F486215

General Info

Members Datasets Scaffolds Average Seq Length
936 457 849 329

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2747842501|2748015858
Length 395
Sequence FAFQTNHESRITNHESPLMSKRDYYEVLGVARGASDEELKKAYRRCAMKHHPDRNPGDAASEALFKECKEAYEVLSDGNKRRAYDAHGHAAFEHGMGGGGGGGPGGPDMGDIFGDIFGNIFGGGAAGPRAARRGADVGYVLELDLEEAVAGIERRIEIPTLIECEPCHGSGSEDGKVETCATCHGRGQVRIQRGIFAMQQSCPHCDGRGTLIQNPCKTCHGAGRVEEDKVLSIKVPAGVDTGDRIRLAGEGEAGPAGTPPGDLYVEVRVREHAIFQRDGDDLHCEVPIRISQAALGDTVRVATLGGEAEIRIPAETQTGKLFRLRGKGVRSVRSRSEGDLYCRVVVETPVNLTADQRELLQQFEATFTGEDARKHSPKSATFIDGVKGFWDRMTS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
4 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
5 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
6 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
7 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
8 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
9 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
10 2643221559 Lysobacter sp. Root559 Isolate Unclassified
11 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
12 2643221573 Lysobacter sp. Root604 Isolate Unclassified
13 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
14 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
15 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
16 2643221586 Lysobacter sp. Root667 Isolate Unclassified
17 2643221593 Lysobacter sp. Root690 Isolate Unclassified
18 2643221612 Lysobacter sp. Root76 Isolate Unclassified
19 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
20 2643221695 Lysobacter sp. Root494 Isolate Unclassified
21 2643221720 Lysobacter sp. Root916 Isolate Unclassified
22 2643221727 Lysobacter sp. Root96 Isolate Unclassified
23 2643221728 Lysobacter sp. Root983 Isolate Unclassified
24 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
25 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
26 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
27 2734482264 Dyella sp. AD052 Isolate Unclassified
28 2738543009 Luteibacter sp. OK325 Isolate Unclassified
29 2739367700 Dyella sp. YR388 Isolate Unclassified
30 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
31 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
32 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
33 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
34 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
35 2818991457 Xanthomonas translucens 569 Isolate Unclassified
36 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
37 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
38 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
39 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
40 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
41 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
42 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
43 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
44 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
45 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
46 2884411467 Dyella sp. AD56 Isolate Rhizosphere
47 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
48 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
49 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
50 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
51 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
52 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
53 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
54 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
55 2919085039 Luteibacter sp. 1214 Isolate Unclassified
56 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
57 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
58 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
59 2919404418 Luteibacter sp. 3190 Isolate Unclassified
60 2919513703 Luteimonas sp. 3794 Isolate Unclassified
61 2919675420 Luteimonas terrae 4099 Isolate Unclassified
62 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
63 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
64 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
65 2928963466 Dyella japonica 1073 Isolate Unclassified
66 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
67 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
68 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
69 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
70 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
71 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
72 2941471342 Luteibacter sp. 621 Isolate Unclassified
73 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
74 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
75 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
76 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
77 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
78 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
79 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
80 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
81 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
82 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
83 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
84 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
85 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
86 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
87 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
88 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
89 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
90 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
91 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
92 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
93 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
94 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
95 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
96 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
97 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
98 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
99 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
102 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
103 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
104 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
105 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
106 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
107 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
108 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
109 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
110 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
111 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
112 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
113 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
114 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
115 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
116 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
117 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
118 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
119 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
120 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
121 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
122 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
123 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
124 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
125 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
126 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
127 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
128 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
129 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
130 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
131 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
132 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
133 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
134 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
135 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
136 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
137 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
140 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
141 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
142 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
143 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
144 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
145 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
146 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
147 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
148 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
151 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
152 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
153 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
154 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
155 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
156 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
157 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
158 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
159 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
162 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
163 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
164 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
165 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
168 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
184 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
188 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
189 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
190 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
191 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
192 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
193 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
206 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
208 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
209 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
210 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
213 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
214 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
215 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
219 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
222 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
224 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
227 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
272 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
275 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
276 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
277 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
278 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
279 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
280 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
281 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
282 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
283 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
284 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
285 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
286 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
287 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
288 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
289 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
292 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
293 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
294 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
295 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
300 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
305 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
313 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
314 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
315 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
316 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
317 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
318 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
319 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
320 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
321 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
322 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
323 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
324 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
325 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
326 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
327 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
328 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
329 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
330 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
331 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
332 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
333 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
334 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
335 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
338 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
339 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
340 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
341 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
342 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
343 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
344 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
345 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
346 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
347 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
348 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
349 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
352 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
353 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
354 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
355 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
356 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
357 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
358 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
359 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
360 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
363 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
364 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
365 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
368 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
369 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
370 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
371 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
372 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
373 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
374 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
375 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
376 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
377 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
378 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
379 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
380 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
381 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
382 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
383 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
391 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
392 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
393 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
398 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
399 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
400 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
401 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
406 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
407 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
408 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
409 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
416 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
432 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
