F486156
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 386 | 920 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10000485|Ga0105237_1000048540 |
| Length | 288 |
| Sequence | MLRDDADDADYCLLSASSAQSIEISASLFLLLTVTKPTSPQSNSKKYMQPLITLKDIGRKYVIGTEIIHALKSVSLTINKGEFVALMGPSGSGKSTLMNILGCLDTPTKGEYILNGINVSHMTDNQLAEVRNEEIGFVFQTFNLLPRNTALDNVALPLVYAGVGKEKRQARAKTSLENVGLGNRVDHKPNELSGGQRQRVAVARALINDPSIILADEPTGNLDTKTSIEIMGLMEDIHKKGNTIILVTHEEDIAMHAHRIVRMRDGLVENDYANTNIITVDRSKATTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 6 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 7 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 8 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 9 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 10 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 11 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 12 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 13 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 14 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 15 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 16 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 17 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 28 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 34 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 217 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 218 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 219 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 225 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 238 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 239 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 247 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 257 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 258 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 328 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 345 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 346 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 347 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 348 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 349 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 351 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 353 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 354 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 355 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 356 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 361 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 377 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 381 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 382 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 383 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 386 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0.43 |
| Isolates | 1.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0 |
| Rhizoplane | 2.89 |
| Rhizosphere | 91.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_731410 | 2162886007 | Bacteria | 1251 |
| 2 | CNAas_1000829 | 3300000532 | Bacteria | 2940 |
| 3 | JGI24741J21665_1012612 | 3300001915 | Bacteria | 1448 |
| 4 | JGI24740J21852_10016887 | 3300001979 | Bacteria | 2625 |
| 5 | JGI24737J22298_10000143 | 3300001990 | Bacteria | 22223 |
| 6 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 7 | JGI24748J21848_1000051 | 3300002074 | Bacteria | 52353 |
| 8 | JGI24744J21845_10002026 | 3300002077 | Bacteria | 4104 |
| 9 | JGI24034J26672_10000030 | 3300002239 | Bacteria | 97515 |
| 10 | JGI24751J29686_10054973 | 3300002459 | Bacteria | 820 |
| 11 | JGI25162J39368_1000089 | 3300002737 | Bacteria | 104054 |
| 12 | JGI25162J39368_1000498 | 3300002737 | Bacteria | 29793 |
| 13 | JGI25157J39369_1005927 | 3300002741 | Bacteria | 1921 |
| 14 | JGI25165J46597_1000618 | 3300003214 | Bacteria | 30063 |
| 15 | rootH1_10029777 | 3300003316 | Bacteria | 8945 |
| 16 | rootH2_10018591 | 3300003320 | Bacteria | 30571 |
| 17 | rootH2_10039562 | 3300003320 | Bacteria | 6649 |
| 18 | rootH2_10186211 | 3300003320 | Bacteria | 1640 |
| 19 | rootL2_10211276 | 3300003322 | Bacteria | 2534 |
| 20 | rootH1_10010194 | 3300003323 | Bacteria | 43591 |
| 21 | rootH1_10105642 | 3300003323 | Bacteria | 3000 |
| 22 | rootH1_10379396 | 3300003323 | Bacteria | 1393 |
| 23 | Ga0058863_11791471 | 3300004799 | Bacteria | 1797 |
| 24 | Ga0058861_11760232 | 3300004800 | Bacteria | 1356 |
| 25 | Ga0058862_12416007 | 3300004803 | Bacteria | 1780 |
| 26 | Ga0065714_10064422 | 3300005288 | Bacteria | 270668 |
| 27 | Ga0065714_10148595 | 3300005288 | Bacteria | 1121 |
| 28 | Ga0065704_10009526 | 3300005289 | Bacteria | 3117 |
| 29 | Ga0065704_10023815 | 3300005289 | Bacteria | 1152 |
| 30 | Ga0065704_10092483 | 3300005289 | Bacteria | 2647 |
| 31 | Ga0065704_10092834 | 3300005289 | Bacteria | 2578 |
| 32 | Ga0065712_10067728 | 3300005290 | Bacteria | 178215 |
| 33 | Ga0065712_10089641 | 3300005290 | Bacteria | 2461 |
| 34 | Ga0065712_10204759 | 3300005290 | Bacteria | 1095 |
| 35 | Ga0065715_10004474 | 3300005293 | Bacteria | 3796 |
| 36 | Ga0065715_10089181 | 3300005293 | Bacteria | 13047 |
| 37 | Ga0065715_10095696 | 3300005293 | Bacteria | 4020 |
| 38 | Ga0065715_10105987 | 3300005293 | Bacteria | 2858 |
| 39 | Ga0065715_10343798 | 3300005293 | Bacteria | 963 |
| 40 | Ga0065715_10443342 | 3300005293 | Bacteria | 833 |
| 41 | Ga0065707_10091424 | 3300005295 | Bacteria | 3950 |
| 42 | Ga0065707_10190589 | 3300005295 | Bacteria | 1363 |
| 43 | Ga0065707_10246444 | 3300005295 | Bacteria | 1139 |
| 44 | Ga0065707_10322946 | 3300005295 | Bacteria | 963 |
| 45 | Ga0070658_10000018 | 3300005327 | Bacteria | 200558 |
| 46 | Ga0070658_10080753 | 3300005327 | Bacteria | 2671 |
| 47 | Ga0070658_10338790 | 3300005327 | Bacteria | 1286 |
| 48 | Ga0070658_10563895 | 3300005327 | Bacteria | 986 |
| 49 | Ga0070676_10004488 | 3300005328 | Bacteria | 7345 |
| 50 | Ga0070676_10093607 | 3300005328 | Bacteria | 1845 |
| 51 | Ga0070676_10149873 | 3300005328 | Bacteria | 1492 |
| 52 | Ga0070676_10503680 | 3300005328 | Bacteria | 860 |
| 53 | Ga0070683_100301639 | 3300005329 | Bacteria | 1524 |
| 54 | Ga0070690_100054471 | 3300005330 | Bacteria | 2561 |
| 55 | Ga0070690_100219957 | 3300005330 | Bacteria | 1330 |
| 56 | Ga0070690_100225321 | 3300005330 | Bacteria | 1315 |
| 57 | Ga0070670_100000165 | 3300005331 | Bacteria | 59984 |
| 58 | Ga0070670_100000767 | 3300005331 | Bacteria | 24964 |
| 59 | Ga0070670_100224439 | 3300005331 | Bacteria | 1635 |
| 60 | Ga0068869_100035202 | 3300005334 | Bacteria | 3548 |
| 61 | Ga0068869_100080076 | 3300005334 | Bacteria | 2436 |
| 62 | Ga0068869_100090184 | 3300005334 | Bacteria | 2303 |
| 63 | Ga0068869_100165587 | 3300005334 | Bacteria | 1724 |
| 64 | Ga0068869_100184623 | 3300005334 | Bacteria | 1636 |
| 65 | Ga0070680_100302537 | 3300005336 | Bacteria | 1356 |
| 66 | Ga0070680_100458117 | 3300005336 | Bacteria | 1089 |
| 67 | Ga0070682_100041994 | 3300005337 | Bacteria | 2821 |
| 68 | Ga0068868_100013908 | 3300005338 | Bacteria | 5917 |
| 69 | Ga0070660_100091736 | 3300005339 | Bacteria | 2396 |
| 70 | Ga0070689_100000816 | 3300005340 | Bacteria | 19247 |
| 71 | Ga0070689_100023397 | 3300005340 | Bacteria | 4624 |
| 72 | Ga0070689_100779276 | 3300005340 | Bacteria | 840 |
| 73 | Ga0070691_10113953 | 3300005341 | Bacteria | 1355 |
| 74 | Ga0070691_10313527 | 3300005341 | Bacteria | 860 |
| 75 | Ga0070687_100057385 | 3300005343 | Bacteria | 2041 |
| 76 | Ga0070687_100226986 | 3300005343 | Bacteria | 1147 |
| 77 | Ga0070661_100050498 | 3300005344 | Bacteria | 3043 |
| 78 | Ga0070692_10016459 | 3300005345 | Bacteria | 3517 |
| 79 | Ga0070692_10031317 | 3300005345 | Bacteria | 2666 |
| 80 | Ga0070692_10060528 | 3300005345 | Bacteria | 1993 |
| 81 | Ga0070692_10203511 | 3300005345 | Bacteria | 1161 |
| 82 | Ga0070669_100011817 | 3300005353 | Bacteria | 6193 |
| 83 | Ga0070669_100026199 | 3300005353 | Bacteria | 4195 |
| 84 | Ga0070669_100324176 | 3300005353 | Bacteria | 1245 |
| 85 | Ga0070675_100047495 | 3300005354 | Bacteria | 3517 |
| 86 | Ga0070671_100027615 | 3300005355 | Bacteria | 4673 |
| 87 | Ga0070671_100208803 | 3300005355 | Bacteria | 1656 |
| 88 | Ga0070673_100008881 | 3300005364 | Bacteria | 6715 |
| 89 | Ga0070673_100014675 | 3300005364 | Bacteria | 5470 |
| 90 | Ga0070673_100028970 | 3300005364 | Bacteria | 4125 |
| 91 | Ga0070688_100000427 | 3300005365 | Bacteria | 21283 |
| 92 | Ga0070688_100009040 | 3300005365 | Bacteria | 5432 |
| 93 | Ga0070659_100018374 | 3300005366 | Bacteria | 5277 |
| 94 | Ga0070659_100026796 | 3300005366 | Bacteria | 4437 |
| 95 | Ga0070667_100139335 | 3300005367 | Bacteria | 2123 |
| 96 | Ga0070701_10026549 | 3300005438 | Bacteria | 2825 |
| 97 | Ga0070701_10065272 | 3300005438 | Bacteria | 1931 |
| 98 | Ga0070705_100022136 | 3300005440 | Unclassified | 3392 |
| 99 | Ga0070705_100193364 | 3300005440 | Bacteria | 1389 |
| 100 | Ga0070700_100004173 | 3300005441 | Bacteria | 7533 |
| 101 | Ga0070700_100118473 | 3300005441 | Bacteria | 1770 |
| 102 | Ga0070700_100138605 | 3300005441 | Bacteria | 1650 |
| 103 | Ga0070700_100199413 | 3300005441 | Bacteria | 1405 |
| 104 | Ga0070694_100005028 | 3300005444 | Bacteria | 7979 |
| 105 | Ga0070694_100029319 | 3300005444 | Bacteria | 3590 |
| 106 | Ga0070694_100067292 | 3300005444 | Bacteria | 2459 |
| 107 | Ga0070694_100200135 | 3300005444 | Bacteria | 1488 |
| 108 | Ga0070694_100210428 | 3300005444 | Bacteria | 1454 |
| 109 | Ga0070694_100359661 | 3300005444 | Bacteria | 1130 |
| 110 | Ga0070694_100696880 | 3300005444 | Bacteria | 826 |
| 111 | Ga0070708_100002619 | 3300005445 | Bacteria | 13932 |
| 112 | Ga0070708_100259342 | 3300005445 | Bacteria | 1634 |
| 113 | Ga0070708_100329329 | 3300005445 | Bacteria | 1439 |
| 114 | Ga0070708_100369972 | 3300005445 | Bacteria | 1351 |
| 115 | Ga0070678_100018207 | 3300005456 | Bacteria | 4549 |
| 116 | Ga0070678_100110744 | 3300005456 | Bacteria | 2147 |
| 117 | Ga0070662_100000626 | 3300005457 | Bacteria | 21383 |
| 118 | Ga0070662_100173729 | 3300005457 | Bacteria | 1694 |
| 119 | Ga0070681_10001768 | 3300005458 | Bacteria | 19378 |
| 120 | Ga0070681_10022542 | 3300005458 | Bacteria | 6324 |
| 121 | Ga0070681_10029377 | 3300005458 | Bacteria | 5520 |
| 122 | Ga0068867_100016777 | 3300005459 | Bacteria | 5203 |
| 123 | Ga0068867_100219256 | 3300005459 | Bacteria | 1532 |
| 124 | Ga0068867_100512828 | 3300005459 | Bacteria | 1033 |
| 125 | Ga0070706_100000128 | 3300005467 | Bacteria | 92969 |
| 126 | Ga0070706_100005626 | 3300005467 | Bacteria | 11923 |
| 127 | Ga0070706_100018438 | 3300005467 | Bacteria | 6437 |
| 128 | Ga0070706_100037115 | 3300005467 | Bacteria | 4502 |
| 129 | Ga0070706_100049046 | 3300005467 | Bacteria | 3897 |
| 130 | Ga0070706_100093641 | 3300005467 | Bacteria | 2788 |
| 131 | Ga0070706_100223588 | 3300005467 | Bacteria | 1757 |
| 132 | Ga0070706_100539125 | 3300005467 | Bacteria | 1085 |
| 133 | Ga0070707_100006408 | 3300005468 | Bacteria | 10942 |
| 134 | Ga0070707_100029831 | 3300005468 | Bacteria | 5191 |
| 135 | Ga0070707_100078663 | 3300005468 | Bacteria | 3182 |
| 136 | Ga0070707_100180455 | 3300005468 | Bacteria | 2058 |
| 137 | Ga0070707_100180813 | 3300005468 | Bacteria | 2056 |
| 138 | Ga0070707_100768365 | 3300005468 | Bacteria | 927 |
| 139 | Ga0070698_100000663 | 3300005471 | Bacteria | 36731 |
| 140 | Ga0070698_100004577 | 3300005471 | Bacteria | 15185 |
| 141 | Ga0070698_100005014 | 3300005471 | Bacteria | 14509 |
| 142 | Ga0070698_100051295 | 3300005471 | Bacteria | 4202 |
| 143 | Ga0070698_100053534 | 3300005471 | Bacteria | 4101 |
| 144 | Ga0070698_100185010 | 3300005471 | Bacteria | 2021 |
| 145 | Ga0070698_100209354 | 3300005471 | Bacteria | 1885 |
| 146 | Ga0070699_100001336 | 3300005518 | Bacteria | 22693 |
| 147 | Ga0070699_100014592 | 3300005518 | Bacteria | 6757 |
| 148 | Ga0070699_100049669 | 3300005518 | Bacteria | 3631 |
| 149 | Ga0070699_100576079 | 3300005518 | Bacteria | 1025 |
| 150 | Ga0070679_100008363 | 3300005530 | Bacteria | 9736 |
| 151 | Ga0070679_100111586 | 3300005530 | Bacteria | 2721 |
| 152 | Ga0070697_100003936 | 3300005536 | Bacteria | 11413 |
| 153 | Ga0070697_100036822 | 3300005536 | Bacteria | 3952 |
| 154 | Ga0070697_100063878 | 3300005536 | Bacteria | 3007 |
| 155 | Ga0070697_100094122 | 3300005536 | Bacteria | 2482 |
| 156 | Ga0070697_100101472 | 3300005536 | Bacteria | 2391 |
| 157 | Ga0070697_100182476 | 3300005536 | Bacteria | 1779 |
| 158 | Ga0070697_100213432 | 3300005536 | Bacteria | 1643 |
| 159 | Ga0070697_100259760 | 3300005536 | Bacteria | 1487 |
| 160 | Ga0068853_100014510 | 3300005539 | Bacteria | 6455 |
| 161 | Ga0068853_100019819 | 3300005539 | Bacteria | 5586 |
| 162 | Ga0068853_100167119 | 3300005539 | Bacteria | 1988 |
| 163 | Ga0068853_100234649 | 3300005539 | Bacteria | 1679 |
| 164 | Ga0068853_100695547 | 3300005539 | Bacteria | 969 |
| 165 | Ga0070672_100019003 | 3300005543 | Bacteria | 4980 |
| 166 | Ga0070672_100104518 | 3300005543 | Bacteria | 2301 |
| 167 | Ga0070672_100124054 | 3300005543 | Bacteria | 2117 |
| 168 | Ga0070672_100235441 | 3300005543 | Bacteria | 1539 |
| 169 | Ga0070686_100011130 | 3300005544 | Bacteria | 5096 |
| 170 | Ga0070686_100014560 | 3300005544 | Bacteria | 4538 |
| 171 | Ga0070695_100011147 | 3300005545 | Bacteria | 5374 |
| 172 | Ga0070695_100035049 | 3300005545 | Bacteria | 3151 |
| 173 | Ga0070695_100051867 | 3300005545 | Bacteria | 2634 |
| 174 | Ga0070695_100172942 | 3300005545 | Bacteria | 1525 |
| 175 | Ga0070695_100174986 | 3300005545 | Bacteria | 1517 |
| 176 | Ga0070695_100356052 | 3300005545 | Bacteria | 1098 |
| 177 | Ga0070696_100008944 | 3300005546 | Bacteria | 6701 |
| 178 | Ga0070696_100123279 | 3300005546 | Bacteria | 1878 |
| 179 | Ga0070693_100031294 | 3300005547 | Bacteria | 2914 |
| 180 | Ga0070693_100303516 | 3300005547 | Bacteria | 1077 |
| 181 | Ga0070665_100000072 | 3300005548 | Bacteria | 198575 |
| 182 | Ga0070665_100149900 | 3300005548 | Bacteria | 2335 |
| 183 | Ga0070704_100031410 | 3300005549 | Bacteria | 3572 |
| 184 | Ga0070704_100098350 | 3300005549 | Bacteria | 2198 |
| 185 | Ga0070704_100288435 | 3300005549 | Bacteria | 1363 |
| 186 | Ga0068855_100000070 | 3300005563 | Bacteria | 123584 |
| 187 | Ga0068855_100000268 | 3300005563 | Bacteria | 64693 |
| 188 | Ga0068855_100012445 | 3300005563 | Bacteria | 10276 |
| 189 | Ga0068855_100063242 | 3300005563 | Bacteria | 4319 |
| 190 | Ga0068855_100152225 | 3300005563 | Bacteria | 2630 |
| 191 | Ga0068855_100204197 | 3300005563 | Bacteria | 2224 |
| 192 | Ga0068855_100416203 | 3300005563 | Bacteria | 1471 |
| 193 | Ga0070664_100004294 | 3300005564 | Bacteria | 11459 |
| 194 | Ga0070664_100025146 | 3300005564 | Bacteria | 4933 |
| 195 | Ga0070664_100461099 | 3300005564 | Bacteria | 1168 |
| 196 | Ga0070664_100549184 | 3300005564 | Bacteria | 1068 |
| 197 | Ga0068857_100006559 | 3300005577 | Bacteria | 9988 |
| 198 | Ga0068857_100127604 | 3300005577 | Bacteria | 2292 |
| 199 | Ga0068857_100164685 | 3300005577 | Bacteria | 2013 |
| 200 | Ga0068857_100578922 | 3300005577 | Bacteria | 1059 |
| 201 | Ga0068854_100095077 | 3300005578 | Bacteria | 2224 |
| 202 | Ga0068854_100271233 | 3300005578 | Bacteria | 1362 |
| 203 | Ga0068856_100000897 | 3300005614 | Bacteria | 31872 |
| 204 | Ga0068856_100003887 | 3300005614 | Bacteria | 14987 |
| 205 | Ga0068856_100005676 | 3300005614 | Bacteria | 12288 |
| 206 | Ga0068856_100009016 | 3300005614 | Bacteria | 9706 |
| 207 | Ga0068856_100013111 | 3300005614 | Bacteria | 8029 |
| 208 | Ga0068856_100194332 | 3300005614 | Bacteria | 2043 |
| 209 | Ga0070702_100001061 | 3300005615 | Bacteria | 10965 |
| 210 | Ga0070702_100184429 | 3300005615 | Bacteria | 1368 |
| 211 | Ga0070702_100340747 | 3300005615 | Bacteria | 1052 |
| 212 | Ga0068852_100017595 | 3300005616 | Bacteria | 5613 |
| 213 | Ga0068852_100230360 | 3300005616 | Bacteria | 1766 |
| 214 | Ga0068859_100054835 | 3300005617 | Bacteria | 4010 |
