10010873 | |||
| 1505 | Ga0207428_10029673 | |||
| 1506 | Ga0207428_10072216 | |||
| 1507 | Ga0265354_1000452 | |||
| 1508 | Ga0268266_10000379 | |||
| 1509 | Ga0268266_10012525 | |||
| 1510 | Ga0268266_10028183 | |||
| 1511 | Ga0268266_10059617 | |||
| 1512 | Ga0268266_10088237 | |||
| 1513 | Ga0268266_10141977 | |||
| 1514 | Ga0268265_10001420 | |||
| 1515 | Ga0268265_10003956 | |||
| 1516 | Ga0268265_10201552 | |||
| 1517 | Ga0268265_10207141 | |||
| 1518 | Ga0268265_10324277 | |||
| 1519 | Ga0268265_10697643 | |||
| 1520 | Ga0268264_10100553 | |||
| 1521 | Ga0268264_10219637 | |||
| 1522 | Ga0265336_10062451 | |||
| 1523 | Ga0265338_10577724 | |||
| 1524 | Ga0307511_10000205 | |||
| 1525 | Ga0265771_1000877 | |||
| 1526 | Ga0265760_10006824 | |||
| 1527 | Ga0265760_10032528 | |||
| 1528 | Ga0265328_10005536 | |||
| 1529 | Ga0265340_10170232 | |||
| 1530 | Ga0265331_10003719 | |||
| 1531 | Ga0265316_10200203 | |||
| 1532 | Ga0307513_10004439 | |||
| 1533 | Ga0307513_10023132 | |||
| 1534 | Ga0307513_10117908 | |||
| 1535 | Ga0307513_10240229 | |||
| 1536 | Ga0307509_10003290 | |||
| 1537 | Ga0307509_10074603 | |||
| 1538 | Ga0307509_10176404 | |||
| 1539 | Ga0307509_10291038 | |||
| 1540 | Ga0307408_100007954 | |||
| 1541 | Ga0307408_100067805 | |||
| 1542 | Ga0307408_100573572 | |||
| 1543 | Ga0307408_100801003 | |||
| 1544 | Ga0265313_10191223 | |||
| 1545 | Ga0307514_10070352 | |||
| 1546 | Ga0316579_10096331 | |||
| 1547 | Ga0316576_10004220 | |||
| 1548 | Ga0316576_10006006 | |||
| 1549 | Ga0316576_10051064 | |||
| 1550 | Ga0316576_10058792 | |||
| 1551 | Ga0316576_10130493 | |||
| 1552 | Ga0316578_10038327 | |||
| 1553 | Ga0316578_10049058 | |||
| 1554 | Ga0307516_10001444 | |||
| 1555 | Ga0307516_10313022 | |||
| 1556 | Ga0307405_10113685 | |||
| 1557 | Ga0307405_10343766 | |||
| 1558 | Ga0307405_10377969 | |||
| 1559 | Ga0316577_10190139 | |||
| 1560 | Ga0316577_10237451 | |||
| 1561 | Ga0307413_10052850 | |||
| 1562 | Ga0307413_10089667 | |||
| 1563 | Ga0307413_10145928 | |||
| 1564 | Ga0307413_10617671 | |||
| 1565 | Ga0307410_10010276 | |||
| 1566 | Ga0307410_10016545 | |||
| 1567 | Ga0307410_10240322 | |||
| 1568 | Ga0307410_10541973 | |||
| 1569 | Ga0307406_10010078 | |||
| 1570 | Ga0307407_10030054 | |||
| 1571 | Ga0307407_10100645 | |||
| 1572 | Ga0307407_10139467 | |||
| 1573 | Ga0307407_10470458 | |||
| 1574 | Ga0307412_10020499 | |||
| 1575 | Ga0307409_100008024 | |||
| 1576 | Ga0307409_100011112 | |||
| 1577 | Ga0307409_100034857 | |||
| 1578 | Ga0307409_100047572 | |||
| 1579 | Ga0307409_100117408 | |||
| 1580 | Ga0307416_100002338 | |||
| 1581 | Ga0307416_100011041 | |||
| 1582 | Ga0307416_100454438 | |||
| 1583 | Ga0307416_101109709 | |||
| 1584 | Ga0307414_10026624 | |||
| 1585 | Ga0307411_10001695 | |||
| 1586 | Ga0307411_10011621 | |||
| 1587 | Ga0307411_10013463 | |||
| 1588 | Ga0307415_100001478 | |||
| 1589 | Ga0307415_100205961 | |||