433 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
445 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
446 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
447 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
448 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
449 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
450 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
451 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
452 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
453 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
454 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
455 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
456 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
457 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.68
Metatranscriptomes 2.03
Isolates 9.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 16.45
Nodule 0.21
Rhizoplane 2.88
Rhizosphere 62.61
Stem 0
Stem Tuber 0
Unclassified 17.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1669114 2162886007 Bacteria 1244
2 SwRhRL2b_contig_2281198 2162886007 Bacteria 1989
3 SwRhRL2b_contig_3463326 2162886007 Bacteria 3784
4 JGI24736J21556_1005967 3300001904 Bacteria 2057
5 JGI24740J21852_10010136 3300001979 Bacteria 3645
6 JGI24739J22299_10000167 3300001989 Bacteria 21671
7 JGI24737J22298_10003147 3300001990 Bacteria 5860
8 JGI24738J21930_10001643 3300002075 Bacteria 6138
9 JGI25162J39368_1000006 3300002737 Bacteria 405267
10 JGI25162J39368_1001676 3300002737 Bacteria 10879
11 JGI25162J39368_1002831 3300002737 Bacteria 6058
12 JGI25162J39368_1002832 3300002737 Bacteria 6055
13 JGI25162J39368_1004188 3300002737 Bacteria 3508
14 JGI25157J39369_1000760 3300002741 Bacteria 16774
15 JGI25157J39369_1000995 3300002741 Bacteria 13223
16 JGI25157J39369_1001690 3300002741 Bacteria 7464
17 JGI25163J39215_1000001 3300002771 Bacteria 314282
18 JGI25163J39215_1001541 3300002771 Bacteria 3565
19 JGI25164J39214_1000001 3300002772 Bacteria 477015
20 JGI25164J39214_1000049 3300002772 Bacteria 123464
21 JGI25164J39214_1001339 3300002772 Bacteria 6058
22 JGI25164J39214_1001343 3300002772 Bacteria 6025
23 JGI25152J39213_1000102 3300002773 Bacteria 59507
24 JGI25150J39212_1000290 3300002774 Bacteria 26031
25 JGI25151J46595_10000041 3300003187 Bacteria 174472
26 JGI25151J46595_10000269 3300003187 Bacteria 59507
27 JGI25165J46597_1000009 3300003214 Bacteria 467965
28 JGI25165J46597_1002794 3300003214 Bacteria 5059
29 JGI25165J46597_1002992 3300003214 Bacteria 4663
30 JGI25153J46596_10000189 3300003215 Bacteria 59507
31 JGI25153J46596_10007884 3300003215 Bacteria 5169
32 rootH2_10010161 3300003320 Bacteria 4322
33 Ga0006562J51391_1029636 3300003578 Bacteria 10630
34 Ga0006562J51391_1029639 3300003578 Bacteria 5430
35 Ga0055538_1000004 3300003751 Bacteria 615646
36 Ga0055538_1000871 3300003751 Bacteria 7648
37 Ga0055539_1000004 3300003752 Bacteria 615646
38 Ga0055533_1000007 3300003756 Bacteria 615646
39 Ga0055533_1002944 3300003756 Bacteria 3655
40 Ga0055525_1000007 3300003759 Bacteria 615646
41 Ga0055535_1000082 3300003761 Bacteria 106958
42 Ga0055542_1001422 3300003762 Bacteria 11999
43 Ga0055542_1001550 3300003762 Bacteria 10879
44 Ga0055529_1000020 3300003763 Bacteria 324857
45 Ga0055529_1004977 3300003763 Bacteria 1971
46 Ga0055526_1000021 3300003771 Bacteria 180007
47 Ga0055526_1001593 3300003771 Bacteria 15910
48 Ga0055526_1018434 3300003771 Bacteria 2603
49 Ga0055537_1000094 3300003773 Bacteria 66156
50 Ga0055537_1000407 3300003773 Bacteria 28206
51 Ga0055524_1000062 3300003775 Bacteria 135238
52 Ga0055524_1005794 3300003775 Bacteria 5460
53 Ga0055524_1006134 3300003775 Bacteria 5257
54 Ga0055524_1026188 3300003775 Bacteria 1810
55 Ga0055536_1005001 3300003781 Bacteria 6586
56 Ga0055534_1000039 3300003784 Bacteria 104863
57 Ga0055534_1000052 3300003784 Bacteria 91095
58 Ga0055534_1008929 3300003784 Bacteria 2223
59 Ga0055528_1000009 3300003790 Bacteria 224150
60 Ga0055528_1000529 3300003790 Bacteria 29538
61 Ga0055530_10001509 3300003791 Bacteria 16843
62 Ga0055530_10001526 3300003791 Bacteria 16684
63 Ga0055530_10002892 3300003791 Bacteria 10448
64 Ga0055531_10007665 3300003794 Bacteria 5840
65 Ga0055531_10019784 3300003794 Bacteria 2703
66 Ga0055541_1000004 3300003841 Bacteria 615646
67 Ga0058692_1000002 3300003856 Bacteria 508401
68 Ga0065165_1000096 3300005262 Bacteria 144938
69 Ga0065165_1003051 3300005262 Bacteria 12552
70 Ga0065704_10000898 3300005289 Bacteria 21490
71 Ga0065704_10000908 3300005289 Bacteria 11740
72 Ga0065704_10072174 3300005289 Bacteria 9007
73 Ga0065704_10103739 3300005289 Bacteria 2163
74 Ga0065715_10038420 3300005293 Bacteria 1239
75 Ga0070683_100275029 3300005329 Bacteria 1602
76 Ga0070690_100016433 3300005330 Bacteria 4433
77 Ga0070670_100042010 3300005331 Bacteria 3929
78 Ga0070670_100157879 3300005331 Bacteria 1965
79 Ga0070666_10000643 3300005335 Bacteria 21062
80 Ga0070666_10018535 3300005335 Bacteria 4478
81 Ga0070682_100040268 3300005337 Bacteria 2874
82 Ga0070682_100048369 3300005337 Bacteria 2647
83 Ga0070682_100049410 3300005337 Bacteria 2622
84 Ga0070682_100049816 3300005337 Bacteria 2612
85 Ga0070682_100083951 3300005337 Bacteria 2068
86 Ga0070661_100043141 3300005344 Bacteria 3295
87 Ga0070661_100069481 3300005344 Bacteria 2589
88 Ga0070661_100216219 3300005344 Bacteria 1468
89 Ga0070692_10033974 3300005345 Bacteria 2573
90 Ga0070668_100165760 3300005347 Bacteria 1795
91 Ga0070669_100012750 3300005353 Bacteria 5967
92 Ga0070671_100146027 3300005355 Bacteria 1996
93 Ga0070659_100004057 3300005366 Bacteria 10441
94 Ga0070659_100012104 3300005366 Bacteria 6389
95 Ga0070659_100060713 3300005366 Bacteria 2987
96 Ga0070667_100000084 3300005367 Bacteria 118027
97 Ga0070667_100029472 3300005367 Bacteria 4572
98 Ga0070714_100000713 3300005435 Bacteria 23558
99 Ga0070714_100003471 3300005435 Bacteria 11756
100 Ga0070714_100072923 3300005435 Bacteria 2973
101 Ga0070713_100011789 3300005436 Bacteria 6386
102 Ga0070694_100039326 3300005444 Bacteria 3148
103 Ga0070694_100076383 3300005444 Bacteria 2319
104 Ga0070663_100000567 3300005455 Bacteria 19726
105 Ga0070663_100042063 3300005455 Bacteria 3209
106 Ga0070663_100090971 3300005455 Bacteria 2260
107 Ga0070662_100014406 3300005457 Bacteria 5283
108 Ga0070662_100092530 3300005457 Bacteria 2273
109 Ga0070681_10048497 3300005458 Bacteria 4243
110 Ga0070681_10103136 3300005458 Bacteria 2797
111 Ga0070685_10037277 3300005466 Bacteria 2753
112 Ga0070679_100175574 3300005530 Bacteria 2115
113 Ga0070679_100298562 3300005530 Bacteria 1561
114 Ga0068853_100002068 3300005539 Bacteria 14881
115 Ga0068853_100004423 3300005539 Bacteria 10877
116 Ga0068853_100087397 3300005539 Bacteria 2735
117 Ga0070672_100007232 3300005543 Bacteria 7520
118 Ga0070672_100009398 3300005543 Bacteria 6739
119 Ga0070696_100002428 3300005546 Bacteria 12346
120 Ga0070696_100190319 3300005546 Bacteria 1527
121 Ga0070693_100004513 3300005547 Bacteria 6592
122 Ga0070665_100066966 3300005548 Bacteria 3602
123 Ga0068855_100015659 3300005563 Bacteria 9124
124 Ga0068855_100041192 3300005563 Bacteria 5475
125 Ga0068855_100047917 3300005563 Bacteria 5046
126 Ga0068855_100165774 3300005563 Bacteria 2505
127 Ga0070664_100123671 3300005564 Bacteria 2267
128 Ga0068857_100013607 3300005577 Bacteria 7088
129 Ga0068857_100049199 3300005577 Bacteria 3740
130 Ga0068857_100091456 3300005577 Bacteria 2724
131 Ga0068857_100194968 3300005577 Bacteria 1846
132 Ga0068854_100020288 3300005578 Bacteria 4494
133 Ga0068854_100030961 3300005578 Bacteria 3715
134 Ga0068856_100010251 3300005614 Bacteria 9109
135 Ga0068856_100184765 3300005614 Bacteria 2098
136 Ga0068852_100037510 3300005616 Bacteria 4064
137 Ga0068852_100057147 3300005616 Bacteria 3375
138 Ga0068852_100087785 3300005616 Bacteria 2776
139 Ga0068864_100005151 3300005618 Bacteria 10705
140 Ga0068864_100058813 3300005618 Bacteria 3324
141 Ga0068870_10091235 3300005840 Bacteria 1704
142 Ga0068863_100000773 3300005841 Bacteria 32109
143 Ga0068863_100298084 3300005841 Bacteria 1564
144 Ga0068858_100010775 3300005842 Bacteria 8644
145 Ga0068858_100044385 3300005842 Bacteria 4120
146 Ga0068860_100025495 3300005843 Bacteria 5704
147 Ga0068860_100132629 3300005843 Bacteria 2392
148 Ga0075364_10001000 3300006051 Bacteria 14962
149 Ga0075364_10096758 3300006051 Bacteria 1963
150 Ga0075364_10157042 3300006051 Bacteria 1534
151 Ga0070712_100047957 3300006175 Unclassified 2959
152 Ga0075428_100003215 3300006844 Bacteria 17873
153 Ga0075430_100042014 3300006846 Bacteria 3867
154 Ga0075429_100020882 3300006880 Bacteria 5682
155 Ga0079104_1003337 3300006946 Bacteria 7573
156 Ga0099794_10093976 3300007265 Bacteria 1491
157 Ga0099795_10002255 3300007788 Bacteria 4482
158 Ga0105251_10000880 3300009011 Bacteria 26879
159 Ga0105244_10000023 3300009036 Bacteria 233110
160 Ga0105244_10003761 3300009036 Bacteria 10713
161 Ga0105244_10048461 3300009036 Bacteria 2174
162 Ga0105244_10058609 3300009036 Bacteria 1942
163 Ga0105250_10000028 3300009092 Bacteria 204198
164 Ga0105250_10000925 3300009092 Bacteria 17260
165 Ga0105250_10005988 3300009092 Bacteria 5366
166 Ga0105240_10000218 3300009093 Bacteria 115562
167 Ga0105240_10012434 3300009093 Bacteria 11750
168 Ga0105240_10018547 3300009093 Bacteria 9340
169 Ga0105240_10034775 3300009093 Bacteria 6497
170 Ga0105240_10088230 3300009093 Bacteria 3796
171 Ga0105240_10289252 3300009093 Bacteria 1879
172 Ga0105240_10296914 3300009093 Bacteria 1850
173 Ga0111539_10015226 3300009094 Bacteria 9583
174 Ga0105245_10057894 3300009098 Bacteria 3487
175 Ga0105245_10290101 3300009098 Bacteria 1602
176 Ga0105247_10000387 3300009101 Bacteria 37452
177 Ga0105247_10008930 3300009101 Bacteria 6108
178 Ga0105243_10082359 3300009148 Bacteria 2630
179 Ga0105248_10000429 3300009177 Bacteria 47562
180 Ga0105248_10032216 3300009177 Bacteria 5859
181 Ga0105237_10000016 3300009545 Bacteria 256506
182 Ga0105237_10000388 3300009545 Bacteria 62620
183 Ga0105237_10013505 3300009545 Bacteria 8557
184 Ga0105237_10179676 3300009545 Bacteria 2116
185 Ga0105238_10007103 3300009551 Bacteria 11206
186 Ga0105238_10010366 3300009551 Bacteria 9353
187 Ga0105249_10004651 3300009553 Bacteria 11849
188 Ga0105239_10012123 3300010375 Bacteria 9611
189 Ga0105239_10013063 3300010375 Bacteria 9230
190 Ga0105239_10035502 3300010375 Bacteria 5475
191 Ga0105239_10107199 3300010375 Bacteria 3095
192 Ga0105239_10264492 3300010375 Bacteria 1934
193 Ga0105246_10096071 3300011119 Bacteria 2147
194 Ga0157373_10010911 3300013100 Bacteria 6689
195 Ga0157373_10018818 3300013100 Bacteria 5026
196 Ga0157373_10054961 3300013100 Bacteria 2828
197 Ga0157373_10108249 3300013100 Bacteria 1954
198 Ga0157371_10000020 3300013102 Bacteria 304987
199 Ga0157371_10000337 3300013102 Bacteria 60433
200 Ga0157371_10001526 3300013102 Bacteria 23861
201 Ga0157371_10007378 3300013102 Bacteria 8908
202 Ga0157371_10030944 3300013102 Bacteria 3857
203 Ga0157371_10059426 3300013102 Bacteria 2710
204 Ga0157371_10083827 3300013102 Bacteria 2257
205 Ga0157371_10096017 3300013102 Bacteria 2101
206 Ga0157370_10000740 3300013104 Bacteria 40971
207 Ga0157370_10006579 3300013104 Bacteria 12796
208 Ga0157370_10019093 3300013104 Bacteria 6891
209 Ga0157370_10051636 3300013104 Bacteria 3927
210 Ga0157370_10086892 3300013104 Bacteria 2937
211 Ga0157370_10117152 3300013104 Bacteria 2488
212 Ga0157370_10320904 3300013104 Bacteria 1429
213 Ga0157369_10012425 3300013105 Bacteria 9665
214 Ga0157369_10014448 3300013105 Bacteria 8914
215 Ga0157369_10020361 3300013105 Bacteria 7416
216 Ga0157369_10040319 3300013105 Bacteria 5097
217 Ga0157369_10086111 3300013105 Bacteria 3356
218 Ga0157369_10102668 3300013105 Bacteria 3046
219 Ga0157369_10226749 3300013105 Bacteria 1954
220 Ga0157369_10414181 3300013105 Bacteria 1397
221 Ga0163162_10000003 3300013306 Bacteria 698280
222 Ga0163162_10021302 3300013306 Bacteria 6382
223 Ga0157372_10030087 3300013307 Bacteria 5936
224 Ga0157372_10131411 3300013307 Bacteria 2881
225 Ga0157372_10139030 3300013307 Bacteria 2797
226 Ga0157372_10165507 3300013307 Bacteria 2557
227 Ga0157372_10423614 3300013307 Bacteria 1551
228 Ga0157375_10085689 3300013308 Bacteria 3200
229 Ga0163163_10000766 3300014325 Bacteria 27287
230 Ga0163163_10015145 3300014325 Bacteria 7119
231 Ga0157380_10024535 3300014326 Bacteria 4564
232 Ga0182008_10000115 3300014497 Bacteria 61294
233 Ga0182008_10002113 3300014497 Bacteria 12670
234 Ga0182008_10007401 3300014497 Bacteria 6065
235 Ga0182008_10040768 3300014497 Bacteria 2317
236 Ga0157379_10000444 3300014968 Bacteria 33508
237 Ga0157376_10060224 3300014969 Bacteria 3187
238 Ga0182006_1000074 3300015261 Bacteria 130403
239 Ga0182006_1001229 3300015261 Bacteria 15917
240 Ga0182006_1018769 3300015261 Bacteria 2918
241 Ga0182006_1023937 3300015261 Bacteria 2525
242 Ga0182006_1033553 3300015261 Bacteria 2057
243 Ga0182006_1040668 3300015261 Bacteria 1829
244 Ga0182007_10000103 3300015262 Bacteria 59975
245 Ga0182007_10005776 3300015262 Bacteria 5380
246 Ga0182007_10008468 3300015262 Bacteria 4223
247 Ga0182005_1000326 3300015265 Bacteria 28190
248 Ga0182005_1001110 3300015265 Bacteria 11246
249 Ga0182005_1002015 3300015265 Bacteria 7626
250 Ga0183368_1004 3300015687 Bacteria 1211761
251 Ga0183360_10001 3300015689 Bacteria 3943671
252 Ga0163161_10000002 3300017792 Bacteria 411983
253 Ga0163161_10002977 3300017792 Bacteria 11994
254 Ga0163161_10114610 3300017792 Bacteria 2019
255 Ga0163161_10169952 3300017792 Bacteria 1666
256 Ga0206349_1636998 3300020075 Bacteria 3879
257 Ga0206351_10099632 3300020077 Bacteria 1544
258 Ga0224712_10016760 3300022467 Bacteria 2414
259 Ga0209760_100063 3300025207 Bacteria 92173
260 Ga0209760_100267 3300025207 Bacteria 19249
261 Ga0209784_100001 3300025224 Bacteria 3600592
262 Ga0209784_100013 3300025224 Bacteria 518664
263 Ga0209566_100001 3300025225 Bacteria 3600765
264 Ga0209674_100002 3300025226 Bacteria 3600592
265 Ga0209674_100062 3300025226 Bacteria 276316
266 Ga0209674_100490 3300025226 Bacteria 16783
267 Ga0209674_102527 3300025226 Bacteria 3866
268 Ga0209672_100870 3300025228 Bacteria 13844
269 Ga0209672_104394 3300025228 Bacteria 2621
270 Ga0209563_100008 3300025230 Bacteria 1554545
271 Ga0207427_100002 3300025231 Bacteria 1355321
272 Ga0207427_100073 3300025231 Bacteria 156503
273 Ga0207427_100289 3300025231 Bacteria 35918
274 Ga0207427_100306 3300025231 Bacteria 34125
275 Ga0207427_101520 3300025231 Bacteria 8177
276 Ga0209437_100012 3300025233 Bacteria 792625
277 Ga0209437_100039 3300025233 Bacteria 448321
278 Ga0209437_100046 3300025233 Bacteria 405293
279 Ga0209437_100129 3300025233 Bacteria 184661
280 Ga0209437_100159 3300025233 Bacteria 149598
281 Ga0209437_101388 3300025233 Bacteria 6119
282 Ga0209258_100019 3300025242 Bacteria 566728
283 Ga0209258_103067 3300025242 Bacteria 3819
284 Ga0207425_1000092 3300025245 Bacteria 87673
285 Ga0207425_1008590 3300025245 Bacteria 2600
286 Ga0209646_1002777 3300025246 Bacteria 3710
287 Ga0209026_1000051 3300025250 Bacteria 250792
288 Ga0209026_1000125 3300025250 Bacteria 124729
289 Ga0209026_1000207 3300025250 Bacteria 81332
290 Ga0209677_100004 3300025253 Bacteria 1554545
291 Ga0209148_1000001 3300025254 Bacteria 2545271
292 Ga0209148_1000005 3300025254 Bacteria 1806504
293 Ga0209148_1006041 3300025254 Bacteria 2673
294 Ga0209759_1001432 3300025256 Bacteria 13494
295 Ga0209759_1001666 3300025256 Bacteria 11590
296 Ga0209759_1011202 3300025256 Bacteria 2567
297 Ga0209129_1000151 3300025258 Bacteria 113221
298 Ga0209129_1002077 3300025258 Bacteria 10304
299 Ga0209129_1003459 3300025258 Bacteria 6852
300 Ga0209233_1000002 3300025261 Bacteria 2501366
301 Ga0209233_1000020 3300025261 Bacteria 798224
302 Ga0209233_1000090 3300025261 Bacteria 315680
303 Ga0209233_1006818 3300025261 Bacteria 3655
304 Ga0209233_1019168 3300025261 Bacteria 1824
305 Ga0209565_1000014 3300025263 Bacteria 530302
306 Ga0209565_1000048 3300025263 Bacteria 224961
307 Ga0209455_1000027 3300025272 Bacteria 566710
308 Ga0209455_1000745 3300025272 Bacteria 18616
309 Ga0209673_1000001 3300025273 Bacteria 3176258
310 Ga0209673_1000171 3300025273 Bacteria 133493
311 Ga0209673_1004687 3300025273 Bacteria 7212
312 Ga0209130_1013770 3300025284 Bacteria 2059
313 Ga0209675_1000011 3300025291 Bacteria 520597
314 Ga0209675_1000045 3300025291 Bacteria 225750