| 215 | Ga0068859_100079747 | 3300005617 | Bacteria | 3314 |
| 216 | Ga0068859_100112551 | 3300005617 | Bacteria | 2785 |
| 217 | Ga0068859_100169538 | 3300005617 | Bacteria | 2264 |
| 218 | Ga0068859_100287541 | 3300005617 | Bacteria | 1737 |
| 219 | Ga0068859_100411653 | 3300005617 | Bacteria | 1448 |
| 220 | Ga0068864_100002141 | 3300005618 | Bacteria | 16331 |
| 221 | Ga0068864_100034796 | 3300005618 | Bacteria | 4286 |
| 222 | Ga0068864_100106485 | 3300005618 | Bacteria | 2493 |
| 223 | Ga0068864_100652402 | 3300005618 | Bacteria | 1025 |
| 224 | Ga0068866_10012210 | 3300005718 | Bacteria | 3741 |
| 225 | Ga0068866_10017052 | 3300005718 | Bacteria | 3260 |
| 226 | Ga0068861_100002200 | 3300005719 | Bacteria | 12657 |
| 227 | Ga0068861_100126572 | 3300005719 | Bacteria | 2068 |
| 228 | Ga0068861_100512790 | 3300005719 | Bacteria | 1086 |
| 229 | Ga0068870_10064483 | 3300005840 | Unclassified | 1979 |
| 230 | Ga0068870_10203280 | 3300005840 | Bacteria | 1202 |
| 231 | Ga0068863_100092530 | 3300005841 | Bacteria | 2868 |
| 232 | Ga0068863_100210158 | 3300005841 | Bacteria | 1874 |
| 233 | Ga0068863_100257220 | 3300005841 | Bacteria | 1687 |
| 234 | Ga0068858_100000405 | 3300005842 | Bacteria | 44934 |
| 235 | Ga0068858_100014535 | 3300005842 | Bacteria | 7417 |
| 236 | Ga0068858_100058092 | 3300005842 | Bacteria | 3576 |
| 237 | Ga0068858_100068571 | 3300005842 | Bacteria | 3287 |
| 238 | Ga0068858_100089413 | 3300005842 | Bacteria | 2866 |
| 239 | Ga0068858_100269722 | 3300005842 | Bacteria | 1619 |
| 240 | Ga0068860_100002487 | 3300005843 | Bacteria | 19327 |
| 241 | Ga0068860_100027839 | 3300005843 | Bacteria | 5443 |
| 242 | Ga0068860_100096792 | 3300005843 | Bacteria | 2813 |
| 243 | Ga0068860_100195015 | 3300005843 | Bacteria | 1961 |
| 244 | Ga0068862_100033821 | 3300005844 | Bacteria | 4323 |
| 245 | Ga0068862_100038785 | 3300005844 | Bacteria | 4042 |
| 246 | Ga0068862_100102426 | 3300005844 | Bacteria | 2506 |
| 247 | Ga0081455_10422222 | 3300005937 | Bacteria | 919 |
| 248 | Ga0081540_1097925 | 3300005983 | Bacteria | 1271 |
| 249 | Ga0081539_10000858 | 3300005985 | Bacteria | 58194 |
| 250 | Ga0070715_10000024 | 3300006163 | Bacteria | 110647 |
| 251 | Ga0070716_100015207 | 3300006173 | Bacteria | 3950 |
| 252 | Ga0075366_10001711 | 3300006195 | Bacteria | 11028 |
| 253 | Ga0097621_100000028 | 3300006237 | Bacteria | 71678 |
| 254 | Ga0097621_100003157 | 3300006237 | Bacteria | 11316 |
| 255 | Ga0097621_100006010 | 3300006237 | Bacteria | 8579 |
| 256 | Ga0068871_100006906 | 3300006358 | Bacteria | 8084 |
| 257 | Ga0068871_100024567 | 3300006358 | Bacteria | 4674 |
| 258 | Ga0068871_100037044 | 3300006358 | Bacteria | 3888 |
| 259 | Ga0075430_100014761 | 3300006846 | Bacteria | 6651 |
| 260 | Ga0075430_100017128 | 3300006846 | Bacteria | 6171 |
| 261 | Ga0075430_100066766 | 3300006846 | Bacteria | 3021 |
| 262 | Ga0075430_100088661 | 3300006846 | Bacteria | 2589 |
| 263 | Ga0075431_100095920 | 3300006847 | Bacteria | 3062 |
| 264 | Ga0075431_100166135 | 3300006847 | Bacteria | 2268 |
| 265 | Ga0075433_10015116 | 3300006852 | Bacteria | 6323 |
| 266 | Ga0075433_10021849 | 3300006852 | Bacteria | 5368 |
| 267 | Ga0075433_10049863 | 3300006852 | Bacteria | 3642 |
| 268 | Ga0075433_10282341 | 3300006852 | Bacteria | 1471 |
| 269 | Ga0075433_10366468 | 3300006852 | Bacteria | 1272 |
| 270 | Ga0075434_100000831 | 3300006871 | Bacteria | 24539 |
| 271 | Ga0075434_100010744 | 3300006871 | Bacteria | 8599 |
| 272 | Ga0075434_100147427 | 3300006871 | Bacteria | 2373 |
| 273 | Ga0075434_100160548 | 3300006871 | Bacteria | 2267 |
| 274 | Ga0075434_100706617 | 3300006871 | Bacteria | 1025 |
| 275 | Ga0075429_100011725 | 3300006880 | Bacteria | 7604 |
| 276 | Ga0075429_100018935 | 3300006880 | Bacteria | 5963 |
| 277 | Ga0075429_100031368 | 3300006880 | Bacteria | 4619 |
| 278 | Ga0075429_100092571 | 3300006880 | Bacteria | 2637 |
| 279 | Ga0075429_100234498 | 3300006880 | Bacteria | 1607 |
| 280 | Ga0068865_100000127 | 3300006881 | Bacteria | 39327 |
| 281 | Ga0068865_100032927 | 3300006881 | Bacteria | 3468 |
| 282 | Ga0068865_100071929 | 3300006881 | Bacteria | 2455 |
| 283 | Ga0068865_100305617 | 3300006881 | Bacteria | 1274 |
| 284 | Ga0075436_100000020 | 3300006914 | Bacteria | 124822 |
| 285 | Ga0075436_100327712 | 3300006914 | Bacteria | 1101 |
| 286 | Ga0075436_100389832 | 3300006914 | Bacteria | 1008 |
| 287 | Ga0097620_100011064 | 3300006931 | Bacteria | 9075 |
| 288 | Ga0097620_100054836 | 3300006931 | Bacteria | 4010 |
| 289 | Ga0097620_100079748 | 3300006931 | Bacteria | 3314 |
| 290 | Ga0097620_100112549 | 3300006931 | Bacteria | 2785 |
| 291 | Ga0097620_100169531 | 3300006931 | Bacteria | 2264 |
| 292 | Ga0097620_100287541 | 3300006931 | Bacteria | 1737 |
| 293 | Ga0097620_100411662 | 3300006931 | Bacteria | 1448 |
| 294 | Ga0075435_100000165 | 3300007076 | Bacteria | 38337 |
| 295 | Ga0075435_100032986 | 3300007076 | Bacteria | 4092 |
| 296 | Ga0075435_100095774 | 3300007076 | Bacteria | 2455 |
| 297 | Ga0075435_100281110 | 3300007076 | Bacteria | 1421 |
| 298 | Ga0099794_10001218 | 3300007265 | Bacteria | 8883 |
| 299 | Ga0105251_10061955 | 3300009011 | Bacteria | 1758 |
| 300 | Ga0105251_10116981 | 3300009011 | Bacteria | 1212 |
| 301 | Ga0105240_10000237 | 3300009093 | Bacteria | 109895 |
| 302 | Ga0105240_10014965 | 3300009093 | Bacteria | 10571 |
| 303 | Ga0105240_10020594 | 3300009093 | Bacteria | 8792 |
| 304 | Ga0105240_10048025 | 3300009093 | Bacteria | 5397 |
| 305 | Ga0105240_10187598 | 3300009093 | Bacteria | 2434 |
| 306 | Ga0105240_10227132 | 3300009093 | Bacteria | 2171 |
| 307 | Ga0105240_10365364 | 3300009093 | Bacteria | 1633 |
| 308 | Ga0105240_11082324 | 3300009093 | Bacteria | 854 |
| 309 | Ga0111539_10079406 | 3300009094 | Bacteria | 3860 |
| 310 | Ga0111539_10211199 | 3300009094 | Bacteria | 2261 |
| 311 | Ga0105245_10243938 | 3300009098 | Bacteria | 1743 |
| 312 | Ga0105245_10607140 | 3300009098 | Bacteria | 1121 |
| 313 | Ga0105247_10000153 | 3300009101 | Bacteria | 67393 |
| 314 | Ga0105247_10005769 | 3300009101 | Bacteria | 7752 |
| 315 | Ga0105247_10009777 | 3300009101 | Bacteria | 5813 |
| 316 | Ga0114129_10007783 | 3300009147 | Bacteria | 15246 |
| 317 | Ga0114129_10018669 | 3300009147 | Bacteria | 9874 |
| 318 | Ga0114129_10213288 | 3300009147 | Bacteria | 2609 |
| 319 | Ga0114129_10654159 | 3300009147 | Bacteria | 1356 |
| 320 | Ga0114129_10843987 | 3300009147 | Bacteria | 1165 |
| 321 | Ga0105243_10000785 | 3300009148 | Bacteria | 30459 |
| 322 | Ga0105243_10080793 | 3300009148 | Bacteria | 2652 |
| 323 | Ga0105243_10133231 | 3300009148 | Bacteria | 2111 |
| 324 | Ga0105243_10189222 | 3300009148 | Bacteria | 1796 |
| 325 | Ga0105243_10298058 | 3300009148 | Bacteria | 1460 |
| 326 | Ga0105241_10535967 | 3300009174 | Bacteria | 1049 |
| 327 | Ga0105242_10001383 | 3300009176 | Bacteria | 19124 |
| 328 | Ga0105242_10029494 | 3300009176 | Bacteria | 4376 |
| 329 | Ga0105242_10187229 | 3300009176 | Bacteria | 1830 |
| 330 | Ga0105242_10256131 | 3300009176 | Bacteria | 1579 |
| 331 | Ga0105248_10015522 | 3300009177 | Bacteria | 8397 |
| 332 | Ga0105248_10015913 | 3300009177 | Bacteria | 8284 |
| 333 | Ga0105248_10165246 | 3300009177 | Bacteria | 2495 |
| 334 | Ga0105237_10000224 | 3300009545 | Bacteria | 79854 |
| 335 | Ga0105237_10000485 | 3300009545 | Bacteria | 56664 |
| 336 | Ga0105237_10001308 | 3300009545 | Bacteria | 33108 |
| 337 | Ga0105237_10037976 | 3300009545 | Bacteria | 4865 |
| 338 | Ga0105237_10041051 | 3300009545 | Bacteria | 4667 |
| 339 | Ga0105237_10065000 | 3300009545 | Bacteria | 3644 |
| 340 | Ga0105237_10093882 | 3300009545 | Bacteria | 2989 |
| 341 | Ga0105237_10279937 | 3300009545 | Bacteria | 1671 |
| 342 | Ga0105237_10385476 | 3300009545 | Bacteria | 1406 |
| 343 | Ga0105237_10411591 | 3300009545 | Bacteria | 1357 |
| 344 | Ga0105237_10442625 | 3300009545 | Bacteria | 1305 |
| 345 | Ga0105237_10553924 | 3300009545 | Bacteria | 1156 |
| 346 | Ga0105238_10133400 | 3300009551 | Bacteria | 2461 |
| 347 | Ga0105238_11076560 | 3300009551 | Bacteria | 826 |
| 348 | Ga0105249_10013986 | 3300009553 | Bacteria | 7094 |
| 349 | Ga0105249_10063134 | 3300009553 | Bacteria | 3402 |
| 350 | Ga0105249_10087773 | 3300009553 | Bacteria | 2903 |
| 351 | Ga0105249_10237828 | 3300009553 | Bacteria | 1799 |
| 352 | Ga0105239_10000039 | 3300010375 | Bacteria | 203537 |
| 353 | Ga0105239_10000120 | 3300010375 | Bacteria | 110003 |
| 354 | Ga0105239_10004436 | 3300010375 | Bacteria | 16776 |
| 355 | Ga0105239_10005560 | 3300010375 | Bacteria | 14739 |
| 356 | Ga0105239_10012917 | 3300010375 | Bacteria | 9289 |
| 357 | Ga0105239_10013753 | 3300010375 | Bacteria | 8983 |
| 358 | Ga0105239_10023687 | 3300010375 | Bacteria | 6759 |
| 359 | Ga0105239_10025250 | 3300010375 | Bacteria | 6543 |
| 360 | Ga0105239_10146195 | 3300010375 | Bacteria | 2636 |
| 361 | Ga0105239_10826509 | 3300010375 | Bacteria | 1062 |
| 362 | Ga0105246_10039466 | 3300011119 | Bacteria | 3181 |
| 363 | Ga0105246_10172179 | 3300011119 | Bacteria | 1659 |
| 364 | Ga0157373_10000208 | 3300013100 | Bacteria | 48082 |
| 365 | Ga0157373_10076454 | 3300013100 | Bacteria | 2362 |
| 366 | Ga0157373_10170348 | 3300013100 | Bacteria | 1532 |
| 367 | Ga0157371_10000263 | 3300013102 | Bacteria | 71557 |
| 368 | Ga0157370_10095584 | 3300013104 | Bacteria | 2788 |
| 369 | Ga0157369_10617552 | 3300013105 | Bacteria | 1119 |
| 370 | Ga0157374_10001845 | 3300013296 | Bacteria | 17834 |
| 371 | Ga0157374_10044113 | 3300013296 | Bacteria | 4121 |
| 372 | Ga0157374_10155428 | 3300013296 | Bacteria | 2226 |
| 373 | Ga0157374_10357088 | 3300013296 | Bacteria | 1453 |
| 374 | Ga0157378_10000002 | 3300013297 | Bacteria | 222652 |
| 375 | Ga0157378_10009280 | 3300013297 | Bacteria | 8570 |
| 376 | Ga0157378_10010199 | 3300013297 | Bacteria | 8198 |
| 377 | Ga0157378_10039044 | 3300013297 | Bacteria | 4210 |
| 378 | Ga0157378_10043262 | 3300013297 | Bacteria | 3999 |
| 379 | Ga0157378_10046779 | 3300013297 | Bacteria | 3845 |
| 380 | Ga0157378_10235654 | 3300013297 | Bacteria | 1746 |
| 381 | Ga0157378_10322829 | 3300013297 | Bacteria | 1500 |
| 382 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 383 | Ga0163162_10003107 | 3300013306 | Bacteria | 15857 |
| 384 | Ga0163162_10005005 | 3300013306 | Bacteria | 12766 |
| 385 | Ga0163162_10010070 | 3300013306 | Bacteria | 9190 |
| 386 | Ga0163162_10013931 | 3300013306 | Bacteria | 7855 |
| 387 | Ga0163162_10016331 | 3300013306 | Bacteria | 7257 |
| 388 | Ga0163162_10033657 | 3300013306 | Bacteria | 5093 |
| 389 | Ga0163162_10064255 | 3300013306 | Bacteria | 3715 |
| 390 | Ga0163162_10110885 | 3300013306 | Bacteria | 2841 |
| 391 | Ga0163162_10610738 | 3300013306 | Bacteria | 1216 |
| 392 | Ga0163162_10727211 | 3300013306 | Bacteria | 1113 |
| 393 | Ga0157372_10000050 | 3300013307 | Bacteria | 140381 |
| 394 | Ga0157372_10000635 | 3300013307 | Bacteria | 38523 |
| 395 | Ga0157372_10001419 | 3300013307 | Bacteria | 25842 |
| 396 | Ga0157372_10002231 | 3300013307 | Bacteria | 21022 |
| 397 | Ga0157372_10189979 | 3300013307 | Bacteria | 2379 |
| 398 | Ga0157372_10403929 | 3300013307 | Bacteria | 1592 |
| 399 | Ga0157375_10007015 | 3300013308 | Bacteria | 9838 |
| 400 | Ga0157375_10021385 | 3300013308 | Bacteria | 5930 |
| 401 | Ga0157375_10055045 | 3300013308 | Bacteria | 3921 |
| 402 | Ga0157375_11236598 | 3300013308 | Bacteria | 877 |
| 403 | Ga0163163_10002079 | 3300014325 | Bacteria | 16899 |
| 404 | Ga0163163_10004729 | 3300014325 | Bacteria | 11666 |
| 405 | Ga0163163_10014695 | 3300014325 | Bacteria | 7200 |
| 406 | Ga0163163_10018317 | 3300014325 | Bacteria | 6552 |
| 407 | Ga0163163_10215737 | 3300014325 | Bacteria | 1968 |
| 408 | Ga0157380_10001101 | 3300014326 | Bacteria | 17410 |
| 409 | Ga0157380_10012995 | 3300014326 | Bacteria | 6054 |
| 410 | Ga0157380_10027529 | 3300014326 | Bacteria | 4324 |
| 411 | Ga0157380_10093550 | 3300014326 | Bacteria | 2486 |
| 412 | Ga0157380_10534322 | 3300014326 | Bacteria | 1147 |
| 413 | Ga0157380_10925475 | 3300014326 | Bacteria | 900 |
| 414 | Ga0157380_11116714 | 3300014326 | Bacteria | 828 |
| 415 | Ga0157379_10047882 | 3300014968 | Bacteria | 3815 |
| 416 | Ga0157379_10059280 | 3300014968 | Bacteria | 3422 |
| 417 | Ga0157376_10027794 | 3300014969 | Bacteria | 4489 |
| 418 | Ga0182006_1091847 | 3300015261 | Bacteria | 1091 |
| 419 | Ga0163161_10027541 | 3300017792 | Bacteria | 4032 |
| 420 | Ga0207672_1000067 | 3300025223 | Bacteria | 14045 |
| 421 | Ga0207427_100172 | 3300025231 | Bacteria | 71550 |
| 422 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 423 | Ga0209437_100221 | 3300025233 | Bacteria | 104135 |
| 424 | Ga0209026_1000728 | 3300025250 | Bacteria | 19168 |
| 425 | Ga0209026_1003634 | 3300025250 | Bacteria | 4952 |
| 426 | Ga0209026_1015127 | 3300025250 | Bacteria | 1272 |
| 427 | Ga0209148_1017175 | 3300025254 | Bacteria | 1232 |
| 428 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 429 | Ga0209233_1001428 | 3300025261 | Bacteria | 9422 |
| 430 | Ga0209233_1013109 | 3300025261 | Bacteria | 2377 |
| 431 | Ga0209233_1019675 | 3300025261 | Bacteria | 1789 |
| 432 | Ga0209455_1000861 | 3300025272 | Bacteria | 16150 |
| 433 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 434 | Ga0207710_10000702 | 3300025900 | Bacteria | 18777 |
| 435 | Ga0207710_10071792 | 3300025900 | Bacteria | 1589 |
| 436 | Ga0207688_10102635 | 3300025901 | Bacteria | 1653 |
| 437 | Ga0207647_10000076 | 3300025904 | Bacteria | 75824 |
| 438 | Ga0207647_10002660 | 3300025904 | Bacteria | 13488 |
| 439 | Ga0207647_10101115 | 3300025904 | Bacteria | 1710 |
| 440 | Ga0207647_10150889 | 3300025904 | Bacteria | 1358 |
| 441 | Ga0207685_10000018 | 3300025905 | Bacteria | 145715 |
| 442 | Ga0207645_10017477 | 3300025907 | Bacteria | 4734 |
| 443 | Ga0207645_10087794 | 3300025907 | Bacteria | 1998 |
| 444 | Ga0207705_10000036 | 3300025909 | Bacteria | 200787 |
| 445 | Ga0207684_10000150 | 3300025910 | Bacteria | 121849 |
| 446 | Ga0207684_10004744 | 3300025910 | Bacteria | 12740 |
| 447 | Ga0207684_10007514 | 3300025910 | Bacteria | 9807 |
| 448 | Ga0207684_10017828 | 3300025910 | Bacteria | 6088 |
| 449 | Ga0207684_10022905 | 3300025910 | Bacteria | 5334 |
| 450 | Ga0207684_10121834 | 3300025910 | Bacteria | 2236 |
| 451 | Ga0207684_10297695 | 3300025910 | Bacteria | 1391 |
| 452 | Ga0207684_10361659 | 3300025910 | Bacteria | 1249 |
| 453 | Ga0207654_10103132 | 3300025911 | Bacteria | 1761 |
| 454 | Ga0207654_10118633 | 3300025911 | Bacteria | 1657 |
| 455 | Ga0207654_10425683 | 3300025911 | Bacteria | 927 |
| 456 | Ga0207707_10000016 | 3300025912 | Bacteria | 256002 |
| 457 | Ga0207707_10030350 | 3300025912 | Bacteria | 4729 |
| 458 | Ga0207707_10268130 | 3300025912 | Bacteria | 1480 |
| 459 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 460 | Ga0207695_10004656 | 3300025913 | Bacteria | 18589 |
| 461 | Ga0207695_10016549 | 3300025913 | Bacteria | 8620 |
| 462 | Ga0207695_10033191 | 3300025913 | Bacteria | 5637 |
| 463 | Ga0207695_10058909 | 3300025913 | Bacteria | 3985 |
| 464 | Ga0207695_10318305 | 3300025913 | Bacteria | 1445 |
| 465 | Ga0207671_10002707 | 3300025914 | Bacteria | 18581 |
| 466 | Ga0207671_10011004 | 3300025914 | Bacteria | 7407 |
| 467 | Ga0207671_10011316 | 3300025914 | Bacteria | 7272 |
| 468 | Ga0207671_10024807 | 3300025914 | Bacteria | 4506 |
| 469 | Ga0207671_10037577 | 3300025914 | Bacteria | 3590 |
| 470 | Ga0207660_10000805 | 3300025917 | Bacteria | 20711 |
| 471 | Ga0207660_10032391 | 3300025917 | Bacteria | 3608 |
| 472 | Ga0207660_10119374 | 3300025917 | Bacteria | 1995 |
| 473 | Ga0207662_10106779 | 3300025918 | Bacteria | 1742 |
| 474 | Ga0207662_10253872 | 3300025918 | Bacteria | 1155 |
| 475 | Ga0207662_10305117 | 3300025918 | Bacteria | 1059 |
| 476 | Ga0207657_10020956 | 3300025919 | Bacteria | 6166 |
| 477 | Ga0207649_10034440 | 3300025920 | Bacteria | 3034 |
| 478 | Ga0207649_10177370 | 3300025920 | Bacteria | 1489 |