| 1590 | Ga0307415_100467538 | |||
| 1591 | Ga0307510_10000009 | |||
| 1592 | Ga0373948_0038589 | |||
| 1593 | Ga0373958_0052080 | |||
| 1594 | Ga0373928_0061227 | |||
| 1595 | Ga0373940_0015761 | |||
| 1596 | Ga0373936_0016115 | |||
| 1597 | Ga0373939_0116197 | |||
| 1598 | Ga0373943_0179037 | |||
| 1599 | Ga0373946_0140342 | |||
| 1600 | Ga0373942_0093196 | |||
| 1601 | Ga0316574_0000207 | |||
| 1602 | Ga0316574_0032511 | |||
| 1603 | Ga0316574_0143602 | |||
| 1604 | Ga0316574_0214450 | |||
| 1605 | Ga0373931_0065594 | |||
| 1606 | Ga0373931_0206291 | |||
| 1607 | Ga0373935_0179044 | |||
| 1608 | Ga0373935_0380516 | |||
| 1609 | Ga0373927_0049029 | |||
| 1610 | Ga0373933_0170731 | |||
| 1611 | Ga0373933_0365360 | |||
| 1612 | Ga0373947_0289294 | |||
| 1613 | Ga0373937_0041078 | |||
| 1614 | Ga0373937_0228110 | |||
| 1615 | Ga0316584_0055222 | |||
| 1616 | Ga0316584_0059102 | |||
| 1617 | Ga0316584_0155374 | |||
| 1618 | Ga0316584_0513131 | |||
| 1619 | Ga0373925_0125185 | |||
| 1620 | Ga0373925_0248624 | |||
| 1621 | Ga0373925_0452040 | |||
| 1622 | Ga0395898_0001660 | |||
| 1623 | Ga0395905_0983593 | |||
| 1624 | Ga0436364_1486386 | |||
| 1625 | Ga0400490_25125 | |||
| 1626 | Ga0400491_25862 | |||
| 1627 | Ga0400488_07793 | |||
| 1628 | Ga0400487_37126 | |||
| 1629 | Ga0436365_0124606 | |||
| 1630 | Ga0436365_0738787 | |||
| 1631 | Ga0436365_1419348 | |||
| 1632 | Ga0436365_1481439 | |||
| 1633 | Ga0436360_0186635 | |||
| 1634 | Ga0436360_1334710 | |||
| 1635 | Ga0436361_0288482 | |||
| 1636 | Ga0436361_0701045 | |||
| 1637 | Ga0436363_0138643 | |||
| 1638 | Ga0436363_0534818 | |||
| 1639 | Ga0436363_0886114 | |||
| 1640 | Ga0436363_0993770 | |||
| 1641 | Ga0436363_1121322 | |||
| 1642 | Ga0436362_1039113 | |||
| 1643 | Ga0436362_1099453 | |||
| 1644 | Ga0439436_0032660 | |||
| 1645 | Ga0439453_0025863 | |||
| 1646 | Ga0451789_0597622 | |||
| 1647 | Ga0451793_1537572 | |||
| 1648 | Ga0451793_1883906 | |||
| 1649 | Ga0451797_0849944 | |||
| 1650 | Ga0451798_0432427 | |||
| 1651 | Ga0451800_0647490 | |||
| 1652 | Ga0451800_1186171 | |||
| 1653 | Ga0451807_1566691 | |||
| 1654 | Ga0451841_0202325 | |||
| 1655 | Ga0451851_0634362 | |||
| 1656 | Ga0451853_3901512 | |||
| 1657 | Ga0439441_035253 | |||
| 1658 | Ga0439456_059445 | |||
| 1659 | Ga0439463_044737 | |||
| 1660 | Ga0450921_000860 | |||
| 1661 | Ga0450923_000137 | |||
| 1662 | Ga0450894_002178 | |||
| 1663 | Ga0450896_000317 | |||
| 1664 | Ga0450898_001506 | |||
| 1665 | Ga0450910_005064 | |||
| 1666 | Ga0439446_0004572 | |||
| 1667 | Ga0439446_0011559 | |||
| 1668 | Ga0439446_0138533 | |||
| 1669 | Ga0450908_002586 | |||
| 1670 | Ga0439434_0000568 | |||
| 1671 | Ga0439435_0010755 | |||
| 1672 | Ga0439444_0000334 | |||
| 1673 | Ga0439444_0031488 | |||
| 1674 | Ga0439459_0016993 | |||
| 1675 | Ga0439460_0003028 | |||
| 1676 | Ga0450916_008956 | |||
| 1677 | Ga0451577_0036730 | |||
| 1678 | Ga0466969_0083705 | |||