315 Ga0209675_1015306 3300025291 Bacteria 2287
316 Ga0209675_1021926 3300025291 Bacteria 1691
317 Ga0209676_1000079 3300025292 Bacteria 290447
318 Ga0209676_1000086 3300025292 Bacteria 264155
319 Ga0209676_1001944 3300025292 Bacteria 16652
320 Ga0209676_1009576 3300025292 Bacteria 4165
321 Ga0209676_1014295 3300025292 Bacteria 2994
322 Ga0209676_1020268 3300025292 Bacteria 2264
323 Ga0209025_1000012 3300025294 Bacteria 924362
324 Ga0209025_1000015 3300025294 Bacteria 808120
325 Ga0209025_1001858 3300025294 Bacteria 24731
326 Ga0209025_1002444 3300025294 Bacteria 19667
327 Ga0209025_1045791 3300025294 Bacteria 1808
328 Ga0209564_1000001 3300025295 Bacteria 3176258
329 Ga0209564_1000221 3300025295 Bacteria 129537
330 Ga0209564_1010571 3300025295 Bacteria 4233
331 Ga0209758_1000018 3300025297 Bacteria 753320
332 Ga0209758_1001482 3300025297 Bacteria 27435
333 Ga0209758_1005446 3300025297 Bacteria 9799
334 Ga0209050_1000528 3300025298 Bacteria 63464
335 Ga0209050_1000689 3300025298 Bacteria 50775
336 Ga0209050_1001366 3300025298 Bacteria 26676
337 Ga0209050_1023040 3300025298 Bacteria 2206
338 Ga0209256_1000002 3300025299 Bacteria 1906740
339 Ga0209256_1005221 3300025299 Bacteria 7622
340 Ga0209256_1005613 3300025299 Bacteria 7117
341 Ga0209256_1006369 3300025299 Bacteria 6284
342 Ga0207426_1004381 3300025302 Bacteria 6923
343 Ga0209051_1001657 3300025303 Bacteria 17977
344 Ga0209051_1002764 3300025303 Bacteria 12119
345 Ga0209051_1015746 3300025303 Bacteria 3464
346 Ga0209257_1000081 3300025304 Bacteria 306577
347 Ga0209257_1001140 3300025304 Bacteria 33983
348 Ga0209257_1002903 3300025304 Bacteria 15868
349 Ga0209257_1008065 3300025304 Bacteria 6130
350 Ga0209257_1009184 3300025304 Bacteria 5373
351 Ga0209257_1014852 3300025304 Bacteria 3301
352 Ga0209257_1016252 3300025304 Bacteria 3024
353 Ga0209257_1023412 3300025304 Bacteria 2172
354 Ga0207656_10035728 3300025321 Bacteria 2082
355 Ga0207696_1000009 3300025711 Bacteria 564405
356 Ga0207696_1000027 3300025711 Bacteria 412783
357 Ga0207696_1000093 3300025711 Bacteria 184278
358 Ga0207655_1000056 3300025728 Bacteria 279166
359 Ga0207655_1003121 3300025728 Bacteria 12552
360 Ga0207713_1000034 3300025735 Bacteria 266214
361 Ga0207713_1009013 3300025735 Bacteria 5672
362 Ga0207710_10000015 3300025900 Bacteria 393018
363 Ga0207680_10002922 3300025903 Bacteria 8017
364 Ga0207647_10001662 3300025904 Bacteria 17127
365 Ga0207647_10002782 3300025904 Bacteria 13194
366 Ga0207647_10014092 3300025904 Bacteria 5524
367 Ga0207647_10036485 3300025904 Bacteria 3123
368 Ga0207647_10076453 3300025904 Bacteria 2014
369 Ga0207643_10039234 3300025908 Bacteria 2664
370 Ga0207707_10019214 3300025912 Bacteria 5963
371 Ga0207695_10000395 3300025913 Bacteria 98285
372 Ga0207695_10000493 3300025913 Bacteria 84173
373 Ga0207695_10000882 3300025913 Bacteria 54604
374 Ga0207695_10009557 3300025913 Bacteria 11986
375 Ga0207695_10026470 3300025913 Bacteria 6474
376 Ga0207695_10048145 3300025913 Bacteria 4504
377 Ga0207671_10000137 3300025914 Bacteria 112029
378 Ga0207671_10000490 3300025914 Bacteria 53783
379 Ga0207671_10014803 3300025914 Bacteria 6145
380 Ga0207693_10218942 3300025915 Bacteria 1496
381 Ga0207657_10002079 3300025919 Bacteria 21652
382 Ga0207657_10009612 3300025919 Bacteria 9705
383 Ga0207657_10155575 3300025919 Bacteria 1859
384 Ga0207649_10077875 3300025920 Bacteria 2138
385 Ga0207681_10004705 3300025923 Bacteria 8395
386 Ga0207694_10065116 3300025924 Bacteria 2841
387 Ga0207694_10099388 3300025924 Bacteria 2304
388 Ga0207694_10119078 3300025924 Bacteria 2107
389 Ga0207650_10040600 3300025925 Bacteria 3406
390 Ga0207650_10065979 3300025925 Bacteria 2714
391 Ga0207687_10126763 3300025927 Bacteria 1918
392 Ga0207700_10007087 3300025928 Bacteria 6825
393 Ga0207664_10000474 3300025929 Bacteria 28453
394 Ga0207664_10000584 3300025929 Bacteria 25442
395 Ga0207664_10104085 3300025929 Bacteria 2350
396 Ga0207644_10000313 3300025931 Bacteria 31603
397 Ga0207644_10020629 3300025931 Bacteria 4484
398 Ga0207690_10000443 3300025932 Bacteria 26830
399 Ga0207690_10004983 3300025932 Bacteria 7841
400 Ga0207690_10039811 3300025932 Bacteria 3068
401 Ga0207706_10009141 3300025933 Bacteria 9110
402 Ga0207709_10008291 3300025935 Bacteria 5756
403 Ga0207709_10024872 3300025935 Bacteria 3425
404 Ga0207691_10022186 3300025940 Bacteria 5988
405 Ga0207691_10202850 3300025940 Bacteria 1725
406 Ga0207691_10316640 3300025940 Unclassified 1338
407 Ga0207711_10001015 3300025941 Bacteria 26915
408 Ga0207679_10045805 3300025945 Bacteria 3166
409 Ga0207667_10000250 3300025949 Bacteria 75738
410 Ga0207667_10001167 3300025949 Bacteria 32985
411 Ga0207667_10009481 3300025949 Bacteria 11462
412 Ga0207667_10010527 3300025949 Bacteria 10809
413 Ga0207667_10190525 3300025949 Bacteria 2104
414 Ga0207651_10082221 3300025960 Bacteria 2325
415 Ga0207712_10000343 3300025961 Bacteria 42053
416 Ga0207640_10001071 3300025981 Bacteria 15167
417 Ga0207658_10000093 3300025986 Bacteria 98928
418 Ga0207658_10291622 3300025986 Bacteria 1402
419 Ga0207703_10017403 3300026035 Bacteria 5610
420 Ga0207703_10124659 3300026035 Bacteria 2216
421 Ga0207639_10019437 3300026041 Bacteria 4845
422 Ga0207639_10023825 3300026041 Bacteria 4423
423 Ga0207678_10001491 3300026067 Bacteria 21445
424 Ga0207678_10010003 3300026067 Bacteria 8323
425 Ga0207678_10049539 3300026067 Bacteria 3630
426 Ga0207678_10174858 3300026067 Bacteria 1833
427 Ga0207708_10032758 3300026075 Bacteria 3945
428 Ga0207702_10000104 3300026078 Bacteria 98370
429 Ga0207702_10060448 3300026078 Bacteria 3230
430 Ga0207641_10007379 3300026088 Bacteria 9150
431 Ga0207641_10013278 3300026088 Bacteria 6757
432 Ga0207674_10011055 3300026116 Bacteria 10152
433 Ga0207674_10041215 3300026116 Bacteria 4777
434 Ga0207674_10120388 3300026116 Bacteria 2593
435 Ga0207683_10106046 3300026121 Bacteria 2512
436 Ga0207698_10014534 3300026142 Bacteria 5237
437 Ga0207698_10041036 3300026142 Bacteria 3445
438 Ga0207698_10180667 3300026142 Bacteria 1869
439 Ga0209371_1026513 3300027312 Bacteria 1318
440 Ga0207428_10147693 3300027907 Bacteria 1791
441 Ga0268266_10098856 3300028379 Bacteria 2568
442 Ga0268265_10229373 3300028380 Bacteria 1631
443 Ga0265338_10016809 3300028800 Bacteria 7925
444 Ga0268256_1030146 3300030500 Bacteria 1318
445 Ga0316176_1003977 3300030732 Bacteria 3332
446 Ga0314311_1227168 3300030733 Bacteria 2836
447 Ga0316178_1160356 3300030735 Bacteria 2197
448 Ga0265332_10102836 3300031238 Bacteria 1204
449 Ga0307513_10025866 3300031456 Bacteria 6783
450 Ga0307513_10045664 3300031456 Bacteria 4786
451 Ga0307513_10180328 3300031456 Bacteria 1976
452 Ga0307509_10009871 3300031507 Bacteria 11810
453 Ga0307509_10166270 3300031507 Bacteria 2094
454 Ga0316575_10020580 3300031665 Bacteria 2532
455 Ga0316575_10062544 3300031665 Bacteria 1489
456 Ga0316579_10001999 3300031691 Bacteria 7628
457 Ga0316579_10027062 3300031691 Bacteria 2601
458 Ga0316576_10018861 3300031727 Bacteria 4718
459 Ga0316576_10122024 3300031727 Bacteria 1957
460 Ga0316578_10022212 3300031728 Bacteria 3534
461 Ga0316578_10042986 3300031728 Bacteria 2623
462 Ga0316577_10023218 3300031733 Bacteria 3444
463 Ga0316577_10091163 3300031733 Bacteria 1706
464 Ga0307413_10060377 3300031824 Bacteria 2334
465 Ga0307410_10094983 3300031852 Bacteria 2125
466 Ga0307406_10013741 3300031901 Bacteria 4644
467 Ga0307406_10059831 3300031901 Bacteria 2454
468 Ga0307412_10136518 3300031911 Bacteria 1790
469 Ga0307416_100111613 3300032002 Bacteria 2411
470 Ga0307414_10082122 3300032004 Bacteria 2362
471 Ga0307414_10128227 3300032004 Bacteria 1964
472 Ga0307411_10004163 3300032005 Bacteria 6874
473 Ga0307411_10159615 3300032005 Bacteria 1687
474 Ga0307411_10168343 3300032005 Bacteria 1649
475 Ga0307415_100201327 3300032126 Bacteria 1580
476 Ga0316593_10001629 3300032168 Bacteria 5029
477 Ga0316593_10006813 3300032168 Bacteria 3107
478 Ga0316586_1002055 3300033527 Bacteria 2453
479 Ga0316587_1000156 3300033529 Bacteria 5556
480 Ga0316587_1000210 3300033529 Bacteria 5143
481 Ga0316587_1000466 3300033529 Bacteria 4069
482 Ga0316587_1003110 3300033529 Bacteria 2292
483 Ga0316596_1001258 3300033541 Bacteria 5020
484 Ga0316596_1002063 3300033541 Bacteria 4233
485 Ga0316596_1002572 3300033541 Bacteria 3884
486 Ga0316596_1010167 3300033541 Bacteria 2272
487 Ga0316596_1015995 3300033541 Bacteria 1876
488 Ga0316596_1034368 3300033541 Bacteria 1324
489 Ga0316596_1035937 3300033541 Bacteria 1295
490 Ga0373952_0005584 3300035092 Bacteria 2304
491 Ga0316574_0003618 3300035398 Bacteria 8001
492 Ga0316574_0010776 3300035398 Bacteria 5177
493 Ga0316574_0032554 3300035398 Bacteria 3169
494 Ga0316574_0035691 3300035398 Bacteria 3040
495 Ga0316574_0039844 3300035398 Bacteria 2891
496 Ga0316574_0041814 3300035398 Bacteria 2827
497 Ga0316574_0057850 3300035398 Bacteria 2428
498 Ga0316574_0063949 3300035398 Bacteria 2315
499 Ga0373933_0135895 3300035724 Bacteria 1549
500 Ga0373947_0237989 3300035725 Bacteria 1201
501 Ga0373937_0078266 3300036401 Unclassified 3056
502 Ga0373937_0105061 3300036401 Bacteria 2624
503 Ga0316582_0023052 3300036647 Bacteria 3705
504 Ga0316584_0264860 3300036712 Bacteria 1252
505 Ga0395899_0019518 3300037312 Bacteria 5148
506 Ga0395899_0034020 3300037312 Bacteria 3826
507 Ga0395899_0077152 3300037312 Bacteria 2430
508 Ga0395900_0000033 3300037418 Bacteria 260271
509 Ga0395900_0002387 3300037418 Bacteria 20737
510 Ga0395900_0011107 3300037418 Bacteria 9205
511 Ga0395900_0021089 3300037418 Bacteria 6658
512 Ga0395900_0022205 3300037418 Bacteria 6491
513 Ga0395900_0156122 3300037418 Bacteria 2330
514 Ga0395898_0004200 3300037466 Bacteria 15794
515 Ga0395898_0025039 3300037466 Bacteria 6016
516 Ga0395898_0028428 3300037466 Bacteria 5602
517 Ga0395898_0185134 3300037466 Bacteria 1990
518 Ga0395905_0029664 3300037471 Bacteria 5155
519 Ga0395905_0031808 3300037471 Bacteria 4965
520 Ga0395905_0034172 3300037471 Bacteria 4774
521 Ga0395905_0154864 3300037471 Bacteria 2155
522 Ga0395905_0232181 3300037471 Bacteria 1725
523 Ga0316581_0010925 3300037588 Bacteria 2528
524 Ga0395901_0002935 3300038443 Bacteria 17206
525 Ga0395901_0070692 3300038443 Bacteria 3636
526 Ga0395901_0101368 3300038443 Bacteria 3021
527 Ga0395901_0108709 3300038443 Bacteria 2911
528 Ga0395901_0269950 3300038443 Bacteria 1769
529 Ga0237819_00127 3300038705 Bacteria 28645
530 Ga0400484_24107 3300038725 Bacteria 14372
531 Ga0400484_37774 3300038725 Bacteria 14462
532 Ga0400490_09770 3300038726 Bacteria 5045
533 Ga0400490_18168 3300038726 Bacteria 53638
534 Ga0400485_11431 3300038735 Bacteria 142174
535 Ga0400485_19947 3300038735 Bacteria 47885
536 Ga0400488_00561 3300038741 Bacteria 1843
537 Ga0400488_16026 3300038741 Bacteria 2532
538 Ga0400488_62624 3300038741 Bacteria 9725
539 Ga0400486_26250 3300038742 Bacteria 56114
540 Ga0400486_28947 3300038742 Bacteria 19120
541 Ga0400483_066859 3300039062 Bacteria 3938
542 Ga0400483_089739 3300039062 Bacteria 12473
543 Ga0400483_097431 3300039062 Bacteria 4037
544 Ga0400483_137250 3300039062 Bacteria 5680
545 Ga0400483_225557 3300039062 Bacteria 3056
546 Ga0400483_266560 3300039062 Bacteria 3074
547 Ga0400483_268468 3300039062 Bacteria 9861
548 Ga0400489_65746 3300039093 Bacteria 1975
549 Ga0400487_32815 3300039110 Bacteria 8519
550 Ga0400487_65159 3300039110 Bacteria 37665
551 Ga0439436_0000010 3300041404 Bacteria 104480
552 Ga0439438_000003 3300041405 Bacteria 464587
553 Ga0439438_008343 3300041405 Bacteria 3444
554 Ga0439447_004864 3300041407 Bacteria 4556
555 Ga0439447_007610 3300041407 Bacteria 3416
556 Ga0439466_0019894 3300041411 Bacteria 2398
557 Ga0439465_0003188 3300041413 Bacteria 5347
558 Ga0439465_0013520 3300041413 Bacteria 2543
559 Ga0451789_0023152 3300041443 Bacteria 1304
560 Ga0451797_0440029 3300041453 Bacteria 1983
561 Ga0451797_1593054 3300041453 Bacteria 1242
562 Ga0451800_0124589 3300041459 Bacteria 1431
563 Ga0451802_0280070 3300041460 Bacteria 1565
564 Ga0451802_1849339 3300041460 Bacteria 2294
565 Ga0451806_093730 3300041462 Bacteria 3970
566 Ga0451804_1138182 3300041463 Bacteria 1658
567 Ga0451807_1175588 3300041486 Bacteria 5060
568 Ga0451807_1480792 3300041486 Bacteria 2951
569 Ga0451837_1816185 3300041494 Bacteria 2382
570 Ga0451839_0730590 3300041496 Bacteria 1571
571 Ga0451843_1531715 3300041509 Bacteria 2114
572 Ga0451853_2618627 3300041512 Bacteria 2441
573 Ga0439445_0001596 3300042004 Bacteria 4951
574 Ga0439448_0008704 3300042005 Bacteria 2974
575 Ga0439432_001288 3300042006 Bacteria 9479
576 Ga0439449_0000905 3300042007 Bacteria 11573
577 Ga0439449_0006091 3300042007 Bacteria 4610
578 Ga0439449_0016820 3300042007 Bacteria 2747
579 Ga0439449_0026182 3300042007 Bacteria 2177
580 Ga0439452_001096 3300042010 Bacteria 11926
581 Ga0439456_013127 3300042013 Bacteria 1722
582 Ga0450923_011998 3300042125 Bacteria 1570
583 Ga0450898_003505 3300042134 Bacteria 2261
584 Ga0450908_000324 3300042184 Bacteria 9395
585 Ga0439434_0000409 3300042435 Bacteria 12218
586 Ga0439459_0004768 3300042438 Bacteria 2194
587 Ga0451577_0000184 3300042876 Bacteria 132503
588 Ga0451577_0085134 3300042876 Bacteria 2820
589 Ga0466982_0000019 3300044672 Bacteria 111595
590 Ga0466982_0002429 3300044672 Bacteria 7576
591 Ga0466966_0007333 3300044684 Bacteria 7312
592 Ga0466964_0012424 3300044706 Bacteria 3221
593 Ga0453684_0000593 3300044712 Bacteria 134271
594 Ga0453684_0001929 3300044712 Bacteria 53615
595 Ga0453684_0002079 3300044712 Bacteria 50825
596 Ga0453684_0005838 3300044712 Bacteria 23943
597 Ga0453684_0321781 3300044712 Bacteria 1751
598 Ga0466968_0041489 3300044735 Bacteria 1942
599 Ga0466960_0067790 3300044901 Bacteria 1768
600 Ga0466959_0003395 3300045049 Bacteria 10407
601 Ga0451576_0000156 3300045051 Bacteria 174140
602 Ga0451576_0003864 3300045051 Bacteria 20090
603 Ga0451576_0210620 3300045051 Bacteria 2030
604 Ga0466958_0164730 3300045836 Bacteria 1402
605 Ga0495617_003710 3300046452 Bacteria 5683
606 Ga0495627_000042 3300046453 Bacteria 189845
607 Ga0495627_043016 3300046453 Bacteria 1382
608 Ga0495590_0000646 3300046457 Bacteria 16170
609 Ga0495638_0000122 3300046460 Bacteria 125872
610 Ga0495638_0000270 3300046460 Bacteria 70022
611 Ga0495638_0001504 3300046460 Bacteria 20993
612 Ga0495638_0003786 3300046460 Bacteria 11755
613 Ga0495638_0007531 3300046460 Bacteria 7792
614 Ga0495638_0031124 3300046460 Bacteria 3430
615 Ga0495638_0033273 3300046460 Bacteria 3297
616 Ga0495638_0085023 3300046460 Bacteria 1914
617 Ga0495650_0000004 3300046471 Bacteria 779487
618 Ga0495650_0000209 3300046471 Bacteria 125495
619 Ga0495650_0002282 3300046471 Bacteria 15944
620 Ga0495605_0120629 3300046474 Bacteria 1189
621 Ga0495584_0007978 3300046491 Bacteria 5501
622 Ga0495585_0000423 3300046492 Bacteria 40748
623 Ga0495585_0079348 3300046492 Bacteria 1780
624 Ga0495607_0001986 3300046501 Bacteria 17209
625 Ga0495607_0007451 3300046501 Bacteria 7572
626 Ga0495607_0041396 3300046501 Bacteria 2738
627 Ga0495606_0000348 3300046507 Bacteria 79254
628 Ga0495606_0001107 3300046507 Bacteria 38560
629 Ga0495606_0011608 3300046507 Bacteria 7161
630 Ga0495606_0013223 3300046507 Bacteria 6545
631 Ga0495610_0001640 3300046512 Bacteria 19663
632 Ga0495616_0000067 3300046513 Bacteria 89610
633 Ga0495616_0001194 3300046513 Bacteria 18313
634 Ga0495620_0006272 3300046515 Bacteria 6545
635 Ga0495631_0004759 3300046518 Bacteria 7168
636 Ga0495631_0005329 3300046518 Bacteria 6749
637 Ga0495632_0000046 3300046519 Bacteria 139365
638 Ga0495632_0007024 3300046519 Bacteria 7139
639 Ga0495632_0016452 3300046519 Bacteria 4114
640 Ga0495632_0055347 3300046519 Bacteria 1942
641 Ga0495637_0018188 3300046520 Bacteria 3263
642 Ga0495648_0005955 3300046524 Bacteria 10034
643 Ga0495648_0013180 3300046524 Bacteria 6128
644 Ga0495663_0009950 3300046525 Bacteria 2639
645 Ga0495609_0010100 3300046538 Bacteria 4543
646 Ga0495622_0019805 3300046557 Bacteria 3132
647 Ga0495633_0085866 3300046558 Bacteria 1463
648 Ga0495656_0013558 3300046615 Bacteria 3035
649 Ga0495668_0005431 3300046616 Bacteria 8649
650 Ga0495668_0015195 3300046616 Bacteria 4499
651 Ga0495611_0000001 3300046648 Bacteria 2628469
652 Ga0495611_0004654 3300046648 Bacteria 5895
653 Ga0495625_0000001 3300046660 Bacteria 1641829
654 Ga0495625_0037625 3300046660 Bacteria 3548
655 Ga0495625_0077729 3300046660 Bacteria 2318