| 479 | Ga0207652_10000693 | 3300025921 | Bacteria | 32703 |
| 480 | Ga0207652_10298145 | 3300025921 | Bacteria | 1455 |
| 481 | Ga0207646_10004823 | 3300025922 | Bacteria | 14455 |
| 482 | Ga0207646_10026415 | 3300025922 | Bacteria | 5298 |
| 483 | Ga0207646_10073942 | 3300025922 | Bacteria | 3045 |
| 484 | Ga0207646_10298506 | 3300025922 | Bacteria | 1455 |
| 485 | Ga0207681_10012288 | 3300025923 | Bacteria | 5281 |
| 486 | Ga0207681_10264841 | 3300025923 | Bacteria | 1347 |
| 487 | Ga0207694_10049255 | 3300025924 | Bacteria | 3261 |
| 488 | Ga0207694_10146670 | 3300025924 | Bacteria | 1900 |
| 489 | Ga0207650_10000011 | 3300025925 | Bacteria | 450115 |
| 490 | Ga0207650_10002299 | 3300025925 | Bacteria | 13320 |
| 491 | Ga0207659_10013295 | 3300025926 | Bacteria | 5266 |
| 492 | Ga0207644_10000882 | 3300025931 | Bacteria | 18926 |
| 493 | Ga0207644_10062324 | 3300025931 | Bacteria | 2704 |
| 494 | Ga0207644_10073528 | 3300025931 | Bacteria | 2507 |
| 495 | Ga0207644_10096507 | 3300025931 | Bacteria | 2213 |
| 496 | Ga0207644_10263654 | 3300025931 | Bacteria | 1378 |
| 497 | Ga0207644_10425065 | 3300025931 | Bacteria | 1089 |
| 498 | Ga0207690_10011536 | 3300025932 | Bacteria | 5278 |
| 499 | Ga0207690_10015769 | 3300025932 | Bacteria | 4586 |
| 500 | Ga0207706_10006487 | 3300025933 | Bacteria | 10861 |
| 501 | Ga0207706_10178930 | 3300025933 | Bacteria | 1863 |
| 502 | Ga0207686_10000952 | 3300025934 | Bacteria | 17283 |
| 503 | Ga0207709_10000524 | 3300025935 | Bacteria | 33443 |
| 504 | Ga0207709_10002326 | 3300025935 | Bacteria | 12000 |
| 505 | Ga0207709_10036889 | 3300025935 | Bacteria | 2900 |
| 506 | Ga0207709_10264132 | 3300025935 | Bacteria | 1264 |
| 507 | Ga0207670_10000065 | 3300025936 | Bacteria | 75480 |
| 508 | Ga0207670_10035418 | 3300025936 | Bacteria | 3236 |
| 509 | Ga0207704_10000044 | 3300025938 | Bacteria | 86753 |
| 510 | Ga0207704_10013016 | 3300025938 | Bacteria | 4148 |
| 511 | Ga0207704_10101785 | 3300025938 | Bacteria | 1917 |
| 512 | Ga0207704_10211159 | 3300025938 | Bacteria | 1429 |
| 513 | Ga0207691_10005500 | 3300025940 | Bacteria | 12241 |
| 514 | Ga0207691_10056180 | 3300025940 | Bacteria | 3587 |
| 515 | Ga0207691_10237566 | 3300025940 | Bacteria | 1576 |
| 516 | Ga0207691_10265208 | 3300025940 | Bacteria | 1480 |
| 517 | Ga0207711_10013164 | 3300025941 | Bacteria | 6870 |
| 518 | Ga0207711_10018170 | 3300025941 | Bacteria | 5845 |
| 519 | Ga0207689_10009519 | 3300025942 | Bacteria | 8385 |
| 520 | Ga0207689_10024086 | 3300025942 | Bacteria | 5106 |
| 521 | Ga0207689_10026884 | 3300025942 | Bacteria | 4816 |
| 522 | Ga0207689_10041222 | 3300025942 | Bacteria | 3820 |
| 523 | Ga0207689_10041530 | 3300025942 | Bacteria | 3806 |
| 524 | Ga0207689_10064294 | 3300025942 | Bacteria | 3019 |
| 525 | Ga0207689_10066062 | 3300025942 | Bacteria | 2975 |
| 526 | Ga0207689_10270225 | 3300025942 | Bacteria | 1407 |
| 527 | Ga0207689_10380763 | 3300025942 | Bacteria | 1175 |
| 528 | Ga0207679_10001977 | 3300025945 | Bacteria | 12712 |
| 529 | Ga0207679_10025207 | 3300025945 | Bacteria | 4087 |
| 530 | Ga0207679_10414295 | 3300025945 | Bacteria | 1188 |
| 531 | Ga0207679_10547559 | 3300025945 | Bacteria | 1038 |
| 532 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 533 | Ga0207667_10000971 | 3300025949 | Bacteria | 36600 |
| 534 | Ga0207667_10051802 | 3300025949 | Bacteria | 4326 |
| 535 | Ga0207667_10085702 | 3300025949 | Bacteria | 3261 |
| 536 | Ga0207667_10205066 | 3300025949 | Bacteria | 2022 |
| 537 | Ga0207667_10553159 | 3300025949 | Bacteria | 1164 |
| 538 | Ga0207667_10758902 | 3300025949 | Bacteria | 969 |
| 539 | Ga0207651_10016587 | 3300025960 | Bacteria | 4321 |
| 540 | Ga0207651_10018113 | 3300025960 | Bacteria | 4182 |
| 541 | Ga0207651_10030254 | 3300025960 | Bacteria | 3445 |
| 542 | Ga0207651_10042500 | 3300025960 | Bacteria | 3026 |
| 543 | Ga0207651_10095736 | 3300025960 | Bacteria | 2187 |
| 544 | Ga0207651_10104905 | 3300025960 | Bacteria | 2107 |
| 545 | Ga0207651_10397315 | 3300025960 | Bacteria | 1172 |
| 546 | Ga0207712_10027437 | 3300025961 | Bacteria | 3802 |
| 547 | Ga0207712_10075328 | 3300025961 | Bacteria | 2439 |
| 548 | Ga0207712_10142459 | 3300025961 | Bacteria | 1841 |
| 549 | Ga0207712_10476213 | 3300025961 | Bacteria | 1063 |
| 550 | Ga0207668_10338072 | 3300025972 | Bacteria | 1255 |
| 551 | Ga0207640_10177008 | 3300025981 | Bacteria | 1596 |
| 552 | Ga0207640_10267992 | 3300025981 | Bacteria | 1334 |
| 553 | Ga0207658_10101237 | 3300025986 | Bacteria | 2257 |
| 554 | Ga0207658_10234206 | 3300025986 | Bacteria | 1552 |
| 555 | Ga0207677_10089034 | 3300026023 | Bacteria | 2240 |
| 556 | Ga0207677_10104836 | 3300026023 | Bacteria | 2091 |
| 557 | Ga0207703_10000045 | 3300026035 | Bacteria | 156669 |
| 558 | Ga0207703_10097306 | 3300026035 | Bacteria | 2486 |
| 559 | Ga0207703_10102201 | 3300026035 | Bacteria | 2432 |
| 560 | Ga0207703_10424570 | 3300026035 | Bacteria | 1238 |
| 561 | Ga0207639_10004531 | 3300026041 | Bacteria | 9364 |
| 562 | Ga0207639_10015887 | 3300026041 | Bacteria | 5316 |
| 563 | Ga0207639_10018588 | 3300026041 | Bacteria | 4943 |
| 564 | Ga0207639_10547352 | 3300026041 | Bacteria | 1062 |
| 565 | Ga0207678_10021588 | 3300026067 | Bacteria | 5646 |
| 566 | Ga0207708_10003530 | 3300026075 | Bacteria | 11518 |
| 567 | Ga0207708_10039998 | 3300026075 | Bacteria | 3574 |
| 568 | Ga0207708_10184541 | 3300026075 | Bacteria | 1657 |
| 569 | Ga0207708_10664032 | 3300026075 | Bacteria | 888 |
| 570 | Ga0207702_10000507 | 3300026078 | Bacteria | 43964 |
| 571 | Ga0207702_10005892 | 3300026078 | Bacteria | 10658 |
| 572 | Ga0207702_10011829 | 3300026078 | Bacteria | 7263 |
| 573 | Ga0207702_10038199 | 3300026078 | Bacteria | 4021 |
| 574 | Ga0207702_10056941 | 3300026078 | Bacteria | 3320 |
| 575 | Ga0207702_10499778 | 3300026078 | Bacteria | 1185 |
| 576 | Ga0207641_10073847 | 3300026088 | Bacteria | 2940 |
| 577 | Ga0207641_10175600 | 3300026088 | Bacteria | 1959 |
| 578 | Ga0207641_10669928 | 3300026088 | Bacteria | 1020 |
| 579 | Ga0207648_10000529 | 3300026089 | Bacteria | 42805 |
| 580 | Ga0207648_10228044 | 3300026089 | Bacteria | 1656 |
| 581 | Ga0207648_10308551 | 3300026089 | Bacteria | 1420 |
| 582 | Ga0207648_10317344 | 3300026089 | Bacteria | 1400 |
| 583 | Ga0207676_10085282 | 3300026095 | Bacteria | 2577 |
| 584 | Ga0207676_10090487 | 3300026095 | Bacteria | 2511 |
| 585 | Ga0207676_10710559 | 3300026095 | Bacteria | 974 |
| 586 | Ga0207676_10833183 | 3300026095 | Bacteria | 901 |
| 587 | Ga0207674_10020588 | 3300026116 | Bacteria | 7123 |
| 588 | Ga0207674_10123397 | 3300026116 | Bacteria | 2556 |
| 589 | Ga0207674_10145605 | 3300026116 | Bacteria | 2328 |
| 590 | Ga0207674_10483995 | 3300026116 | Bacteria | 1196 |
| 591 | Ga0207675_100000849 | 3300026118 | Bacteria | 30412 |
| 592 | Ga0207675_100004603 | 3300026118 | Bacteria | 13293 |
| 593 | Ga0207675_100144676 | 3300026118 | Bacteria | 2260 |
| 594 | Ga0207675_100184473 | 3300026118 | Bacteria | 1999 |
| 595 | Ga0207675_100484499 | 3300026118 | Bacteria | 1230 |
| 596 | Ga0207683_10031312 | 3300026121 | Bacteria | 4616 |
| 597 | Ga0207683_10273793 | 3300026121 | Bacteria | 1542 |
| 598 | Ga0207698_10005251 | 3300026142 | Bacteria | 7971 |
| 599 | Ga0207698_10117485 | 3300026142 | Bacteria | 2244 |
| 600 | Ga0209588_1010709 | 3300027671 | Bacteria | 2761 |
| 601 | Ga0209974_10003508 | 3300027876 | Bacteria | 5647 |
| 602 | Ga0207428_10001623 | 3300027907 | Bacteria | 23347 |
| 603 | Ga0207428_10117762 | 3300027907 | Bacteria | 2039 |
| 604 | Ga0207428_10135769 | 3300027907 | Bacteria | 1880 |
| 605 | Ga0268266_10000089 | 3300028379 | Bacteria | 198566 |
| 606 | Ga0268266_10088905 | 3300028379 | Bacteria | 2704 |
| 607 | Ga0268265_10018602 | 3300028380 | Bacteria | 4818 |
| 608 | Ga0268265_10026095 | 3300028380 | Bacteria | 4153 |
| 609 | Ga0268265_10026318 | 3300028380 | Bacteria | 4138 |
| 610 | Ga0268265_10355986 | 3300028380 | Bacteria | 1338 |
| 611 | Ga0268264_10007034 | 3300028381 | Bacteria | 9436 |
| 612 | Ga0268264_10069792 | 3300028381 | Bacteria | 2973 |
| 613 | Ga0268264_10080774 | 3300028381 | Bacteria | 2777 |
| 614 | Ga0268264_10128605 | 3300028381 | Bacteria | 2242 |
| 615 | Ga0307517_10003551 | 3300028786 | Bacteria | 24219 |
| 616 | Ga0307515_10001481 | 3300028794 | Bacteria | 52778 |
| 617 | Ga0307515_10001997 | 3300028794 | Bacteria | 45190 |
| 618 | Ga0307515_10100898 | 3300028794 | Bacteria | 3490 |
| 619 | Ga0265338_10015871 | 3300028800 | Bacteria | 8244 |
| 620 | Ga0316177_1009900 | 3300030731 | Bacteria | 5129 |
| 621 | Ga0316176_1141979 | 3300030732 | Bacteria | 21893 |
| 622 | Ga0316183_1118483 | 3300030742 | Bacteria | 38677 |
| 623 | Ga0316181_1033622 | 3300030744 | Bacteria | 4944 |
| 624 | Ga0265339_10084041 | 3300031249 | Bacteria | 1678 |
| 625 | Ga0265331_10075889 | 3300031250 | Bacteria | 1567 |
| 626 | Ga0265316_10220112 | 3300031344 | Bacteria | 1401 |
| 627 | Ga0307408_100016223 | 3300031548 | Bacteria | 4967 |
| 628 | Ga0307408_100058015 | 3300031548 | Bacteria | 2813 |
| 629 | Ga0307408_100149571 | 3300031548 | Bacteria | 1842 |
| 630 | Ga0316579_10043400 | 3300031691 | Bacteria | 2092 |
| 631 | Ga0316576_10127932 | 3300031727 | Bacteria | 1910 |
| 632 | Ga0307405_10001983 | 3300031731 | Bacteria | 8851 |
| 633 | Ga0307405_10058440 | 3300031731 | Bacteria | 2427 |
| 634 | Ga0307413_10001627 | 3300031824 | Bacteria | 8700 |
| 635 | Ga0307413_10036294 | 3300031824 | Bacteria | 2836 |
| 636 | Ga0307410_10002169 | 3300031852 | Bacteria | 9326 |
| 637 | Ga0307410_10390195 | 3300031852 | Bacteria | 1122 |
| 638 | Ga0307410_10435734 | 3300031852 | Bacteria | 1066 |
| 639 | Ga0307406_10042010 | 3300031901 | Bacteria | 2853 |
| 640 | Ga0307406_10091712 | 3300031901 | Bacteria | 2047 |
| 641 | Ga0307406_10441028 | 3300031901 | Bacteria | 1042 |
| 642 | Ga0307407_10067696 | 3300031903 | Bacteria | 2112 |
| 643 | Ga0307412_10045347 | 3300031911 | Bacteria | 2873 |
| 644 | Ga0307412_10052264 | 3300031911 | Bacteria | 2705 |
| 645 | Ga0307412_10077908 | 3300031911 | Bacteria | 2281 |
| 646 | Ga0307412_10284247 | 3300031911 | Bacteria | 1300 |
| 647 | Ga0307412_10406460 | 3300031911 | Bacteria | 1110 |
| 648 | Ga0307409_100007363 | 3300031995 | Bacteria | 6576 |
| 649 | Ga0307409_100056497 | 3300031995 | Bacteria | 3036 |
| 650 | Ga0307409_100817175 | 3300031995 | Bacteria | 941 |
| 651 | Ga0307416_100001756 | 3300032002 | Bacteria | 12005 |
| 652 | Ga0307416_100013314 | 3300032002 | Bacteria | 5587 |
| 653 | Ga0307416_100042843 | 3300032002 | Bacteria | 3538 |
| 654 | Ga0307414_10041283 | 3300032004 | Bacteria | 3124 |
| 655 | Ga0307411_10000610 | 3300032005 | Bacteria | 12858 |
| 656 | Ga0307411_10121123 | 3300032005 | Bacteria | 1893 |
| 657 | Ga0307411_10256934 | 3300032005 | Bacteria | 1377 |
| 658 | Ga0307415_100051090 | 3300032126 | Bacteria | 2804 |
| 659 | Ga0307415_100117087 | 3300032126 | Bacteria | 1989 |
| 660 | Ga0307415_100151684 | 3300032126 | Bacteria | 1784 |
| 661 | Ga0307415_100405665 | 3300032126 | Bacteria | 1165 |
| 662 | Ga0316585_10039603 | 3300032137 | Bacteria | 1499 |
| 663 | Ga0316580_10007805 | 3300032139 | Bacteria | 3194 |
| 664 | Ga0307507_10000015 | 3300033179 | Bacteria | 237419 |
| 665 | Ga0373940_0085463 | 3300035088 | Bacteria | 939 |
| 666 | Ga0373951_0004432 | 3300035091 | Bacteria | 3336 |
| 667 | Ga0373941_0107012 | 3300035115 | Bacteria | 981 |
| 668 | Ga0373942_0019143 | 3300035207 | Bacteria | 1706 |
| 669 | Ga0373962_0030121 | 3300035242 | Bacteria | 1483 |
| 670 | Ga0373937_0110636 | 3300036401 | Bacteria | 2555 |
| 671 | Ga0373937_0273069 | 3300036401 | Bacteria | 1596 |
| 672 | Ga0373937_0498038 | 3300036401 | Bacteria | 1158 |
| 673 | Ga0316582_0022813 | 3300036647 | Bacteria | 3722 |
| 674 | Ga0316584_0052688 | 3300036712 | Bacteria | 3043 |
| 675 | Ga0316584_0057497 | 3300036712 | Bacteria | 2911 |
| 676 | Ga0395899_0000033 | 3300037312 | Bacteria | 306589 |
| 677 | Ga0395899_0000659 | 3300037312 | Bacteria | 35170 |
| 678 | Ga0395899_0001109 | 3300037312 | Bacteria | 24123 |
| 679 | Ga0395899_0021085 | 3300037312 | Bacteria | 4942 |
| 680 | Ga0395900_0000277 | 3300037418 | Bacteria | 77256 |
| 681 | Ga0395900_0001234 | 3300037418 | Bacteria | 31453 |
| 682 | Ga0395900_0019640 | 3300037418 | Bacteria | 6889 |
| 683 | Ga0395900_0127856 | 3300037418 | Bacteria | 2605 |
| 684 | Ga0395898_0001918 | 3300037466 | Bacteria | 26473 |
| 685 | Ga0395905_0000068 | 3300037471 | Bacteria | 177163 |
| 686 | Ga0395905_0000348 | 3300037471 | Bacteria | 65915 |
| 687 | Ga0395905_0004443 | 3300037471 | Bacteria | 14577 |
| 688 | Ga0395901_0000199 | 3300038443 | Bacteria | 76415 |
| 689 | Ga0395901_0005268 | 3300038443 | Bacteria | 13060 |
| 690 | Ga0395901_0140444 | 3300038443 | Bacteria | 2539 |
| 691 | Ga0395901_0173777 | 3300038443 | Bacteria | 2260 |
| 692 | Ga0242420_003202 | 3300038996 | Bacteria | 2411 |
| 693 | Ga0242420_011217 | 3300038996 | Bacteria | 1499 |
| 694 | Ga0436365_0065130 | 3300039437 | Bacteria | 167769 |
| 695 | Ga0436361_0742208 | 3300039447 | Bacteria | 6052 |
| 696 | Ga0439448_0020387 | 3300042005 | Bacteria | 2050 |
| 697 | Ga0439464_0003170 | 3300042439 | Bacteria | 4124 |
| 698 | Ga0439460_0036907 | 3300042461 | Bacteria | 1420 |
| 699 | Ga0451577_0000034 | 3300042876 | Bacteria | 376183 |
| 700 | Ga0451577_0003212 | 3300042876 | Bacteria | 18354 |
| 701 | Ga0451577_0025370 | 3300042876 | Bacteria | 5378 |
| 702 | Ga0451577_0132698 | 3300042876 | Bacteria | 2235 |
| 703 | Ga0466969_0032580 | 3300044656 | Bacteria | 2649 |
| 704 | Ga0453683_0000005 | 3300044673 | Bacteria | 741657 |
| 705 | Ga0453683_0000122 | 3300044673 | Bacteria | 116184 |
| 706 | Ga0453683_0004573 | 3300044673 | Bacteria | 9780 |
| 707 | Ga0453683_0127057 | 3300044673 | Bacteria | 1605 |
| 708 | Ga0453683_0156419 | 3300044673 | Bacteria | 1441 |
| 709 | Ga0466966_0016086 | 3300044684 | Bacteria | 4946 |
| 710 | Ga0466961_0102343 | 3300044693 | Bacteria | 1804 |
| 711 | Ga0453684_0000098 | 3300044712 | Bacteria | 376183 |
| 712 | Ga0453684_0000467 | 3300044712 | Bacteria | 161003 |
| 713 | Ga0453684_0000603 | 3300044712 | Bacteria | 132340 |
| 714 | Ga0453684_0001278 | 3300044712 | Bacteria | 75250 |
| 715 | Ga0453684_0065621 | 3300044712 | Bacteria | 4628 |
| 716 | Ga0453684_0268672 | 3300044712 | Bacteria | 1950 |
| 717 | Ga0466968_0072467 | 3300044735 | Bacteria | 1502 |
| 718 | Ga0451576_0000036 | 3300045051 | Bacteria | 376183 |
| 719 | Ga0451576_0000397 | 3300045051 | Bacteria | 101182 |
| 720 | Ga0451576_0005569 | 3300045051 | Bacteria | 15735 |
| 721 | Ga0451576_0023567 | 3300045051 | Bacteria | 6663 |
| 722 | Ga0451576_0046399 | 3300045051 | Bacteria | 4575 |
| 723 | Ga0451576_0114207 | 3300045051 | Bacteria | 2811 |
| 724 | Ga0466967_0097786 | 3300045976 | Bacteria | 2679 |
| 725 | Ga0495603_0042271 | 3300046455 | Bacteria | 2725 |
| 726 | Ga0495629_0126159 | 3300046459 | Bacteria | 1783 |
| 727 | Ga0495638_0102196 | 3300046460 | Bacteria | 1713 |
| 728 | Ga0495638_0235657 | 3300046460 | Bacteria | 1016 |
| 729 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 730 | Ga0495580_0378928 | 3300046472 | Bacteria | 956 |
| 731 | Ga0495582_0004387 | 3300046473 | Bacteria | 7935 |
| 732 | Ga0495664_0059927 | 3300046477 | Bacteria | 2266 |
| 733 | Ga0495584_0088190 | 3300046491 | Bacteria | 1564 |
| 734 | Ga0495585_0001521 | 3300046492 | Bacteria | 18009 |
| 735 | Ga0495585_0003658 | 3300046492 | Bacteria | 10277 |
| 736 | Ga0495596_0018700 | 3300046500 | Bacteria | 2854 |
| 737 | Ga0495606_0000528 | 3300046507 | Bacteria | 61795 |
| 738 | Ga0495606_0005674 | 3300046507 | Bacteria | 11821 |
| 739 | Ga0495606_0016540 | 3300046507 | Bacteria | 5616 |
| 740 | Ga0495610_0006009 | 3300046512 | Bacteria | 8481 |
| 741 | Ga0495616_0005759 | 3300046513 | Bacteria | 7578 |
| 742 | Ga0495616_0023741 | 3300046513 | Bacteria | 3296 |
| 743 | Ga0495631_0087772 | 3300046518 | Bacteria | 1339 |
| 744 | Ga0495631_0109135 | 3300046518 | Bacteria | 1190 |