| 1679 | Ga0466966_0026246 | |||
| 1680 | Ga0466966_0372522 | |||
| 1681 | Ga0453684_0295348 | |||
| 1682 | Ga0466957_0784532 | |||
| 1683 | Ga0466960_0030401 | |||
| 1684 | Ga0466959_0006207 | |||
| 1685 | Ga0466959_0009242 | |||
| 1686 | Ga0466959_0042845 | |||
| 1687 | Ga0466959_0070811 | |||
| 1688 | Ga0451576_0034057 | |||
| 1689 | Ga0495590_0134962 | |||
| 1690 | Ga0495591_045564 | |||
| 1691 | Ga0495629_0363109 | |||
| 1692 | Ga0495638_0001279 | |||
| 1693 | Ga0495580_0450157 | |||
| 1694 | Ga0495582_0183720 | |||
| 1695 | Ga0495639_0243144 | |||
| 1696 | Ga0495664_0115219 | |||
| 1697 | Ga0495584_0067299 | |||
| 1698 | Ga0495596_0080818 | |||
| 1699 | Ga0495616_0006051 | |||
| 1700 | Ga0495618_0185442 | |||
| 1701 | Ga0495628_0071937 | |||
| 1702 | Ga0495630_0033559 | |||
| 1703 | Ga0495630_0262314 | |||
| 1704 | Ga0495630_0532580 | |||
| 1705 | Ga0495632_0043607 | |||
| 1706 | Ga0495632_0061014 | |||
| 1707 | Ga0495632_0068367 | |||
| 1708 | Ga0495648_0145103 | |||
| 1709 | Ga0495654_0073726 | |||
| 1710 | Ga0495640_0234724 | |||
| 1711 | Ga0495586_0157365 | |||
| 1712 | Ga0495587_0295000 | |||
| 1713 | Ga0495622_0085692 | |||
| 1714 | Ga0495633_0074390 | |||
| 1715 | Ga0495656_0065987 | |||
| 1716 | Ga0495668_0142910 | |||
| 1717 | Ga0495668_0231927 | |||
| 1718 | Ga0495611_0158022 | |||
| 1719 | Ga0495625_0001239 | |||
| 1720 | Ga0495625_0186302 | |||
| 1721 | Ga0495635_0356150 | |||
| 1722 | Ga0495599_0173505 | |||
| 1723 | Ga0495647_0087215 | |||
| 1724 | Ga0495658_0588444 | |||
| 1725 | Ga0495671_0010128 | |||
| 1726 | Ga0495671_0065823 | |||
| 1727 | Ga0495671_0243937 | |||
| 1728 | Ga0495649_0099653 | |||
| 1729 | Ga0495674_0067917 | |||
| 1730 | Ga0495674_0176591 | |||
| 1731 | Ga0495672_0077199 | |||
| 1732 | Ga0495686_0203801 | |||
| 1733 | Ga0495686_0220284 | |||
| 1734 | Ga0496100_0004572 | |||
| 1735 | Ga0496100_0205037 | |||
| 1736 | Ga0496101_0002164 | |||
| 1737 | Ga0496101_0180353 | |||
| 1738 | Ga0496101_0532760 | |||
| 1739 | Ga0496102_0007024 | |||
| 1740 | Ga0496102_0067437 | |||
| 1741 | Ga0496102_0084368 | |||
| 1742 | Ga0496102_0108790 | |||
| 1743 | Ga0496102_0601944 | |||
| 1744 | Ga0496103_0131504 | |||
| 1745 | Ga0496103_0507447 | |||
| 1746 | Ga0496104_0016553 | |||
| 1747 | Ga0496105_0011414 | |||
| 1748 | Ga0496105_0020813 | |||
| 1749 | Ga0496106_0003997 | |||
| 1750 | Ga0496106_0049060 | |||
| 1751 | Ga0496107_0009320 | |||
| 1752 | Ga0496107_0193292 | |||
| 1753 | Ga0496108_0006755 | |||
| 1754 | Ga0496108_0392611 | |||
| 1755 | Ga0496108_0431769 | |||
| 1756 | Ga0496109_0001391 | |||
| 1757 | Ga0496109_0156598 | |||
| 1758 | Ga0496110_0005095 | |||
| 1759 | Ga0496110_0048188 | |||
| 1760 | Ga0496111_0003948 | |||
| 1761 | Ga0496112_0094457 | |||
| 1762 | Ga0496112_0208483 | |||
| 1763 | Ga0496113_0014370 | |||
| 1764 | Ga0496113_0089788 | |||
| 1765 | Ga0496114_0003345 | |||
| 1766 | Ga0496114_0581430 | |||
| 1767 | Ga0496115_0008741 | |||