656 Ga0495661_0005030 3300046665 Bacteria 9440
657 Ga0495670_0002524 3300046691 Bacteria 9045
658 Ga0495670_0006643 3300046691 Bacteria 5690
659 Ga0495670_0135521 3300046691 Bacteria 1285
660 Ga0495671_0014149 3300046692 Bacteria 4298
661 Ga0495649_0011944 3300046694 Bacteria 5075
662 Ga0495649_0016409 3300046694 Bacteria 4196
663 Ga0495660_0000013 3300046810 Bacteria 350283
664 Ga0495660_0000411 3300046810 Bacteria 36503
665 Ga0495660_0000801 3300046810 Bacteria 23607
666 Ga0495636_0005005 3300047318 Bacteria 5200
667 Ga0495636_0009260 3300047318 Bacteria 3877
668 Ga0495636_0031549 3300047318 Bacteria 2172
669 Ga0495672_0000596 3300047320 Bacteria 40742
670 Ga0495683_0004541 3300047323 Bacteria 7856
671 Ga0495679_000029 3300047446 Bacteria 190883
672 Ga0495673_0000001 3300047469 Bacteria 1630730
673 Ga0495673_0000018 3300047469 Bacteria 569190
674 Ga0495673_0011430 3300047469 Bacteria 4772
675 Ga0495681_0007084 3300047470 Bacteria 7237
676 Ga0495681_0026609 3300047470 Bacteria 3007
677 Ga0495686_0000043 3300047472 Bacteria 291565
678 Ga0495686_0007272 3300047472 Bacteria 8326
679 Ga0495686_0010235 3300047472 Bacteria 6679
680 Ga0495686_0047713 3300047472 Bacteria 2703
681 Ga0495686_0061162 3300047472 Bacteria 2339
682 Ga0495686_0085505 3300047472 Bacteria 1920
683 Ga0495686_0097119 3300047472 Bacteria 1782
684 Ga0496101_0058013 3300048904 Bacteria 2802
685 Ga0496101_0104597 3300048904 Bacteria 2123
686 Ga0496104_0001002 3300048907 Bacteria 24155
687 Ga0496104_0050979 3300048907 Bacteria 3905
688 Ga0496104_0108145 3300048907 Bacteria 2665
689 Ga0496105_0002557 3300048908 Bacteria 13205
690 Ga0496107_0183065 3300048910 Bacteria 1556
691 Ga0496108_0014371 3300048911 Bacteria 6464
692 Ga0496108_0145968 3300048911 Bacteria 2040
693 Ga0496109_0329449 3300048912 Bacteria 1441
694 Ga0496110_0089483 3300048913 Bacteria 2751
695 Ga0496113_0031220 3300048916 Bacteria 3864
696 Ga0496114_0002649 3300048917 Bacteria 13661
697 Ga0496114_0010697 3300048917 Bacteria 7302
698 Ga0496115_0000181 3300048918 Bacteria 58749
699 Ga0496115_0004090 3300048918 Bacteria 10534
700 Ga0496115_0012285 3300048918 Bacteria 6439
701 Ga0496116_0000015 3300048919 Bacteria 560702
702 Ga0496116_0000016 3300048919 Bacteria 555146
703 Ga0496117_0000810 3300048920 Bacteria 48467
704 Ga0496117_0003669 3300048920 Bacteria 17651
705 Ga0496117_0007719 3300048920 Bacteria 10403
706 Ga0496117_0010350 3300048920 Bacteria 8521
707 Ga0496117_0065383 3300048920 Bacteria 2473
708 Ga0496117_0138051 3300048920 Bacteria 1465
709 Ga0496118_0000579 3300048921 Bacteria 60445
710 Ga0496118_0002039 3300048921 Bacteria 28549
711 Ga0496118_0005474 3300048921 Bacteria 14415
712 Ga0496118_0006581 3300048921 Bacteria 12690
713 Ga0496118_0007761 3300048921 Bacteria 11265
714 Ga0496118_0009054 3300048921 Bacteria 10144
715 Ga0496118_0027316 3300048921 Bacteria 4834
716 Ga0496118_0028873 3300048921 Bacteria 4662
717 Ga0496118_0104861 3300048921 Bacteria 1896
718 Ga0496118_0160021 3300048921 Bacteria 1394
719 Ga0496119_0001017 3300048922 Bacteria 35895
720 Ga0496119_0003593 3300048922 Bacteria 15978
721 Ga0496120_0000307 3300048923 Bacteria 81552
722 Ga0496120_0000511 3300048923 Bacteria 60526
723 Ga0496120_0004519 3300048923 Bacteria 11629
724 Ga0496121_0000045 3300048924 Bacteria 336130
725 Ga0496121_0007677 3300048924 Bacteria 12956
726 Ga0496121_0009283 3300048924 Bacteria 11346
727 Ga0496121_0012034 3300048924 Bacteria 9506
728 Ga0496121_0012497 3300048924 Bacteria 9246
729 Ga0496121_0017399 3300048924 Bacteria 7346
730 Ga0496121_0026266 3300048924 Bacteria 5493
731 Ga0496121_0031488 3300048924 Bacteria 4844
732 Ga0496121_0104532 3300048924 Bacteria 2176
733 Ga0496122_0000125 3300048925 Bacteria 179659
734 Ga0496122_0000267 3300048925 Bacteria 116950
735 Ga0496122_0004439 3300048925 Bacteria 17411
736 Ga0496122_0005388 3300048925 Bacteria 15269
737 Ga0496122_0020200 3300048925 Bacteria 6036
738 Ga0496122_0034949 3300048925 Bacteria 4102
739 Ga0496122_0060870 3300048925 Bacteria 2776
740 Ga0496123_0000092 3300048926 Bacteria 179551
741 Ga0496123_0000161 3300048926 Bacteria 134623
742 Ga0496123_0003530 3300048926 Bacteria 17401
743 Ga0496123_0004404 3300048926 Bacteria 14846
744 Ga0496123_0070573 3300048926 Bacteria 2185
745 Ga0496123_0070615 3300048926 Bacteria 2184
746 Ga0496124_0000238 3300048927 Bacteria 106881
747 Ga0496124_0000481 3300048927 Bacteria 68720
748 Ga0496124_0002434 3300048927 Bacteria 24396
749 Ga0496124_0003052 3300048927 Bacteria 20874
750 Ga0496124_0038859 3300048927 Bacteria 4128
751 Ga0496124_0084631 3300048927 Bacteria 2600
752 Ga0496124_0157882 3300048927 Bacteria 1771
753 Ga0496125_0000149 3300048928 Bacteria 154223
754 Ga0496125_0001495 3300048928 Bacteria 33502
755 Ga0496125_0004714 3300048928 Bacteria 15543
756 Ga0496125_0005103 3300048928 Bacteria 14775
757 Ga0496125_0005215 3300048928 Bacteria 14583
758 Ga0496125_0017819 3300048928 Bacteria 6757
759 Ga0496125_0118728 3300048928 Bacteria 1893
760 Ga0496126_0000109 3300048929 Bacteria 196717
761 Ga0496126_0001534 3300048929 Bacteria 35571
762 Ga0496126_0043415 3300048929 Bacteria 4147
763 Ga0496126_0051430 3300048929 Bacteria 3750
764 Ga0496126_0054731 3300048929 Bacteria 3612
765 Ga0496126_0067067 3300048929 Bacteria 3207
766 Ga0496126_0095065 3300048929 Bacteria 2614
767 Ga0495678_000718 3300049459 Bacteria 30159
768 Ga0495678_027434 3300049459 Bacteria 2416
769 Ga0501031_0002335 3300049568 Bacteria 12012
770 Ga0501031_0002640 3300049568 Bacteria 11413
771 Ga0501031_0089505 3300049568 Bacteria 2007
772 Ga0501031_0276612 3300049568 Bacteria 1089
773 Ga0501032_0009095 3300049569 Bacteria 7210
774 Ga0501032_0030291 3300049569 Bacteria 3713
775 Ga0501032_0036448 3300049569 Bacteria 3356
776 Ga0501032_0072929 3300049569 Bacteria 2287
777 Ga0501032_0079907 3300049569 Bacteria 2177
778 Ga0501033_0001508 3300049570 Bacteria 20623
779 Ga0501033_0005880 3300049570 Bacteria 9640
780 Ga0501033_0029500 3300049570 Bacteria 4122
781 Ga0501033_0031519 3300049570 Bacteria 3983
782 Ga0501034_0000344 3300049571 Bacteria 80851
783 Ga0501034_0002344 3300049571 Bacteria 23117
784 Ga0501034_0011597 3300049571 Bacteria 9128
785 Ga0501034_0020047 3300049571 Bacteria 6830
786 Ga0501034_0098610 3300049571 Bacteria 2917
787 Ga0501034_0322552 3300049571 Bacteria 1477
788 Ga0501036_0010128 3300049572 Bacteria 7770
789 Ga0501036_0077557 3300049572 Bacteria 2811
790 Ga0501036_0159848 3300049572 Bacteria 1900
791 Ga0501037_0001128 3300049573 Bacteria 19768
792 Ga0501037_0005791 3300049573 Bacteria 9026
793 Ga0501037_0058800 3300049573 Bacteria 2804
794 Ga0501037_0183865 3300049573 Bacteria 1482
795 Ga0501038_0001341 3300049574 Bacteria 22396
796 Ga0501038_0001896 3300049574 Bacteria 19341
797 Ga0501038_0072277 3300049574 Bacteria 2923
798 Ga0501038_0160085 3300049574 Bacteria 1830
799 Ga0501039_0013892 3300049575 Bacteria 6161
800 Ga0501039_0066108 3300049575 Bacteria 2806
801 Ga0501040_0001220 3300049576 Bacteria 16339
802 Ga0501042_0068726 3300049578 Bacteria 2533
803 Ga0501043_0002588 3300049579 Bacteria 15289
804 Ga0501043_0019401 3300049579 Bacteria 5338
805 Ga0501043_0029205 3300049579 Bacteria 4330
806 Ga0501043_0159145 3300049579 Bacteria 1765
807 Ga0501046_0012062 3300049580 Bacteria 7368
808 Ga0501046_0017144 3300049580 Bacteria 6052
809 Ga0501046_0053070 3300049580 Bacteria 3193
810 Ga0501047_0002448 3300049581 Bacteria 17724
811 Ga0501047_0010659 3300049581 Bacteria 8686
812 Ga0501047_0024619 3300049581 Bacteria 5778
813 Ga0501047_0041367 3300049581 Bacteria 4454
814 Ga0501047_0093814 3300049581 Bacteria 2881
815 Ga0501048_0126977 3300049582 Bacteria 1803
816 Ga0501069_0092778 3300049585 Bacteria 1708
817 Ga0501070_0002917 3300049586 Bacteria 14882
818 Ga0501070_0010973 3300049586 Bacteria 7648
819 Ga0501070_0028987 3300049586 Bacteria 4642
820 Ga0501070_0057150 3300049586 Bacteria 3234
821 Ga0501071_0147454 3300049587 Bacteria 1754
822 Ga0501073_0002128 3300049589 Bacteria 14842
823 Ga0501073_0069323 3300049589 Bacteria 2457
824 Ga0501074_0197082 3300049590 Bacteria 1436
825 Ga0501075_0035574 3300049591 Bacteria 3715
826 Ga0501080_0095968 3300049742 Bacteria 2753
827 Ga0501080_0309120 3300049742 Bacteria 1433
828 Ga0501081_0218453 3300049743 Bacteria 1386
829 Ga0501035_0003161 3300049822 Bacteria 15818
830 Ga0501035_0016852 3300049822 Bacteria 6736
831 Ga0501035_0029407 3300049822 Bacteria 5010
832 Ga0501035_0210714 3300049822 Bacteria 1662
833 Ga0501044_0007144 3300049823 Bacteria 12285
834 Ga0501044_0011340 3300049823 Bacteria 9657
835 Ga0501044_0030343 3300049823 Bacteria 5699
836 Ga0501044_0038490 3300049823 Bacteria 4994
837 Ga0501044_0085626 3300049823 Bacteria 3184
838 nmdc:mga00v17_1798_c1 3300050491 Bacteria 11108
839 nmdc:mga0qj67_129675_c1 3300050509 Bacteria 2042
840 Ga0495601_0009903 3300053077 Bacteria 5646
841 Ga0500610_0005427 3300053079 Bacteria 5227
842 Ga0500643_000002 3300053087 Bacteria 1277657
843 Ga0500643_003542 3300053087 Bacteria 7440
844 Ga0500651_0029217 3300053093 Bacteria 3466
845 Ga0500597_000225 3300053120 Bacteria 11664
846 Ga0500568_0022358 3300053139 Bacteria 2706
847 Ga0500634_0013478 3300053161 Bacteria 4287
848 Ga0500645_006047 3300053730 Bacteria 4368
849 Ga0530510_0303970 3300061734 Bacteria 1194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0276612 Ga0501031_0276612_14_913 250
2 3300041443 Ga0451789_0023152 Ga0451789_0023152_234_1277 272
3 3300041453 Ga0451797_1593054 Ga0451797_1593054_186_1223 274
4 3300003771 Ga0055526_1000021 Ga0055526_1000021146 279
5 3300003773 Ga0055537_1000094 Ga0055537_100009414 279
6 3300003775 Ga0055524_1000062 Ga0055524_100006218 279
7 3300003784 Ga0055534_1000052 Ga0055534_100005269 279
8 3300003790 Ga0055528_1000009 Ga0055528_1000009147 279
9 3300025263 Ga0209565_1000048 Ga0209565_1000048145 279
10 3300025273 Ga0209673_1000001 Ga0209673_10000012547 279
11 3300025291 Ga0209675_1000045 Ga0209675_100004519 279
12 3300025295 Ga0209564_1000001 Ga0209564_1000001145 279
13 3300025299 Ga0209256_1000002 Ga0209256_10000021405 279
14 3300041496 Ga0451839_0730590 Ga0451839_0730590_464_1513 280
15 3300061734 Ga0530510_0303970 Ga0530510_0303970_137_1183 282
16 3300025940 Ga0207691_10316640 Ga0207691_103166401 283
17 3300033541 Ga0316596_1035937 Ga0316596_10359372 289
18 3300048925 Ga0496122_0034949 Ga0496122_0034949_1028_2164 290
19 3300048928 Ga0496125_0004714 Ga0496125_0004714_2335_3471 290
20 3300048929 Ga0496126_0043415 Ga0496126_0043415_1959_3095 290
21 3300032168 Ga0316593_10001629 Ga0316593_100016293 291
22 3300033541 Ga0316596_1002572 Ga0316596_10025723 291
23 3300046474 Ga0495605_0120629 Ga0495605_0120629_14_1111 291
24 3300005353 Ga0070669_100012750 Ga0070669_1000127507 292
25 3300010375 Ga0105239_10013063 Ga0105239_100130634 292
26 3300025923 Ga0207681_10004705 Ga0207681_100047059 292
27 3300031727 Ga0316576_10018861 Ga0316576_100188612 293
28 3300031728 Ga0316578_10042986 Ga0316578_100429862 293
29 3300031456 Ga0307513_10025866 Ga0307513_100258662 294
30 3300031727 Ga0316576_10122024 Ga0316576_101220242 295
31 3300031733 Ga0316577_10023218 Ga0316577_100232182 295
32 3300035398 Ga0316574_0035691 Ga0316574_0035691_1538_2662 295
33 3300036712 Ga0316584_0264860 Ga0316584_0264860_22_1146 295
34 3300038741 Ga0400488_16026 Ga0400488_16026_1070_2209 295
35 3300042876 Ga0451577_0085134 Ga0451577_0085134_936_2096 295
36 3300045051 Ga0451576_0003864 Ga0451576_0003864_899_2059 296
37 3300046460 Ga0495638_0031124 Ga0495638_0031124_864_1994 296
38 3300003187 JGI25151J46595_10000041 JGI25151J46595_10000041166 297
39 3300005616 Ga0068852_100037510 Ga0068852_1000375103 297
40 3300025245 Ga0207425_1008590 Ga0207425_10085901 297
41 3300025294 Ga0209025_1000015 Ga0209025_1000015726 297
42 3300025294 Ga0209025_1001858 Ga0209025_10018583 297
43 3300026142 Ga0207698_10014534 Ga0207698_100145345 297
44 3300027312 Ga0209371_1026513 Ga0209371_10265131 297
45 3300030500 Ga0268256_1030146 Ga0268256_10301461 297
46 3300031824 Ga0307413_10060377 Ga0307413_100603773 297
47 3300032004 Ga0307414_10128227 Ga0307414_101282272 297
48 3300032005 Ga0307411_10168343 Ga0307411_101683432 297
49 3300033529 Ga0316587_1003110 Ga0316587_10031102 297
50 3300033541 Ga0316596_1002063 Ga0316596_10020632 297
51 3300038741 Ga0400488_62624 Ga0400488_62624_2062_3207 297
52 3300042007 Ga0439449_0006091 Ga0439449_0006091_103_1251 297
53 3300042007 Ga0439449_0016820 Ga0439449_0016820_738_1886 297
54 3300042007 Ga0439449_0026182 Ga0439449_0026182_677_1801 297
55 3300048924 Ga0496121_0012034 Ga0496121_0012034_4351_5490 297
56 3300003775 Ga0055524_1026188 Ga0055524_10261881 298
57 3300013100 Ga0157373_10018818 Ga0157373_100188182 298
58 3300025292 Ga0209676_1014295 Ga0209676_10142952 298
59 3300025299 Ga0209256_1006369 Ga0209256_10063695 298
60 3300031901 Ga0307406_10059831 Ga0307406_100598312 298
61 3300031911 Ga0307412_10136518 Ga0307412_101365182 298
62 3300032002 Ga0307416_100111613 Ga0307416_1001116132 298
63 3300032005 Ga0307411_10004163 Ga0307411_100041635 298
64 3300032126 Ga0307415_100201327 Ga0307415_1002013272 298
65 3300035724 Ga0373933_0135895 Ga0373933_0135895_253_1389 298
66 3300036401 Ga0373937_0105061 Ga0373937_0105061_1151_2287 298
67 3300041405 Ga0439438_000003 Ga0439438_000003_179248_180414 298
68 3300042006 Ga0439432_001288 Ga0439432_001288_88_1254 298
69 3300048927 Ga0496124_0084631 Ga0496124_0084631_861_1991 298
70 3300013105 Ga0157369_10012425 Ga0157369_100124255 299
71 3300031665 Ga0316575_10062544 Ga0316575_100625442 299
72 3300031901 Ga0307406_10013741 Ga0307406_100137412 299
73 3300033529 Ga0316587_1000156 Ga0316587_10001561 299
74 3300033541 Ga0316596_1015995 Ga0316596_10159952 299
75 3300035398 Ga0316574_0010776 Ga0316574_0010776_3543_4676 299
76 3300035398 Ga0316574_0057850 Ga0316574_0057850_890_2026 299
77 3300041405 Ga0439438_008343 Ga0439438_008343_1639_2766 299
78 3300041407 Ga0439447_004864 Ga0439447_004864_2850_3977 299
79 3300041411 Ga0439466_0019894 Ga0439466_0019894_149_1276 299
80 3300042010 Ga0439452_001096 Ga0439452_001096_1934_3061 299
81 3300042125 Ga0450923_011998 Ga0450923_011998_416_1543 299
82 3300042435 Ga0439434_0000409 Ga0439434_0000409_8731_9858 299
83 3300003771 Ga0055526_1018434 Ga0055526_10184342 300
84 3300003775 Ga0055524_1005794 Ga0055524_10057946 300
85 3300003775 Ga0055524_1006134 Ga0055524_10061344 300
86 3300003784 Ga0055534_1008929 Ga0055534_10089292 300
87 3300003791 Ga0055530_10002892 Ga0055530_100028924 300
88 3300003794 Ga0055531_10007665 Ga0055531_100076651 300
89 3300003794 Ga0055531_10019784 Ga0055531_100197842 300
90 3300005330 Ga0070690_100016433 Ga0070690_1000164334 300
91 3300005331 Ga0070670_100042010 Ga0070670_1000420103 300
92 3300005337 Ga0070682_100048369 Ga0070682_1000483692 300
93 3300005337 Ga0070682_100083951 Ga0070682_1000839512 300
94 3300005543 Ga0070672_100009398 Ga0070672_1000093985 300
95 3300005564 Ga0070664_100123671 Ga0070664_1001236712 300
96 3300005840 Ga0068870_10091235 Ga0068870_100912352 300
97 3300005841 Ga0068863_100298084 Ga0068863_1002980842 300
98 3300013308 Ga0157375_10085689 Ga0157375_100856892 300
99 3300014325 Ga0163163_10015145 Ga0163163_100151452 300
100 3300015689 Ga0183360_10001 Ga0183360_100011253 300
101 3300025273 Ga0209673_1004687 Ga0209673_10046877 300
102 3300025291 Ga0209675_1015306 Ga0209675_10153061 300
103 3300025291 Ga0209675_1021926 Ga0209675_10219261 300
104 3300025292 Ga0209676_1001944 Ga0209676_100194412 300
105 3300025292 Ga0209676_1009576 Ga0209676_10095762 300
106 3300025292 Ga0209676_1020268 Ga0209676_10202682 300
107 3300025294 Ga0209025_1002444 Ga0209025_100244418 300
108 3300025294 Ga0209025_1045791 Ga0209025_10457912 300
109 3300025295 Ga0209564_1010571 Ga0209564_10105711 300
110 3300025298 Ga0209050_1000528 Ga0209050_100052855 300
111 3300025298 Ga0209050_1023040 Ga0209050_10230402 300
112 3300025299 Ga0209256_1005613 Ga0209256_10056132 300
113 3300025303 Ga0209051_1015746 Ga0209051_10157462 300
114 3300025304 Ga0209257_1001140 Ga0209257_10011402 300
115 3300025304 Ga0209257_1008065 Ga0209257_10080655 300
116 3300025304 Ga0209257_1009184 Ga0209257_10091845 300
117 3300025304 Ga0209257_1016252 Ga0209257_10162522 300
118 3300025304 Ga0209257_1023412 Ga0209257_10234122 300
119 3300025908 Ga0207643_10039234 Ga0207643_100392342 300
120 3300025925 Ga0207650_10040600 Ga0207650_100406002 300
121 3300025940 Ga0207691_10022186 Ga0207691_100221864 300