| 745 | Ga0495632_0230054 | 3300046519 | Bacteria | 836 |
| 746 | Ga0495644_0051316 | 3300046523 | Bacteria | 1549 |
| 747 | Ga0495642_0034662 | 3300046528 | Bacteria | 2034 |
| 748 | Ga0495652_0157877 | 3300046529 | Bacteria | 1764 |
| 749 | Ga0495665_0052354 | 3300046531 | Bacteria | 2161 |
| 750 | Ga0495609_0005281 | 3300046538 | Bacteria | 6852 |
| 751 | Ga0495609_0052156 | 3300046538 | Bacteria | 1820 |
| 752 | Ga0495622_0041224 | 3300046557 | Bacteria | 2147 |
| 753 | Ga0495633_0000035 | 3300046558 | Bacteria | 185403 |
| 754 | Ga0495633_0011158 | 3300046558 | Bacteria | 4867 |
| 755 | Ga0495633_0015320 | 3300046558 | Bacteria | 3979 |
| 756 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 757 | Ga0495634_0237511 | 3300046642 | Bacteria | 1119 |
| 758 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 759 | Ga0495625_0000753 | 3300046660 | Bacteria | 45225 |
| 760 | Ga0495625_0001432 | 3300046660 | Bacteria | 29071 |
| 761 | Ga0495625_0082121 | 3300046660 | Bacteria | 2242 |
| 762 | Ga0495625_0099251 | 3300046660 | Bacteria | 2002 |
| 763 | Ga0495625_0301139 | 3300046660 | Bacteria | 1026 |
| 764 | Ga0495659_0016122 | 3300046664 | Bacteria | 2462 |
| 765 | Ga0495659_0068983 | 3300046664 | Bacteria | 1321 |
| 766 | Ga0495661_0000707 | 3300046665 | Bacteria | 33018 |
| 767 | Ga0495661_0004079 | 3300046665 | Bacteria | 10640 |
| 768 | Ga0495647_0005287 | 3300046681 | Bacteria | 4228 |
| 769 | Ga0495647_0023171 | 3300046681 | Bacteria | 2250 |
| 770 | Ga0495658_0000570 | 3300046683 | Bacteria | 20102 |
| 771 | Ga0495658_0075837 | 3300046683 | Bacteria | 1963 |
| 772 | Ga0495658_0136364 | 3300046683 | Bacteria | 1497 |
| 773 | Ga0495658_0163109 | 3300046683 | Bacteria | 1376 |
| 774 | Ga0495658_0191774 | 3300046683 | Bacteria | 1271 |
| 775 | Ga0495669_0010075 | 3300046684 | Bacteria | 3992 |
| 776 | Ga0495670_0061831 | 3300046691 | Bacteria | 1883 |
| 777 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 778 | Ga0495676_0248657 | 3300047321 | Bacteria | 1214 |
| 779 | Ga0495680_0339732 | 3300047322 | Bacteria | 1048 |
| 780 | Ga0495687_001120 | 3300047443 | Bacteria | 26041 |
| 781 | Ga0495687_006439 | 3300047443 | Bacteria | 7196 |
| 782 | Ga0495677_0037403 | 3300047445 | Bacteria | 1773 |
| 783 | Ga0495686_0001209 | 3300047472 | Bacteria | 29698 |
| 784 | Ga0495686_0001825 | 3300047472 | Bacteria | 21435 |
| 785 | Ga0495602_0001510 | 3300048088 | Bacteria | 23177 |
| 786 | Ga0495614_0083785 | 3300048089 | Bacteria | 1383 |
| 787 | Ga0495626_0009849 | 3300048091 | Bacteria | 5138 |
| 788 | Ga0496100_0167413 | 3300048903 | Bacteria | 1580 |
| 789 | Ga0496102_0030220 | 3300048905 | Bacteria | 4848 |
| 790 | Ga0496102_0042442 | 3300048905 | Bacteria | 4121 |
| 791 | Ga0496103_0061654 | 3300048906 | Bacteria | 2333 |
| 792 | Ga0496103_0120921 | 3300048906 | Bacteria | 1668 |
| 793 | Ga0496104_0020868 | 3300048907 | Bacteria | 6008 |
| 794 | Ga0496104_0098177 | 3300048907 | Bacteria | 2804 |
| 795 | Ga0496106_0000834 | 3300048909 | Bacteria | 22319 |
| 796 | Ga0496106_0032249 | 3300048909 | Bacteria | 3906 |
| 797 | Ga0496106_0045581 | 3300048909 | Bacteria | 3294 |
| 798 | Ga0496107_0046604 | 3300048910 | Bacteria | 3120 |
| 799 | Ga0496107_0156100 | 3300048910 | Bacteria | 1690 |
| 800 | Ga0496107_0204380 | 3300048910 | Bacteria | 1468 |
| 801 | Ga0496107_0314167 | 3300048910 | Bacteria | 1166 |
| 802 | Ga0496108_0031353 | 3300048911 | Bacteria | 4411 |
| 803 | Ga0496108_0595622 | 3300048911 | Bacteria | 963 |
| 804 | Ga0496109_0278429 | 3300048912 | Bacteria | 1577 |
| 805 | Ga0496109_0531654 | 3300048912 | Bacteria | 1109 |
| 806 | Ga0496110_0265779 | 3300048913 | Bacteria | 1562 |
| 807 | Ga0496111_0202197 | 3300048914 | Bacteria | 1477 |
| 808 | Ga0496112_0315805 | 3300048915 | Bacteria | 1507 |
| 809 | Ga0496112_0547925 | 3300048915 | Bacteria | 1091 |
| 810 | Ga0496112_0610918 | 3300048915 | Bacteria | 1022 |
| 811 | Ga0496112_0641627 | 3300048915 | Bacteria | 992 |
| 812 | Ga0496113_0131242 | 3300048916 | Bacteria | 1966 |
| 813 | Ga0496113_0194871 | 3300048916 | Bacteria | 1609 |
| 814 | Ga0496116_0002379 | 3300048919 | Bacteria | 19844 |
| 815 | Ga0496117_0002276 | 3300048920 | Bacteria | 24806 |
| 816 | Ga0496118_0026652 | 3300048921 | Bacteria | 4916 |
| 817 | Ga0496122_0015395 | 3300048925 | Bacteria | 7314 |
| 818 | Ga0496123_0018244 | 3300048926 | Bacteria | 5590 |
| 819 | Ga0496125_0038198 | 3300048928 | Bacteria | 4161 |
| 820 | Ga0495678_033997 | 3300049459 | Bacteria | 2101 |
| 821 | Ga0501298_018491 | 3300049521 | Bacteria | 1282 |
| 822 | Ga0501299_025167 | 3300049522 | Bacteria | 1116 |
| 823 | Ga0501033_0108285 | 3300049570 | Bacteria | 2024 |
| 824 | Ga0501036_0445463 | 3300049572 | Bacteria | 1079 |
| 825 | Ga0501038_0020497 | 3300049574 | Bacteria | 5940 |
| 826 | Ga0501041_0043753 | 3300049577 | Bacteria | 2722 |
| 827 | Ga0501041_0127761 | 3300049577 | Bacteria | 1583 |
| 828 | Ga0501042_0005696 | 3300049578 | Bacteria | 8040 |
| 829 | Ga0501042_0346235 | 3300049578 | Bacteria | 1075 |
| 830 | Ga0501046_0258124 | 3300049580 | Bacteria | 1281 |
| 831 | Ga0501047_0153441 | 3300049581 | Bacteria | 2178 |
| 832 | Ga0501048_0049392 | 3300049582 | Bacteria | 2998 |
| 833 | Ga0501068_0172402 | 3300049584 | Bacteria | 1366 |
| 834 | Ga0501069_0128203 | 3300049585 | Bacteria | 1452 |
| 835 | Ga0501071_0030335 | 3300049587 | Bacteria | 3824 |
| 836 | Ga0501071_0055109 | 3300049587 | Bacteria | 2870 |
| 837 | Ga0501071_0095316 | 3300049587 | Bacteria | 2190 |
| 838 | Ga0501071_0263414 | 3300049587 | Bacteria | 1302 |
| 839 | Ga0501072_0115331 | 3300049588 | Bacteria | 2139 |
| 840 | Ga0501074_0315803 | 3300049590 | Bacteria | 1110 |
| 841 | Ga0501075_0516219 | 3300049591 | Bacteria | 912 |
| 842 | Ga0501076_0054267 | 3300049592 | Bacteria | 3176 |
| 843 | Ga0501076_0120138 | 3300049592 | Bacteria | 2128 |
| 844 | Ga0501076_0558653 | 3300049592 | Bacteria | 944 |
| 845 | Ga0501201_008382 | 3300049651 | Bacteria | 997 |
| 846 | Ga0501202_010222 | 3300049652 | Bacteria | 1738 |
| 847 | Ga0501207_010580 | 3300049654 | Bacteria | 1363 |
| 848 | Ga0501216_009248 | 3300049660 | Bacteria | 1568 |
| 849 | Ga0501217_015028 | 3300049661 | Bacteria | 1757 |
| 850 | Ga0501223_012726 | 3300049663 | Bacteria | 1680 |
| 851 | Ga0501224_006106 | 3300049664 | Bacteria | 1743 |
| 852 | Ga0501233_040704 | 3300049668 | Bacteria | 1091 |
| 853 | Ga0501243_027846 | 3300049675 | Bacteria | 955 |
| 854 | Ga0501247_003827 | 3300049677 | Bacteria | 1628 |
| 855 | Ga0501261_023759 | 3300049690 | Bacteria | 894 |
| 856 | Ga0501221_037169 | 3300049704 | Bacteria | 1047 |
| 857 | Ga0501225_0040627 | 3300049705 | Bacteria | 1282 |
| 858 | Ga0501079_0030984 | 3300049741 | Bacteria | 4110 |
| 859 | Ga0501080_0140288 | 3300049742 | Bacteria | 2235 |
| 860 | Ga0501081_0445458 | 3300049743 | Bacteria | 962 |
| 861 | Ga0501263_000507 | 3300049760 | Bacteria | 2952 |
| 862 | Ga0501273_015469 | 3300049770 | Bacteria | 991 |
| 863 | Ga0501035_0283680 | 3300049822 | Bacteria | 1399 |
| 864 | Ga0501044_0778945 | 3300049823 | Bacteria | 837 |
| 865 | Ga0501045_0018713 | 3300049824 | Bacteria | 4931 |
| 866 | Ga0501045_0351132 | 3300049824 | Bacteria | 1098 |
| 867 | nmdc:mga0k408_23828_c1 | 3300050493 | Bacteria | 2298 |
| 868 | nmdc:mga0k408_260_c1 | 3300050493 | Bacteria | 28863 |
| 869 | nmdc:mga0k408_859_c1 | 3300050493 | Bacteria | 12690 |
| 870 | nmdc:mga05p37_10032_c1 | 3300050507 | Bacteria | 11242 |
| 871 | nmdc:mga05p37_197765_c1 | 3300050507 | Bacteria | 2437 |
| 872 | nmdc:mga05p37_21055_c1 | 3300050507 | Bacteria | 7893 |
| 873 | nmdc:mga05p37_271433_c1 | 3300050507 | Bacteria | 2026 |
| 874 | nmdc:mga05p37_346171_c1 | 3300050507 | Bacteria | 1751 |
| 875 | nmdc:mga05p37_39517_c1 | 3300050507 | Bacteria | 5793 |
| 876 | nmdc:mga09592_1094_c1 | 3300050508 | Bacteria | 21508 |
| 877 | nmdc:mga09592_11444_c1 | 3300050508 | Bacteria | 7216 |
| 878 | nmdc:mga09592_137492_c1 | 3300050508 | Bacteria | 2105 |
| 879 | nmdc:mga09592_207144_c1 | 3300050508 | Bacteria | 1698 |
| 880 | nmdc:mga09592_24524_c1 | 3300050508 | Bacteria | 4988 |
| 881 | nmdc:mga09592_24982_c1 | 3300050508 | Bacteria | 4942 |
| 882 | nmdc:mga09592_397145_c1 | 3300050508 | Bacteria | 1192 |
| 883 | nmdc:mga0qj67_15222_c1 | 3300050509 | Bacteria | 5821 |
| 884 | nmdc:mga0qj67_212774_c1 | 3300050509 | Bacteria | 1570 |
| 885 | nmdc:mga0qj67_45964_c1 | 3300050509 | Bacteria | 3445 |
| 886 | nmdc:mga06r32_2891_c1 | 3300050510 | Bacteria | 15411 |
| 887 | nmdc:mga06r32_78179_c1 | 3300050510 | Bacteria | 3215 |
| 888 | nmdc:mga08y16_178990_c1 | 3300050511 | Bacteria | 2202 |
| 889 | nmdc:mga08y16_28893_c1 | 3300050511 | Bacteria | 5845 |
| 890 | nmdc:mga08y16_296218_c1 | 3300050511 | Bacteria | 1668 |
| 891 | nmdc:mga08y16_487978_c1 | 3300050511 | Bacteria | 1253 |
| 892 | nmdc:mga08y16_58876_c1 | 3300050511 | Bacteria | 4014 |
| 893 | nmdc:mga08y16_76589_c1 | 3300050511 | Bacteria | 3487 |
| 894 | nmdc:mga08y16_821_c1 | 3300050511 | Bacteria | 29792 |
| 895 | nmdc:mga0n895_163892_c1 | 3300050512 | Bacteria | 2254 |
| 896 | nmdc:mga0n895_726655_c1 | 3300050512 | Bacteria | 987 |
| 897 | nmdc:mga0rr50_139_c1 | 3300050513 | Bacteria | 40055 |
| 898 | nmdc:mga0rr50_170349_c1 | 3300050513 | Bacteria | 1774 |
| 899 | nmdc:mga0rr50_4236_c1 | 3300050513 | Bacteria | 8392 |
| 900 | nmdc:mga08x19_3622_c1 | 3300050514 | Bacteria | 9201 |
| 901 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 902 | nmdc:mga0a205_174193_c1 | 3300050515 | Bacteria | 2047 |
| 903 | nmdc:mga0a205_273633_c1 | 3300050515 | Bacteria | 1565 |
| 904 | nmdc:mga0a205_302050_c1 | 3300050515 | Bacteria | 1474 |
| 905 | nmdc:mga0a205_63177_c1 | 3300050515 | Bacteria | 3577 |
| 906 | nmdc:mga0a205_7292_c1 | 3300050515 | Bacteria | 10004 |
| 907 | nmdc:mga0a205_88196_c1 | 3300050515 | Bacteria | 2998 |
| 908 | Ga0495601_0153090 | 3300053077 | Bacteria | 1506 |
| 909 | Ga0500635_0001015 | 3300053080 | Bacteria | 6718 |
| 910 | Ga0500555_000471 | 3300053103 | Bacteria | 16699 |
| 911 | Ga0500608_000203 | 3300053122 | Bacteria | 23751 |
| 912 | Ga0500608_007068 | 3300053122 | Bacteria | 4615 |
| 913 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 914 | Ga0500618_008815 | 3300053125 | Bacteria | 2788 |
| 915 | Ga0500622_0001600 | 3300053156 | Bacteria | 17790 |
| 916 | Ga0500624_000694 | 3300053157 | Bacteria | 8505 |
| 917 | Ga0590074_040918 | 3300059423 | Bacteria | 834 |
| 918 | Ga0587085_028233 | 3300059506 | Bacteria | 905 |
| 919 | Ga0501082_0623385 | 3300060353 | Bacteria | 944 |
| 920 | Ga0530510_0029172 | 3300061734 | Bacteria | 3959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025904 | Ga0207647_10150889 | Ga0207647_101508892 | 222 |
| 2 | 3300046507 | Ga0495606_0016540 | Ga0495606_0016540_2990_3709 | 223 |
| 3 | 3300002459 | JGI24751J29686_10054973 | JGI24751J29686_100549731 | 224 |
| 4 | 3300005288 | Ga0065714_10148595 | Ga0065714_101485952 | 224 |
| 5 | 3300005290 | Ga0065712_10089641 | Ga0065712_100896412 | 224 |
| 6 | 3300005293 | Ga0065715_10343798 | Ga0065715_103437981 | 224 |
| 7 | 3300005330 | Ga0070690_100054471 | Ga0070690_1000544712 | 224 |
| 8 | 3300005331 | Ga0070670_100000767 | Ga0070670_1000007676 | 224 |
| 9 | 3300005340 | Ga0070689_100023397 | Ga0070689_1000233974 | 224 |
| 10 | 3300005344 | Ga0070661_100050498 | Ga0070661_1000504982 | 224 |
| 11 | 3300005354 | Ga0070675_100047495 | Ga0070675_1000474953 | 224 |
| 12 | 3300005365 | Ga0070688_100009040 | Ga0070688_1000090404 | 224 |
| 13 | 3300005468 | Ga0070707_100768365 | Ga0070707_1007683651 | 224 |
| 14 | 3300005543 | Ga0070672_100019003 | Ga0070672_1000190032 | 224 |
| 15 | 3300005564 | Ga0070664_100004294 | Ga0070664_1000042942 | 224 |
| 16 | 3300005564 | Ga0070664_100025146 | Ga0070664_1000251463 | 224 |
| 17 | 3300005618 | Ga0068864_100106485 | Ga0068864_1001064852 | 224 |
| 18 | 3300006880 | Ga0075429_100092571 | Ga0075429_1000925712 | 224 |
| 19 | 3300009147 | Ga0114129_10654159 | Ga0114129_106541592 | 224 |
| 20 | 3300014325 | Ga0163163_10018317 | Ga0163163_100183172 | 224 |
| 21 | 3300025920 | Ga0207649_10034440 | Ga0207649_100344403 | 224 |
| 22 | 3300025925 | Ga0207650_10002299 | Ga0207650_100022996 | 224 |
| 23 | 3300025926 | Ga0207659_10013295 | Ga0207659_100132952 | 224 |
| 24 | 3300025931 | Ga0207644_10073528 | Ga0207644_100735282 | 224 |
| 25 | 3300025936 | Ga0207670_10035418 | Ga0207670_100354182 | 224 |
| 26 | 3300025940 | Ga0207691_10005500 | Ga0207691_100055005 | 224 |
| 27 | 3300025945 | Ga0207679_10001977 | Ga0207679_100019778 | 224 |
| 28 | 3300025945 | Ga0207679_10025207 | Ga0207679_100252073 | 224 |
| 29 | 3300026075 | Ga0207708_10664032 | Ga0207708_106640322 | 224 |
| 30 | 3300026095 | Ga0207676_10090487 | Ga0207676_100904873 | 224 |
| 31 | 3300031548 | Ga0307408_100149571 | Ga0307408_1001495712 | 224 |
| 32 | 3300031731 | Ga0307405_10001983 | Ga0307405_100019833 | 224 |
| 33 | 3300031824 | Ga0307413_10036294 | Ga0307413_100362942 | 224 |
| 34 | 3300031852 | Ga0307410_10002169 | Ga0307410_100021697 | 224 |
| 35 | 3300031852 | Ga0307410_10390195 | Ga0307410_103901951 | 224 |
| 36 | 3300031901 | Ga0307406_10091712 | Ga0307406_100917122 | 224 |
| 37 | 3300031911 | Ga0307412_10045347 | Ga0307412_100453473 | 224 |
| 38 | 3300031911 | Ga0307412_10284247 | Ga0307412_102842472 | 224 |
| 39 | 3300031995 | Ga0307409_100007363 | Ga0307409_1000073634 | 224 |
| 40 | 3300032002 | Ga0307416_100001756 | Ga0307416_1000017562 | 224 |
| 41 | 3300032002 | Ga0307416_100042843 | Ga0307416_1000428434 | 224 |
| 42 | 3300032005 | Ga0307411_10000610 | Ga0307411_1000061013 | 224 |
| 43 | 3300032126 | Ga0307415_100405665 | Ga0307415_1004056652 | 224 |
| 44 | 3300046459 | Ga0495629_0126159 | Ga0495629_0126159_694_1395 | 224 |
| 45 | 3300046531 | Ga0495665_0052354 | Ga0495665_0052354_1043_1744 | 224 |
| 46 | 3300046558 | Ga0495633_0015320 | Ga0495633_0015320_87_791 | 224 |
| 47 | 3300046681 | Ga0495647_0005287 | Ga0495647_0005287_3441_4142 | 224 |
| 48 | 3300046681 | Ga0495647_0023171 | Ga0495647_0023171_156_860 | 224 |
| 49 | 3300046683 | Ga0495658_0075837 | Ga0495658_0075837_1038_1742 | 224 |
| 50 | 3300046683 | Ga0495658_0191774 | Ga0495658_0191774_429_1130 | 224 |
| 51 | 3300046691 | Ga0495670_0061831 | Ga0495670_0061831_319_1023 | 224 |
| 52 | 3300048088 | Ga0495602_0001510 | Ga0495602_0001510_4172_4870 | 224 |
| 53 | 3300049572 | Ga0501036_0445463 | Ga0501036_0445463_356_1057 | 224 |
| 54 | 3300049587 | Ga0501071_0095316 | Ga0501071_0095316_1412_2113 | 224 |
| 55 | 3300049741 | Ga0501079_0030984 | Ga0501079_0030984_1269_1970 | 224 |
| 56 | 3300049743 | Ga0501081_0445458 | Ga0501081_0445458_35_745 | 224 |
| 57 | 3300050508 | nmdc:mga09592_137492_c1 | nmdc:mga09592_137492_c1_1277_1981 | 224 |
| 58 | 3300005334 | Ga0068869_100080076 | Ga0068869_1000800762 | 225 |
| 59 | 3300005336 | Ga0070680_100302537 | Ga0070680_1003025372 | 225 |
| 60 | 3300005336 | Ga0070680_100458117 | Ga0070680_1004581172 | 225 |
| 61 | 3300005340 | Ga0070689_100779276 | Ga0070689_1007792761 | 225 |
| 62 | 3300005341 | Ga0070691_10113953 | Ga0070691_101139532 | 225 |
| 63 | 3300005341 | Ga0070691_10313527 | Ga0070691_103135272 | 225 |
| 64 | 3300005345 | Ga0070692_10031317 | Ga0070692_100313172 | 225 |
| 65 | 3300005438 | Ga0070701_10026549 | Ga0070701_100265492 | 225 |
| 66 | 3300005441 | Ga0070700_100118473 | Ga0070700_1001184732 | 225 |
| 67 | 3300005444 | Ga0070694_100029319 | Ga0070694_1000293192 | 225 |
| 68 | 3300005444 | Ga0070694_100359661 | Ga0070694_1003596611 | 225 |
| 69 | 3300005444 | Ga0070694_100696880 | Ga0070694_1006968801 | 225 |
| 70 | 3300005459 | Ga0068867_100512828 | Ga0068867_1005128282 | 225 |
| 71 | 3300005545 | Ga0070695_100174986 | Ga0070695_1001749862 | 225 |
| 72 | 3300005549 | Ga0070704_100098350 | Ga0070704_1000983502 | 225 |
| 73 | 3300005617 | Ga0068859_100169538 | Ga0068859_1001695382 | 225 |
| 74 | 3300005719 | Ga0068861_100126572 | Ga0068861_1001265722 | 225 |
| 75 | 3300005844 | Ga0068862_100033821 | Ga0068862_1000338214 | 225 |