| 1768 | Ga0496115_0037484 | |||
| 1769 | Ga0496115_0389434 | |||
| 1770 | Ga0496115_0824483 | |||
| 1771 | Ga0496117_0000099 | |||
| 1772 | Ga0496118_0000105 | |||
| 1773 | Ga0496119_0022550 | |||
| 1774 | Ga0496119_0356042 | |||
| 1775 | Ga0496120_0057067 | |||
| 1776 | Ga0496120_0244554 | |||
| 1777 | Ga0496121_0000772 | |||
| 1778 | Ga0496121_0038922 | |||
| 1779 | Ga0496121_0089235 | |||
| 1780 | Ga0496124_0053017 | |||
| 1781 | Ga0496125_0001407 | |||
| 1782 | Ga0496125_0015680 | |||
| 1783 | Ga0496126_0001705 | |||
| 1784 | Ga0496126_0045294 | |||
| 1785 | Ga0501299_007008 | |||
| 1786 | Ga0501032_0022084 | |||
| 1787 | Ga0501034_0361212 | |||
| 1788 | Ga0501034_0720714 | |||
| 1789 | Ga0501036_0008935 | |||
| 1790 | Ga0501038_0026078 | |||
| 1791 | Ga0501038_0338404 | |||
| 1792 | Ga0501038_0389330 | |||
| 1793 | Ga0501039_0003228 | |||
| 1794 | Ga0501039_0567414 | |||
| 1795 | Ga0501040_0003733 | |||
| 1796 | Ga0501040_0166380 | |||
| 1797 | Ga0501041_0313382 | |||
| 1798 | Ga0501042_0107371 | |||
| 1799 | Ga0501042_0416106 | |||
| 1800 | Ga0501048_0287717 | |||
| 1801 | Ga0501067_0023647 | |||
| 1802 | Ga0501068_0014527 | |||
| 1803 | Ga0501068_0091577 | |||
| 1804 | Ga0501070_0358712 | |||
| 1805 | Ga0501071_0000497 | |||
| 1806 | Ga0501071_0003420 | |||
| 1807 | Ga0501071_0190450 | |||
| 1808 | Ga0501071_0197132 | |||
| 1809 | Ga0501072_0056549 | |||
| 1810 | Ga0501072_0059319 | |||
| 1811 | Ga0501072_0165848 | |||
| 1812 | Ga0501072_0257420 | |||
| 1813 | Ga0501073_0003564 | |||
| 1814 | Ga0501073_0009069 | |||
| 1815 | Ga0501073_0141368 | |||
| 1816 | Ga0501073_0153826 | |||
| 1817 | Ga0501074_0011114 | |||
| 1818 | Ga0501074_0288634 | |||
| 1819 | Ga0501075_0017587 | |||
| 1820 | Ga0501075_0058296 | |||
| 1821 | Ga0501075_0308300 | |||
| 1822 | Ga0501076_0004515 | |||
| 1823 | Ga0501076_0089815 | |||
| 1824 | Ga0501077_0001025 | |||
| 1825 | Ga0501077_0055665 | |||
| 1826 | Ga0501079_0004155 | |||
| 1827 | Ga0501079_0277096 | |||
| 1828 | Ga0501080_0005088 | |||
| 1829 | Ga0501080_0009460 | |||
| 1830 | Ga0501080_0117354 | |||
| 1831 | Ga0501081_0041701 | |||
| 1832 | Ga0501083_0025130 | |||
| 1833 | Ga0501083_0051954 | |||
| 1834 | Ga0501083_0278070 | |||
| 1835 | Ga0501035_0917575 | |||
| 1836 | nmdc:mga05p37_168_c1 | |||
| 1837 | nmdc:mga05p37_29033_c2 | |||
| 1838 | nmdc:mga09592_10179_c1 | |||
| 1839 | nmdc:mga09592_504_c1 | |||
| 1840 | nmdc:mga0qj67_280627_c1 | |||
| 1841 | nmdc:mga0qj67_5835_c1 | |||
| 1842 | nmdc:mga06r32_344365_c1 | |||
| 1843 | nmdc:mga06r32_90_c1 | |||
| 1844 | nmdc:mga06r32_9_c1 | |||
| 1845 | nmdc:mga08y16_1158_c1 | |||
| 1846 | nmdc:mga08y16_179769_c1 | |||
| 1847 | nmdc:mga08y16_59465_c1 | |||
| 1848 | nmdc:mga08y16_616515_c1 | |||
| 1849 | nmdc:mga08y16_64510_c1 | |||
| 1850 | nmdc:mga0n895_87_c1 | |||
| 1851 | nmdc:mga0rr50_842550_c1 | |||
| 1852 | nmdc:mga0rr50_9835_c1 | |||
| 1853 | nmdc:mga08x19_122046_c1 | |||