122 3300025945 Ga0207679_10045805 Ga0207679_100458052 300
123 3300025960 Ga0207651_10082221 Ga0207651_100822212 300
124 3300026088 Ga0207641_10013278 Ga0207641_100132782 300
125 3300028800 Ga0265338_10016809 Ga0265338_100168095 300
126 3300031456 Ga0307513_10045664 Ga0307513_100456645 300
127 3300035092 Ga0373952_0005584 Ga0373952_0005584_1111_2226 300
128 3300041460 Ga0451802_0280070 Ga0451802_0280070_351_1490 300
129 3300045049 Ga0466959_0003395 Ga0466959_0003395_7008_8186 300
130 3300046460 Ga0495638_0007531 Ga0495638_0007531_1211_2350 300
131 3300046694 Ga0495649_0011944 Ga0495649_0011944_56_1195 300
132 3300006175 Ga0070712_100047957 Ga0070712_1000479572 301
133 3300007265 Ga0099794_10093976 Ga0099794_100939762 301
134 3300007788 Ga0099795_10002255 Ga0099795_100022553 301
135 3300009036 Ga0105244_10048461 Ga0105244_100484612 301
136 3300013102 Ga0157371_10001526 Ga0157371_1000152611 301
137 3300031456 Ga0307513_10180328 Ga0307513_101803281 301
138 3300031507 Ga0307509_10009871 Ga0307509_100098717 301
139 3300031507 Ga0307509_10166270 Ga0307509_101662702 301
140 3300033529 Ga0316587_1000210 Ga0316587_10002102 301
141 3300033541 Ga0316596_1001258 Ga0316596_10012583 301
142 3300033541 Ga0316596_1010167 Ga0316596_10101672 301
143 3300035725 Ga0373947_0237989 Ga0373947_0237989_68_1186 301
144 3300036401 Ga0373937_0078266 Ga0373937_0078266_1491_2609 301
145 3300038726 Ga0400490_18168 Ga0400490_18168_10678_11808 301
146 3300038735 Ga0400485_19947 Ga0400485_19947_1722_2861 301
147 3300038742 Ga0400486_28947 Ga0400486_28947_6624_7763 301
148 3300039062 Ga0400483_089739 Ga0400483_089739_10549_11688 301
149 3300039110 Ga0400487_32815 Ga0400487_32815_4415_5554 301
150 3300041407 Ga0439447_007610 Ga0439447_007610_1189_2319 301
151 3300046457 Ga0495590_0000646 Ga0495590_0000646_9497_10639 301
152 3300046460 Ga0495638_0085023 Ga0495638_0085023_250_1392 301
153 3300046513 Ga0495616_0001194 Ga0495616_0001194_4692_5834 301
154 3300046519 Ga0495632_0016452 Ga0495632_0016452_12_1154 301
155 3300046616 Ga0495668_0005431 Ga0495668_0005431_7333_8469 301
156 3300046660 Ga0495625_0037625 Ga0495625_0037625_839_1981 301
157 3300048907 Ga0496104_0001002 Ga0496104_0001002_7312_8430 301
158 3300048908 Ga0496105_0002557 Ga0496105_0002557_6124_7242 301
159 3300048917 Ga0496114_0002649 Ga0496114_0002649_5383_6501 301
160 3300048918 Ga0496115_0004090 Ga0496115_0004090_3509_4627 301
161 3300049571 Ga0501034_0011597 Ga0501034_0011597_7338_8468 301
162 3300049574 Ga0501038_0160085 Ga0501038_0160085_223_1353 301
163 3300001979 JGI24740J21852_10010136 JGI24740J21852_100101362 302
164 3300001989 JGI24739J22299_10000167 JGI24739J22299_100001675 302
165 3300001990 JGI24737J22298_10003147 JGI24737J22298_100031475 302
166 3300003215 JGI25153J46596_10007884 JGI25153J46596_100078844 302
167 3300003578 Ga0006562J51391_1029636 Ga0006562J51391_10296365 302
168 3300003578 Ga0006562J51391_1029639 Ga0006562J51391_10296395 302
169 3300005344 Ga0070661_100069481 Ga0070661_1000694812 302
170 3300005563 Ga0068855_100015659 Ga0068855_1000156599 302
171 3300005577 Ga0068857_100013607 Ga0068857_1000136075 302
172 3300005616 Ga0068852_100057147 Ga0068852_1000571473 302
173 3300005842 Ga0068858_100010775 Ga0068858_1000107755 302
174 3300009093 Ga0105240_10088230 Ga0105240_100882303 302
175 3300009101 Ga0105247_10008930 Ga0105247_100089303 302
176 3300009545 Ga0105237_10000016 Ga0105237_10000016216 302
177 3300010375 Ga0105239_10012123 Ga0105239_100121235 302
178 3300013105 Ga0157369_10414181 Ga0157369_104141811 302
179 3300013306 Ga0163162_10000003 Ga0163162_10000003151 302
180 3300014497 Ga0182008_10040768 Ga0182008_100407681 302
181 3300015261 Ga0182006_1000074 Ga0182006_1000074107 302
182 3300015261 Ga0182006_1033553 Ga0182006_10335531 302
183 3300015262 Ga0182007_10005776 Ga0182007_100057763 302
184 3300022467 Ga0224712_10016760 Ga0224712_100167602 302
185 3300025258 Ga0209129_1002077 Ga0209129_10020778 302
186 3300025297 Ga0209758_1001482 Ga0209758_100148222 302
187 3300025904 Ga0207647_10076453 Ga0207647_100764532 302
188 3300025913 Ga0207695_10009557 Ga0207695_100095578 302
189 3300025914 Ga0207671_10000137 Ga0207671_1000013716 302
190 3300025949 Ga0207667_10001167 Ga0207667_1000116718 302
191 3300026035 Ga0207703_10017403 Ga0207703_100174033 302
192 3300026116 Ga0207674_10011055 Ga0207674_1001105510 302
193 3300026142 Ga0207698_10041036 Ga0207698_100410363 302
194 3300031665 Ga0316575_10020580 Ga0316575_100205803 302
195 3300031691 Ga0316579_10027062 Ga0316579_100270623 302
196 3300031728 Ga0316578_10022212 Ga0316578_100222124 302
197 3300032168 Ga0316593_10006813 Ga0316593_100068132 302
198 3300033527 Ga0316586_1002055 Ga0316586_10020551 302
199 3300033529 Ga0316587_1000466 Ga0316587_10004661 302
200 3300041486 Ga0451807_1175588 Ga0451807_1175588_3138_4274 302
201 3300044712 Ga0453684_0000593 Ga0453684_0000593_90019_91146 302
202 3300045051 Ga0451576_0000156 Ga0451576_0000156_83051_84178 302
203 3300046460 Ga0495638_0000122 Ga0495638_0000122_22370_23500 302
204 3300046492 Ga0495585_0000423 Ga0495585_0000423_8240_9370 302
205 3300046501 Ga0495607_0001986 Ga0495607_0001986_1416_2546 302
206 3300046518 Ga0495631_0005329 Ga0495631_0005329_156_1286 302
207 3300046520 Ga0495637_0018188 Ga0495637_0018188_924_2054 302
208 3300046524 Ga0495648_0013180 Ga0495648_0013180_1653_2783 302
209 3300046538 Ga0495609_0010100 Ga0495609_0010100_2143_3273 302
210 3300046616 Ga0495668_0015195 Ga0495668_0015195_3318_4448 302
211 3300046648 Ga0495611_0000001 Ga0495611_0000001_1757685_1758815 302
212 3300046660 Ga0495625_0000001 Ga0495625_0000001_157236_158366 302
213 3300046665 Ga0495661_0005030 Ga0495661_0005030_6809_7939 302
214 3300046691 Ga0495670_0006643 Ga0495670_0006643_2971_4101 302
215 3300046692 Ga0495671_0014149 Ga0495671_0014149_1191_2321 302
216 3300046810 Ga0495660_0000411 Ga0495660_0000411_31382_32512 302
217 3300046810 Ga0495660_0000801 Ga0495660_0000801_1128_2258 302
218 3300047318 Ga0495636_0009260 Ga0495636_0009260_518_1660 302
219 3300047318 Ga0495636_0031549 Ga0495636_0031549_513_1655 302
220 3300047446 Ga0495679_000029 Ga0495679_000029_18155_19285 302
221 3300047469 Ga0495673_0000001 Ga0495673_0000001_102678_103808 302
222 3300047469 Ga0495673_0011430 Ga0495673_0011430_2601_3731 302
223 3300047470 Ga0495681_0026609 Ga0495681_0026609_627_1757 302
224 3300048910 Ga0496107_0183065 Ga0496107_0183065_297_1427 302
225 3300048924 Ga0496121_0017399 Ga0496121_0017399_1490_2620 302
226 3300048924 Ga0496121_0026266 Ga0496121_0026266_3709_4833 302
227 3300048928 Ga0496125_0000149 Ga0496125_0000149_129378_130502 302
228 3300049459 Ga0495678_000718 Ga0495678_000718_27966_29096 302
229 3300049570 Ga0501033_0005880 Ga0501033_0005880_3425_4552 302
230 3300053087 Ga0500643_000002 Ga0500643_000002_60060_61190 302
231 3300053730 Ga0500645_006047 Ga0500645_006047_1554_2684 302
232 3300005563 Ga0068855_100165774 Ga0068855_1001657742 303
233 3300005578 Ga0068854_100020288 Ga0068854_1000202886 303
234 3300006051 Ga0075364_10001000 Ga0075364_1000100010 303
235 3300009093 Ga0105240_10289252 Ga0105240_102892522 303
236 3300014969 Ga0157376_10060224 Ga0157376_100602242 303
237 3300025913 Ga0207695_10048145 Ga0207695_100481455 303
238 3300025949 Ga0207667_10000250 Ga0207667_1000025054 303
239 3300025981 Ga0207640_10001071 Ga0207640_1000107110 303
240 3300038725 Ga0400484_37774 Ga0400484_37774_2102_3250 303
241 3300041509 Ga0451843_1531715 Ga0451843_1531715_332_1456 303
242 3300044712 Ga0453684_0005838 Ga0453684_0005838_5368_6498 303
243 3300050491 nmdc:mga00v17_1798_c1 nmdc:mga00v17_1798_c1_8775_9902 303
244 3300005262 Ga0065165_1003051 Ga0065165_10030516 304
245 3300005344 Ga0070661_100043141 Ga0070661_1000431412 304
246 3300005345 Ga0070692_10033974 Ga0070692_100339742 304
247 3300005457 Ga0070662_100014406 Ga0070662_1000144065 304
248 3300005539 Ga0068853_100087397 Ga0068853_1000873972 304
249 3300005577 Ga0068857_100194968 Ga0068857_1001949682 304
250 3300005614 Ga0068856_100184765 Ga0068856_1001847651 304
251 3300009098 Ga0105245_10057894 Ga0105245_100578943 304
252 3300009545 Ga0105237_10179676 Ga0105237_101796761 304
253 3300010375 Ga0105239_10264492 Ga0105239_102644922 304
254 3300013102 Ga0157371_10030944 Ga0157371_100309444 304
255 3300013105 Ga0157369_10226749 Ga0157369_102267492 304
256 3300025904 Ga0207647_10014092 Ga0207647_100140922 304
257 3300025919 Ga0207657_10009612 Ga0207657_100096125 304
258 3300025924 Ga0207694_10065116 Ga0207694_100651162 304
259 3300025927 Ga0207687_10126763 Ga0207687_101267632 304
260 3300025932 Ga0207690_10000443 Ga0207690_1000044312 304
261 3300025933 Ga0207706_10009141 Ga0207706_100091414 304
262 3300025949 Ga0207667_10010527 Ga0207667_100105275 304
263 3300026078 Ga0207702_10060448 Ga0207702_100604482 304
264 3300031691 Ga0316579_10001999 Ga0316579_100019991 304
265 3300031733 Ga0316577_10091163 Ga0316577_100911632 304
266 3300033541 Ga0316596_1034368 Ga0316596_10343681 304
267 3300035398 Ga0316574_0041814 Ga0316574_0041814_509_1627 304
268 3300036647 Ga0316582_0023052 Ga0316582_0023052_1560_2708 304
269 3300037588 Ga0316581_0010925 Ga0316581_0010925_558_1706 304
270 3300038735 Ga0400485_11431 Ga0400485_11431_34619_35764 304
271 3300038742 Ga0400486_26250 Ga0400486_26250_47745_48890 304
272 3300039110 Ga0400487_65159 Ga0400487_65159_1910_3055 304
273 3300042005 Ga0439448_0008704 Ga0439448_0008704_1536_2663 304
274 3300044712 Ga0453684_0002079 Ga0453684_0002079_46657_47793 304
275 3300046471 Ga0495650_0002282 Ga0495650_0002282_13376_14506 304
276 3300046491 Ga0495584_0007978 Ga0495584_0007978_4262_5392 304
277 3300046492 Ga0495585_0079348 Ga0495585_0079348_624_1754 304
278 3300046507 Ga0495606_0001107 Ga0495606_0001107_34729_35859 304
279 3300046513 Ga0495616_0000067 Ga0495616_0000067_79589_80719 304
280 3300046518 Ga0495631_0004759 Ga0495631_0004759_5218_6348 304
281 3300046519 Ga0495632_0007024 Ga0495632_0007024_63_1193 304
282 3300046519 Ga0495632_0055347 Ga0495632_0055347_86_1216 304
283 3300046524 Ga0495648_0005955 Ga0495648_0005955_7884_9014 304
284 3300046648 Ga0495611_0004654 Ga0495611_0004654_61_1191 304
285 3300046691 Ga0495670_0135521 Ga0495670_0135521_120_1250 304
286 3300047323 Ga0495683_0004541 Ga0495683_0004541_6482_7612 304
287 3300047469 Ga0495673_0000018 Ga0495673_0000018_449861_450991 304
288 3300047472 Ga0495686_0007272 Ga0495686_0007272_3846_4976 304
289 3300047472 Ga0495686_0047713 Ga0495686_0047713_1487_2617 304
290 3300048924 Ga0496121_0009283 Ga0496121_0009283_4464_5594 304
291 3300005458 Ga0070681_10048497 Ga0070681_100484972 305
292 3300006946 Ga0079104_1003337 Ga0079104_10033376 305
293 3300009092 Ga0105250_10000028 Ga0105250_10000028101 305
294 3300009092 Ga0105250_10005988 Ga0105250_100059882 305
295 3300009101 Ga0105247_10000387 Ga0105247_1000038730 305
296 3300015265 Ga0182005_1000326 Ga0182005_10003267 305
297 3300017792 Ga0163161_10000002 Ga0163161_10000002179 305
298 3300025711 Ga0207696_1000009 Ga0207696_1000009194 305
299 3300025711 Ga0207696_1000027 Ga0207696_1000027185 305
300 3300025735 Ga0207713_1000034 Ga0207713_100003417 305
301 3300025900 Ga0207710_10000015 Ga0207710_10000015331 305
302 3300037471 Ga0395905_0031808 Ga0395905_0031808_2567_3706 305
303 3300038443 Ga0395901_0108709 Ga0395901_0108709_1394_2521 305
304 3300038725 Ga0400484_24107 Ga0400484_24107_2190_3338 305
305 3300044672 Ga0466982_0000019 Ga0466982_0000019_5663_6835 305
306 3300044684 Ga0466966_0007333 Ga0466966_0007333_653_1825 305
307 3300044706 Ga0466964_0012424 Ga0466964_0012424_1662_2834 305
308 3300044901 Ga0466960_0067790 Ga0466960_0067790_485_1657 305
309 3300045836 Ga0466958_0164730 Ga0466958_0164730_90_1262 305
310 3300046501 Ga0495607_0041396 Ga0495607_0041396_425_1555 305
311 3300047472 Ga0495686_0010235 Ga0495686_0010235_3548_4678 305
312 3300048919 Ga0496116_0000015 Ga0496116_0000015_212350_213480 305
313 3300048920 Ga0496117_0007719 Ga0496117_0007719_3966_5096 305
314 3300048921 Ga0496118_0009054 Ga0496118_0009054_3177_4307 305
315 3300002737 JGI25162J39368_1000006 JGI25162J39368_1000006123 306
316 3300002771 JGI25163J39215_1000001 JGI25163J39215_1000001234 306
317 3300002772 JGI25164J39214_1000001 JGI25164J39214_1000001194 306
318 3300003751 Ga0055538_1000004 Ga0055538_1000004324 306
319 3300003752 Ga0055539_1000004 Ga0055539_1000004234 306
320 3300003756 Ga0055533_1000007 Ga0055533_1000007324 306
321 3300003759 Ga0055525_1000007 Ga0055525_1000007324 306
322 3300003841 Ga0055541_1000004 Ga0055541_1000004324 306
323 3300005289 Ga0065704_10000908 Ga0065704_100009086 306
324 3300009036 Ga0105244_10000023 Ga0105244_1000002367 306
325 3300009036 Ga0105244_10003761 Ga0105244_100037615 306
326 3300009092 Ga0105250_10000925 Ga0105250_100009256 306
327 3300009093 Ga0105240_10000218 Ga0105240_1000021844 306
328 3300013100 Ga0157373_10108249 Ga0157373_101082492 306
329 3300013102 Ga0157371_10000020 Ga0157371_10000020138 306
330 3300013102 Ga0157371_10096017 Ga0157371_100960172 306
331 3300013104 Ga0157370_10000740 Ga0157370_1000074031 306
332 3300013105 Ga0157369_10086111 Ga0157369_100861114 306
333 3300013306 Ga0163162_10021302 Ga0163162_100213024 306
334 3300025207 Ga0209760_100063 Ga0209760_10006337 306
335 3300025224 Ga0209784_100001 Ga0209784_100001318 306
336 3300025225 Ga0209566_100001 Ga0209566_100001318 306
337 3300025226 Ga0209674_100002 Ga0209674_100002318 306
338 3300025230 Ga0209563_100008 Ga0209563_100008321 306
339 3300025231 Ga0207427_100002 Ga0207427_100002959 306
340 3300025233 Ga0209437_100046 Ga0209437_100046123 306
341 3300025253 Ga0209677_100004 Ga0209677_100004321 306
342 3300025261 Ga0209233_1006818 Ga0209233_10068183 306
343 3300025711 Ga0207696_1000093 Ga0207696_100009356 306
344 3300025728 Ga0207655_1000056 Ga0207655_1000056132 306
345 3300025728 Ga0207655_1003121 Ga0207655_10031216 306
346 3300025913 Ga0207695_10000395 Ga0207695_1000039558 306
347 3300028379 Ga0268266_10098856 Ga0268266_100988563 306
348 3300031852 Ga0307410_10094983 Ga0307410_100949832 306
349 3300032005 Ga0307411_10159615 Ga0307411_101596152 306
350 3300037471 Ga0395905_0232181 Ga0395905_0232181_112_1239 306
351 3300042013 Ga0439456_013127 Ga0439456_013127_172_1305 306
352 3300046453 Ga0495627_000042 Ga0495627_000042_17012_18142 306
353 3300046471 Ga0495650_0000004 Ga0495650_0000004_358144_359277 306
354 3300046507 Ga0495606_0013223 Ga0495606_0013223_743_1870 306
355 3300046810 Ga0495660_0000013 Ga0495660_0000013_260823_261956 306
356 3300047470 Ga0495681_0007084 Ga0495681_0007084_4262_5401 306
357 3300048907 Ga0496104_0050979 Ga0496104_0050979_259_1392 306
358 3300048919 Ga0496116_0000016 Ga0496116_0000016_229289_230422 306
359 3300048921 Ga0496118_0007761 Ga0496118_0007761_6006_7139 306
360 3300048923 Ga0496120_0004519 Ga0496120_0004519_6041_7174 306
361 3300048925 Ga0496122_0000125 Ga0496122_0000125_90064_91197 306
362 3300048926 Ga0496123_0000092 Ga0496123_0000092_88472_89605 306
363 3300048927 Ga0496124_0000238 Ga0496124_0000238_79983_81116 306
364 3300048928 Ga0496125_0001495 Ga0496125_0001495_25900_27033 306
365 3300048929 Ga0496126_0000109 Ga0496126_0000109_72587_73720 306
366 3300049568 Ga0501031_0002335 Ga0501031_0002335_1594_2721 306
367 3300049569 Ga0501032_0030291 Ga0501032_0030291_726_1853 306
368 3300049571 Ga0501034_0098610 Ga0501034_0098610_427_1554 306
369 3300049572 Ga0501036_0077557 Ga0501036_0077557_99_1226 306
370 3300049573 Ga0501037_0005791 Ga0501037_0005791_1459_2586 306
371 3300049574 Ga0501038_0001341 Ga0501038_0001341_3041_4168 306
372 3300049575 Ga0501039_0066108 Ga0501039_0066108_274_1401 306
373 3300049579 Ga0501043_0019401 Ga0501043_0019401_2333_3460 306
374 3300049581 Ga0501047_0024619 Ga0501047_0024619_2115_3242 306
375 3300049586 Ga0501070_0010973 Ga0501070_0010973_6211_7338 306
376 3300049589 Ga0501073_0069323 Ga0501073_0069323_1243_2370 306
377 3300049822 Ga0501035_0029407 Ga0501035_0029407_1844_2971 306
378 3300049823 Ga0501044_0011340 Ga0501044_0011340_1988_3115 306
379 3300046452 Ga0495617_003710 Ga0495617_003710_36_1163 307
380 3300046515 Ga0495620_0006272 Ga0495620_0006272_615_1742 307
381 3300005293 Ga0065715_10038420 Ga0065715_100384201 308
382 3300005530 Ga0070679_100298562 Ga0070679_1002985622 308
383 3300005546 Ga0070696_100002428 Ga0070696_1000024288 308
384 3300005614 Ga0068856_100010251 Ga0068856_1000102514 308