| 76 | 3300005937 | Ga0081455_10422222 | Ga0081455_104222222 | 225 |
| 77 | 3300006846 | Ga0075430_100066766 | Ga0075430_1000667663 | 225 |
| 78 | 3300006871 | Ga0075434_100000831 | Ga0075434_1000008313 | 225 |
| 79 | 3300006871 | Ga0075434_100706617 | Ga0075434_1007066171 | 225 |
| 80 | 3300006880 | Ga0075429_100031368 | Ga0075429_1000313686 | 225 |
| 81 | 3300006881 | Ga0068865_100071929 | Ga0068865_1000719292 | 225 |
| 82 | 3300006931 | Ga0097620_100169531 | Ga0097620_1001695312 | 225 |
| 83 | 3300009148 | Ga0105243_10133231 | Ga0105243_101332312 | 225 |
| 84 | 3300014326 | Ga0157380_11116714 | Ga0157380_111167141 | 225 |
| 85 | 3300025911 | Ga0207654_10425683 | Ga0207654_104256831 | 225 |
| 86 | 3300025917 | Ga0207660_10032391 | Ga0207660_100323913 | 225 |
| 87 | 3300025917 | Ga0207660_10119374 | Ga0207660_101193742 | 225 |
| 88 | 3300025938 | Ga0207704_10101785 | Ga0207704_101017852 | 225 |
| 89 | 3300025942 | Ga0207689_10066062 | Ga0207689_100660622 | 225 |
| 90 | 3300026075 | Ga0207708_10039998 | Ga0207708_100399982 | 225 |
| 91 | 3300026075 | Ga0207708_10184541 | Ga0207708_101845411 | 225 |
| 92 | 3300026089 | Ga0207648_10317344 | Ga0207648_103173441 | 225 |
| 93 | 3300026116 | Ga0207674_10145605 | Ga0207674_101456052 | 225 |
| 94 | 3300026118 | Ga0207675_100184473 | Ga0207675_1001844732 | 225 |
| 95 | 3300026118 | Ga0207675_100484499 | Ga0207675_1004844992 | 225 |
| 96 | 3300028380 | Ga0268265_10018602 | Ga0268265_100186022 | 225 |
| 97 | 3300031824 | Ga0307413_10001627 | Ga0307413_100016273 | 225 |
| 98 | 3300031995 | Ga0307409_100817175 | Ga0307409_1008171752 | 225 |
| 99 | 3300046664 | Ga0495659_0016122 | Ga0495659_0016122_831_1544 | 225 |
| 100 | 3300049588 | Ga0501072_0115331 | Ga0501072_0115331_874_1575 | 225 |
| 101 | 3300049590 | Ga0501074_0315803 | Ga0501074_0315803_219_920 | 225 |
| 102 | 3300049591 | Ga0501075_0516219 | Ga0501075_0516219_177_878 | 225 |
| 103 | 3300050509 | nmdc:mga0qj67_45964_c1 | nmdc:mga0qj67_45964_c1_558_1259 | 225 |
| 104 | 3300050511 | nmdc:mga08y16_296218_c1 | nmdc:mga08y16_296218_c1_748_1449 | 225 |
| 105 | 3300050515 | nmdc:mga0a205_63177_c1 | nmdc:mga0a205_63177_c1_1773_2486 | 225 |
| 106 | iso_pu_bacteria | 2738541284 | 2738762616 | 225 |
| 107 | iso_pu_bacteria | 2842903701 | 2842906507 | 225 |
| 108 | 3300005295 | Ga0065707_10322946 | Ga0065707_103229461 | 226 |
| 109 | 3300005334 | Ga0068869_100165587 | Ga0068869_1001655872 | 226 |
| 110 | 3300005340 | Ga0070689_100000816 | Ga0070689_1000008165 | 226 |
| 111 | 3300005353 | Ga0070669_100011817 | Ga0070669_1000118173 | 226 |
| 112 | 3300005365 | Ga0070688_100000427 | Ga0070688_1000004275 | 226 |
| 113 | 3300005444 | Ga0070694_100005028 | Ga0070694_1000050286 | 226 |
| 114 | 3300005467 | Ga0070706_100037115 | Ga0070706_1000371151 | 226 |
| 115 | 3300005536 | Ga0070697_100101472 | Ga0070697_1001014722 | 226 |
| 116 | 3300005549 | Ga0070704_100031410 | Ga0070704_1000314102 | 226 |
| 117 | 3300005843 | Ga0068860_100027839 | Ga0068860_1000278394 | 226 |
| 118 | 3300005844 | Ga0068862_100038785 | Ga0068862_1000387853 | 226 |
| 119 | 3300006852 | Ga0075433_10015116 | Ga0075433_100151165 | 226 |
| 120 | 3300006852 | Ga0075433_10282341 | Ga0075433_102823412 | 226 |
| 121 | 3300006871 | Ga0075434_100010744 | Ga0075434_1000107442 | 226 |
| 122 | 3300006880 | Ga0075429_100011725 | Ga0075429_1000117256 | 226 |
| 123 | 3300006914 | Ga0075436_100389832 | Ga0075436_1003898322 | 226 |
| 124 | 3300007076 | Ga0075435_100095774 | Ga0075435_1000957742 | 226 |
| 125 | 3300009098 | Ga0105245_10607140 | Ga0105245_106071401 | 226 |
| 126 | 3300009147 | Ga0114129_10007783 | Ga0114129_1000778314 | 226 |
| 127 | 3300009147 | Ga0114129_10018669 | Ga0114129_100186693 | 226 |
| 128 | 3300009176 | Ga0105242_10256131 | Ga0105242_102561312 | 226 |
| 129 | 3300009553 | Ga0105249_10013986 | Ga0105249_100139869 | 226 |
| 130 | 3300013297 | Ga0157378_10039044 | Ga0157378_100390444 | 226 |
| 131 | 3300013306 | Ga0163162_10033657 | Ga0163162_100336575 | 226 |
| 132 | 3300014968 | Ga0157379_10047882 | Ga0157379_100478823 | 226 |
| 133 | 3300025910 | Ga0207684_10007514 | Ga0207684_100075148 | 226 |
| 134 | 3300025922 | Ga0207646_10026415 | Ga0207646_100264154 | 226 |
| 135 | 3300025931 | Ga0207644_10425065 | Ga0207644_104250652 | 226 |
| 136 | 3300025936 | Ga0207670_10000065 | Ga0207670_1000006556 | 226 |
| 137 | 3300025940 | Ga0207691_10056180 | Ga0207691_100561802 | 226 |
| 138 | 3300025960 | Ga0207651_10042500 | Ga0207651_100425002 | 226 |
| 139 | 3300025972 | Ga0207668_10338072 | Ga0207668_103380721 | 226 |
| 140 | 3300025986 | Ga0207658_10234206 | Ga0207658_102342062 | 226 |
| 141 | 3300026067 | Ga0207678_10021588 | Ga0207678_100215883 | 226 |
| 142 | 3300026088 | Ga0207641_10669928 | Ga0207641_106699282 | 226 |
| 143 | 3300027876 | Ga0209974_10003508 | Ga0209974_100035083 | 226 |
| 144 | 3300028380 | Ga0268265_10026095 | Ga0268265_100260953 | 226 |
| 145 | 3300031249 | Ga0265339_10084041 | Ga0265339_100840412 | 226 |
| 146 | 3300031250 | Ga0265331_10075889 | Ga0265331_100758892 | 226 |
| 147 | 3300031344 | Ga0265316_10220112 | Ga0265316_102201122 | 226 |
| 148 | 3300035242 | Ga0373962_0030121 | Ga0373962_0030121_118_837 | 226 |
| 149 | 3300042461 | Ga0439460_0036907 | Ga0439460_0036907_543_1244 | 226 |
| 150 | 3300045051 | Ga0451576_0046399 | Ga0451576_0046399_3672_4391 | 226 |
| 151 | 3300045976 | Ga0466967_0097786 | Ga0466967_0097786_1542_2252 | 226 |
| 152 | 3300048905 | Ga0496102_0042442 | Ga0496102_0042442_3368_4087 | 226 |
| 153 | 3300048910 | Ga0496107_0156100 | Ga0496107_0156100_459_1178 | 226 |
| 154 | 3300049578 | Ga0501042_0346235 | Ga0501042_0346235_181_936 | 226 |
| 155 | 3300049584 | Ga0501068_0172402 | Ga0501068_0172402_239_973 | 226 |
| 156 | 3300049585 | Ga0501069_0128203 | Ga0501069_0128203_581_1291 | 226 |
| 157 | 3300050507 | nmdc:mga05p37_39517_c1 | nmdc:mga05p37_39517_c1_3142_3855 | 226 |
| 158 | 3300050511 | nmdc:mga08y16_178990_c1 | nmdc:mga08y16_178990_c1_767_1501 | 226 |
| 159 | 3300050511 | nmdc:mga08y16_487978_c1 | nmdc:mga08y16_487978_c1_167_892 | 226 |
| 160 | 3300050512 | nmdc:mga0n895_726655_c1 | nmdc:mga0n895_726655_c1_110_829 | 226 |
| 161 | 3300050515 | nmdc:mga0a205_273633_c1 | nmdc:mga0a205_273633_c1_199_918 | 226 |
| 162 | 3300050515 | nmdc:mga0a205_7292_c1 | nmdc:mga0a205_7292_c1_5510_6223 | 226 |
| 163 | 3300060353 | Ga0501082_0623385 | Ga0501082_0623385_153_908 | 226 |
| 164 | iso_pu_bacteria | 2721755487 | 2722726500 | 226 |
| 165 | iso_pu_bacteria | 2896317667 | 2896319414 | 226 |
| 166 | iso_pu_bacteria | 2904780799 | 2904783635 | 226 |
| 167 | iso_pu_bacteria | 2919177583 | 2919182186 | 226 |
| 168 | iso_pu_bacteria | 3003233435 | 3003233521 | 226 |
| 169 | iso_pu_bacteria | 8055588893 | 8055590801 | 226 |
| 170 | 3300005290 | Ga0065712_10204759 | Ga0065712_102047592 | 227 |
| 171 | 3300005293 | Ga0065715_10443342 | Ga0065715_104433421 | 227 |
| 172 | 3300005353 | Ga0070669_100324176 | Ga0070669_1003241762 | 227 |
| 173 | 3300005355 | Ga0070671_100208803 | Ga0070671_1002088032 | 227 |
| 174 | 3300005441 | Ga0070700_100199413 | Ga0070700_1001994131 | 227 |
| 175 | 3300005467 | Ga0070706_100049046 | Ga0070706_1000490463 | 227 |
| 176 | 3300005536 | Ga0070697_100213432 | Ga0070697_1002134322 | 227 |
| 177 | 3300005546 | Ga0070696_100008944 | Ga0070696_1000089445 | 227 |
| 178 | 3300005564 | Ga0070664_100461099 | Ga0070664_1004610992 | 227 |
| 179 | 3300005841 | Ga0068863_100210158 | Ga0068863_1002101582 | 227 |
| 180 | 3300006846 | Ga0075430_100088661 | Ga0075430_1000886612 | 227 |
| 181 | 3300006852 | Ga0075433_10366468 | Ga0075433_103664682 | 227 |
| 182 | 3300006931 | Ga0097620_100011064 | Ga0097620_1000110643 | 227 |
| 183 | 3300007076 | Ga0075435_100032986 | Ga0075435_1000329864 | 227 |
| 184 | 3300009147 | Ga0114129_10843987 | Ga0114129_108439872 | 227 |
| 185 | 3300009551 | Ga0105238_11076560 | Ga0105238_110765601 | 227 |
| 186 | 3300013306 | Ga0163162_10110885 | Ga0163162_101108852 | 227 |
| 187 | 3300025910 | Ga0207684_10121834 | Ga0207684_101218342 | 227 |
| 188 | 3300025923 | Ga0207681_10264841 | Ga0207681_102648412 | 227 |
| 189 | 3300025931 | Ga0207644_10096507 | Ga0207644_100965072 | 227 |
| 190 | 3300025942 | Ga0207689_10380763 | Ga0207689_103807631 | 227 |
| 191 | 3300025945 | Ga0207679_10547559 | Ga0207679_105475591 | 227 |
| 192 | 3300025961 | Ga0207712_10476213 | Ga0207712_104762132 | 227 |
| 193 | 3300026088 | Ga0207641_10175600 | Ga0207641_101756002 | 227 |
| 194 | 3300027907 | Ga0207428_10001623 | Ga0207428_100016232 | 227 |
| 195 | 3300031548 | Ga0307408_100016223 | Ga0307408_1000162234 | 227 |
| 196 | 3300036401 | Ga0373937_0273069 | Ga0373937_0273069_522_1229 | 227 |
| 197 | 3300036401 | Ga0373937_0498038 | Ga0373937_0498038_402_1103 | 227 |
| 198 | 3300042439 | Ga0439464_0003170 | Ga0439464_0003170_583_1293 | 227 |
| 199 | 3300045051 | Ga0451576_0005569 | Ga0451576_0005569_6600_7316 | 227 |
| 200 | 3300045051 | Ga0451576_0023567 | Ga0451576_0023567_2235_2951 | 227 |
| 201 | 3300046455 | Ga0495603_0042271 | Ga0495603_0042271_1071_1796 | 227 |
| 202 | 3300046472 | Ga0495580_0378928 | Ga0495580_0378928_51_776 | 227 |
| 203 | 3300046477 | Ga0495664_0059927 | Ga0495664_0059927_639_1346 | 227 |
| 204 | 3300046491 | Ga0495584_0088190 | Ga0495584_0088190_353_1063 | 227 |
| 205 | 3300046528 | Ga0495642_0034662 | Ga0495642_0034662_1126_1836 | 227 |
| 206 | 3300046538 | Ga0495609_0052156 | Ga0495609_0052156_169_879 | 227 |
| 207 | 3300046664 | Ga0495659_0068983 | Ga0495659_0068983_187_897 | 227 |
| 208 | 3300046683 | Ga0495658_0163109 | Ga0495658_0163109_617_1324 | 227 |
| 209 | 3300046684 | Ga0495669_0010075 | Ga0495669_0010075_2336_3046 | 227 |
| 210 | 3300047321 | Ga0495676_0248657 | Ga0495676_0248657_327_1052 | 227 |
| 211 | 3300047322 | Ga0495680_0339732 | Ga0495680_0339732_150_857 | 227 |
| 212 | 3300049522 | Ga0501299_025167 | Ga0501299_025167_245_955 | 227 |
| 213 | 3300049577 | Ga0501041_0043753 | Ga0501041_0043753_1949_2656 | 227 |
| 214 | 3300049587 | Ga0501071_0055109 | Ga0501071_0055109_466_1173 | 227 |
| 215 | 3300049592 | Ga0501076_0054267 | Ga0501076_0054267_1771_2478 | 227 |
| 216 | 3300049668 | Ga0501233_040704 | Ga0501233_040704_344_1054 | 227 |
| 217 | 3300049690 | Ga0501261_023759 | Ga0501261_023759_141_851 | 227 |
| 218 | 3300049742 | Ga0501080_0140288 | Ga0501080_0140288_437_1144 | 227 |
| 219 | 3300049770 | Ga0501273_015469 | Ga0501273_015469_53_763 | 227 |
| 220 | 3300049824 | Ga0501045_0018713 | Ga0501045_0018713_618_1325 | 227 |
| 221 | 3300050507 | nmdc:mga05p37_10032_c1 | nmdc:mga05p37_10032_c1_710_1420 | 227 |
| 222 | 3300050507 | nmdc:mga05p37_197765_c1 | nmdc:mga05p37_197765_c1_1680_2399 | 227 |
| 223 | 3300050507 | nmdc:mga05p37_271433_c1 | nmdc:mga05p37_271433_c1_1212_1913 | 227 |
| 224 | 3300050508 | nmdc:mga09592_1094_c1 | nmdc:mga09592_1094_c1_3591_4301 | 227 |
| 225 | 3300050509 | nmdc:mga0qj67_15222_c1 | nmdc:mga0qj67_15222_c1_2725_3435 | 227 |
| 226 | 3300050510 | nmdc:mga06r32_2891_c1 | nmdc:mga06r32_2891_c1_343_1053 | 227 |
| 227 | 3300050511 | nmdc:mga08y16_821_c1 | nmdc:mga08y16_821_c1_16941_17651 | 227 |
| 228 | 3300050513 | nmdc:mga0rr50_170349_c1 | nmdc:mga0rr50_170349_c1_230_949 | 227 |
| 229 | 3300050515 | nmdc:mga0a205_302050_c1 | nmdc:mga0a205_302050_c1_158_877 | 227 |
| 230 | 3300053077 | Ga0495601_0153090 | Ga0495601_0153090_245_952 | 227 |
| 231 | 3300059423 | Ga0590074_040918 | Ga0590074_040918_19_717 | 227 |
| 232 | 3300001915 | JGI24741J21665_1012612 | JGI24741J21665_10126122 | 228 |
| 233 | 3300001979 | JGI24740J21852_10016887 | JGI24740J21852_100168872 | 228 |
| 234 | 3300002077 | JGI24744J21845_10002026 | JGI24744J21845_100020263 | 228 |
| 235 | 3300002737 | JGI25162J39368_1000498 | JGI25162J39368_100049815 | 228 |
| 236 | 3300002741 | JGI25157J39369_1005927 | JGI25157J39369_10059272 | 228 |
| 237 | 3300003214 | JGI25165J46597_1000618 | JGI25165J46597_100061813 | 228 |
| 238 | 3300003320 | rootH2_10018591 | rootH2_1001859114 | 228 |
| 239 | 3300003320 | rootH2_10039562 | rootH2_100395622 | 228 |
| 240 | 3300003320 | rootH2_10186211 | rootH2_101862112 | 228 |
| 241 | 3300003323 | rootH1_10010194 | rootH1_1001019418 | 228 |
| 242 | 3300003323 | rootH1_10105642 | rootH1_101056421 | 228 |
| 243 | 3300003323 | rootH1_10379396 | rootH1_103793961 | 228 |
| 244 | 3300004799 | Ga0058863_11791471 | Ga0058863_117914712 | 228 |
| 245 | 3300004800 | Ga0058861_11760232 | Ga0058861_117602321 | 228 |
| 246 | 3300004803 | Ga0058862_12416007 | Ga0058862_124160072 | 228 |
| 247 | 3300005327 | Ga0070658_10000018 | Ga0070658_10000018120 | 228 |
| 248 | 3300005327 | Ga0070658_10080753 | Ga0070658_100807535 | 228 |
| 249 | 3300005327 | Ga0070658_10338790 | Ga0070658_103387902 | 228 |
| 250 | 3300005327 | Ga0070658_10563895 | Ga0070658_105638951 | 228 |
| 251 | 3300005328 | Ga0070676_10004488 | Ga0070676_100044882 | 228 |
| 252 | 3300005338 | Ga0068868_100013908 | Ga0068868_1000139085 | 228 |
| 253 | 3300005339 | Ga0070660_100091736 | Ga0070660_1000917363 | 228 |
| 254 | 3300005355 | Ga0070671_100027615 | Ga0070671_1000276155 | 228 |
| 255 | 3300005364 | Ga0070673_100008881 | Ga0070673_1000088813 | 228 |
| 256 | 3300005366 | Ga0070659_100018374 | Ga0070659_1000183746 | 228 |
| 257 | 3300005366 | Ga0070659_100026796 | Ga0070659_1000267964 | 228 |
| 258 | 3300005456 | Ga0070678_100018207 | Ga0070678_1000182076 | 228 |
| 259 | 3300005457 | Ga0070662_100000626 | Ga0070662_1000006269 | 228 |
| 260 | 3300005458 | Ga0070681_10022542 | Ga0070681_100225425 | 228 |
| 261 | 3300005459 | Ga0068867_100016777 | Ga0068867_1000167772 | 228 |
| 262 | 3300005530 | Ga0070679_100008363 | Ga0070679_1000083634 | 228 |
| 263 | 3300005539 | Ga0068853_100019819 | Ga0068853_1000198198 | 228 |
| 264 | 3300005548 | Ga0070665_100000072 | Ga0070665_10000007279 | 228 |
| 265 | 3300005563 | Ga0068855_100000070 | Ga0068855_10000007067 | 228 |
| 266 | 3300005563 | Ga0068855_100000268 | Ga0068855_1000002687 | 228 |
| 267 | 3300005563 | Ga0068855_100012445 | Ga0068855_10001244510 | 228 |
| 268 | 3300005563 | Ga0068855_100063242 | Ga0068855_1000632424 | 228 |
| 269 | 3300005563 | Ga0068855_100416203 | Ga0068855_1004162032 | 228 |
| 270 | 3300005614 | Ga0068856_100000897 | Ga0068856_10000089732 | 228 |
| 271 | 3300005614 | Ga0068856_100003887 | Ga0068856_10000388712 | 228 |
| 272 | 3300005614 | Ga0068856_100009016 | Ga0068856_1000090162 | 228 |
| 273 | 3300005614 | Ga0068856_100013111 | Ga0068856_1000131114 | 228 |
| 274 | 3300005614 | Ga0068856_100194332 | Ga0068856_1001943322 | 228 |
| 275 | 3300005616 | Ga0068852_100017595 | Ga0068852_1000175953 | 228 |
| 276 | 3300005718 | Ga0068866_10017052 | Ga0068866_100170522 | 228 |
| 277 | 3300005842 | Ga0068858_100269722 | Ga0068858_1002697222 | 228 |
| 278 | 3300006195 | Ga0075366_10001711 | Ga0075366_100017117 | 228 |
| 279 | 3300006237 | Ga0097621_100000028 | Ga0097621_1000000283 | 228 |
| 280 | 3300006358 | Ga0068871_100006906 | Ga0068871_10000690610 | 228 |
| 281 | 3300006881 | Ga0068865_100000127 | Ga0068865_10000012719 | 228 |
| 282 | 3300009093 | Ga0105240_10000237 | Ga0105240_1000023716 | 228 |
| 283 | 3300009093 | Ga0105240_10014965 | Ga0105240_100149652 | 228 |
| 284 | 3300009093 | Ga0105240_10020594 | Ga0105240_100205944 | 228 |
| 285 | 3300009093 | Ga0105240_10048025 | Ga0105240_100480255 | 228 |
| 286 | 3300009093 | Ga0105240_10187598 | Ga0105240_101875984 | 228 |
| 287 | 3300009093 | Ga0105240_10227132 | Ga0105240_102271324 | 228 |
| 288 | 3300009174 | Ga0105241_10535967 | Ga0105241_105359672 | 228 |
| 289 | 3300009176 | Ga0105242_10029494 | Ga0105242_100294941 | 228 |
| 290 | 3300009545 | Ga0105237_10000224 | Ga0105237_1000022444 | 228 |
| 291 | 3300009545 | Ga0105237_10000485 | Ga0105237_1000048540 | 228 |
| 292 | 3300009545 | Ga0105237_10037976 | Ga0105237_100379763 | 228 |
| 293 | 3300009545 | Ga0105237_10041051 | Ga0105237_100410512 | 228 |
| 294 | 3300009545 | Ga0105237_10385476 | Ga0105237_103854762 | 228 |