| 1854 | nmdc:mga0a205_73_c1 | |||
| 1855 | Ga0495612_0072104 | |||
| 1856 | Ga0495655_0013271 | |||
| 1857 | Ga0500578_0272086 | |||
| 1858 | Ga0500644_0130816 | |||
| 1859 | Ga0500583_0009635 | |||
| 1860 | Ga0500651_0115122 | |||
| 1861 | Ga0500651_0209733 | |||
| 1862 | Ga0500641_0013838 | |||
| 1863 | Ga0500556_0000174 | |||
| 1864 | Ga0500556_0047263 | |||
| 1865 | Ga0500556_0136022 | |||
| 1866 | Ga0500594_0043115 | |||
| 1867 | Ga0500617_015195 | |||
| 1868 | Ga0500655_004693 | |||
| 1869 | Ga0500658_0028219 | |||
| 1870 | Ga0500658_0131769 | |||
| 1871 | Ga0500568_0119886 | |||
| 1872 | Ga0500588_0001164 | |||
| 1873 | Ga0500588_0004234 | |||
| 1874 | Ga0500604_0012558 | |||
| 1875 | Ga0500622_0039171 | |||
| 1876 | Ga0500627_0184996 | |||
| 1877 | Ga0500630_059666 | |||
| 1878 | Ga0500639_018575 | |||
| 1879 | Ga0500636_0136875 | |||
| 1880 | Ga0500637_0104350 | |||
| 1881 | Ga0500637_0302596 | |||
| 1882 | Ga0501084_0000568 | |||
| 1883 | Ga0501084_0347563 | |||
| 1884 | Ga0587077_063278 | |||
| 1885 | Ga0501082_0009537 | |||
| 1886 | Ga0501082_0077167 | |||
| 1887 | Ga0501082_0147269 | |||
| 1888 | Ga0530510_0361235 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5sv0-assembly1.cif.gz_B | structure of the exbb/exbd complex from e. coli at ph 7.0 | 0.6501 | 20 | 189 |
| 6ye4-assembly1.cif.gz_C | structure of exbb pentamer from serratia marcescens by single particle cryo electron microscopy | 0.5895 | 7 | 184 |
| 5sv0-assembly1.cif.gz_B | structure of the exbb/exbd complex from e. coli at ph 7.0 | 0.5859 | 20 | 189 |
| 5sv0-assembly2.cif.gz_J | structure of the exbb/exbd complex from e. coli at ph 7.0 | 0.5682 | 23 | 189 |
| 6tyi-assembly1.cif.gz_D | exbb-exbd complex in msp1e3d1 nanodisc | 0.568 | 23 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5kc4E00 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.5456 | 76 | 183 | 1.10.1760.20 |
| 1t8bA01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.5425 | 25 | 182 | 1.20.58.220 |
| af_D3ZUH2_40_162_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.533 | 28 | 188 | 1.20.58.70 |
| 1t8bB01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.5242 | 25 | 182 | 1.20.58.220 |
| af_D3ZUH2_40_162_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5171 | 28 | 188 | 1.20.58.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A657B547-F1-model_v4 | Flagellar motor protein MotA | 0.8104 | 19 | 184 |
GO:0005886
GO:0017038 |
| AF-A0A661C4G6-F1-model_v4 | MotA/TolQ/ExbB proton channel family protein | 0.8067 | 5 | 123 |
GO:0005886
GO:0017038 |
| AF-A0A536UT80-F1-model_v4 | MotA/TolQ/ExbB proton channel family protein | 0.7989 | 1 | 187 |
GO:0005886
GO:0017038 |
| AF-B4X0Q2-F1-model_v4 | Transporter, MotA/TolQ/ExbB proton channel family protein | 0.7984 | 2 | 188 |
GO:0005886
GO:0017038 |
| AF-A0A7C1GXX7-F1-model_v4 | MotA/TolQ/ExbB proton channel family protein | 0.7972 | 4 | 187 |
GO:0005886
GO:0017038 |