385 3300005618 Ga0068864_100005151 Ga0068864_1000051513 308
386 3300005841 Ga0068863_100000773 Ga0068863_1000007733 308
387 3300005843 Ga0068860_100132629 Ga0068860_1001326292 308
388 3300009177 Ga0105248_10032216 Ga0105248_100322166 308
389 3300009551 Ga0105238_10007103 Ga0105238_100071033 308
390 3300011119 Ga0105246_10096071 Ga0105246_100960713 308
391 3300013102 Ga0157371_10083827 Ga0157371_100838272 308
392 3300013104 Ga0157370_10086892 Ga0157370_100868923 308
393 3300013307 Ga0157372_10165507 Ga0157372_101655073 308
394 3300014325 Ga0163163_10000766 Ga0163163_1000076624 308
395 3300014968 Ga0157379_10000444 Ga0157379_100004446 308
396 3300020077 Ga0206351_10099632 Ga0206351_100996322 308
397 3300025924 Ga0207694_10119078 Ga0207694_101190783 308
398 3300026078 Ga0207702_10000104 Ga0207702_1000010444 308
399 3300026088 Ga0207641_10007379 Ga0207641_100073793 308
400 3300035398 Ga0316574_0063949 Ga0316574_0063949_545_1675 308
401 3300037466 Ga0395898_0025039 Ga0395898_0025039_515_1645 308
402 3300037471 Ga0395905_0034172 Ga0395905_0034172_1759_2889 308
403 3300042004 Ga0439445_0001596 Ga0439445_0001596_2308_3435 308
404 3300042007 Ga0439449_0000905 Ga0439449_0000905_6809_7933 308
405 3300047472 Ga0495686_0097119 Ga0495686_0097119_605_1729 308
406 3300049572 Ga0501036_0159848 Ga0501036_0159848_547_1680 308
407 3300049581 Ga0501047_0093814 Ga0501047_0093814_617_1750 308
408 3300053093 Ga0500651_0029217 Ga0500651_0029217_699_1829 308
409 3300005335 Ga0070666_10000643 Ga0070666_1000064317 309
410 3300005335 Ga0070666_10018535 Ga0070666_100185352 309
411 3300005344 Ga0070661_100216219 Ga0070661_1002162191 309
412 3300005366 Ga0070659_100060713 Ga0070659_1000607132 309
413 3300005367 Ga0070667_100029472 Ga0070667_1000294723 309
414 3300005457 Ga0070662_100092530 Ga0070662_1000925302 309
415 3300005458 Ga0070681_10103136 Ga0070681_101031362 309
416 3300005530 Ga0070679_100175574 Ga0070679_1001755742 309
417 3300005577 Ga0068857_100049199 Ga0068857_1000491993 309
418 3300005842 Ga0068858_100044385 Ga0068858_1000443853 309
419 3300005843 Ga0068860_100025495 Ga0068860_1000254953 309
420 3300009093 Ga0105240_10034775 Ga0105240_100347752 309
421 3300013102 Ga0157371_10059426 Ga0157371_100594263 309
422 3300013105 Ga0157369_10020361 Ga0157369_100203614 309
423 3300025321 Ga0207656_10035728 Ga0207656_100357282 309
424 3300025903 Ga0207680_10002922 Ga0207680_100029224 309
425 3300025904 Ga0207647_10002782 Ga0207647_100027823 309
426 3300025919 Ga0207657_10002079 Ga0207657_1000207916 309
427 3300025935 Ga0207709_10008291 Ga0207709_100082912 309
428 3300025949 Ga0207667_10190525 Ga0207667_101905251 309
429 3300025986 Ga0207658_10291622 Ga0207658_102916222 309
430 3300026116 Ga0207674_10041215 Ga0207674_100412153 309
431 3300030733 Ga0314311_1227168 Ga0314311_12271681 309
432 3300030735 Ga0316178_1160356 Ga0316178_11603562 309
433 3300041459 Ga0451800_0124589 Ga0451800_0124589_155_1291 309
434 3300041462 Ga0451806_093730 Ga0451806_093730_2449_3585 309
435 3300041463 Ga0451804_1138182 Ga0451804_1138182_118_1254 309
436 3300041486 Ga0451807_1480792 Ga0451807_1480792_978_2114 309
437 3300042134 Ga0450898_003505 Ga0450898_003505_612_1736 309
438 3300048920 Ga0496117_0010350 Ga0496117_0010350_6795_7922 309
439 3300048921 Ga0496118_0028873 Ga0496118_0028873_675_1802 309
440 3300048927 Ga0496124_0038859 Ga0496124_0038859_697_1824 309
441 3300049585 Ga0501069_0092778 Ga0501069_0092778_561_1679 309
442 3300049586 Ga0501070_0002917 Ga0501070_0002917_11746_12864 309
443 2162886007 SwRhRL2b_contig_2281198 SwRhRL2b_0184.00004070 310
444 3300002075 JGI24738J21930_10001643 JGI24738J21930_100016435 310
445 3300003771 Ga0055526_1001593 Ga0055526_100159312 310
446 3300003773 Ga0055537_1000407 Ga0055537_10004077 310
447 3300003784 Ga0055534_1000039 Ga0055534_100003912 310
448 3300003790 Ga0055528_1000529 Ga0055528_100052912 310
449 3300003791 Ga0055530_10001509 Ga0055530_100015092 310
450 3300003791 Ga0055530_10001526 Ga0055530_100015262 310
451 3300005289 Ga0065704_10072174 Ga0065704_100721742 310
452 3300005331 Ga0070670_100157879 Ga0070670_1001578791 310
453 3300005337 Ga0070682_100049410 Ga0070682_1000494102 310
454 3300005337 Ga0070682_100049816 Ga0070682_1000498162 310
455 3300005366 Ga0070659_100004057 Ga0070659_1000040572 310
456 3300005366 Ga0070659_100012104 Ga0070659_1000121046 310
457 3300005367 Ga0070667_100000084 Ga0070667_100000084102 310
458 3300005444 Ga0070694_100039326 Ga0070694_1000393263 310
459 3300005455 Ga0070663_100000567 Ga0070663_1000005675 310
460 3300005466 Ga0070685_10037277 Ga0070685_100372772 310
461 3300005539 Ga0068853_100004423 Ga0068853_1000044236 310
462 3300005548 Ga0070665_100066966 Ga0070665_1000669662 310
463 3300005577 Ga0068857_100091456 Ga0068857_1000914563 310
464 3300005616 Ga0068852_100087785 Ga0068852_1000877852 310
465 3300006051 Ga0075364_10096758 Ga0075364_100967581 310
466 3300009011 Ga0105251_10000880 Ga0105251_1000088017 310
467 3300009093 Ga0105240_10296914 Ga0105240_102969142 310
468 3300009177 Ga0105248_10000429 Ga0105248_1000042916 310
469 3300009545 Ga0105237_10000388 Ga0105237_1000038820 310
470 3300009551 Ga0105238_10010366 Ga0105238_100103666 310
471 3300009553 Ga0105249_10004651 Ga0105249_100046517 310
472 3300013100 Ga0157373_10010911 Ga0157373_100109115 310
473 3300013102 Ga0157371_10007378 Ga0157371_100073786 310
474 3300013307 Ga0157372_10030087 Ga0157372_100300872 310
475 3300014497 Ga0182008_10002113 Ga0182008_100021135 310
476 3300015261 Ga0182006_1001229 Ga0182006_10012293 310
477 3300015261 Ga0182006_1018769 Ga0182006_10187692 310
478 3300015261 Ga0182006_1040668 Ga0182006_10406681 310
479 3300015265 Ga0182005_1001110 Ga0182005_10011107 310
480 3300017792 Ga0163161_10114610 Ga0163161_101146102 310
481 3300025228 Ga0209672_100870 Ga0209672_10087010 310
482 3300025263 Ga0209565_1000014 Ga0209565_100001487 310
483 3300025273 Ga0209673_1000171 Ga0209673_1000171138 310
484 3300025284 Ga0209130_1013770 Ga0209130_10137702 310
485 3300025291 Ga0209675_1000011 Ga0209675_1000011367 310
486 3300025292 Ga0209676_1000079 Ga0209676_1000079261 310
487 3300025295 Ga0209564_1000221 Ga0209564_1000221104 310
488 3300025298 Ga0209050_1000689 Ga0209050_10006892 310
489 3300025298 Ga0209050_1001366 Ga0209050_10013662 310
490 3300025299 Ga0209256_1005221 Ga0209256_10052217 310
491 3300025303 Ga0209051_1002764 Ga0209051_10027645 310
492 3300025304 Ga0209257_1000081 Ga0209257_1000081271 310
493 3300025304 Ga0209257_1002903 Ga0209257_100290313 310
494 3300025735 Ga0207713_1009013 Ga0207713_10090132 310
495 3300025912 Ga0207707_10019214 Ga0207707_100192142 310
496 3300025914 Ga0207671_10014803 Ga0207671_100148033 310
497 3300025919 Ga0207657_10155575 Ga0207657_101555751 310
498 3300025924 Ga0207694_10099388 Ga0207694_100993881 310
499 3300025925 Ga0207650_10065979 Ga0207650_100659792 310
500 3300025932 Ga0207690_10004983 Ga0207690_100049835 310
501 3300025932 Ga0207690_10039811 Ga0207690_100398113 310
502 3300025941 Ga0207711_10001015 Ga0207711_100010152 310
503 3300025949 Ga0207667_10009481 Ga0207667_100094819 310
504 3300025961 Ga0207712_10000343 Ga0207712_100003437 310
505 3300025986 Ga0207658_10000093 Ga0207658_100000932 310
506 3300026041 Ga0207639_10023825 Ga0207639_100238252 310
507 3300026067 Ga0207678_10001491 Ga0207678_100014912 310
508 3300026116 Ga0207674_10120388 Ga0207674_101203882 310
509 3300026142 Ga0207698_10180667 Ga0207698_101806672 310
510 3300039062 Ga0400483_097431 Ga0400483_097431_204_1352 310
511 3300039062 Ga0400483_268468 Ga0400483_268468_8573_9721 310
512 3300041404 Ga0439436_0000010 Ga0439436_0000010_67736_68863 310
513 3300041413 Ga0439465_0003188 Ga0439465_0003188_890_2017 310
514 3300041494 Ga0451837_1816185 Ga0451837_1816185_145_1275 310
515 3300042438 Ga0439459_0004768 Ga0439459_0004768_470_1594 310
516 3300046460 Ga0495638_0001504 Ga0495638_0001504_11739_12887 310
517 3300046507 Ga0495606_0000348 Ga0495606_0000348_44300_45448 310
518 3300046512 Ga0495610_0001640 Ga0495610_0001640_17742_18869 310
519 3300046519 Ga0495632_0000046 Ga0495632_0000046_103054_104184 310
520 3300046557 Ga0495622_0019805 Ga0495622_0019805_1865_3013 310
521 3300046660 Ga0495625_0077729 Ga0495625_0077729_18_1166 310
522 3300046691 Ga0495670_0002524 Ga0495670_0002524_2294_3421 310
523 3300046694 Ga0495649_0016409 Ga0495649_0016409_1168_2316 310
524 3300047320 Ga0495672_0000596 Ga0495672_0000596_879_2039 310
525 3300047472 Ga0495686_0061162 Ga0495686_0061162_326_1486 310
526 3300047472 Ga0495686_0085505 Ga0495686_0085505_563_1684 310
527 3300048918 Ga0496115_0012285 Ga0496115_0012285_3370_4518 310
528 3300048921 Ga0496118_0006581 Ga0496118_0006581_10611_11738 310
529 3300048921 Ga0496118_0104861 Ga0496118_0104861_525_1655 310
530 3300048922 Ga0496119_0003593 Ga0496119_0003593_1320_2450 310
531 3300048923 Ga0496120_0000307 Ga0496120_0000307_62201_63331 310
532 3300048924 Ga0496121_0104532 Ga0496121_0104532_799_1920 310
533 3300048925 Ga0496122_0000267 Ga0496122_0000267_18256_19386 310
534 3300048925 Ga0496122_0004439 Ga0496122_0004439_14914_16035 310
535 3300048926 Ga0496123_0000161 Ga0496123_0000161_18330_19460 310
536 3300048926 Ga0496123_0003530 Ga0496123_0003530_1363_2484 310
537 3300048927 Ga0496124_0003052 Ga0496124_0003052_1641_2771 310
538 3300048927 Ga0496124_0157882 Ga0496124_0157882_17_1144 310
539 3300048929 Ga0496126_0051430 Ga0496126_0051430_2519_3667 310
540 3300048929 Ga0496126_0067067 Ga0496126_0067067_1310_2431 310
541 3300049459 Ga0495678_027434 Ga0495678_027434_896_2044 310
542 3300049569 Ga0501032_0079907 Ga0501032_0079907_20_1144 310
543 3300049571 Ga0501034_0020047 Ga0501034_0020047_4442_5566 310
544 3300049579 Ga0501043_0159145 Ga0501043_0159145_82_1206 310
545 3300049586 Ga0501070_0057150 Ga0501070_0057150_651_1775 310
546 3300049742 Ga0501080_0309120 Ga0501080_0309120_245_1369 310
547 3300049823 Ga0501044_0038490 Ga0501044_0038490_3238_4362 310
548 3300053087 Ga0500643_003542 Ga0500643_003542_237_1358 310
549 3300053120 Ga0500597_000225 Ga0500597_000225_8862_9983 310
550 iso_pu_bacteria 2916178963 2916179209 310
551 3300001904 JGI24736J21556_1005967 JGI24736J21556_10059672 311
552 3300002737 JGI25162J39368_1004188 JGI25162J39368_10041883 311
553 3300003762 Ga0055542_1001422 Ga0055542_10014222 311
554 3300003763 Ga0055529_1004977 Ga0055529_10049771 311
555 3300005337 Ga0070682_100040268 Ga0070682_1000402683 311
556 3300005347 Ga0070668_100165760 Ga0070668_1001657602 311
557 3300005355 Ga0070671_100146027 Ga0070671_1001460272 311
558 3300005444 Ga0070694_100076383 Ga0070694_1000763832 311
559 3300005455 Ga0070663_100042063 Ga0070663_1000420632 311
560 3300005547 Ga0070693_100004513 Ga0070693_1000045136 311
561 3300005563 Ga0068855_100041192 Ga0068855_1000411924 311
562 3300005578 Ga0068854_100030961 Ga0068854_1000309614 311
563 3300005618 Ga0068864_100058813 Ga0068864_1000588131 311
564 3300006051 Ga0075364_10157042 Ga0075364_101570421 311
565 3300009093 Ga0105240_10018547 Ga0105240_100185478 311
566 3300009545 Ga0105237_10013505 Ga0105237_100135053 311
567 3300013104 Ga0157370_10019093 Ga0157370_100190933 311
568 3300013104 Ga0157370_10051636 Ga0157370_100516362 311
569 3300013105 Ga0157369_10014448 Ga0157369_100144482 311
570 3300014497 Ga0182008_10000115 Ga0182008_100001152 311
571 3300025231 Ga0207427_101520 Ga0207427_1015208 311
572 3300025233 Ga0209437_100159 Ga0209437_100159131 311
573 3300025242 Ga0209258_103067 Ga0209258_1030673 311
574 3300025246 Ga0209646_1002777 Ga0209646_10027772 311
575 3300025250 Ga0209026_1000207 Ga0209026_100020737 311
576 3300025254 Ga0209148_1000005 Ga0209148_1000005559 311
577 3300025256 Ga0209759_1001666 Ga0209759_10016668 311
578 3300025256 Ga0209759_1011202 Ga0209759_10112022 311
579 3300025261 Ga0209233_1019168 Ga0209233_10191682 311
580 3300025272 Ga0209455_1000745 Ga0209455_10007457 311
581 3300025303 Ga0209051_1001657 Ga0209051_100165716 311
582 3300025904 Ga0207647_10001662 Ga0207647_100016624 311
583 3300025913 Ga0207695_10000493 Ga0207695_1000049345 311
584 3300025913 Ga0207695_10000882 Ga0207695_1000088232 311
585 3300025914 Ga0207671_10000490 Ga0207671_100004903 311
586 3300025920 Ga0207649_10077875 Ga0207649_100778753 311
587 3300025931 Ga0207644_10020629 Ga0207644_100206292 311
588 3300026067 Ga0207678_10010003 Ga0207678_100100034 311
589 3300026067 Ga0207678_10049539 Ga0207678_100495392 311
590 3300026075 Ga0207708_10032758 Ga0207708_100327582 311
591 3300028380 Ga0268265_10229373 Ga0268265_102293732 311
592 3300030732 Ga0316176_1003977 Ga0316176_10039773 311
593 3300046460 Ga0495638_0003786 Ga0495638_0003786_9686_10819 311
594 3300046460 Ga0495638_0033273 Ga0495638_0033273_1033_2178 311
595 3300046471 Ga0495650_0000209 Ga0495650_0000209_47413_48558 311
596 3300046525 Ga0495663_0009950 Ga0495663_0009950_824_1957 311
597 3300046615 Ga0495656_0013558 Ga0495656_0013558_1687_2811 311
598 3300047318 Ga0495636_0005005 Ga0495636_0005005_3193_4317 311
599 3300048911 Ga0496108_0145968 Ga0496108_0145968_842_1972 311
600 3300048912 Ga0496109_0329449 Ga0496109_0329449_287_1411 311
601 3300048913 Ga0496110_0089483 Ga0496110_0089483_1112_2236 311
602 3300048920 Ga0496117_0000810 Ga0496117_0000810_945_2075 311
603 3300048921 Ga0496118_0002039 Ga0496118_0002039_26444_27574 311
604 3300048924 Ga0496121_0007677 Ga0496121_0007677_10885_12015 311
605 3300048925 Ga0496122_0060870 Ga0496122_0060870_27_1157 311
606 3300048928 Ga0496125_0017819 Ga0496125_0017819_841_1971 311
607 3300048929 Ga0496126_0095065 Ga0496126_0095065_70_1200 311
608 3300049569 Ga0501032_0072929 Ga0501032_0072929_1004_2134 311
609 3300049570 Ga0501033_0031519 Ga0501033_0031519_1538_2668 311
610 3300049574 Ga0501038_0072277 Ga0501038_0072277_1178_2308 311
611 3300049580 Ga0501046_0053070 Ga0501046_0053070_409_1539 311
612 3300049582 Ga0501048_0126977 Ga0501048_0126977_85_1215 311
613 3300049586 Ga0501070_0028987 Ga0501070_0028987_1634_2764 311
614 3300049587 Ga0501071_0147454 Ga0501071_0147454_335_1468 311
615 3300049590 Ga0501074_0197082 Ga0501074_0197082_218_1351 311
616 3300049591 Ga0501075_0035574 Ga0501075_0035574_2318_3451 311
617 3300049742 Ga0501080_0095968 Ga0501080_0095968_1252_2379 311
618 3300002737 JGI25162J39368_1001676 JGI25162J39368_10016762 312
619 3300002741 JGI25157J39369_1000760 JGI25157J39369_10007605 312
620 3300002741 JGI25157J39369_1001690 JGI25157J39369_10016902 312
621 3300002771 JGI25163J39215_1001541 JGI25163J39215_10015411 312
622 3300002772 JGI25164J39214_1000049 JGI25164J39214_100004960 312
623 3300002773 JGI25152J39213_1000102 JGI25152J39213_10001027 312
624 3300002774 JGI25150J39212_1000290 JGI25150J39212_100029020 312
625 3300003187 JGI25151J46595_10000269 JGI25151J46595_100002697 312
626 3300003214 JGI25165J46597_1000009 JGI25165J46597_1000009380 312
627 3300003215 JGI25153J46596_10000189 JGI25153J46596_100001897 312
628 3300003751 Ga0055538_1000871 Ga0055538_10008713 312
629 3300003761 Ga0055535_1000082 Ga0055535_100008229 312
630 3300003762 Ga0055542_1001550 Ga0055542_10015502 312
631 3300003763 Ga0055529_1000020 Ga0055529_1000020265 312
632 3300005539 Ga0068853_100002068 Ga0068853_1000020684 312
633 3300005563 Ga0068855_100047917 Ga0068855_1000479173 312
634 3300006880 Ga0075429_100020882 Ga0075429_1000208822 312
635 3300010375 Ga0105239_10035502 Ga0105239_100355021 312
636 3300013104 Ga0157370_10320904 Ga0157370_103209041 312
637 3300013307 Ga0157372_10423614 Ga0157372_104236141 312
638 3300014326 Ga0157380_10024535 Ga0157380_100245352 312
639 3300025207 Ga0209760_100267 Ga0209760_1002675 312
640 3300025224 Ga0209784_100013 Ga0209784_10001357 312
641 3300025226 Ga0209674_100490 Ga0209674_1004905 312
642 3300025228 Ga0209672_104394 Ga0209672_1043943 312
643 3300025231 Ga0207427_100073 Ga0207427_10007357 312
644 3300025233 Ga0209437_100012 Ga0209437_100012377 312
645 3300025233 Ga0209437_101388 Ga0209437_1013884 312
646 3300025242 Ga0209258_100019 Ga0209258_100019482 312
647 3300025245 Ga0207425_1000092 Ga0207425_100009216 312
648 3300025250 Ga0209026_1000125 Ga0209026_100012563 312
649 3300025254 Ga0209148_1000001 Ga0209148_10000011819 312
650 3300025254 Ga0209148_1006041 Ga0209148_10060412 312
651 3300025256 Ga0209759_1001432 Ga0209759_100143211 312
652 3300025258 Ga0209129_1000151 Ga0209129_100015190 312
653 3300025261 Ga0209233_1000002 Ga0209233_1000002412 312