| 295 | 3300009545 | Ga0105237_10411591 | Ga0105237_104115912 | 228 |
| 296 | 3300009551 | Ga0105238_10133400 | Ga0105238_101334003 | 228 |
| 297 | 3300009553 | Ga0105249_10237828 | Ga0105249_102378282 | 228 |
| 298 | 3300010375 | Ga0105239_10000039 | Ga0105239_10000039154 | 228 |
| 299 | 3300010375 | Ga0105239_10000120 | Ga0105239_1000012073 | 228 |
| 300 | 3300010375 | Ga0105239_10004436 | Ga0105239_1000443612 | 228 |
| 301 | 3300010375 | Ga0105239_10013753 | Ga0105239_100137538 | 228 |
| 302 | 3300010375 | Ga0105239_10023687 | Ga0105239_100236876 | 228 |
| 303 | 3300010375 | Ga0105239_10025250 | Ga0105239_100252504 | 228 |
| 304 | 3300010375 | Ga0105239_10826509 | Ga0105239_108265092 | 228 |
| 305 | 3300011119 | Ga0105246_10172179 | Ga0105246_101721792 | 228 |
| 306 | 3300013100 | Ga0157373_10000208 | Ga0157373_1000020824 | 228 |
| 307 | 3300013100 | Ga0157373_10076454 | Ga0157373_100764542 | 228 |
| 308 | 3300013102 | Ga0157371_10000263 | Ga0157371_1000026322 | 228 |
| 309 | 3300013104 | Ga0157370_10095584 | Ga0157370_100955843 | 228 |
| 310 | 3300013105 | Ga0157369_10617552 | Ga0157369_106175522 | 228 |
| 311 | 3300013296 | Ga0157374_10001845 | Ga0157374_1000184518 | 228 |
| 312 | 3300013296 | Ga0157374_10044113 | Ga0157374_100441131 | 228 |
| 313 | 3300013296 | Ga0157374_10155428 | Ga0157374_101554283 | 228 |
| 314 | 3300013297 | Ga0157378_10043262 | Ga0157378_100432623 | 228 |
| 315 | 3300013306 | Ga0163162_10000010 | Ga0163162_1000001048 | 228 |
| 316 | 3300013306 | Ga0163162_10064255 | Ga0163162_100642551 | 228 |
| 317 | 3300013307 | Ga0157372_10000050 | Ga0157372_10000050114 | 228 |
| 318 | 3300013307 | Ga0157372_10000635 | Ga0157372_1000063539 | 228 |
| 319 | 3300013307 | Ga0157372_10001419 | Ga0157372_1000141913 | 228 |
| 320 | 3300013307 | Ga0157372_10189979 | Ga0157372_101899792 | 228 |
| 321 | 3300013307 | Ga0157372_10403929 | Ga0157372_104039291 | 228 |
| 322 | 3300013308 | Ga0157375_10021385 | Ga0157375_100213853 | 228 |
| 323 | 3300025231 | Ga0207427_100172 | Ga0207427_10017278 | 228 |
| 324 | 3300025233 | Ga0209437_100034 | Ga0209437_100034183 | 228 |
| 325 | 3300025250 | Ga0209026_1000728 | Ga0209026_10007282 | 228 |
| 326 | 3300025250 | Ga0209026_1003634 | Ga0209026_10036343 | 228 |
| 327 | 3300025250 | Ga0209026_1015127 | Ga0209026_10151271 | 228 |
| 328 | 3300025254 | Ga0209148_1017175 | Ga0209148_10171751 | 228 |
| 329 | 3300025261 | Ga0209233_1000038 | Ga0209233_1000038183 | 228 |
| 330 | 3300025261 | Ga0209233_1001428 | Ga0209233_10014281 | 228 |
| 331 | 3300025261 | Ga0209233_1013109 | Ga0209233_10131093 | 228 |
| 332 | 3300025261 | Ga0209233_1019675 | Ga0209233_10196752 | 228 |
| 333 | 3300025272 | Ga0209455_1000861 | Ga0209455_100086112 | 228 |
| 334 | 3300025904 | Ga0207647_10000076 | Ga0207647_100000767 | 228 |
| 335 | 3300025907 | Ga0207645_10017477 | Ga0207645_100174773 | 228 |
| 336 | 3300025909 | Ga0207705_10000036 | Ga0207705_1000003675 | 228 |
| 337 | 3300025911 | Ga0207654_10118633 | Ga0207654_101186332 | 228 |
| 338 | 3300025912 | Ga0207707_10030350 | Ga0207707_100303504 | 228 |
| 339 | 3300025913 | Ga0207695_10000013 | Ga0207695_1000001317 | 228 |
| 340 | 3300025913 | Ga0207695_10004656 | Ga0207695_1000465615 | 228 |
| 341 | 3300025913 | Ga0207695_10016549 | Ga0207695_1001654911 | 228 |
| 342 | 3300025913 | Ga0207695_10033191 | Ga0207695_100331916 | 228 |
| 343 | 3300025913 | Ga0207695_10318305 | Ga0207695_103183053 | 228 |
| 344 | 3300025914 | Ga0207671_10002707 | Ga0207671_1000270715 | 228 |
| 345 | 3300025914 | Ga0207671_10011316 | Ga0207671_100113161 | 228 |
| 346 | 3300025914 | Ga0207671_10037577 | Ga0207671_100375772 | 228 |
| 347 | 3300025919 | Ga0207657_10020956 | Ga0207657_100209563 | 228 |
| 348 | 3300025924 | Ga0207694_10146670 | Ga0207694_101466703 | 228 |
| 349 | 3300025931 | Ga0207644_10062324 | Ga0207644_100623245 | 228 |
| 350 | 3300025932 | Ga0207690_10011536 | Ga0207690_100115364 | 228 |
| 351 | 3300025932 | Ga0207690_10015769 | Ga0207690_100157694 | 228 |
| 352 | 3300025933 | Ga0207706_10006487 | Ga0207706_100064878 | 228 |
| 353 | 3300025938 | Ga0207704_10000044 | Ga0207704_1000004436 | 228 |
| 354 | 3300025949 | Ga0207667_10000009 | Ga0207667_10000009445 | 228 |
| 355 | 3300025949 | Ga0207667_10000971 | Ga0207667_1000097134 | 228 |
| 356 | 3300025949 | Ga0207667_10051802 | Ga0207667_100518024 | 228 |
| 357 | 3300025949 | Ga0207667_10085702 | Ga0207667_100857023 | 228 |
| 358 | 3300025949 | Ga0207667_10553159 | Ga0207667_105531591 | 228 |
| 359 | 3300025949 | Ga0207667_10758902 | Ga0207667_107589021 | 228 |
| 360 | 3300025960 | Ga0207651_10018113 | Ga0207651_100181136 | 228 |
| 361 | 3300025961 | Ga0207712_10142459 | Ga0207712_101424592 | 228 |
| 362 | 3300026041 | Ga0207639_10004531 | Ga0207639_100045319 | 228 |
| 363 | 3300026041 | Ga0207639_10015887 | Ga0207639_100158876 | 228 |
| 364 | 3300026078 | Ga0207702_10000507 | Ga0207702_1000050727 | 228 |
| 365 | 3300026078 | Ga0207702_10005892 | Ga0207702_100058923 | 228 |
| 366 | 3300026078 | Ga0207702_10038199 | Ga0207702_100381993 | 228 |
| 367 | 3300026078 | Ga0207702_10056941 | Ga0207702_100569414 | 228 |
| 368 | 3300026078 | Ga0207702_10499778 | Ga0207702_104997782 | 228 |
| 369 | 3300026089 | Ga0207648_10000529 | Ga0207648_100005293 | 228 |
| 370 | 3300026121 | Ga0207683_10031312 | Ga0207683_100313123 | 228 |
| 371 | 3300026142 | Ga0207698_10005251 | Ga0207698_100052511 | 228 |
| 372 | 3300028379 | Ga0268266_10000089 | Ga0268266_1000008978 | 228 |
| 373 | 3300028786 | Ga0307517_10003551 | Ga0307517_1000355118 | 228 |
| 374 | 3300031691 | Ga0316579_10043400 | Ga0316579_100434003 | 228 |
| 375 | 3300031727 | Ga0316576_10127932 | Ga0316576_101279322 | 228 |
| 376 | 3300031911 | Ga0307412_10077908 | Ga0307412_100779082 | 228 |
| 377 | 3300031911 | Ga0307412_10406460 | Ga0307412_104064602 | 228 |
| 378 | 3300032137 | Ga0316585_10039603 | Ga0316585_100396031 | 228 |
| 379 | 3300032139 | Ga0316580_10007805 | Ga0316580_100078053 | 228 |
| 380 | 3300036647 | Ga0316582_0022813 | Ga0316582_0022813_1880_2578 | 228 |
| 381 | 3300036712 | Ga0316584_0052688 | Ga0316584_0052688_1562_2260 | 228 |
| 382 | 3300036712 | Ga0316584_0057497 | Ga0316584_0057497_1347_2045 | 228 |
| 383 | 3300037312 | Ga0395899_0000033 | Ga0395899_0000033_44899_45621 | 228 |
| 384 | 3300037312 | Ga0395899_0000659 | Ga0395899_0000659_7500_8225 | 228 |
| 385 | 3300037312 | Ga0395899_0001109 | Ga0395899_0001109_6542_7288 | 228 |
| 386 | 3300037312 | Ga0395899_0021085 | Ga0395899_0021085_1803_2522 | 228 |
| 387 | 3300037418 | Ga0395900_0000277 | Ga0395900_0000277_25183_25929 | 228 |
| 388 | 3300037418 | Ga0395900_0001234 | Ga0395900_0001234_5567_6289 | 228 |
| 389 | 3300037418 | Ga0395900_0019640 | Ga0395900_0019640_448_1167 | 228 |
| 390 | 3300037466 | Ga0395898_0001918 | Ga0395898_0001918_1662_2408 | 228 |
| 391 | 3300037471 | Ga0395905_0000068 | Ga0395905_0000068_65337_66083 | 228 |
| 392 | 3300037471 | Ga0395905_0000348 | Ga0395905_0000348_56477_57205 | 228 |
| 393 | 3300037471 | Ga0395905_0004443 | Ga0395905_0004443_347_1066 | 228 |
| 394 | 3300038443 | Ga0395901_0000199 | Ga0395901_0000199_2862_3608 | 228 |
| 395 | 3300038443 | Ga0395901_0005268 | Ga0395901_0005268_8570_9289 | 228 |
| 396 | 3300038443 | Ga0395901_0140444 | Ga0395901_0140444_772_1491 | 228 |
| 397 | 3300039447 | Ga0436361_0742208 | Ga0436361_0742208_454_1200 | 228 |
| 398 | 3300042005 | Ga0439448_0020387 | Ga0439448_0020387_370_1116 | 228 |
| 399 | 3300042876 | Ga0451577_0000034 | Ga0451577_0000034_356589_357287 | 228 |
| 400 | 3300042876 | Ga0451577_0003212 | Ga0451577_0003212_14685_15389 | 228 |
| 401 | 3300042876 | Ga0451577_0025370 | Ga0451577_0025370_2521_3219 | 228 |
| 402 | 3300042876 | Ga0451577_0132698 | Ga0451577_0132698_615_1364 | 228 |
| 403 | 3300044656 | Ga0466969_0032580 | Ga0466969_0032580_584_1309 | 228 |
| 404 | 3300044673 | Ga0453683_0000005 | Ga0453683_0000005_508418_509116 | 228 |
| 405 | 3300044673 | Ga0453683_0000122 | Ga0453683_0000122_114793_115491 | 228 |
| 406 | 3300044673 | Ga0453683_0004573 | Ga0453683_0004573_7353_8102 | 228 |
| 407 | 3300044673 | Ga0453683_0127057 | Ga0453683_0127057_47_796 | 228 |
| 408 | 3300044684 | Ga0466966_0016086 | Ga0466966_0016086_432_1157 | 228 |
| 409 | 3300044693 | Ga0466961_0102343 | Ga0466961_0102343_431_1156 | 228 |
| 410 | 3300044712 | Ga0453684_0000098 | Ga0453684_0000098_356589_357287 | 228 |
| 411 | 3300044712 | Ga0453684_0000467 | Ga0453684_0000467_47986_48684 | 228 |
| 412 | 3300044712 | Ga0453684_0000603 | Ga0453684_0000603_42139_42843 | 228 |
| 413 | 3300044712 | Ga0453684_0001278 | Ga0453684_0001278_44321_45019 | 228 |
| 414 | 3300044712 | Ga0453684_0065621 | Ga0453684_0065621_2148_2897 | 228 |
| 415 | 3300044712 | Ga0453684_0268672 | Ga0453684_0268672_493_1242 | 228 |
| 416 | 3300044735 | Ga0466968_0072467 | Ga0466968_0072467_142_864 | 228 |
| 417 | 3300045051 | Ga0451576_0000036 | Ga0451576_0000036_18897_19595 | 228 |
| 418 | 3300045051 | Ga0451576_0000397 | Ga0451576_0000397_89586_90290 | 228 |
| 419 | 3300045051 | Ga0451576_0114207 | Ga0451576_0114207_1882_2580 | 228 |
| 420 | 3300046500 | Ga0495596_0018700 | Ga0495596_0018700_1452_2195 | 228 |
| 421 | 3300046518 | Ga0495631_0087772 | Ga0495631_0087772_250_993 | 228 |
| 422 | 3300046519 | Ga0495632_0230054 | Ga0495632_0230054_84_806 | 228 |
| 423 | 3300046523 | Ga0495644_0051316 | Ga0495644_0051316_667_1389 | 228 |
| 424 | 3300046529 | Ga0495652_0157877 | Ga0495652_0157877_730_1455 | 228 |
| 425 | 3300047443 | Ga0495687_006439 | Ga0495687_006439_6120_6866 | 228 |
| 426 | 3300047445 | Ga0495677_0037403 | Ga0495677_0037403_756_1478 | 228 |
| 427 | 3300047472 | Ga0495686_0001825 | Ga0495686_0001825_3243_3971 | 228 |
| 428 | 3300050493 | nmdc:mga0k408_260_c1 | nmdc:mga0k408_260_c1_11983_12705 | 228 |
| 429 | 3300053122 | Ga0500608_000203 | Ga0500608_000203_19045_19767 | 228 |
| 430 | 3300030731 | Ga0316177_1009900 | Ga0316177_10099001 | 229 |
| 431 | 3300030732 | Ga0316176_1141979 | Ga0316176_114197911 | 229 |
| 432 | 3300030742 | Ga0316183_1118483 | Ga0316183_111848335 | 229 |
| 433 | 3300030744 | Ga0316181_1033622 | Ga0316181_10336224 | 229 |
| 434 | 3300006880 | Ga0075429_100234498 | Ga0075429_1002344982 | 230 |
| 435 | 3300048919 | Ga0496116_0002379 | Ga0496116_0002379_16545_17303 | 230 |
| 436 | 3300048920 | Ga0496117_0002276 | Ga0496117_0002276_9493_10251 | 230 |
| 437 | 3300048921 | Ga0496118_0026652 | Ga0496118_0026652_1087_1845 | 230 |
| 438 | 3300048925 | Ga0496122_0015395 | Ga0496122_0015395_3255_4013 | 230 |
| 439 | 3300048926 | Ga0496123_0018244 | Ga0496123_0018244_1300_2058 | 230 |
| 440 | 3300048928 | Ga0496125_0038198 | Ga0496125_0038198_1427_2185 | 230 |
| 441 | 3300049570 | Ga0501033_0108285 | Ga0501033_0108285_646_1407 | 230 |
| 442 | 3300049577 | Ga0501041_0127761 | Ga0501041_0127761_759_1481 | 230 |
| 443 | 3300049582 | Ga0501048_0049392 | Ga0501048_0049392_148_870 | 230 |
| 444 | 3300049822 | Ga0501035_0283680 | Ga0501035_0283680_255_977 | 230 |
| 445 | 3300049823 | Ga0501044_0778945 | Ga0501044_0778945_95_817 | 230 |
| 446 | 3300050508 | nmdc:mga09592_397145_c1 | nmdc:mga09592_397145_c1_135_872 | 230 |
| 447 | iso_pu_bacteria | 2599185184 | 2599477068 | 230 |
| 448 | iso_pu_bacteria | 2919437846 | 2919442232 | 230 |
| 449 | iso_pu_bacteria | 2928078545 | 2928078981 | 230 |
| 450 | iso_pu_bacteria | 2928147474 | 2928148652 | 230 |
| 451 | iso_pu_bacteria | 2932082852 | 2932085628 | 230 |
| 452 | 3300005617 | Ga0068859_100112551 | Ga0068859_1001125512 | 231 |
| 453 | 3300006931 | Ga0097620_100112549 | Ga0097620_1001125492 | 231 |
| 454 | 3300009094 | Ga0111539_10079406 | Ga0111539_100794063 | 231 |
| 455 | 3300027907 | Ga0207428_10117762 | Ga0207428_101177622 | 231 |
| 456 | 3300032005 | Ga0307411_10121123 | Ga0307411_101211232 | 231 |
| 457 | 3300048091 | Ga0495626_0009849 | Ga0495626_0009849_1776_2510 | 231 |
| 458 | 3300049578 | Ga0501042_0005696 | Ga0501042_0005696_735_1460 | 231 |
| 459 | 3300050511 | nmdc:mga08y16_76589_c1 | nmdc:mga08y16_76589_c1_954_1670 | 231 |
| 460 | iso_pu_bacteria | 2852623160 | 2852626917 | 231 |
| 461 | iso_pu_bacteria | 2884933994 | 2884938030 | 231 |
| 462 | 3300050508 | nmdc:mga09592_11444_c1 | nmdc:mga09592_11444_c1_4899_5642 | 232 |
| 463 | 3300053103 | Ga0500555_000471 | Ga0500555_000471_6106_6810 | 232 |
| 464 | 3300009545 | Ga0105237_10553924 | Ga0105237_105539241 | 233 |
| 465 | 3300028794 | Ga0307515_10001481 | Ga0307515_1000148136 | 233 |
| 466 | 3300028794 | Ga0307515_10001997 | Ga0307515_1000199741 | 233 |
| 467 | 3300033179 | Ga0307507_10000015 | Ga0307507_1000001560 | 233 |
| 468 | 3300046492 | Ga0495585_0003658 | Ga0495585_0003658_7027_7782 | 233 |
| 469 | 3300046518 | Ga0495631_0109135 | Ga0495631_0109135_421_1176 | 233 |
| 470 | 3300046538 | Ga0495609_0005281 | Ga0495609_0005281_5739_6485 | 233 |
| 471 | 3300046557 | Ga0495622_0041224 | Ga0495622_0041224_1133_1888 | 233 |
| 472 | 3300046558 | Ga0495633_0000035 | Ga0495633_0000035_126140_126886 | 233 |
| 473 | 3300046616 | Ga0495668_0000032 | Ga0495668_0000032_77455_78210 | 233 |
| 474 | 3300046660 | Ga0495625_0000753 | Ga0495625_0000753_487_1233 | 233 |
| 475 | 3300046660 | Ga0495625_0001432 | Ga0495625_0001432_2510_3265 | 233 |
| 476 | 3300046660 | Ga0495625_0082121 | Ga0495625_0082121_1330_2067 | 233 |
| 477 | 3300046660 | Ga0495625_0099251 | Ga0495625_0099251_1025_1762 | 233 |
| 478 | 3300046660 | Ga0495625_0301139 | Ga0495625_0301139_117_896 | 233 |
| 479 | 3300046683 | Ga0495658_0136364 | Ga0495658_0136364_379_1134 | 233 |
| 480 | 3300048089 | Ga0495614_0083785 | Ga0495614_0083785_190_945 | 233 |
| 481 | 3300050493 | nmdc:mga0k408_859_c1 | nmdc:mga0k408_859_c1_11252_11998 | 233 |
| 482 | 3300053080 | Ga0500635_0001015 | Ga0500635_0001015_2898_3632 | 233 |
| 483 | 3300053122 | Ga0500608_007068 | Ga0500608_007068_2880_3617 | 233 |
| 484 | 3300053156 | Ga0500622_0001600 | Ga0500622_0001600_14264_15001 | 233 |
| 485 | 3300001990 | JGI24737J22298_10000143 | JGI24737J22298_100001434 | 234 |
| 486 | 3300002067 | JGI24735J21928_10000006 | JGI24735J21928_10000006260 | 234 |
| 487 | 3300002737 | JGI25162J39368_1000089 | JGI25162J39368_100008957 | 234 |
| 488 | 3300003316 | rootH1_10029777 | rootH1_100297778 | 234 |
| 489 | 3300003322 | rootL2_10211276 | rootL2_102112761 | 234 |
| 490 | 3300005563 | Ga0068855_100152225 | Ga0068855_1001522254 | 234 |
| 491 | 3300005577 | Ga0068857_100164685 | Ga0068857_1001646853 | 234 |
| 492 | 3300009093 | Ga0105240_10365364 | Ga0105240_103653642 | 234 |
| 493 | 3300009093 | Ga0105240_11082324 | Ga0105240_110823241 | 234 |
| 494 | 3300009545 | Ga0105237_10065000 | Ga0105237_100650003 | 234 |
| 495 | 3300009545 | Ga0105237_10279937 | Ga0105237_102799372 | 234 |
| 496 | 3300010375 | Ga0105239_10005560 | Ga0105239_1000556013 | 234 |
| 497 | 3300010375 | Ga0105239_10012917 | Ga0105239_100129174 | 234 |
| 498 | 3300013306 | Ga0163162_10013931 | Ga0163162_100139312 | 234 |
| 499 | 3300013306 | Ga0163162_10610738 | Ga0163162_106107381 | 234 |
| 500 | 3300013307 | Ga0157372_10002231 | Ga0157372_100022314 | 234 |
| 501 | 3300017792 | Ga0163161_10027541 | Ga0163161_100275414 | 234 |
| 502 | 3300025233 | Ga0209437_100221 | Ga0209437_10022151 | 234 |
| 503 | 3300025913 | Ga0207695_10058909 | Ga0207695_100589092 | 234 |
| 504 | 3300025914 | Ga0207671_10024807 | Ga0207671_100248074 | 234 |
| 505 | 3300025949 | Ga0207667_10205066 | Ga0207667_102050663 | 234 |
| 506 | 3300026116 | Ga0207674_10483995 | Ga0207674_104839952 | 234 |
| 507 | 3300046460 | Ga0495638_0102196 | Ga0495638_0102196_243_983 | 234 |
| 508 | 3300046460 | Ga0495638_0235657 | Ga0495638_0235657_95_835 | 234 |
| 509 | 3300046471 | Ga0495650_0000014 | Ga0495650_0000014_286458_287198 | 234 |
| 510 | 3300046492 | Ga0495585_0001521 | Ga0495585_0001521_13351_14091 | 234 |
| 511 | 3300046507 | Ga0495606_0000528 | Ga0495606_0000528_8696_9436 | 234 |
| 512 | 3300046507 | Ga0495606_0005674 | Ga0495606_0005674_10194_10958 | 234 |
| 513 | 3300046512 | Ga0495610_0006009 | Ga0495610_0006009_4036_4776 | 234 |
| 514 | 3300046513 | Ga0495616_0005759 | Ga0495616_0005759_5806_6546 | 234 |
| 515 | 3300046513 | Ga0495616_0023741 | Ga0495616_0023741_2416_3156 | 234 |
| 516 | 3300046558 | Ga0495633_0011158 | Ga0495633_0011158_3889_4629 | 234 |
| 517 | 3300046660 | Ga0495625_0000009 | Ga0495625_0000009_340207_340947 | 234 |
| 518 | 3300046665 | Ga0495661_0004079 | Ga0495661_0004079_6360_7100 | 234 |
| 519 | 3300046694 | Ga0495649_0000002 | Ga0495649_0000002_1058117_1058857 | 234 |
| 520 | 3300047443 | Ga0495687_001120 | Ga0495687_001120_20440_21180 | 234 |
| 521 | 3300047472 | Ga0495686_0001209 | Ga0495686_0001209_9237_9977 | 234 |
| 522 | 3300049459 | Ga0495678_033997 | Ga0495678_033997_1185_1925 | 234 |
| 523 | 3300050493 | nmdc:mga0k408_23828_c1 | nmdc:mga0k408_23828_c1_696_1436 | 234 |
| 524 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_5646_6407 | 234 |
| 525 | 3300053125 | Ga0500618_008815 | Ga0500618_008815_797_1537 | 234 |
| 526 | 3300053157 | Ga0500624_000694 | Ga0500624_000694_4201_4941 | 234 |
| 527 | 3300005545 | Ga0070695_100035049 | Ga0070695_1000350492 | 235 |
| 528 | 3300049664 | Ga0501224_006106 | Ga0501224_006106_232_939 | 235 |
| 529 | 3300006847 | Ga0075431_100095920 | Ga0075431_1000959201 | 236 |
| 530 | 3300009545 | Ga0105237_10001308 | Ga0105237_100013088 | 236 |
| 531 | 3300025914 | Ga0207671_10011004 | Ga0207671_100110048 | 236 |
| 532 | 3300025942 | Ga0207689_10270225 | Ga0207689_102702252 | 236 |
| 533 | 3300028794 | Ga0307515_10100898 | Ga0307515_101008983 | 236 |
| 534 | 3300046665 | Ga0495661_0000707 | Ga0495661_0000707_7729_8505 | 236 |
| 535 | 3300050510 | nmdc:mga06r32_78179_c1 | nmdc:mga06r32_78179_c1_47_814 | 236 |
| 536 | 3300014326 | Ga0157380_10093550 | Ga0157380_100935503 | 237 |
| 537 | 3300028800 | Ga0265338_10015871 | Ga0265338_100158716 | 237 |
| 538 | 3300049581 | Ga0501047_0153441 | Ga0501047_0153441_561_1328 | 237 |
| 539 | 3300046473 | Ga0495582_0004387 | Ga0495582_0004387_6016_6765 | 238 |
| 540 | 3300046642 | Ga0495634_0237511 | Ga0495634_0237511_340_1059 | 238 |
| 541 | 3300046683 | Ga0495658_0000570 | Ga0495658_0000570_13091_13840 | 238 |
| 542 | 3300013308 | Ga0157375_11236598 | Ga0157375_112365981 | 239 |
| 543 | 3300049587 | Ga0501071_0030335 | Ga0501071_0030335_1886_2644 | 239 |
| 544 | 3300009101 | Ga0105247_10009777 | Ga0105247_100097772 | 240 |
| 545 | 3300013100 | Ga0157373_10170348 | Ga0157373_101703482 | 240 |
| 546 | 3300015261 | Ga0182006_1091847 | Ga0182006_10918472 | 240 |
| 547 | 3300028380 | Ga0268265_10355986 | Ga0268265_103559862 | 240 |
| 548 | 3300035088 | Ga0373940_0085463 | Ga0373940_0085463_30_752 | 240 |
| 549 | 3300035091 | Ga0373951_0004432 | Ga0373951_0004432_1230_1952 | 240 |
| 550 | 3300038996 | Ga0242420_003202 | Ga0242420_003202_536_1258 | 240 |
| 551 | 3300048906 | Ga0496103_0120921 | Ga0496103_0120921_613_1335 | 240 |
| 552 | 3300048909 | Ga0496106_0032249 | Ga0496106_0032249_1036_1758 | 240 |
| 553 | 3300048912 | Ga0496109_0531654 | Ga0496109_0531654_18_740 | 240 |
| 554 | 3300048914 | Ga0496111_0202197 | Ga0496111_0202197_737_1459 | 240 |
| 555 | 3300048915 | Ga0496112_0315805 | Ga0496112_0315805_309_1031 | 240 |
| 556 | 3300048915 | Ga0496112_0547925 | Ga0496112_0547925_339_1064 | 240 |
| 557 | 3300048915 | Ga0496112_0641627 | Ga0496112_0641627_33_755 | 240 |
| 558 | 3300048916 | Ga0496113_0131242 | Ga0496113_0131242_357_1079 | 240 |
| 559 | 3300049705 | Ga0501225_0040627 | Ga0501225_0040627_280_1002 | 240 |
| 560 | 3300050507 | nmdc:mga05p37_346171_c1 | nmdc:mga05p37_346171_c1_296_1024 | 242 |
| 561 | 3300002074 | JGI24748J21848_1000051 | JGI24748J21848_100005139 | 243 |
| 562 | 3300002239 | JGI24034J26672_10000030 | JGI24034J26672_1000003013 | 243 |
| 563 | 3300005842 | Ga0068858_100000405 | Ga0068858_1000004052 | 243 |
| 564 | 3300009101 | Ga0105247_10000153 | Ga0105247_1000015312 | 243 |
| 565 | 3300013297 | Ga0157378_10235654 | Ga0157378_102356542 | 243 |
| 566 | 3300014968 | Ga0157379_10059280 | Ga0157379_100592802 | 243 |
| 567 | 3300025223 | Ga0207672_1000067 | Ga0207672_100006711 | 243 |
| 568 | 3300025900 | Ga0207710_10000001 | Ga0207710_100000011447 | 243 |
| 569 | 3300025931 | Ga0207644_10000882 | Ga0207644_100008827 | 243 |
| 570 | 3300025960 | Ga0207651_10397315 | Ga0207651_103973152 | 243 |
| 571 | 3300026035 | Ga0207703_10000045 | Ga0207703_1000004515 | 243 |
| 572 | 3300025901 | Ga0207688_10102635 | Ga0207688_101026352 | 244 |
| 573 | 3300031901 | Ga0307406_10441028 | Ga0307406_104410281 | 244 |
| 574 | 3300032005 | Ga0307411_10256934 | Ga0307411_102569341 | 244 |
| 575 | 3300032126 | Ga0307415_100117087 | Ga0307415_1001170872 | 244 |
| 576 | 3300049580 | Ga0501046_0258124 | Ga0501046_0258124_104_877 | 244 |
| 577 | 3300049592 | Ga0501076_0120138 | Ga0501076_0120138_70_843 | 244 |
| 578 | 3300000532 | CNAas_1000829 | CNAas_10008292 | 245 |
| 579 | 3300014326 | Ga0157380_10012995 | Ga0157380_100129954 | 245 |
| 580 | 3300005578 | Ga0068854_100095077 | Ga0068854_1000950772 | 249 |
| 581 | 3300005328 | Ga0070676_10149873 | Ga0070676_101498731 | 250 |
| 582 | 3300005328 | Ga0070676_10503680 | Ga0070676_105036801 | 250 |
| 583 | 3300005334 | Ga0068869_100035202 | Ga0068869_1000352024 | 250 |
| 584 | 3300005364 | Ga0070673_100014675 | Ga0070673_1000146752 | 250 |
| 585 | 3300005445 | Ga0070708_100002619 | Ga0070708_1000026195 | 250 |
| 586 | 3300005467 | Ga0070706_100005626 | Ga0070706_1000056267 | 250 |
| 587 | 3300005468 | Ga0070707_100029831 | Ga0070707_1000298313 | 250 |
| 588 | 3300005471 | Ga0070698_100005014 | Ga0070698_10000501410 | 250 |
| 589 | 3300005518 | Ga0070699_100001336 | Ga0070699_10000133610 | 250 |
| 590 | 3300005536 | Ga0070697_100003936 | Ga0070697_1000039364 | 250 |
| 591 | 3300005536 | Ga0070697_100259760 | Ga0070697_1002597602 | 250 |
| 592 | 3300005543 | Ga0070672_100235441 | Ga0070672_1002354412 | 250 |
| 593 | 3300005545 | Ga0070695_100011147 | Ga0070695_1000111472 | 250 |
| 594 | 3300006852 | Ga0075433_10049863 | Ga0075433_100498632 | 250 |
| 595 | 3300006871 | Ga0075434_100147427 | Ga0075434_1001474272 | 250 |
| 596 | 3300007076 | Ga0075435_100281110 | Ga0075435_1002811102 | 250 |
| 597 | 3300009098 | Ga0105245_10243938 | Ga0105245_102439382 | 250 |
| 598 | 3300009148 | Ga0105243_10000785 | Ga0105243_1000078510 | 250 |
| 599 | 3300009176 | Ga0105242_10001383 | Ga0105242_1000138312 | 250 |
| 600 | 3300009177 | Ga0105248_10015522 | Ga0105248_100155225 | 250 |
| 601 | 3300013297 | Ga0157378_10000002 | Ga0157378_10000002123 | 250 |
| 602 | 3300013306 | Ga0163162_10010070 | Ga0163162_100100705 | 250 |
| 603 | 3300013306 | Ga0163162_10016331 | Ga0163162_100163316 | 250 |
| 604 | 3300025907 | Ga0207645_10087794 | Ga0207645_100877943 | 250 |
| 605 | 3300025910 | Ga0207684_10022905 | Ga0207684_100229054 | 250 |
| 606 | 3300025934 | Ga0207686_10000952 | Ga0207686_1000095211 | 250 |
| 607 | 3300025935 | Ga0207709_10000524 | Ga0207709_1000052416 | 250 |
| 608 | 3300025940 | Ga0207691_10265208 | Ga0207691_102652082 | 250 |
| 609 | 3300025941 | Ga0207711_10013164 | Ga0207711_100131646 | 250 |
| 610 | 3300025942 | Ga0207689_10026884 | Ga0207689_100268842 | 250 |
| 611 | 3300025960 | Ga0207651_10016587 | Ga0207651_100165874 | 250 |
| 612 | 3300025981 | Ga0207640_10177008 | Ga0207640_101770082 | 250 |
| 613 | 3300026035 | Ga0207703_10424570 | Ga0207703_104245701 | 250 |
| 614 | 3300026118 | Ga0207675_100000849 | Ga0207675_10000084923 | 250 |
| 615 | 3300038996 | Ga0242420_011217 | Ga0242420_011217_321_1079 | 250 |
| 616 | 3300048903 | Ga0496100_0167413 | Ga0496100_0167413_592_1350 | 250 |
| 617 | 3300048909 | Ga0496106_0000834 | Ga0496106_0000834_17715_18473 | 250 |
| 618 | 3300050515 | nmdc:mga0a205_88196_c1 | nmdc:mga0a205_88196_c1_775_1533 | 250 |
| 619 | 3300005330 | Ga0070690_100225321 | Ga0070690_1002253212 | 251 |
| 620 | 3300005334 | Ga0068869_100090184 | Ga0068869_1000901842 | 251 |
| 621 | 3300005367 | Ga0070667_100139335 | Ga0070667_1001393352 | 251 |
| 622 | 3300005445 | Ga0070708_100259342 | Ga0070708_1002593422 | 251 |
| 623 | 3300005445 | Ga0070708_100369972 | Ga0070708_1003699722 | 251 |
| 624 | 3300005456 | Ga0070678_100110744 | Ga0070678_1001107442 | 251 |
| 625 | 3300005457 | Ga0070662_100173729 | Ga0070662_1001737291 | 251 |
| 626 | 3300005459 | Ga0068867_100219256 | Ga0068867_1002192562 | 251 |
| 627 | 3300005471 | Ga0070698_100051295 | Ga0070698_1000512952 | 251 |
| 628 | 3300005471 | Ga0070698_100209354 | Ga0070698_1002093542 | 251 |
| 629 | 3300005518 | Ga0070699_100049669 | Ga0070699_1000496693 | 251 |
| 630 | 3300005543 | Ga0070672_100104518 | Ga0070672_1001045182 | 251 |
| 631 | 3300005543 | Ga0070672_100124054 | Ga0070672_1001240542 | 251 |
| 632 | 3300005544 | Ga0070686_100011130 | Ga0070686_1000111302 | 251 |
| 633 | 3300005548 | Ga0070665_100149900 | Ga0070665_1001499002 | 251 |
| 634 | 3300005615 | Ga0070702_100340747 | Ga0070702_1003407471 | 251 |
| 635 | 3300005616 | Ga0068852_100230360 | Ga0068852_1002303602 | 251 |
| 636 | 3300005618 | Ga0068864_100002141 | Ga0068864_1000021412 | 251 |
| 637 | 3300005718 | Ga0068866_10012210 | Ga0068866_100122102 | 251 |
| 638 | 3300005719 | Ga0068861_100512790 | Ga0068861_1005127902 | 251 |
| 639 | 3300005842 | Ga0068858_100014535 | Ga0068858_1000145356 | 251 |
| 640 | 3300005983 | Ga0081540_1097925 | Ga0081540_10979252 | 251 |
| 641 | 3300006163 | Ga0070715_10000024 | Ga0070715_1000002463 | 251 |
| 642 | 3300006237 | Ga0097621_100006010 | Ga0097621_1000060106 | 251 |
| 643 | 3300006358 | Ga0068871_100024567 | Ga0068871_1000245673 | 251 |
| 644 | 3300006914 | Ga0075436_100327712 | Ga0075436_1003277122 | 251 |
| 645 | 3300007265 | Ga0099794_10001218 | Ga0099794_100012183 | 251 |
| 646 | 3300009177 | Ga0105248_10015913 | Ga0105248_100159135 | 251 |
| 647 | 3300013296 | Ga0157374_10357088 | Ga0157374_103570882 | 251 |
| 648 | 3300013297 | Ga0157378_10009280 | Ga0157378_100092808 | 251 |
| 649 | 3300013297 | Ga0157378_10046779 | Ga0157378_100467792 | 251 |
| 650 | 3300013306 | Ga0163162_10005005 | Ga0163162_100050052 | 251 |
| 651 | 3300013308 | Ga0157375_10055045 | Ga0157375_100550453 | 251 |
| 652 | 3300014325 | Ga0163163_10002079 | Ga0163163_100020792 | 251 |
| 653 | 3300014325 | Ga0163163_10004729 | Ga0163163_1000472910 | 251 |
| 654 | 3300014326 | Ga0157380_10925475 | Ga0157380_109254751 | 251 |
| 655 | 3300014969 | Ga0157376_10027794 | Ga0157376_100277942 | 251 |
| 656 | 3300025905 | Ga0207685_10000018 | Ga0207685_1000001859 | 251 |
| 657 | 3300025918 | Ga0207662_10305117 | Ga0207662_103051172 | 251 |
| 658 | 3300025931 | Ga0207644_10263654 | Ga0207644_102636542 | 251 |
| 659 | 3300025933 | Ga0207706_10178930 | Ga0207706_101789302 | 251 |
| 660 | 3300025940 | Ga0207691_10237566 | Ga0207691_102375662 | 251 |
| 661 | 3300025941 | Ga0207711_10018170 | Ga0207711_100181704 | 251 |
| 662 | 3300025942 | Ga0207689_10041222 | Ga0207689_100412222 | 251 |
| 663 | 3300025942 | Ga0207689_10041530 | Ga0207689_100415303 | 251 |
| 664 | 3300025960 | Ga0207651_10104905 | Ga0207651_101049052 | 251 |
| 665 | 3300025986 | Ga0207658_10101237 | Ga0207658_101012372 | 251 |
| 666 | 3300026023 | Ga0207677_10089034 | Ga0207677_100890342 | 251 |
| 667 | 3300026035 | Ga0207703_10097306 | Ga0207703_100973062 | 251 |
| 668 | 3300026088 | Ga0207641_10073847 | Ga0207641_100738472 | 251 |
| 669 | 3300026121 | Ga0207683_10273793 | Ga0207683_102737932 | 251 |
| 670 | 3300026142 | Ga0207698_10117485 | Ga0207698_101174852 | 251 |
| 671 | 3300027671 | Ga0209588_1010709 | Ga0209588_10107092 | 251 |
| 672 | 3300028379 | Ga0268266_10088905 | Ga0268266_100889052 | 251 |
| 673 | 3300028381 | Ga0268264_10080774 | Ga0268264_100807742 | 251 |
| 674 | 3300036401 | Ga0373937_0110636 | Ga0373937_0110636_893_1654 | 251 |
| 675 | 2162886007 | SwRhRL2b_contig_731410 | SwRhRL2b_0575.00004840 | 252 |
| 676 | 3300005288 | Ga0065714_10064422 | Ga0065714_10064422102 | 252 |
| 677 | 3300005289 | Ga0065704_10009526 | Ga0065704_100095262 | 252 |
| 678 | 3300005289 | Ga0065704_10023815 | Ga0065704_100238152 | 252 |
| 679 | 3300005289 | Ga0065704_10092483 | Ga0065704_100924832 | 252 |
| 680 | 3300005289 | Ga0065704_10092834 | Ga0065704_100928342 | 252 |
| 681 | 3300005290 | Ga0065712_10067728 | Ga0065712_1006772863 | 252 |
| 682 | 3300005293 | Ga0065715_10004474 | Ga0065715_100044742 | 252 |
| 683 | 3300005293 | Ga0065715_10089181 | Ga0065715_100891812 | 252 |
| 684 | 3300005293 | Ga0065715_10095696 | Ga0065715_100956961 | 252 |
| 685 | 3300005293 | Ga0065715_10105987 | Ga0065715_101059872 | 252 |
| 686 | 3300005295 | Ga0065707_10091424 | Ga0065707_100914243 | 252 |
| 687 | 3300005295 | Ga0065707_10190589 | Ga0065707_101905892 | 252 |
| 688 | 3300005295 | Ga0065707_10246444 | Ga0065707_102464442 | 252 |
| 689 | 3300005328 | Ga0070676_10093607 | Ga0070676_100936072 | 252 |
| 690 | 3300005329 | Ga0070683_100301639 | Ga0070683_1003016392 | 252 |
| 691 | 3300005330 | Ga0070690_100219957 | Ga0070690_1002199572 | 252 |
| 692 | 3300005331 | Ga0070670_100000165 | Ga0070670_10000016517 | 252 |
| 693 | 3300005331 | Ga0070670_100224439 | Ga0070670_1002244392 | 252 |
| 694 | 3300005334 | Ga0068869_100184623 | Ga0068869_1001846232 | 252 |
| 695 | 3300005337 | Ga0070682_100041994 | Ga0070682_1000419942 | 252 |
| 696 | 3300005343 | Ga0070687_100057385 | Ga0070687_1000573852 | 252 |
| 697 | 3300005343 | Ga0070687_100226986 | Ga0070687_1002269861 | 252 |
| 698 | 3300005345 | Ga0070692_10016459 | Ga0070692_100164592 | 252 |
| 699 | 3300005345 | Ga0070692_10060528 | Ga0070692_100605282 | 252 |
| 700 | 3300005345 | Ga0070692_10203511 | Ga0070692_102035112 | 252 |
| 701 | 3300005353 | Ga0070669_100026199 | Ga0070669_1000261992 | 252 |
| 702 | 3300005364 | Ga0070673_100028970 | Ga0070673_1000289703 | 252 |
| 703 | 3300005438 | Ga0070701_10065272 | Ga0070701_100652722 | 252 |
| 704 | 3300005440 | Ga0070705_100022136 | Ga0070705_1000221363 | 252 |
| 705 | 3300005440 | Ga0070705_100193364 | Ga0070705_1001933642 | 252 |
| 706 | 3300005441 | Ga0070700_100004173 | Ga0070700_1000041735 | 252 |
| 707 | 3300005441 | Ga0070700_100138605 | Ga0070700_1001386052 | 252 |
| 708 | 3300005444 | Ga0070694_100067292 | Ga0070694_1000672922 | 252 |
| 709 | 3300005444 | Ga0070694_100200135 | Ga0070694_1002001352 | 252 |
| 710 | 3300005444 | Ga0070694_100210428 | Ga0070694_1002104282 | 252 |
| 711 | 3300005445 | Ga0070708_100329329 | Ga0070708_1003293292 | 252 |
| 712 | 3300005458 | Ga0070681_10001768 | Ga0070681_1000176818 | 252 |
| 713 | 3300005458 | Ga0070681_10029377 | Ga0070681_100293772 | 252 |
| 714 | 3300005467 | Ga0070706_100000128 | Ga0070706_10000012846 | 252 |
| 715 | 3300005467 | Ga0070706_100018438 | Ga0070706_1000184382 | 252 |
| 716 | 3300005467 | Ga0070706_100093641 | Ga0070706_1000936411 | 252 |
| 717 | 3300005467 | Ga0070706_100223588 | Ga0070706_1002235882 | 252 |
| 718 | 3300005467 | Ga0070706_100539125 | Ga0070706_1005391251 | 252 |
| 719 | 3300005468 | Ga0070707_100006408 | Ga0070707_1000064082 | 252 |
| 720 | 3300005468 | Ga0070707_100078663 | Ga0070707_1000786632 | 252 |
| 721 | 3300005468 | Ga0070707_100180455 | Ga0070707_1001804552 | 252 |
| 722 | 3300005468 | Ga0070707_100180813 | Ga0070707_1001808132 | 252 |
| 723 | 3300005471 | Ga0070698_100000663 | Ga0070698_10000066311 | 252 |
| 724 | 3300005471 | Ga0070698_100004577 | Ga0070698_10000457710 | 252 |
| 725 | 3300005471 | Ga0070698_100053534 | Ga0070698_1000535342 | 252 |
| 726 | 3300005471 | Ga0070698_100185010 | Ga0070698_1001850102 | 252 |
| 727 | 3300005518 | Ga0070699_100014592 | Ga0070699_1000145923 | 252 |
| 728 | 3300005518 | Ga0070699_100576079 | Ga0070699_1005760791 | 252 |
| 729 | 3300005530 | Ga0070679_100111586 | Ga0070679_1001115862 | 252 |
| 730 | 3300005536 | Ga0070697_100036822 | Ga0070697_1000368222 | 252 |
| 731 | 3300005536 | Ga0070697_100063878 | Ga0070697_1000638782 | 252 |
| 732 | 3300005536 | Ga0070697_100094122 | Ga0070697_1000941222 | 252 |
| 733 | 3300005536 | Ga0070697_100182476 | Ga0070697_1001824762 | 252 |
| 734 | 3300005539 | Ga0068853_100014510 | Ga0068853_1000145104 | 252 |