654 3300025272 Ga0209455_1000027 Ga0209455_100002763 312
655 3300025294 Ga0209025_1000012 Ga0209025_1000012209 312
656 3300025297 Ga0209758_1000018 Ga0209758_1000018449 312
657 3300026035 Ga0207703_10124659 Ga0207703_101246592 312
658 3300026041 Ga0207639_10019437 Ga0207639_100194374 312
659 3300027907 Ga0207428_10147693 Ga0207428_101476932 312
660 3300035398 Ga0316574_0003618 Ga0316574_0003618_2864_3994 312
661 3300035398 Ga0316574_0032554 Ga0316574_0032554_174_1301 312
662 3300035398 Ga0316574_0039844 Ga0316574_0039844_1471_2601 312
663 3300037418 Ga0395900_0000033 Ga0395900_0000033_201066_202187 312
664 3300037466 Ga0395898_0185134 Ga0395898_0185134_468_1589 312
665 3300038705 Ga0237819_00127 Ga0237819_00127_27329_28450 312
666 3300041453 Ga0451797_0440029 Ga0451797_0440029_201_1340 312
667 3300041460 Ga0451802_1849339 Ga0451802_1849339_897_2036 312
668 3300042876 Ga0451577_0000184 Ga0451577_0000184_72993_74135 312
669 3300044712 Ga0453684_0001929 Ga0453684_0001929_22671_23813 312
670 3300045051 Ga0451576_0210620 Ga0451576_0210620_779_1921 312
671 3300046453 Ga0495627_043016 Ga0495627_043016_110_1234 312
672 3300046460 Ga0495638_0000270 Ga0495638_0000270_67457_68581 312
673 3300046558 Ga0495633_0085866 Ga0495633_0085866_109_1233 312
674 3300048907 Ga0496104_0108145 Ga0496104_0108145_894_2024 312
675 3300048920 Ga0496117_0003669 Ga0496117_0003669_814_1941 312
676 3300048920 Ga0496117_0065383 Ga0496117_0065383_732_1859 312
677 3300048921 Ga0496118_0000579 Ga0496118_0000579_58309_59436 312
678 3300048921 Ga0496118_0005474 Ga0496118_0005474_5100_6227 312
679 3300048921 Ga0496118_0160021 Ga0496118_0160021_11_1135 312
680 3300048924 Ga0496121_0000045 Ga0496121_0000045_28782_29909 312
681 3300048929 Ga0496126_0054731 Ga0496126_0054731_1595_2722 312
682 3300049576 Ga0501040_0001220 Ga0501040_0001220_4890_6026 312
683 3300049578 Ga0501042_0068726 Ga0501042_0068726_691_1827 312
684 3300049743 Ga0501081_0218453 Ga0501081_0218453_157_1296 312
685 3300049822 Ga0501035_0016852 Ga0501035_0016852_4962_6092 312
686 3300049823 Ga0501044_0030343 Ga0501044_0030343_1113_2243 312
687 3300053139 Ga0500568_0022358 Ga0500568_0022358_1155_2285 312
688 3300053161 Ga0500634_0013478 Ga0500634_0013478_152_1276 312
689 iso_pu_bacteria 2643221577 2643894369 312
690 iso_pu_bacteria 2643221685 2644476573 312
691 iso_pu_bacteria 2687453130 2687583258 312
692 iso_pu_bacteria 2894414249 2894415655 312
693 iso_pu_bacteria 2895498888 2895500620 312
694 iso_pu_bacteria 2895511927 2895516510 312
695 iso_pu_bacteria 2895522137 2895523570 312
696 iso_pu_bacteria 2895525241 2895526848 312
697 3300002741 JGI25157J39369_1000995 JGI25157J39369_10009955 313
698 3300003756 Ga0055533_1002944 Ga0055533_10029443 313
699 3300005262 Ga0065165_1000096 Ga0065165_100009665 313
700 3300005435 Ga0070714_100000713 Ga0070714_10000071312 313
701 3300005435 Ga0070714_100072923 Ga0070714_1000729232 313
702 3300005436 Ga0070713_100011789 Ga0070713_1000117896 313
703 3300005455 Ga0070663_100090971 Ga0070663_1000909713 313
704 3300005546 Ga0070696_100190319 Ga0070696_1001903191 313
705 3300009036 Ga0105244_10058609 Ga0105244_100586092 313
706 3300010375 Ga0105239_10107199 Ga0105239_101071993 313
707 3300013100 Ga0157373_10054961 Ga0157373_100549613 313
708 3300013102 Ga0157371_10000337 Ga0157371_1000033749 313
709 3300013105 Ga0157369_10102668 Ga0157369_101026682 313
710 3300013307 Ga0157372_10139030 Ga0157372_101390302 313
711 3300015262 Ga0182007_10000103 Ga0182007_1000010350 313
712 3300015265 Ga0182005_1002015 Ga0182005_10020157 313
713 3300015687 Ga0183368_1004 Ga0183368_10041047 313
714 3300017792 Ga0163161_10169952 Ga0163161_101699522 313
715 3300025226 Ga0209674_100062 Ga0209674_100062212 313
716 3300025226 Ga0209674_102527 Ga0209674_1025272 313
717 3300025250 Ga0209026_1000051 Ga0209026_1000051155 313
718 3300025258 Ga0209129_1003459 Ga0209129_10034595 313
719 3300025297 Ga0209758_1005446 Ga0209758_10054461 313
720 3300025302 Ga0207426_1004381 Ga0207426_10043815 313
721 3300025304 Ga0209257_1014852 Ga0209257_10148523 313
722 3300025904 Ga0207647_10036485 Ga0207647_100364853 313
723 3300025928 Ga0207700_10007087 Ga0207700_100070872 313
724 3300025929 Ga0207664_10000584 Ga0207664_1000058414 313
725 3300025929 Ga0207664_10104085 Ga0207664_101040852 313
726 3300026067 Ga0207678_10174858 Ga0207678_101748582 313
727 3300037418 Ga0395900_0011107 Ga0395900_0011107_6671_7786 313
728 3300038443 Ga0395901_0101368 Ga0395901_0101368_94_1221 313
729 3300038726 Ga0400490_09770 Ga0400490_09770_788_1927 313
730 3300038741 Ga0400488_00561 Ga0400488_00561_512_1651 313
731 3300039062 Ga0400483_066859 Ga0400483_066859_1564_2703 313
732 3300039062 Ga0400483_137250 Ga0400483_137250_3424_4560 313
733 3300039062 Ga0400483_225557 Ga0400483_225557_1089_2225 313
734 3300039062 Ga0400483_266560 Ga0400483_266560_897_2036 313
735 3300039093 Ga0400489_65746 Ga0400489_65746_352_1491 313
736 3300041512 Ga0451853_2618627 Ga0451853_2618627_846_1982 313
737 3300042184 Ga0450908_000324 Ga0450908_000324_6670_7800 313
738 3300044672 Ga0466982_0002429 Ga0466982_0002429_5028_6158 313
739 3300044712 Ga0453684_0321781 Ga0453684_0321781_565_1707 313
740 3300044735 Ga0466968_0041489 Ga0466968_0041489_178_1308 313
741 3300046501 Ga0495607_0007451 Ga0495607_0007451_1663_2808 313
742 3300046507 Ga0495606_0011608 Ga0495606_0011608_2846_3973 313
743 3300047472 Ga0495686_0000043 Ga0495686_0000043_136849_137982 313
744 3300048904 Ga0496101_0104597 Ga0496101_0104597_901_2025 313
745 3300048918 Ga0496115_0000181 Ga0496115_0000181_7071_8216 313
746 3300048920 Ga0496117_0138051 Ga0496117_0138051_107_1240 313
747 3300048921 Ga0496118_0027316 Ga0496118_0027316_1346_2479 313
748 3300048922 Ga0496119_0001017 Ga0496119_0001017_530_1666 313
749 3300048923 Ga0496120_0000511 Ga0496120_0000511_58439_59575 313
750 3300048924 Ga0496121_0031488 Ga0496121_0031488_494_1630 313
751 3300048925 Ga0496122_0020200 Ga0496122_0020200_1207_2337 313
752 3300048926 Ga0496123_0070573 Ga0496123_0070573_99_1223 313
753 3300048926 Ga0496123_0070615 Ga0496123_0070615_78_1208 313
754 3300048927 Ga0496124_0000481 Ga0496124_0000481_65413_66543 313
755 3300048927 Ga0496124_0002434 Ga0496124_0002434_2177_3307 313
756 3300048928 Ga0496125_0005103 Ga0496125_0005103_130_1263 313
757 3300048928 Ga0496125_0005215 Ga0496125_0005215_13318_14454 313
758 3300048929 Ga0496126_0001534 Ga0496126_0001534_75_1211 313
759 3300049573 Ga0501037_0058800 Ga0501037_0058800_644_1768 313
760 iso_pu_bacteria 2524614729 2525556678 313
761 iso_pu_bacteria 2537561836 2538832651 313
762 iso_pu_bacteria 2547132130 2547502789 313
763 iso_pu_bacteria 2571042365 2572253865 313
764 iso_pu_bacteria 2576861471 2578458696 313
765 iso_pu_bacteria 2593339239 2595451989 313
766 iso_pu_bacteria 2627854209 2630648274 313
767 iso_pu_bacteria 2643221559 2643815899 313
768 iso_pu_bacteria 2643221562 2643830104 313
769 iso_pu_bacteria 2643221573 2643879121 313
770 iso_pu_bacteria 2643221579 2643907788 313
771 iso_pu_bacteria 2643221581 2643916007 313
772 iso_pu_bacteria 2643221586 2643940588 313
773 iso_pu_bacteria 2643221593 2643977020 313
774 iso_pu_bacteria 2643221612 2644076808 313
775 iso_pu_bacteria 2643221720 2644660423 313
776 iso_pu_bacteria 2643221727 2644695122 313
777 iso_pu_bacteria 2643221728 2644697782 313
778 iso_pu_bacteria 2690315857 2691329660 313
779 iso_pu_bacteria 2718218334 2721026886 313
780 iso_pu_bacteria 2734482264 2735837563 313
781 iso_pu_bacteria 2738543009 2739228170 313
782 iso_pu_bacteria 2747842428 2747950822 313
783 iso_pu_bacteria 2765235840 2765578687 313
784 iso_pu_bacteria 2816332141 2816516762 313
785 iso_pu_bacteria 2818991457 2819662985 313
786 iso_pu_bacteria 2842391507 2842394997 313
787 iso_pu_bacteria 2842757796 2842758396 313
788 iso_pu_bacteria 2842780639 2842780771 313
789 iso_pu_bacteria 2842918807 2842919610 313
790 iso_pu_bacteria 2852649853 2852651065 313
791 iso_pu_bacteria 2852684882 2852686024 313
792 iso_pu_bacteria 2857442823 2857446881 313
793 iso_pu_bacteria 2874220319 2874221315 313
794 iso_pu_bacteria 2884338543 2884341160 313
795 iso_pu_bacteria 2884411467 2884413501 313
796 iso_pu_bacteria 2895395659 2895395694 313
797 iso_pu_bacteria 2919089067 2919091820 313
798 iso_pu_bacteria 2919130084 2919133561 313
799 iso_pu_bacteria 2919134579 2919136103 313
800 iso_pu_bacteria 2919404418 2919405097 313
801 iso_pu_bacteria 2919513703 2919514567 313
802 iso_pu_bacteria 2919675420 2919676609 313
803 iso_pu_bacteria 2919688452 2919691984 313
804 iso_pu_bacteria 2923516293 2923518465 313
805 iso_pu_bacteria 2928496128 2928496284 313
806 iso_pu_bacteria 2928963466 2928967505 313
807 iso_pu_bacteria 2929195423 2929197385 313
808 iso_pu_bacteria 2931380184 2931381031 313
809 iso_pu_bacteria 2937610967 2937612136 313
810 iso_pu_bacteria 2939589442 2939590778 313
811 iso_pu_bacteria 2939622612 2939622960 313
812 iso_pu_bacteria 2939626828 2939630875 313
813 iso_pu_bacteria 2941471342 2941472616 313
814 iso_pu_bacteria 2941475908 2941478058 313
815 iso_pu_bacteria 2941489479 2941491052 313
816 iso_pu_bacteria 2953994433 2953994888 313
817 iso_pu_bacteria 2961047084 2961048081 313
818 iso_pu_bacteria 2961064222 2961065099 313
819 iso_pu_bacteria 2974307012 2974309193 313
820 iso_pu_bacteria 2977247770 2977249911 313
821 iso_pu_bacteria 2984514374 2984515598 313
822 iso_pu_bacteria 2987605356 2987607317 313
823 iso_pu_bacteria 2995948881 2995951991 313
824 iso_pu_bacteria 8002869464 8002872220 313
825 iso_pu_bacteria 8003014200 8003015919 313
826 iso_pu_bacteria 8021622325 8021623758 313
827 iso_pu_bacteria 8021626552 8021630454 313
828 iso_pu_bacteria 8021648035 8021650616 313
829 iso_pu_bacteria 8054357960 8054359850 313
830 3300002737 JGI25162J39368_1002831 JGI25162J39368_10028312 314
831 3300002737 JGI25162J39368_1002832 JGI25162J39368_10028322 314
832 3300002772 JGI25164J39214_1001339 JGI25164J39214_10013394 314
833 3300002772 JGI25164J39214_1001343 JGI25164J39214_10013432 314
834 3300003214 JGI25165J46597_1002794 JGI25165J46597_10027944 314
835 3300003214 JGI25165J46597_1002992 JGI25165J46597_10029922 314
836 3300014497 Ga0182008_10007401 Ga0182008_100074016 314
837 3300015261 Ga0182006_1023937 Ga0182006_10239372 314
838 3300025231 Ga0207427_100289 Ga0207427_10028913 314
839 3300025231 Ga0207427_100306 Ga0207427_10030612 314
840 3300025233 Ga0209437_100039 Ga0209437_100039140 314
841 3300025233 Ga0209437_100129 Ga0209437_10012942 314
842 3300025261 Ga0209233_1000020 Ga0209233_1000020741 314
843 3300025261 Ga0209233_1000090 Ga0209233_1000090256 314
844 3300031238 Ga0265332_10102836 Ga0265332_101028361 314
845 3300037312 Ga0395899_0034020 Ga0395899_0034020_2236_3354 314
846 3300037418 Ga0395900_0156122 Ga0395900_0156122_996_2114 314
847 3300037471 Ga0395905_0029664 Ga0395905_0029664_494_1612 314
848 3300048904 Ga0496101_0058013 Ga0496101_0058013_471_1589 314
849 3300049568 Ga0501031_0002640 Ga0501031_0002640_9213_10340 314
850 3300049568 Ga0501031_0089505 Ga0501031_0089505_211_1332 314
851 3300049569 Ga0501032_0009095 Ga0501032_0009095_5725_6852 314
852 3300049569 Ga0501032_0036448 Ga0501032_0036448_662_1783 314
853 3300049570 Ga0501033_0001508 Ga0501033_0001508_8518_9645 314
854 3300049571 Ga0501034_0002344 Ga0501034_0002344_16106_17233 314
855 3300049572 Ga0501036_0010128 Ga0501036_0010128_5535_6662 314
856 3300049573 Ga0501037_0001128 Ga0501037_0001128_16032_17159 314
857 3300049573 Ga0501037_0183865 Ga0501037_0183865_13_1134 314
858 3300049574 Ga0501038_0001896 Ga0501038_0001896_2040_3167 314
859 3300049575 Ga0501039_0013892 Ga0501039_0013892_995_2122 314
860 3300049579 Ga0501043_0002588 Ga0501043_0002588_5577_6704 314
861 3300049579 Ga0501043_0029205 Ga0501043_0029205_2974_4095 314
862 3300049580 Ga0501046_0012062 Ga0501046_0012062_6181_7308 314
863 3300049580 Ga0501046_0017144 Ga0501046_0017144_662_1783 314
864 3300049581 Ga0501047_0002448 Ga0501047_0002448_5619_6746 314
865 3300049581 Ga0501047_0041367 Ga0501047_0041367_2543_3664 314
866 3300049589 Ga0501073_0002128 Ga0501073_0002128_1087_2214 314
867 3300049822 Ga0501035_0003161 Ga0501035_0003161_9076_10203 314
868 3300049823 Ga0501044_0007144 Ga0501044_0007144_5974_7101 314
869 3300053077 Ga0495601_0009903 Ga0495601_0009903_3452_4585 314
870 iso_pu_bacteria 2593339238 2595446480 314
871 iso_pu_bacteria 2818991440 2819565243 314
872 iso_pu_bacteria 2842914999 2842917428 314
873 iso_pu_bacteria 2904463128 2904466911 314
874 iso_pu_bacteria 2919085039 2919087875 314
875 3300003781 Ga0055536_1005001 Ga0055536_10050012 315
876 3300003856 Ga0058692_1000002 Ga0058692_100000251 315
877 3300005289 Ga0065704_10103739 Ga0065704_101037391 315
878 3300005329 Ga0070683_100275029 Ga0070683_1002750292 315
879 3300005435 Ga0070714_100003471 Ga0070714_1000034712 315
880 3300005543 Ga0070672_100007232 Ga0070672_10000723210 315
881 3300006844 Ga0075428_100003215 Ga0075428_10000321510 315
882 3300006846 Ga0075430_100042014 Ga0075430_1000420143 315
883 3300009094 Ga0111539_10015226 Ga0111539_100152266 315
884 3300013104 Ga0157370_10006579 Ga0157370_100065792 315
885 3300013104 Ga0157370_10117152 Ga0157370_101171522 315
886 3300013307 Ga0157372_10131411 Ga0157372_101314112 315
887 3300015262 Ga0182007_10008468 Ga0182007_100084684 315
888 3300017792 Ga0163161_10002977 Ga0163161_1000297710 315
889 3300025292 Ga0209676_1000086 Ga0209676_1000086191 315
890 3300025915 Ga0207693_10218942 Ga0207693_102189421 315
891 3300025929 Ga0207664_10000474 Ga0207664_1000047416 315
892 3300025931 Ga0207644_10000313 Ga0207644_1000031316 315
893 3300025940 Ga0207691_10202850 Ga0207691_102028502 315
894 3300037312 Ga0395899_0077152 Ga0395899_0077152_219_1346 315
895 3300037418 Ga0395900_0002387 Ga0395900_0002387_13168_14301 315
896 3300037418 Ga0395900_0022205 Ga0395900_0022205_4156_5283 315
897 3300037466 Ga0395898_0004200 Ga0395898_0004200_1580_2713 315
898 3300037471 Ga0395905_0154864 Ga0395905_0154864_318_1436 315
899 3300038443 Ga0395901_0002935 Ga0395901_0002935_5199_6332 315
900 3300038443 Ga0395901_0070692 Ga0395901_0070692_1301_2428 315
901 3300041413 Ga0439465_0013520 Ga0439465_0013520_631_1752 315
902 3300048911 Ga0496108_0014371 Ga0496108_0014371_1766_2887 315
903 3300048916 Ga0496113_0031220 Ga0496113_0031220_2062_3183 315
904 3300048917 Ga0496114_0010697 Ga0496114_0010697_5382_6500 315
905 3300048928 Ga0496125_0118728 Ga0496125_0118728_70_1197 315
906 3300049571 Ga0501034_0000344 Ga0501034_0000344_70405_71523 315
907 3300050509 nmdc:mga0qj67_129675_c1 nmdc:mga0qj67_129675_c1_707_1840 315
908 3300053079 Ga0500610_0005427 Ga0500610_0005427_3945_5078 315
909 2162886007 SwRhRL2b_contig_3463326 SwRhRL2b_0895.00002950 316
910 3300005289 Ga0065704_10000898 Ga0065704_100008982 316
911 3300020075 Ga0206349_1636998 Ga0206349_16369981 316
912 3300032004 Ga0307414_10082122 Ga0307414_100821222 316
913 3300037312 Ga0395899_0019518 Ga0395899_0019518_626_1753 316
914 3300037418 Ga0395900_0021089 Ga0395900_0021089_5224_6351 316
915 3300037466 Ga0395898_0028428 Ga0395898_0028428_795_1922 316
916 3300038443 Ga0395901_0269950 Ga0395901_0269950_76_1203 316
917 3300049570 Ga0501033_0029500 Ga0501033_0029500_369_1496 316
918 3300049571 Ga0501034_0322552 Ga0501034_0322552_306_1433 316
919 3300049581 Ga0501047_0010659 Ga0501047_0010659_6581_7708 316
920 3300049822 Ga0501035_0210714 Ga0501035_0210714_17_1144 316
921 3300049823 Ga0501044_0085626 Ga0501044_0085626_1107_2234 316
922 2162886007 SwRhRL2b_contig_1669114 SwRhRL2b_0143.00007140 317
923 3300003320 rootH2_10010161 rootH2_100101613 317
924 3300009093 Ga0105240_10012434 Ga0105240_100124348 317
925 3300009098 Ga0105245_10290101 Ga0105245_102901011 317
926 3300009148 Ga0105243_10082359 Ga0105243_100823593 317
927 3300013105 Ga0157369_10040319 Ga0157369_100403191 317
928 3300025913 Ga0207695_10026470 Ga0207695_100264705 317
929 3300025935 Ga0207709_10024872 Ga0207709_100248723 317
930 3300026121 Ga0207683_10106046 Ga0207683_101060462 317
931 3300048924 Ga0496121_0012497 Ga0496121_0012497_92_1225 317
932 3300048925 Ga0496122_0005388 Ga0496122_0005388_664_1788 317
933 3300048926 Ga0496123_0004404 Ga0496123_0004404_12952_14076 317
934 iso_pu_bacteria 2643221695 2644529378 317
935 iso_pu_bacteria 2739367700 2739731592 317
936 iso_pu_bacteria 2747842501 2748015858 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

23

85

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

137

349

0.98

PF00684

DnaJ_CXXCXGXG

DnaJ central domain

164

223

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9494 3 64
6rzy-assembly2.cif.gz_B plasmodium falciparum pfa0660w hsp40 co-chaperone j-domain 0.9459 2 67
2qsa-assembly1.cif.gz_A crystal structure of j-domain of dnaj homolog dnj-2 precursor from c.elegans. 0.9366 4 69
6yxy-assembly1.cif.gz_BK state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.9244 3 68
2dn9-assembly1.cif.gz_A solution structure of j-domain from the dnaj homolog, human tid1 protein 0.9229 1 70
ID Description Score Start End Superfamily
af_B0S5B7_83_192_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9874 4 72 1.10.287.110
af_Q55D57_37_119_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9856 4 68 1.10.287.110
af_I1NG96_25_126_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9844 4 68 1.10.287.110
af_Q8SZX1_97_207_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9815 6 70 1.10.287.110
af_Q4DS80_4_96_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9801 4 69 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A835YKT5-F1-model_v4 Uncharacterized protein 0.9996 3 69 GO:0005737
GO:0046872
AF-A0A522XL00-F1-model_v4 Molecular chaperone DnaJ 0.9943 1 67 GO:0005737
GO:0044183
GO:0051082
GO:0051087
GO:0061077
AF-E4Y2M7-F1-model_v4 J domain-containing protein 0.9908 6 70 GO:0005737
GO:0016020
AF-A0A2N3IKT2-F1-model_v4 DnaJ domain 0.9895 4 68 GO:0016020
GO:0036503
GO:0051087
GO:0051787
AF-D8M3X4-F1-model_v4 J domain-containing protein 0.9852 6 73 GO:0005783
GO:0016020
GO:0036503
GO:0051087
GO:0051787

Feature Viewer

pLDDT pTM Quality
82.32 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map