| 735 | 3300005539 | Ga0068853_100167119 | Ga0068853_1001671192 | 252 |
| 736 | 3300005539 | Ga0068853_100234649 | Ga0068853_1002346492 | 252 |
| 737 | 3300005539 | Ga0068853_100695547 | Ga0068853_1006955471 | 252 |
| 738 | 3300005544 | Ga0070686_100014560 | Ga0070686_1000145602 | 252 |
| 739 | 3300005545 | Ga0070695_100051867 | Ga0070695_1000518672 | 252 |
| 740 | 3300005545 | Ga0070695_100172942 | Ga0070695_1001729422 | 252 |
| 741 | 3300005545 | Ga0070695_100356052 | Ga0070695_1003560522 | 252 |
| 742 | 3300005546 | Ga0070696_100123279 | Ga0070696_1001232792 | 252 |
| 743 | 3300005547 | Ga0070693_100031294 | Ga0070693_1000312942 | 252 |
| 744 | 3300005547 | Ga0070693_100303516 | Ga0070693_1003035161 | 252 |
| 745 | 3300005549 | Ga0070704_100288435 | Ga0070704_1002884352 | 252 |
| 746 | 3300005563 | Ga0068855_100204197 | Ga0068855_1002041972 | 252 |
| 747 | 3300005564 | Ga0070664_100549184 | Ga0070664_1005491842 | 252 |
| 748 | 3300005577 | Ga0068857_100006559 | Ga0068857_1000065593 | 252 |
| 749 | 3300005577 | Ga0068857_100127604 | Ga0068857_1001276042 | 252 |
| 750 | 3300005577 | Ga0068857_100578922 | Ga0068857_1005789222 | 252 |
| 751 | 3300005578 | Ga0068854_100271233 | Ga0068854_1002712332 | 252 |
| 752 | 3300005614 | Ga0068856_100005676 | Ga0068856_1000056763 | 252 |
| 753 | 3300005615 | Ga0070702_100001061 | Ga0070702_1000010618 | 252 |
| 754 | 3300005615 | Ga0070702_100184429 | Ga0070702_1001844292 | 252 |
| 755 | 3300005617 | Ga0068859_100054835 | Ga0068859_1000548353 | 252 |
| 756 | 3300005617 | Ga0068859_100079747 | Ga0068859_1000797472 | 252 |
| 757 | 3300005617 | Ga0068859_100287541 | Ga0068859_1002875412 | 252 |
| 758 | 3300005617 | Ga0068859_100411653 | Ga0068859_1004116532 | 252 |
| 759 | 3300005618 | Ga0068864_100034796 | Ga0068864_1000347964 | 252 |
| 760 | 3300005618 | Ga0068864_100652402 | Ga0068864_1006524022 | 252 |
| 761 | 3300005719 | Ga0068861_100002200 | Ga0068861_1000022007 | 252 |
| 762 | 3300005840 | Ga0068870_10064483 | Ga0068870_100644832 | 252 |
| 763 | 3300005840 | Ga0068870_10203280 | Ga0068870_102032802 | 252 |
| 764 | 3300005841 | Ga0068863_100092530 | Ga0068863_1000925302 | 252 |
| 765 | 3300005841 | Ga0068863_100257220 | Ga0068863_1002572202 | 252 |
| 766 | 3300005842 | Ga0068858_100058092 | Ga0068858_1000580923 | 252 |
| 767 | 3300005842 | Ga0068858_100068571 | Ga0068858_1000685712 | 252 |
| 768 | 3300005842 | Ga0068858_100089413 | Ga0068858_1000894133 | 252 |
| 769 | 3300005843 | Ga0068860_100002487 | Ga0068860_1000024872 | 252 |
| 770 | 3300005843 | Ga0068860_100096792 | Ga0068860_1000967922 | 252 |
| 771 | 3300005843 | Ga0068860_100195015 | Ga0068860_1001950152 | 252 |
| 772 | 3300005844 | Ga0068862_100102426 | Ga0068862_1001024262 | 252 |
| 773 | 3300005985 | Ga0081539_10000858 | Ga0081539_1000085815 | 252 |
| 774 | 3300006173 | Ga0070716_100015207 | Ga0070716_1000152072 | 252 |
| 775 | 3300006237 | Ga0097621_100003157 | Ga0097621_10000315711 | 252 |
| 776 | 3300006358 | Ga0068871_100037044 | Ga0068871_1000370442 | 252 |
| 777 | 3300006846 | Ga0075430_100014761 | Ga0075430_1000147614 | 252 |
| 778 | 3300006846 | Ga0075430_100017128 | Ga0075430_1000171282 | 252 |
| 779 | 3300006847 | Ga0075431_100166135 | Ga0075431_1001661352 | 252 |
| 780 | 3300006852 | Ga0075433_10021849 | Ga0075433_100218494 | 252 |
| 781 | 3300006871 | Ga0075434_100160548 | Ga0075434_1001605482 | 252 |
| 782 | 3300006880 | Ga0075429_100018935 | Ga0075429_1000189354 | 252 |
| 783 | 3300006881 | Ga0068865_100032927 | Ga0068865_1000329272 | 252 |
| 784 | 3300006881 | Ga0068865_100305617 | Ga0068865_1003056172 | 252 |
| 785 | 3300006914 | Ga0075436_100000020 | Ga0075436_10000002057 | 252 |
| 786 | 3300006931 | Ga0097620_100054836 | Ga0097620_1000548363 | 252 |
| 787 | 3300006931 | Ga0097620_100079748 | Ga0097620_1000797482 | 252 |
| 788 | 3300006931 | Ga0097620_100287541 | Ga0097620_1002875412 | 252 |
| 789 | 3300006931 | Ga0097620_100411662 | Ga0097620_1004116622 | 252 |
| 790 | 3300007076 | Ga0075435_100000165 | Ga0075435_10000016523 | 252 |
| 791 | 3300009011 | Ga0105251_10061955 | Ga0105251_100619552 | 252 |
| 792 | 3300009011 | Ga0105251_10116981 | Ga0105251_101169812 | 252 |
| 793 | 3300009094 | Ga0111539_10211199 | Ga0111539_102111992 | 252 |
| 794 | 3300009101 | Ga0105247_10005769 | Ga0105247_100057695 | 252 |
| 795 | 3300009147 | Ga0114129_10213288 | Ga0114129_102132882 | 252 |
| 796 | 3300009148 | Ga0105243_10080793 | Ga0105243_100807932 | 252 |
| 797 | 3300009148 | Ga0105243_10189222 | Ga0105243_101892222 | 252 |
| 798 | 3300009148 | Ga0105243_10298058 | Ga0105243_102980582 | 252 |
| 799 | 3300009176 | Ga0105242_10187229 | Ga0105242_101872292 | 252 |
| 800 | 3300009177 | Ga0105248_10165246 | Ga0105248_101652461 | 252 |
| 801 | 3300009545 | Ga0105237_10093882 | Ga0105237_100938822 | 252 |
| 802 | 3300009545 | Ga0105237_10442625 | Ga0105237_104426251 | 252 |
| 803 | 3300009553 | Ga0105249_10063134 | Ga0105249_100631342 | 252 |
| 804 | 3300009553 | Ga0105249_10087773 | Ga0105249_100877732 | 252 |
| 805 | 3300010375 | Ga0105239_10146195 | Ga0105239_101461952 | 252 |
| 806 | 3300011119 | Ga0105246_10039466 | Ga0105246_100394662 | 252 |
| 807 | 3300013297 | Ga0157378_10010199 | Ga0157378_100101995 | 252 |
| 808 | 3300013297 | Ga0157378_10322829 | Ga0157378_103228292 | 252 |
| 809 | 3300013306 | Ga0163162_10003107 | Ga0163162_1000310710 | 252 |
| 810 | 3300013306 | Ga0163162_10727211 | Ga0163162_107272112 | 252 |
| 811 | 3300013308 | Ga0157375_10007015 | Ga0157375_100070159 | 252 |
| 812 | 3300014325 | Ga0163163_10014695 | Ga0163163_100146955 | 252 |
| 813 | 3300014325 | Ga0163163_10215737 | Ga0163163_102157371 | 252 |
| 814 | 3300014326 | Ga0157380_10001101 | Ga0157380_1000110110 | 252 |
| 815 | 3300014326 | Ga0157380_10027529 | Ga0157380_100275293 | 252 |
| 816 | 3300014326 | Ga0157380_10534322 | Ga0157380_105343221 | 252 |
| 817 | 3300025900 | Ga0207710_10000702 | Ga0207710_1000070214 | 252 |
| 818 | 3300025900 | Ga0207710_10071792 | Ga0207710_100717921 | 252 |
| 819 | 3300025904 | Ga0207647_10002660 | Ga0207647_100026606 | 252 |
| 820 | 3300025904 | Ga0207647_10101115 | Ga0207647_101011152 | 252 |
| 821 | 3300025910 | Ga0207684_10000150 | Ga0207684_1000015046 | 252 |
| 822 | 3300025910 | Ga0207684_10004744 | Ga0207684_1000474410 | 252 |
| 823 | 3300025910 | Ga0207684_10017828 | Ga0207684_100178282 | 252 |
| 824 | 3300025910 | Ga0207684_10297695 | Ga0207684_102976952 | 252 |
| 825 | 3300025910 | Ga0207684_10361659 | Ga0207684_103616592 | 252 |
| 826 | 3300025911 | Ga0207654_10103132 | Ga0207654_101031322 | 252 |
| 827 | 3300025912 | Ga0207707_10000016 | Ga0207707_1000001683 | 252 |
| 828 | 3300025912 | Ga0207707_10268130 | Ga0207707_102681301 | 252 |
| 829 | 3300025917 | Ga0207660_10000805 | Ga0207660_1000080511 | 252 |
| 830 | 3300025918 | Ga0207662_10106779 | Ga0207662_101067792 | 252 |
| 831 | 3300025918 | Ga0207662_10253872 | Ga0207662_102538722 | 252 |
| 832 | 3300025920 | Ga0207649_10177370 | Ga0207649_101773702 | 252 |
| 833 | 3300025921 | Ga0207652_10000693 | Ga0207652_1000069320 | 252 |
| 834 | 3300025921 | Ga0207652_10298145 | Ga0207652_102981452 | 252 |
| 835 | 3300025922 | Ga0207646_10004823 | Ga0207646_100048234 | 252 |
| 836 | 3300025922 | Ga0207646_10073942 | Ga0207646_100739422 | 252 |
| 837 | 3300025922 | Ga0207646_10298506 | Ga0207646_102985062 | 252 |
| 838 | 3300025923 | Ga0207681_10012288 | Ga0207681_100122882 | 252 |
| 839 | 3300025924 | Ga0207694_10049255 | Ga0207694_100492552 | 252 |
| 840 | 3300025925 | Ga0207650_10000011 | Ga0207650_10000011211 | 252 |
| 841 | 3300025935 | Ga0207709_10002326 | Ga0207709_1000232612 | 252 |
| 842 | 3300025935 | Ga0207709_10036889 | Ga0207709_100368892 | 252 |
| 843 | 3300025935 | Ga0207709_10264132 | Ga0207709_102641322 | 252 |
| 844 | 3300025938 | Ga0207704_10013016 | Ga0207704_100130162 | 252 |
| 845 | 3300025938 | Ga0207704_10211159 | Ga0207704_102111592 | 252 |
| 846 | 3300025942 | Ga0207689_10009519 | Ga0207689_100095192 | 252 |
| 847 | 3300025942 | Ga0207689_10024086 | Ga0207689_100240862 | 252 |
| 848 | 3300025942 | Ga0207689_10064294 | Ga0207689_100642942 | 252 |
| 849 | 3300025945 | Ga0207679_10414295 | Ga0207679_104142951 | 252 |
| 850 | 3300025960 | Ga0207651_10030254 | Ga0207651_100302543 | 252 |
| 851 | 3300025960 | Ga0207651_10095736 | Ga0207651_100957362 | 252 |
| 852 | 3300025961 | Ga0207712_10027437 | Ga0207712_100274375 | 252 |
| 853 | 3300025961 | Ga0207712_10075328 | Ga0207712_100753282 | 252 |
| 854 | 3300025981 | Ga0207640_10267992 | Ga0207640_102679921 | 252 |
| 855 | 3300026023 | Ga0207677_10104836 | Ga0207677_101048362 | 252 |
| 856 | 3300026035 | Ga0207703_10102201 | Ga0207703_101022012 | 252 |
| 857 | 3300026041 | Ga0207639_10018588 | Ga0207639_100185882 | 252 |
| 858 | 3300026041 | Ga0207639_10547352 | Ga0207639_105473521 | 252 |
| 859 | 3300026075 | Ga0207708_10003530 | Ga0207708_100035304 | 252 |
| 860 | 3300026078 | Ga0207702_10011829 | Ga0207702_100118295 | 252 |
| 861 | 3300026089 | Ga0207648_10228044 | Ga0207648_102280442 | 252 |
| 862 | 3300026089 | Ga0207648_10308551 | Ga0207648_103085512 | 252 |
| 863 | 3300026095 | Ga0207676_10085282 | Ga0207676_100852821 | 252 |
| 864 | 3300026095 | Ga0207676_10710559 | Ga0207676_107105592 | 252 |
| 865 | 3300026095 | Ga0207676_10833183 | Ga0207676_108331832 | 252 |
| 866 | 3300026116 | Ga0207674_10020588 | Ga0207674_100205886 | 252 |
| 867 | 3300026116 | Ga0207674_10123397 | Ga0207674_101233971 | 252 |
| 868 | 3300026118 | Ga0207675_100004603 | Ga0207675_1000046033 | 252 |
| 869 | 3300026118 | Ga0207675_100144676 | Ga0207675_1001446762 | 252 |
| 870 | 3300027907 | Ga0207428_10135769 | Ga0207428_101357692 | 252 |
| 871 | 3300028380 | Ga0268265_10026318 | Ga0268265_100263182 | 252 |
| 872 | 3300028381 | Ga0268264_10007034 | Ga0268264_100070345 | 252 |
| 873 | 3300028381 | Ga0268264_10069792 | Ga0268264_100697922 | 252 |
| 874 | 3300028381 | Ga0268264_10128605 | Ga0268264_101286052 | 252 |
| 875 | 3300031548 | Ga0307408_100058015 | Ga0307408_1000580152 | 252 |
| 876 | 3300031731 | Ga0307405_10058440 | Ga0307405_100584402 | 252 |
| 877 | 3300031852 | Ga0307410_10435734 | Ga0307410_104357342 | 252 |
| 878 | 3300031901 | Ga0307406_10042010 | Ga0307406_100420102 | 252 |
| 879 | 3300031903 | Ga0307407_10067696 | Ga0307407_100676962 | 252 |
| 880 | 3300031911 | Ga0307412_10052264 | Ga0307412_100522642 | 252 |
| 881 | 3300031995 | Ga0307409_100056497 | Ga0307409_1000564972 | 252 |
| 882 | 3300032002 | Ga0307416_100013314 | Ga0307416_1000133144 | 252 |
| 883 | 3300032004 | Ga0307414_10041283 | Ga0307414_100412832 | 252 |
| 884 | 3300032126 | Ga0307415_100051090 | Ga0307415_1000510902 | 252 |
| 885 | 3300032126 | Ga0307415_100151684 | Ga0307415_1001516842 | 252 |
| 886 | 3300035115 | Ga0373941_0107012 | Ga0373941_0107012_182_949 | 252 |
| 887 | 3300035207 | Ga0373942_0019143 | Ga0373942_0019143_583_1344 | 252 |
| 888 | 3300037418 | Ga0395900_0127856 | Ga0395900_0127856_840_1601 | 252 |
| 889 | 3300038443 | Ga0395901_0173777 | Ga0395901_0173777_441_1202 | 252 |
| 890 | 3300039437 | Ga0436365_0065130 | Ga0436365_0065130_39378_40184 | 252 |
| 891 | 3300044673 | Ga0453683_0156419 | Ga0453683_0156419_251_1018 | 252 |
| 892 | 3300048905 | Ga0496102_0030220 | Ga0496102_0030220_780_1541 | 252 |
| 893 | 3300048906 | Ga0496103_0061654 | Ga0496103_0061654_1188_1949 | 252 |
| 894 | 3300048907 | Ga0496104_0020868 | Ga0496104_0020868_1404_2165 | 252 |
| 895 | 3300048907 | Ga0496104_0098177 | Ga0496104_0098177_953_1714 | 252 |
| 896 | 3300048909 | Ga0496106_0045581 | Ga0496106_0045581_1336_2097 | 252 |
| 897 | 3300048910 | Ga0496107_0046604 | Ga0496107_0046604_1110_1871 | 252 |
| 898 | 3300048910 | Ga0496107_0204380 | Ga0496107_0204380_178_939 | 252 |
| 899 | 3300048910 | Ga0496107_0314167 | Ga0496107_0314167_35_796 | 252 |
| 900 | 3300048911 | Ga0496108_0031353 | Ga0496108_0031353_2658_3419 | 252 |
| 901 | 3300048911 | Ga0496108_0595622 | Ga0496108_0595622_151_915 | 252 |
| 902 | 3300048912 | Ga0496109_0278429 | Ga0496109_0278429_318_1079 | 252 |
| 903 | 3300048913 | Ga0496110_0265779 | Ga0496110_0265779_213_974 | 252 |
| 904 | 3300048915 | Ga0496112_0610918 | Ga0496112_0610918_166_927 | 252 |
| 905 | 3300048916 | Ga0496113_0194871 | Ga0496113_0194871_288_1049 | 252 |
| 906 | 3300049521 | Ga0501298_018491 | Ga0501298_018491_412_1173 | 252 |
| 907 | 3300049574 | Ga0501038_0020497 | Ga0501038_0020497_1976_2749 | 252 |
| 908 | 3300049587 | Ga0501071_0263414 | Ga0501071_0263414_46_807 | 252 |
| 909 | 3300049592 | Ga0501076_0558653 | Ga0501076_0558653_168_929 | 252 |
| 910 | 3300049651 | Ga0501201_008382 | Ga0501201_008382_21_782 | 252 |
| 911 | 3300049652 | Ga0501202_010222 | Ga0501202_010222_748_1509 | 252 |
| 912 | 3300049654 | Ga0501207_010580 | Ga0501207_010580_279_1040 | 252 |
| 913 | 3300049660 | Ga0501216_009248 | Ga0501216_009248_306_1067 | 252 |
| 914 | 3300049661 | Ga0501217_015028 | Ga0501217_015028_382_1143 | 252 |
| 915 | 3300049663 | Ga0501223_012726 | Ga0501223_012726_698_1459 | 252 |
| 916 | 3300049675 | Ga0501243_027846 | Ga0501243_027846_23_784 | 252 |
| 917 | 3300049677 | Ga0501247_003827 | Ga0501247_003827_406_1167 | 252 |
| 918 | 3300049704 | Ga0501221_037169 | Ga0501221_037169_276_1037 | 252 |
| 919 | 3300049760 | Ga0501263_000507 | Ga0501263_000507_558_1319 | 252 |
| 920 | 3300049824 | Ga0501045_0351132 | Ga0501045_0351132_212_973 | 252 |
| 921 | 3300050507 | nmdc:mga05p37_21055_c1 | nmdc:mga05p37_21055_c1_5574_6335 | 252 |
| 922 | 3300050508 | nmdc:mga09592_207144_c1 | nmdc:mga09592_207144_c1_416_1177 | 252 |
| 923 | 3300050508 | nmdc:mga09592_24524_c1 | nmdc:mga09592_24524_c1_3050_3811 | 252 |
| 924 | 3300050508 | nmdc:mga09592_24982_c1 | nmdc:mga09592_24982_c1_250_1014 | 252 |
| 925 | 3300050509 | nmdc:mga0qj67_212774_c1 | nmdc:mga0qj67_212774_c1_96_857 | 252 |
| 926 | 3300050511 | nmdc:mga08y16_28893_c1 | nmdc:mga08y16_28893_c1_2743_3501 | 252 |
| 927 | 3300050511 | nmdc:mga08y16_58876_c1 | nmdc:mga08y16_58876_c1_2666_3424 | 252 |
| 928 | 3300050512 | nmdc:mga0n895_163892_c1 | nmdc:mga0n895_163892_c1_1200_1961 | 252 |
| 929 | 3300050513 | nmdc:mga0rr50_139_c1 | nmdc:mga0rr50_139_c1_14168_14935 | 252 |
| 930 | 3300050513 | nmdc:mga0rr50_4236_c1 | nmdc:mga0rr50_4236_c1_2155_2916 | 252 |
| 931 | 3300050514 | nmdc:mga08x19_3622_c1 | nmdc:mga08x19_3622_c1_3252_4013 | 252 |
| 932 | 3300050514 | nmdc:mga08x19_3_c1 | nmdc:mga08x19_3_c1_481882_482649 | 252 |
| 933 | 3300050515 | nmdc:mga0a205_174193_c1 | nmdc:mga0a205_174193_c1_210_971 | 252 |
| 934 | 3300059506 | Ga0587085_028233 | Ga0587085_028233_35_796 | 252 |
| 935 | 3300061734 | Ga0530510_0029172 | Ga0530510_0029172_2884_3645 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.989 | 27 | 249 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9869 | 27 | 249 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9776 | 25 | 250 |
| 5lj9-assembly3.cif.gz_C | structure of the e. coli macb abc domain (c2221) | 0.9749 | 26 | 252 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9713 | 27 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.989 | 27 | 249 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9736 | 55 | 251 | 3.40.50.300 |
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9729 | 28 | 250 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9723 | 27 | 252 | 3.40.50.300 |
| af_Q8T664_36_360_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9722 | 27 | 252 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5S202-F1-model_v4 | deleted | 0.9979 | 28 | 250 |
|
| AF-A0A1Q6ERV0-F1-model_v4 | deleted | 0.9961 | 31 | 250 |
|
| AF-A0A1V4HEF9-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9906 | 28 | 251 |
GO:0005524
GO:0016887 |
| AF-A0A7V4MYJ4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9881 | 25 | 250 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A428XK65-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9869 | 26 | 251 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar