F486156

General Info

Members Datasets Scaffolds Average Seq Length
935 386 920 246

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000485|Ga0105237_1000048540
Length 288
Sequence MLRDDADDADYCLLSASSAQSIEISASLFLLLTVTKPTSPQSNSKKYMQPLITLKDIGRKYVIGTEIIHALKSVSLTINKGEFVALMGPSGSGKSTLMNILGCLDTPTKGEYILNGINVSHMTDNQLAEVRNEEIGFVFQTFNLLPRNTALDNVALPLVYAGVGKEKRQARAKTSLENVGLGNRVDHKPNELSGGQRQRVAVARALINDPSIILADEPTGNLDTKTSIEIMGLMEDIHKKGNTIILVTHEEDIAMHAHRIVRMRDGLVENDYANTNIITVDRSKATTE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
8 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
9 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
10 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
11 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
12 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
13 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
14 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
15 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
16 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
17 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
217 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
218 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
219 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
225 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
238 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
239 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
247 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
327 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
328 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
345 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
346 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
347 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
348 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
349 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
350 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
351 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
352 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
353 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
354 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
355 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
356 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
361 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
377 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
378 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
380 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
381 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
382 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
386 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.43
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 2.89
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_731410 2162886007 Bacteria 1251
2 CNAas_1000829 3300000532 Bacteria 2940
3 JGI24741J21665_1012612 3300001915 Bacteria 1448
4 JGI24740J21852_10016887 3300001979 Bacteria 2625
5 JGI24737J22298_10000143 3300001990 Bacteria 22223
6 JGI24735J21928_10000006 3300002067 Bacteria 339303
7 JGI24748J21848_1000051 3300002074 Bacteria 52353
8 JGI24744J21845_10002026 3300002077 Bacteria 4104
9 JGI24034J26672_10000030 3300002239 Bacteria 97515
10 JGI24751J29686_10054973 3300002459 Bacteria 820
11 JGI25162J39368_1000089 3300002737 Bacteria 104054
12 JGI25162J39368_1000498 3300002737 Bacteria 29793
13 JGI25157J39369_1005927 3300002741 Bacteria 1921
14 JGI25165J46597_1000618 3300003214 Bacteria 30063
15 rootH1_10029777 3300003316 Bacteria 8945
16 rootH2_10018591 3300003320 Bacteria 30571
17 rootH2_10039562 3300003320 Bacteria 6649
18 rootH2_10186211 3300003320 Bacteria 1640
19 rootL2_10211276 3300003322 Bacteria 2534
20 rootH1_10010194 3300003323 Bacteria 43591
21 rootH1_10105642 3300003323 Bacteria 3000
22 rootH1_10379396 3300003323 Bacteria 1393
23 Ga0058863_11791471 3300004799 Bacteria 1797
24 Ga0058861_11760232 3300004800 Bacteria 1356
25 Ga0058862_12416007 3300004803 Bacteria 1780
26 Ga0065714_10064422 3300005288 Bacteria 270668
27 Ga0065714_10148595 3300005288 Bacteria 1121
28 Ga0065704_10009526 3300005289 Bacteria 3117
29 Ga0065704_10023815 3300005289 Bacteria 1152
30 Ga0065704_10092483 3300005289 Bacteria 2647
31 Ga0065704_10092834 3300005289 Bacteria 2578
32 Ga0065712_10067728 3300005290 Bacteria 178215
33 Ga0065712_10089641 3300005290 Bacteria 2461
34 Ga0065712_10204759 3300005290 Bacteria 1095
35 Ga0065715_10004474 3300005293 Bacteria 3796
36 Ga0065715_10089181 3300005293 Bacteria 13047
37 Ga0065715_10095696 3300005293 Bacteria 4020
38 Ga0065715_10105987 3300005293 Bacteria 2858
39 Ga0065715_10343798 3300005293 Bacteria 963
40 Ga0065715_10443342 3300005293 Bacteria 833
41 Ga0065707_10091424 3300005295 Bacteria 3950
42 Ga0065707_10190589 3300005295 Bacteria 1363
43 Ga0065707_10246444 3300005295 Bacteria 1139
44 Ga0065707_10322946 3300005295 Bacteria 963
45 Ga0070658_10000018 3300005327 Bacteria 200558
46 Ga0070658_10080753 3300005327 Bacteria 2671
47 Ga0070658_10338790 3300005327 Bacteria 1286
48 Ga0070658_10563895 3300005327 Bacteria 986
49 Ga0070676_10004488 3300005328 Bacteria 7345
50 Ga0070676_10093607 3300005328 Bacteria 1845
51 Ga0070676_10149873 3300005328 Bacteria 1492
52 Ga0070676_10503680 3300005328 Bacteria 860
53 Ga0070683_100301639 3300005329 Bacteria 1524
54 Ga0070690_100054471 3300005330 Bacteria 2561
55 Ga0070690_100219957 3300005330 Bacteria 1330
56 Ga0070690_100225321 3300005330 Bacteria 1315
57 Ga0070670_100000165 3300005331 Bacteria 59984
58 Ga0070670_100000767 3300005331 Bacteria 24964
59 Ga0070670_100224439 3300005331 Bacteria 1635
60 Ga0068869_100035202 3300005334 Bacteria 3548
61 Ga0068869_100080076 3300005334 Bacteria 2436
62 Ga0068869_100090184 3300005334 Bacteria 2303
63 Ga0068869_100165587 3300005334 Bacteria 1724
64 Ga0068869_100184623 3300005334 Bacteria 1636
65 Ga0070680_100302537 3300005336 Bacteria 1356
66 Ga0070680_100458117 3300005336 Bacteria 1089
67 Ga0070682_100041994 3300005337 Bacteria 2821
68 Ga0068868_100013908 3300005338 Bacteria 5917
69 Ga0070660_100091736 3300005339 Bacteria 2396
70 Ga0070689_100000816 3300005340 Bacteria 19247
71 Ga0070689_100023397 3300005340 Bacteria 4624
72 Ga0070689_100779276 3300005340 Bacteria 840
73 Ga0070691_10113953 3300005341 Bacteria 1355
74 Ga0070691_10313527 3300005341 Bacteria 860
75 Ga0070687_100057385 3300005343 Bacteria 2041
76 Ga0070687_100226986 3300005343 Bacteria 1147
77 Ga0070661_100050498 3300005344 Bacteria 3043
78 Ga0070692_10016459 3300005345 Bacteria 3517
79 Ga0070692_10031317 3300005345 Bacteria 2666
80 Ga0070692_10060528 3300005345 Bacteria 1993
81 Ga0070692_10203511 3300005345 Bacteria 1161
82 Ga0070669_100011817 3300005353 Bacteria 6193
83 Ga0070669_100026199 3300005353 Bacteria 4195
84 Ga0070669_100324176 3300005353 Bacteria 1245
85 Ga0070675_100047495 3300005354 Bacteria 3517
86 Ga0070671_100027615 3300005355 Bacteria 4673
87 Ga0070671_100208803 3300005355 Bacteria 1656
88 Ga0070673_100008881 3300005364 Bacteria 6715
89 Ga0070673_100014675 3300005364 Bacteria 5470
90 Ga0070673_100028970 3300005364 Bacteria 4125
91 Ga0070688_100000427 3300005365 Bacteria 21283
92 Ga0070688_100009040 3300005365 Bacteria 5432
93 Ga0070659_100018374 3300005366 Bacteria 5277
94 Ga0070659_100026796 3300005366 Bacteria 4437
95 Ga0070667_100139335 3300005367 Bacteria 2123
96 Ga0070701_10026549 3300005438 Bacteria 2825
97 Ga0070701_10065272 3300005438 Bacteria 1931
98 Ga0070705_100022136 3300005440 Unclassified 3392
99 Ga0070705_100193364 3300005440 Bacteria 1389
100 Ga0070700_100004173 3300005441 Bacteria 7533
101 Ga0070700_100118473 3300005441 Bacteria 1770
102 Ga0070700_100138605 3300005441 Bacteria 1650
103 Ga0070700_100199413 3300005441 Bacteria 1405
104 Ga0070694_100005028 3300005444 Bacteria 7979
105 Ga0070694_100029319 3300005444 Bacteria 3590
106 Ga0070694_100067292 3300005444 Bacteria 2459
107 Ga0070694_100200135 3300005444 Bacteria 1488
108 Ga0070694_100210428 3300005444 Bacteria 1454
109 Ga0070694_100359661 3300005444 Bacteria 1130
110 Ga0070694_100696880 3300005444 Bacteria 826
111 Ga0070708_100002619 3300005445 Bacteria 13932
112 Ga0070708_100259342 3300005445 Bacteria 1634
113 Ga0070708_100329329 3300005445 Bacteria 1439
114 Ga0070708_100369972 3300005445 Bacteria 1351
115 Ga0070678_100018207 3300005456 Bacteria 4549
116 Ga0070678_100110744 3300005456 Bacteria 2147
117 Ga0070662_100000626 3300005457 Bacteria 21383
118 Ga0070662_100173729 3300005457 Bacteria 1694
119 Ga0070681_10001768 3300005458 Bacteria 19378
120 Ga0070681_10022542 3300005458 Bacteria 6324
121 Ga0070681_10029377 3300005458 Bacteria 5520
122 Ga0068867_100016777 3300005459 Bacteria 5203
123 Ga0068867_100219256 3300005459 Bacteria 1532
124 Ga0068867_100512828 3300005459 Bacteria 1033
125 Ga0070706_100000128 3300005467 Bacteria 92969
126 Ga0070706_100005626 3300005467 Bacteria 11923
127 Ga0070706_100018438 3300005467 Bacteria 6437
128 Ga0070706_100037115 3300005467 Bacteria 4502
129 Ga0070706_100049046 3300005467 Bacteria 3897
130 Ga0070706_100093641 3300005467 Bacteria 2788
131 Ga0070706_100223588 3300005467 Bacteria 1757
132 Ga0070706_100539125 3300005467 Bacteria 1085
133 Ga0070707_100006408 3300005468 Bacteria 10942
134 Ga0070707_100029831 3300005468 Bacteria 5191
135 Ga0070707_100078663 3300005468 Bacteria 3182
136 Ga0070707_100180455 3300005468 Bacteria 2058
137 Ga0070707_100180813 3300005468 Bacteria 2056
138 Ga0070707_100768365 3300005468 Bacteria 927
139 Ga0070698_100000663 3300005471 Bacteria 36731
140 Ga0070698_100004577 3300005471 Bacteria 15185
141 Ga0070698_100005014 3300005471 Bacteria 14509
142 Ga0070698_100051295 3300005471 Bacteria 4202
143 Ga0070698_100053534 3300005471 Bacteria 4101
144 Ga0070698_100185010 3300005471 Bacteria 2021
145 Ga0070698_100209354 3300005471 Bacteria 1885
146 Ga0070699_100001336 3300005518 Bacteria 22693
147 Ga0070699_100014592 3300005518 Bacteria 6757
148 Ga0070699_100049669 3300005518 Bacteria 3631
149 Ga0070699_100576079 3300005518 Bacteria 1025
150 Ga0070679_100008363 3300005530 Bacteria 9736
151 Ga0070679_100111586 3300005530 Bacteria 2721
152 Ga0070697_100003936 3300005536 Bacteria 11413
153 Ga0070697_100036822 3300005536 Bacteria 3952
154 Ga0070697_100063878 3300005536 Bacteria 3007
155 Ga0070697_100094122 3300005536 Bacteria 2482
156 Ga0070697_100101472 3300005536 Bacteria 2391
157 Ga0070697_100182476 3300005536 Bacteria 1779
158 Ga0070697_100213432 3300005536 Bacteria 1643
159 Ga0070697_100259760 3300005536 Bacteria 1487
160 Ga0068853_100014510 3300005539 Bacteria 6455
161 Ga0068853_100019819 3300005539 Bacteria 5586
162 Ga0068853_100167119 3300005539 Bacteria 1988
163 Ga0068853_100234649 3300005539 Bacteria 1679
164 Ga0068853_100695547 3300005539 Bacteria 969
165 Ga0070672_100019003 3300005543 Bacteria 4980
166 Ga0070672_100104518 3300005543 Bacteria 2301
167 Ga0070672_100124054 3300005543 Bacteria 2117
168 Ga0070672_100235441 3300005543 Bacteria 1539
169 Ga0070686_100011130 3300005544 Bacteria 5096
170 Ga0070686_100014560 3300005544 Bacteria 4538
171 Ga0070695_100011147 3300005545 Bacteria 5374
172 Ga0070695_100035049 3300005545 Bacteria 3151
173 Ga0070695_100051867 3300005545 Bacteria 2634
174 Ga0070695_100172942 3300005545 Bacteria 1525
175 Ga0070695_100174986 3300005545 Bacteria 1517
176 Ga0070695_100356052 3300005545 Bacteria 1098
177 Ga0070696_100008944 3300005546 Bacteria 6701
178 Ga0070696_100123279 3300005546 Bacteria 1878
179 Ga0070693_100031294 3300005547 Bacteria 2914
180 Ga0070693_100303516 3300005547 Bacteria 1077
181 Ga0070665_100000072 3300005548 Bacteria 198575
182 Ga0070665_100149900 3300005548 Bacteria 2335
183 Ga0070704_100031410 3300005549 Bacteria 3572
184 Ga0070704_100098350 3300005549 Bacteria 2198
185 Ga0070704_100288435 3300005549 Bacteria 1363
186 Ga0068855_100000070 3300005563 Bacteria 123584
187 Ga0068855_100000268 3300005563 Bacteria 64693
188 Ga0068855_100012445 3300005563 Bacteria 10276
189 Ga0068855_100063242 3300005563 Bacteria 4319
190 Ga0068855_100152225 3300005563 Bacteria 2630
191 Ga0068855_100204197 3300005563 Bacteria 2224
192 Ga0068855_100416203 3300005563 Bacteria 1471
193 Ga0070664_100004294 3300005564 Bacteria 11459
194 Ga0070664_100025146 3300005564 Bacteria 4933
195 Ga0070664_100461099 3300005564 Bacteria 1168
196 Ga0070664_100549184 3300005564 Bacteria 1068
197 Ga0068857_100006559 3300005577 Bacteria 9988
198 Ga0068857_100127604 3300005577 Bacteria 2292
199 Ga0068857_100164685 3300005577 Bacteria 2013
200 Ga0068857_100578922 3300005577 Bacteria 1059
201 Ga0068854_100095077 3300005578 Bacteria 2224
202 Ga0068854_100271233 3300005578 Bacteria 1362
203 Ga0068856_100000897 3300005614 Bacteria 31872
204 Ga0068856_100003887 3300005614 Bacteria 14987
205 Ga0068856_100005676 3300005614 Bacteria 12288
206 Ga0068856_100009016 3300005614 Bacteria 9706
207 Ga0068856_100013111 3300005614 Bacteria 8029
208 Ga0068856_100194332 3300005614 Bacteria 2043
209 Ga0070702_100001061 3300005615 Bacteria 10965
210 Ga0070702_100184429 3300005615 Bacteria 1368
211 Ga0070702_100340747 3300005615 Bacteria 1052
212 Ga0068852_100017595 3300005616 Bacteria 5613
213 Ga0068852_100230360 3300005616 Bacteria 1766
214 Ga0068859_100054835 3300005617 Bacteria 4010
215 Ga0068859_100079747 3300005617 Bacteria 3314
216 Ga0068859_100112551 3300005617 Bacteria 2785
217 Ga0068859_100169538 3300005617 Bacteria 2264
218 Ga0068859_100287541 3300005617 Bacteria 1737
219 Ga0068859_100411653 3300005617 Bacteria 1448
220 Ga0068864_100002141 3300005618 Bacteria 16331
221 Ga0068864_100034796 3300005618 Bacteria 4286
222 Ga0068864_100106485 3300005618 Bacteria 2493
223 Ga0068864_100652402 3300005618 Bacteria 1025
224 Ga0068866_10012210 3300005718 Bacteria 3741
225 Ga0068866_10017052 3300005718 Bacteria 3260
226 Ga0068861_100002200 3300005719 Bacteria 12657
227 Ga0068861_100126572 3300005719 Bacteria 2068
228 Ga0068861_100512790 3300005719 Bacteria 1086
229 Ga0068870_10064483 3300005840 Unclassified 1979
230 Ga0068870_10203280 3300005840 Bacteria 1202
231 Ga0068863_100092530 3300005841 Bacteria 2868
232 Ga0068863_100210158 3300005841 Bacteria 1874
233 Ga0068863_100257220 3300005841 Bacteria 1687
234 Ga0068858_100000405 3300005842 Bacteria 44934
235 Ga0068858_100014535 3300005842 Bacteria 7417
236 Ga0068858_100058092 3300005842 Bacteria 3576
237 Ga0068858_100068571 3300005842 Bacteria 3287
238 Ga0068858_100089413 3300005842 Bacteria 2866
239 Ga0068858_100269722 3300005842 Bacteria 1619
240 Ga0068860_100002487 3300005843 Bacteria 19327
241 Ga0068860_100027839 3300005843 Bacteria 5443
242 Ga0068860_100096792 3300005843 Bacteria 2813
243 Ga0068860_100195015 3300005843 Bacteria 1961
244 Ga0068862_100033821 3300005844 Bacteria 4323
245 Ga0068862_100038785 3300005844 Bacteria 4042
246 Ga0068862_100102426 3300005844 Bacteria 2506
247 Ga0081455_10422222 3300005937 Bacteria 919
248 Ga0081540_1097925 3300005983 Bacteria 1271
249 Ga0081539_10000858 3300005985 Bacteria 58194
250 Ga0070715_10000024 3300006163 Bacteria 110647
251 Ga0070716_100015207 3300006173 Bacteria 3950
252 Ga0075366_10001711 3300006195 Bacteria 11028
253 Ga0097621_100000028 3300006237 Bacteria 71678
254 Ga0097621_100003157 3300006237 Bacteria 11316
255 Ga0097621_100006010 3300006237 Bacteria 8579
256 Ga0068871_100006906 3300006358 Bacteria 8084
257 Ga0068871_100024567 3300006358 Bacteria 4674
258 Ga0068871_100037044 3300006358 Bacteria 3888
259 Ga0075430_100014761 3300006846 Bacteria 6651
260 Ga0075430_100017128 3300006846 Bacteria 6171
261 Ga0075430_100066766 3300006846 Bacteria 3021
262 Ga0075430_100088661 3300006846 Bacteria 2589
263 Ga0075431_100095920 3300006847 Bacteria 3062
264 Ga0075431_100166135 3300006847 Bacteria 2268
265 Ga0075433_10015116 3300006852 Bacteria 6323
266 Ga0075433_10021849 3300006852 Bacteria 5368
267 Ga0075433_10049863 3300006852 Bacteria 3642
268 Ga0075433_10282341 3300006852 Bacteria 1471
269 Ga0075433_10366468 3300006852 Bacteria 1272
270 Ga0075434_100000831 3300006871 Bacteria 24539
271 Ga0075434_100010744 3300006871 Bacteria 8599
272 Ga0075434_100147427 3300006871 Bacteria 2373
273 Ga0075434_100160548 3300006871 Bacteria 2267
274 Ga0075434_100706617 3300006871 Bacteria 1025
275 Ga0075429_100011725 3300006880 Bacteria 7604
276 Ga0075429_100018935 3300006880 Bacteria 5963
277 Ga0075429_100031368 3300006880 Bacteria 4619
278 Ga0075429_100092571 3300006880 Bacteria 2637
279 Ga0075429_100234498 3300006880 Bacteria 1607
280 Ga0068865_100000127 3300006881 Bacteria 39327
281 Ga0068865_100032927 3300006881 Bacteria 3468
282 Ga0068865_100071929 3300006881 Bacteria 2455
283 Ga0068865_100305617 3300006881 Bacteria 1274
284 Ga0075436_100000020 3300006914 Bacteria 124822
285 Ga0075436_100327712 3300006914 Bacteria 1101
286 Ga0075436_100389832 3300006914 Bacteria 1008
287 Ga0097620_100011064 3300006931 Bacteria 9075
288 Ga0097620_100054836 3300006931 Bacteria 4010
289 Ga0097620_100079748 3300006931 Bacteria 3314
290 Ga0097620_100112549 3300006931 Bacteria 2785
291 Ga0097620_100169531 3300006931 Bacteria 2264
292 Ga0097620_100287541 3300006931 Bacteria 1737
293 Ga0097620_100411662 3300006931 Bacteria 1448
294 Ga0075435_100000165 3300007076 Bacteria 38337
295 Ga0075435_100032986 3300007076 Bacteria 4092
296 Ga0075435_100095774 3300007076 Bacteria 2455
297 Ga0075435_100281110 3300007076 Bacteria 1421
298 Ga0099794_10001218 3300007265 Bacteria 8883
299 Ga0105251_10061955 3300009011 Bacteria 1758
300 Ga0105251_10116981 3300009011 Bacteria 1212
301 Ga0105240_10000237 3300009093 Bacteria 109895
302 Ga0105240_10014965 3300009093 Bacteria 10571
303 Ga0105240_10020594 3300009093 Bacteria 8792
304 Ga0105240_10048025 3300009093 Bacteria 5397
305 Ga0105240_10187598 3300009093 Bacteria 2434
306 Ga0105240_10227132 3300009093 Bacteria 2171
307 Ga0105240_10365364 3300009093 Bacteria 1633
308 Ga0105240_11082324 3300009093 Bacteria 854
309 Ga0111539_10079406 3300009094 Bacteria 3860
310 Ga0111539_10211199 3300009094 Bacteria 2261
311 Ga0105245_10243938 3300009098 Bacteria 1743
312 Ga0105245_10607140 3300009098 Bacteria 1121
313 Ga0105247_10000153 3300009101 Bacteria 67393
314 Ga0105247_10005769 3300009101 Bacteria 7752
315 Ga0105247_10009777 3300009101 Bacteria 5813
316 Ga0114129_10007783 3300009147 Bacteria 15246
317 Ga0114129_10018669 3300009147 Bacteria 9874
318 Ga0114129_10213288 3300009147 Bacteria 2609
319 Ga0114129_10654159 3300009147 Bacteria 1356
320 Ga0114129_10843987 3300009147 Bacteria 1165
321 Ga0105243_10000785 3300009148 Bacteria 30459
322 Ga0105243_10080793 3300009148 Bacteria 2652
323 Ga0105243_10133231 3300009148 Bacteria 2111
324 Ga0105243_10189222 3300009148 Bacteria 1796
325 Ga0105243_10298058 3300009148 Bacteria 1460
326 Ga0105241_10535967 3300009174 Bacteria 1049
327 Ga0105242_10001383 3300009176 Bacteria 19124
328 Ga0105242_10029494 3300009176 Bacteria 4376
329 Ga0105242_10187229 3300009176 Bacteria 1830
330 Ga0105242_10256131 3300009176 Bacteria 1579
331 Ga0105248_10015522 3300009177 Bacteria 8397
332 Ga0105248_10015913 3300009177 Bacteria 8284
333 Ga0105248_10165246 3300009177 Bacteria 2495
334 Ga0105237_10000224 3300009545 Bacteria 79854
335 Ga0105237_10000485 3300009545 Bacteria 56664
336 Ga0105237_10001308 3300009545 Bacteria 33108
337 Ga0105237_10037976 3300009545 Bacteria 4865
338 Ga0105237_10041051 3300009545 Bacteria 4667
339 Ga0105237_10065000 3300009545 Bacteria 3644
340 Ga0105237_10093882 3300009545 Bacteria 2989
341 Ga0105237_10279937 3300009545 Bacteria 1671
342 Ga0105237_10385476 3300009545 Bacteria 1406
343 Ga0105237_10411591 3300009545 Bacteria 1357
344 Ga0105237_10442625 3300009545 Bacteria 1305
345 Ga0105237_10553924 3300009545 Bacteria 1156
346 Ga0105238_10133400 3300009551 Bacteria 2461
347 Ga0105238_11076560 3300009551 Bacteria 826
348 Ga0105249_10013986 3300009553 Bacteria 7094
349 Ga0105249_10063134 3300009553 Bacteria 3402
350 Ga0105249_10087773 3300009553 Bacteria 2903
351 Ga0105249_10237828 3300009553 Bacteria 1799
352 Ga0105239_10000039 3300010375 Bacteria 203537
353 Ga0105239_10000120 3300010375 Bacteria 110003
354 Ga0105239_10004436 3300010375 Bacteria 16776
355 Ga0105239_10005560 3300010375 Bacteria 14739
356 Ga0105239_10012917 3300010375 Bacteria 9289
357 Ga0105239_10013753 3300010375 Bacteria 8983
358 Ga0105239_10023687 3300010375 Bacteria 6759
359 Ga0105239_10025250 3300010375 Bacteria 6543
360 Ga0105239_10146195 3300010375 Bacteria 2636
361 Ga0105239_10826509 3300010375 Bacteria 1062
362 Ga0105246_10039466 3300011119 Bacteria 3181
363 Ga0105246_10172179 3300011119 Bacteria 1659
364 Ga0157373_10000208 3300013100 Bacteria 48082
365 Ga0157373_10076454 3300013100 Bacteria 2362
366 Ga0157373_10170348 3300013100 Bacteria 1532
367 Ga0157371_10000263 3300013102 Bacteria 71557
368 Ga0157370_10095584 3300013104 Bacteria 2788
369 Ga0157369_10617552 3300013105 Bacteria 1119
370 Ga0157374_10001845 3300013296 Bacteria 17834
371 Ga0157374_10044113 3300013296 Bacteria 4121
372 Ga0157374_10155428 3300013296 Bacteria 2226
373 Ga0157374_10357088 3300013296 Bacteria 1453
374 Ga0157378_10000002 3300013297 Bacteria 222652
375 Ga0157378_10009280 3300013297 Bacteria 8570
376 Ga0157378_10010199 3300013297 Bacteria 8198
377 Ga0157378_10039044 3300013297 Bacteria 4210
378 Ga0157378_10043262 3300013297 Bacteria 3999
379 Ga0157378_10046779 3300013297 Bacteria 3845
380 Ga0157378_10235654 3300013297 Bacteria 1746
381 Ga0157378_10322829 3300013297 Bacteria 1500
382 Ga0163162_10000010 3300013306 Bacteria 302032
383 Ga0163162_10003107 3300013306 Bacteria 15857
384 Ga0163162_10005005 3300013306 Bacteria 12766
385 Ga0163162_10010070 3300013306 Bacteria 9190
386 Ga0163162_10013931 3300013306 Bacteria 7855
387 Ga0163162_10016331 3300013306 Bacteria 7257
388 Ga0163162_10033657 3300013306 Bacteria 5093
389 Ga0163162_10064255 3300013306 Bacteria 3715
390 Ga0163162_10110885 3300013306 Bacteria 2841
391 Ga0163162_10610738 3300013306 Bacteria 1216
392 Ga0163162_10727211 3300013306 Bacteria 1113
393 Ga0157372_10000050 3300013307 Bacteria 140381
394 Ga0157372_10000635 3300013307 Bacteria 38523
395 Ga0157372_10001419 3300013307 Bacteria 25842
396 Ga0157372_10002231 3300013307 Bacteria 21022
397 Ga0157372_10189979 3300013307 Bacteria 2379
398 Ga0157372_10403929 3300013307 Bacteria 1592
399 Ga0157375_10007015 3300013308 Bacteria 9838
400 Ga0157375_10021385 3300013308 Bacteria 5930
401 Ga0157375_10055045 3300013308 Bacteria 3921
402 Ga0157375_11236598 3300013308 Bacteria 877
403 Ga0163163_10002079 3300014325 Bacteria 16899
404 Ga0163163_10004729 3300014325 Bacteria 11666
405 Ga0163163_10014695 3300014325 Bacteria 7200
406 Ga0163163_10018317 3300014325 Bacteria 6552
407 Ga0163163_10215737 3300014325 Bacteria 1968
408 Ga0157380_10001101 3300014326 Bacteria 17410
409 Ga0157380_10012995 3300014326 Bacteria 6054
410 Ga0157380_10027529 3300014326 Bacteria 4324
411 Ga0157380_10093550 3300014326 Bacteria 2486
412 Ga0157380_10534322 3300014326 Bacteria 1147
413 Ga0157380_10925475 3300014326 Bacteria 900
414 Ga0157380_11116714 3300014326 Bacteria 828
415 Ga0157379_10047882 3300014968 Bacteria 3815
416 Ga0157379_10059280 3300014968 Bacteria 3422
417 Ga0157376_10027794 3300014969 Bacteria 4489
418 Ga0182006_1091847 3300015261 Bacteria 1091
419 Ga0163161_10027541 3300017792 Bacteria 4032
420 Ga0207672_1000067 3300025223 Bacteria 14045
421 Ga0207427_100172 3300025231 Bacteria 71550
422 Ga0209437_100034 3300025233 Bacteria 494007
423 Ga0209437_100221 3300025233 Bacteria 104135
424 Ga0209026_1000728 3300025250 Bacteria 19168
425 Ga0209026_1003634 3300025250 Bacteria 4952
426 Ga0209026_1015127 3300025250 Bacteria 1272
427 Ga0209148_1017175 3300025254 Bacteria 1232
428 Ga0209233_1000038 3300025261 Bacteria 548972
429 Ga0209233_1001428 3300025261 Bacteria 9422
430 Ga0209233_1013109 3300025261 Bacteria 2377
431 Ga0209233_1019675 3300025261 Bacteria 1789
432 Ga0209455_1000861 3300025272 Bacteria 16150
433 Ga0207710_10000001 3300025900 Bacteria 1797433
434 Ga0207710_10000702 3300025900 Bacteria 18777
435 Ga0207710_10071792 3300025900 Bacteria 1589
436 Ga0207688_10102635 3300025901 Bacteria 1653
437 Ga0207647_10000076 3300025904 Bacteria 75824
438 Ga0207647_10002660 3300025904 Bacteria 13488
439 Ga0207647_10101115 3300025904 Bacteria 1710
440 Ga0207647_10150889 3300025904 Bacteria 1358
441 Ga0207685_10000018 3300025905 Bacteria 145715
442 Ga0207645_10017477 3300025907 Bacteria 4734
443 Ga0207645_10087794 3300025907 Bacteria 1998
444 Ga0207705_10000036 3300025909 Bacteria 200787
445 Ga0207684_10000150 3300025910 Bacteria 121849
446 Ga0207684_10004744 3300025910 Bacteria 12740
447 Ga0207684_10007514 3300025910 Bacteria 9807
448 Ga0207684_10017828 3300025910 Bacteria 6088
449 Ga0207684_10022905 3300025910 Bacteria 5334
450 Ga0207684_10121834 3300025910 Bacteria 2236
451 Ga0207684_10297695 3300025910 Bacteria 1391
452 Ga0207684_10361659 3300025910 Bacteria 1249
453 Ga0207654_10103132 3300025911 Bacteria 1761
454 Ga0207654_10118633 3300025911 Bacteria 1657
455 Ga0207654_10425683 3300025911 Bacteria 927
456 Ga0207707_10000016 3300025912 Bacteria 256002
457 Ga0207707_10030350 3300025912 Bacteria 4729
458 Ga0207707_10268130 3300025912 Bacteria 1480
459 Ga0207695_10000013 3300025913 Bacteria 821265
460 Ga0207695_10004656 3300025913 Bacteria 18589
461 Ga0207695_10016549 3300025913 Bacteria 8620
462 Ga0207695_10033191 3300025913 Bacteria 5637
463 Ga0207695_10058909 3300025913 Bacteria 3985
464 Ga0207695_10318305 3300025913 Bacteria 1445
465 Ga0207671_10002707 3300025914 Bacteria 18581
466 Ga0207671_10011004 3300025914 Bacteria 7407
467 Ga0207671_10011316 3300025914 Bacteria 7272
468 Ga0207671_10024807 3300025914 Bacteria 4506
469 Ga0207671_10037577 3300025914 Bacteria 3590
470 Ga0207660_10000805 3300025917 Bacteria 20711
471 Ga0207660_10032391 3300025917 Bacteria 3608
472 Ga0207660_10119374 3300025917 Bacteria 1995
473 Ga0207662_10106779 3300025918 Bacteria 1742
474 Ga0207662_10253872 3300025918 Bacteria 1155
475 Ga0207662_10305117 3300025918 Bacteria 1059
476 Ga0207657_10020956 3300025919 Bacteria 6166
477 Ga0207649_10034440 3300025920 Bacteria 3034
478 Ga0207649_10177370 3300025920 Bacteria 1489
479 Ga0207652_10000693 3300025921 Bacteria 32703
480 Ga0207652_10298145 3300025921 Bacteria 1455
481 Ga0207646_10004823 3300025922 Bacteria 14455
482 Ga0207646_10026415 3300025922 Bacteria 5298
483 Ga0207646_10073942 3300025922 Bacteria 3045
484 Ga0207646_10298506 3300025922 Bacteria 1455
485 Ga0207681_10012288 3300025923 Bacteria 5281
486 Ga0207681_10264841 3300025923 Bacteria 1347
487 Ga0207694_10049255 3300025924 Bacteria 3261
488 Ga0207694_10146670 3300025924 Bacteria 1900
489 Ga0207650_10000011 3300025925 Bacteria 450115
490 Ga0207650_10002299 3300025925 Bacteria 13320
491 Ga0207659_10013295 3300025926 Bacteria 5266
492 Ga0207644_10000882 3300025931 Bacteria 18926
493 Ga0207644_10062324 3300025931 Bacteria 2704
494 Ga0207644_10073528 3300025931 Bacteria 2507
495 Ga0207644_10096507 3300025931 Bacteria 2213
496 Ga0207644_10263654 3300025931 Bacteria 1378
497 Ga0207644_10425065 3300025931 Bacteria 1089
498 Ga0207690_10011536 3300025932 Bacteria 5278
499 Ga0207690_10015769 3300025932 Bacteria 4586
500 Ga0207706_10006487 3300025933 Bacteria 10861
501 Ga0207706_10178930 3300025933 Bacteria 1863
502 Ga0207686_10000952 3300025934 Bacteria 17283
503 Ga0207709_10000524 3300025935 Bacteria 33443
504 Ga0207709_10002326 3300025935 Bacteria 12000
505 Ga0207709_10036889 3300025935 Bacteria 2900
506 Ga0207709_10264132 3300025935 Bacteria 1264
507 Ga0207670_10000065 3300025936 Bacteria 75480
508 Ga0207670_10035418 3300025936 Bacteria 3236
509 Ga0207704_10000044 3300025938 Bacteria 86753
510 Ga0207704_10013016 3300025938 Bacteria 4148
511 Ga0207704_10101785 3300025938 Bacteria 1917
512 Ga0207704_10211159 3300025938 Bacteria 1429
513 Ga0207691_10005500 3300025940 Bacteria 12241
514 Ga0207691_10056180 3300025940 Bacteria 3587
515 Ga0207691_10237566 3300025940 Bacteria 1576
516 Ga0207691_10265208 3300025940 Bacteria 1480
517 Ga0207711_10013164 3300025941 Bacteria 6870
518 Ga0207711_10018170 3300025941 Bacteria 5845
519 Ga0207689_10009519 3300025942 Bacteria 8385
520 Ga0207689_10024086 3300025942 Bacteria 5106
521 Ga0207689_10026884 3300025942 Bacteria 4816
522 Ga0207689_10041222 3300025942 Bacteria 3820
523 Ga0207689_10041530 3300025942 Bacteria 3806
524 Ga0207689_10064294 3300025942 Bacteria 3019
525 Ga0207689_10066062 3300025942 Bacteria 2975
526 Ga0207689_10270225 3300025942 Bacteria 1407
527 Ga0207689_10380763 3300025942 Bacteria 1175
528 Ga0207679_10001977 3300025945 Bacteria 12712
529 Ga0207679_10025207 3300025945 Bacteria 4087
530 Ga0207679_10414295 3300025945 Bacteria 1188
531 Ga0207679_10547559 3300025945 Bacteria 1038
532 Ga0207667_10000009 3300025949 Bacteria 603135
533 Ga0207667_10000971 3300025949 Bacteria 36600
534 Ga0207667_10051802 3300025949 Bacteria 4326
535 Ga0207667_10085702 3300025949 Bacteria 3261
536 Ga0207667_10205066 3300025949 Bacteria 2022
537 Ga0207667_10553159 3300025949 Bacteria 1164
538 Ga0207667_10758902 3300025949 Bacteria 969
539 Ga0207651_10016587 3300025960 Bacteria 4321
540 Ga0207651_10018113 3300025960 Bacteria 4182
541 Ga0207651_10030254 3300025960 Bacteria 3445
542 Ga0207651_10042500 3300025960 Bacteria 3026
543 Ga0207651_10095736 3300025960 Bacteria 2187
544 Ga0207651_10104905 3300025960 Bacteria 2107
545 Ga0207651_10397315 3300025960 Bacteria 1172
546 Ga0207712_10027437 3300025961 Bacteria 3802
547 Ga0207712_10075328 3300025961 Bacteria 2439
548 Ga0207712_10142459 3300025961 Bacteria 1841
549 Ga0207712_10476213 3300025961 Bacteria 1063
550 Ga0207668_10338072 3300025972 Bacteria 1255
551 Ga0207640_10177008 3300025981 Bacteria 1596
552 Ga0207640_10267992 3300025981 Bacteria 1334
553 Ga0207658_10101237 3300025986 Bacteria 2257
554 Ga0207658_10234206 3300025986 Bacteria 1552
555 Ga0207677_10089034 3300026023 Bacteria 2240
556 Ga0207677_10104836 3300026023 Bacteria 2091
557 Ga0207703_10000045 3300026035 Bacteria 156669
558 Ga0207703_10097306 3300026035 Bacteria 2486
559 Ga0207703_10102201 3300026035 Bacteria 2432
560 Ga0207703_10424570 3300026035 Bacteria 1238
561 Ga0207639_10004531 3300026041 Bacteria 9364
562 Ga0207639_10015887 3300026041 Bacteria 5316
563 Ga0207639_10018588 3300026041 Bacteria 4943
564 Ga0207639_10547352 3300026041 Bacteria 1062
565 Ga0207678_10021588 3300026067 Bacteria 5646
566 Ga0207708_10003530 3300026075 Bacteria 11518
567 Ga0207708_10039998 3300026075 Bacteria 3574
568 Ga0207708_10184541 3300026075 Bacteria 1657
569 Ga0207708_10664032 3300026075 Bacteria 888
570 Ga0207702_10000507 3300026078 Bacteria 43964
571 Ga0207702_10005892 3300026078 Bacteria 10658
572 Ga0207702_10011829 3300026078 Bacteria 7263
573 Ga0207702_10038199 3300026078 Bacteria 4021
574 Ga0207702_10056941 3300026078 Bacteria 3320
575 Ga0207702_10499778 3300026078 Bacteria 1185
576 Ga0207641_10073847 3300026088 Bacteria 2940
577 Ga0207641_10175600 3300026088 Bacteria 1959
578 Ga0207641_10669928 3300026088 Bacteria 1020
579 Ga0207648_10000529 3300026089 Bacteria 42805
580 Ga0207648_10228044 3300026089 Bacteria 1656
581 Ga0207648_10308551 3300026089 Bacteria 1420
582 Ga0207648_10317344 3300026089 Bacteria 1400
583 Ga0207676_10085282 3300026095 Bacteria 2577
584 Ga0207676_10090487 3300026095 Bacteria 2511
585 Ga0207676_10710559 3300026095 Bacteria 974
586 Ga0207676_10833183 3300026095 Bacteria 901
587 Ga0207674_10020588 3300026116 Bacteria 7123
588 Ga0207674_10123397 3300026116 Bacteria 2556
589 Ga0207674_10145605 3300026116 Bacteria 2328
590 Ga0207674_10483995 3300026116 Bacteria 1196
591 Ga0207675_100000849 3300026118 Bacteria 30412
592 Ga0207675_100004603 3300026118 Bacteria 13293
593 Ga0207675_100144676 3300026118 Bacteria 2260
594 Ga0207675_100184473 3300026118 Bacteria 1999
595 Ga0207675_100484499 3300026118 Bacteria 1230
596 Ga0207683_10031312 3300026121 Bacteria 4616
597 Ga0207683_10273793 3300026121 Bacteria 1542
598 Ga0207698_10005251 3300026142 Bacteria 7971
599 Ga0207698_10117485 3300026142 Bacteria 2244
600 Ga0209588_1010709 3300027671 Bacteria 2761
601 Ga0209974_10003508 3300027876 Bacteria 5647
602 Ga0207428_10001623 3300027907 Bacteria 23347
603 Ga0207428_10117762 3300027907 Bacteria 2039
604 Ga0207428_10135769 3300027907 Bacteria 1880
605 Ga0268266_10000089 3300028379 Bacteria 198566
606 Ga0268266_10088905 3300028379 Bacteria 2704
607 Ga0268265_10018602 3300028380 Bacteria 4818
608 Ga0268265_10026095 3300028380 Bacteria 4153
609 Ga0268265_10026318 3300028380 Bacteria 4138
610 Ga0268265_10355986 3300028380 Bacteria 1338
611 Ga0268264_10007034 3300028381 Bacteria 9436
612 Ga0268264_10069792 3300028381 Bacteria 2973
613 Ga0268264_10080774 3300028381 Bacteria 2777
614 Ga0268264_10128605 3300028381 Bacteria 2242
615 Ga0307517_10003551 3300028786 Bacteria 24219
616 Ga0307515_10001481 3300028794 Bacteria 52778
617 Ga0307515_10001997 3300028794 Bacteria 45190
618 Ga0307515_10100898 3300028794 Bacteria 3490
619 Ga0265338_10015871 3300028800 Bacteria 8244
620 Ga0316177_1009900 3300030731 Bacteria 5129
621 Ga0316176_1141979 3300030732 Bacteria 21893
622 Ga0316183_1118483 3300030742 Bacteria 38677
623 Ga0316181_1033622 3300030744 Bacteria 4944
624 Ga0265339_10084041 3300031249 Bacteria 1678
625 Ga0265331_10075889 3300031250 Bacteria 1567
626 Ga0265316_10220112 3300031344 Bacteria 1401
627 Ga0307408_100016223 3300031548 Bacteria 4967
628 Ga0307408_100058015 3300031548 Bacteria 2813
629 Ga0307408_100149571 3300031548 Bacteria 1842
630 Ga0316579_10043400 3300031691 Bacteria 2092
631 Ga0316576_10127932 3300031727 Bacteria 1910
632 Ga0307405_10001983 3300031731 Bacteria 8851
633 Ga0307405_10058440 3300031731 Bacteria 2427
634 Ga0307413_10001627 3300031824 Bacteria 8700
635 Ga0307413_10036294 3300031824 Bacteria 2836
636 Ga0307410_10002169 3300031852 Bacteria 9326
637 Ga0307410_10390195 3300031852 Bacteria 1122
638 Ga0307410_10435734 3300031852 Bacteria 1066
639 Ga0307406_10042010 3300031901 Bacteria 2853
640 Ga0307406_10091712 3300031901 Bacteria 2047
641 Ga0307406_10441028 3300031901 Bacteria 1042
642 Ga0307407_10067696 3300031903 Bacteria 2112
643 Ga0307412_10045347 3300031911 Bacteria 2873
644 Ga0307412_10052264 3300031911 Bacteria 2705
645 Ga0307412_10077908 3300031911 Bacteria 2281
646 Ga0307412_10284247 3300031911 Bacteria 1300
647 Ga0307412_10406460 3300031911 Bacteria 1110
648 Ga0307409_100007363 3300031995 Bacteria 6576
649 Ga0307409_100056497 3300031995 Bacteria 3036
650 Ga0307409_100817175 3300031995 Bacteria 941
651 Ga0307416_100001756 3300032002 Bacteria 12005
652 Ga0307416_100013314 3300032002 Bacteria 5587
653 Ga0307416_100042843 3300032002 Bacteria 3538
654 Ga0307414_10041283 3300032004 Bacteria 3124
655 Ga0307411_10000610 3300032005 Bacteria 12858
656 Ga0307411_10121123 3300032005 Bacteria 1893
657 Ga0307411_10256934 3300032005 Bacteria 1377
658 Ga0307415_100051090 3300032126 Bacteria 2804
659 Ga0307415_100117087 3300032126 Bacteria 1989
660 Ga0307415_100151684 3300032126 Bacteria 1784
661 Ga0307415_100405665 3300032126 Bacteria 1165
662 Ga0316585_10039603 3300032137 Bacteria 1499
663 Ga0316580_10007805 3300032139 Bacteria 3194
664 Ga0307507_10000015 3300033179 Bacteria 237419
665 Ga0373940_0085463 3300035088 Bacteria 939
666 Ga0373951_0004432 3300035091 Bacteria 3336
667 Ga0373941_0107012 3300035115 Bacteria 981
668 Ga0373942_0019143 3300035207 Bacteria 1706
669 Ga0373962_0030121 3300035242 Bacteria 1483
670 Ga0373937_0110636 3300036401 Bacteria 2555
671 Ga0373937_0273069 3300036401 Bacteria 1596
672 Ga0373937_0498038 3300036401 Bacteria 1158
673 Ga0316582_0022813 3300036647 Bacteria 3722
674 Ga0316584_0052688 3300036712 Bacteria 3043
675 Ga0316584_0057497 3300036712 Bacteria 2911
676 Ga0395899_0000033 3300037312 Bacteria 306589
677 Ga0395899_0000659 3300037312 Bacteria 35170
678 Ga0395899_0001109 3300037312 Bacteria 24123
679 Ga0395899_0021085 3300037312 Bacteria 4942
680 Ga0395900_0000277 3300037418 Bacteria 77256
681 Ga0395900_0001234 3300037418 Bacteria 31453
682 Ga0395900_0019640 3300037418 Bacteria 6889
683 Ga0395900_0127856 3300037418 Bacteria 2605
684 Ga0395898_0001918 3300037466 Bacteria 26473
685 Ga0395905_0000068 3300037471 Bacteria 177163
686 Ga0395905_0000348 3300037471 Bacteria 65915
687 Ga0395905_0004443 3300037471 Bacteria 14577
688 Ga0395901_0000199 3300038443 Bacteria 76415
689 Ga0395901_0005268 3300038443 Bacteria 13060
690 Ga0395901_0140444 3300038443 Bacteria 2539
691 Ga0395901_0173777 3300038443 Bacteria 2260
692 Ga0242420_003202 3300038996 Bacteria 2411
693 Ga0242420_011217 3300038996 Bacteria 1499
694 Ga0436365_0065130 3300039437 Bacteria 167769
695 Ga0436361_0742208 3300039447 Bacteria 6052
696 Ga0439448_0020387 3300042005 Bacteria 2050
697 Ga0439464_0003170 3300042439 Bacteria 4124
698 Ga0439460_0036907 3300042461 Bacteria 1420
699 Ga0451577_0000034 3300042876 Bacteria 376183
700 Ga0451577_0003212 3300042876 Bacteria 18354
701 Ga0451577_0025370 3300042876 Bacteria 5378
702 Ga0451577_0132698 3300042876 Bacteria 2235
703 Ga0466969_0032580 3300044656 Bacteria 2649
704 Ga0453683_0000005 3300044673 Bacteria 741657
705 Ga0453683_0000122 3300044673 Bacteria 116184
706 Ga0453683_0004573 3300044673 Bacteria 9780
707 Ga0453683_0127057 3300044673 Bacteria 1605
708 Ga0453683_0156419 3300044673 Bacteria 1441
709 Ga0466966_0016086 3300044684 Bacteria 4946
710 Ga0466961_0102343 3300044693 Bacteria 1804
711 Ga0453684_0000098 3300044712 Bacteria 376183
712 Ga0453684_0000467 3300044712 Bacteria 161003
713 Ga0453684_0000603 3300044712 Bacteria 132340
714 Ga0453684_0001278 3300044712 Bacteria 75250
715 Ga0453684_0065621 3300044712 Bacteria 4628
716 Ga0453684_0268672 3300044712 Bacteria 1950
717 Ga0466968_0072467 3300044735 Bacteria 1502
718 Ga0451576_0000036 3300045051 Bacteria 376183
719 Ga0451576_0000397 3300045051 Bacteria 101182
720 Ga0451576_0005569 3300045051 Bacteria 15735
721 Ga0451576_0023567 3300045051 Bacteria 6663
722 Ga0451576_0046399 3300045051 Bacteria 4575
723 Ga0451576_0114207 3300045051 Bacteria 2811
724 Ga0466967_0097786 3300045976 Bacteria 2679
725 Ga0495603_0042271 3300046455 Bacteria 2725
726 Ga0495629_0126159 3300046459 Bacteria 1783
727 Ga0495638_0102196 3300046460 Bacteria 1713
728 Ga0495638_0235657 3300046460 Bacteria 1016
729 Ga0495650_0000014 3300046471 Bacteria 581606
730 Ga0495580_0378928 3300046472 Bacteria 956
731 Ga0495582_0004387 3300046473 Bacteria 7935
732 Ga0495664_0059927 3300046477 Bacteria 2266
733 Ga0495584_0088190 3300046491 Bacteria 1564
734 Ga0495585_0001521 3300046492 Bacteria 18009
735 Ga0495585_0003658 3300046492 Bacteria 10277
736 Ga0495596_0018700 3300046500 Bacteria 2854
737 Ga0495606_0000528 3300046507 Bacteria 61795
738 Ga0495606_0005674 3300046507 Bacteria 11821
739 Ga0495606_0016540 3300046507 Bacteria 5616
740 Ga0495610_0006009 3300046512 Bacteria 8481
741 Ga0495616_0005759 3300046513 Bacteria 7578
742 Ga0495616_0023741 3300046513 Bacteria 3296
743 Ga0495631_0087772 3300046518 Bacteria 1339
744 Ga0495631_0109135 3300046518 Bacteria 1190
745 Ga0495632_0230054 3300046519 Bacteria 836
746 Ga0495644_0051316 3300046523 Bacteria 1549
747 Ga0495642_0034662 3300046528 Bacteria 2034
748 Ga0495652_0157877 3300046529 Bacteria 1764
749 Ga0495665_0052354 3300046531 Bacteria 2161
750 Ga0495609_0005281 3300046538 Bacteria 6852
751 Ga0495609_0052156 3300046538 Bacteria 1820
752 Ga0495622_0041224 3300046557 Bacteria 2147
753 Ga0495633_0000035 3300046558 Bacteria 185403
754 Ga0495633_0011158 3300046558 Bacteria 4867
755 Ga0495633_0015320 3300046558 Bacteria 3979
756 Ga0495668_0000032 3300046616 Bacteria 254951
757 Ga0495634_0237511 3300046642 Bacteria 1119
758 Ga0495625_0000009 3300046660 Bacteria 404954
759 Ga0495625_0000753 3300046660 Bacteria 45225
760 Ga0495625_0001432 3300046660 Bacteria 29071
761 Ga0495625_0082121 3300046660 Bacteria 2242
762 Ga0495625_0099251 3300046660 Bacteria 2002
763 Ga0495625_0301139 3300046660 Bacteria 1026
764 Ga0495659_0016122 3300046664 Bacteria 2462
765 Ga0495659_0068983 3300046664 Bacteria 1321
766 Ga0495661_0000707 3300046665 Bacteria 33018
767 Ga0495661_0004079 3300046665 Bacteria 10640
768 Ga0495647_0005287 3300046681 Bacteria 4228
769 Ga0495647_0023171 3300046681 Bacteria 2250
770 Ga0495658_0000570 3300046683 Bacteria 20102
771 Ga0495658_0075837 3300046683 Bacteria 1963
772 Ga0495658_0136364 3300046683 Bacteria 1497
773 Ga0495658_0163109 3300046683 Bacteria 1376
774 Ga0495658_0191774 3300046683 Bacteria 1271
775 Ga0495669_0010075 3300046684 Bacteria 3992
776 Ga0495670_0061831 3300046691 Bacteria 1883
777 Ga0495649_0000002 3300046694 Bacteria 1093458
778 Ga0495676_0248657 3300047321 Bacteria 1214
779 Ga0495680_0339732 3300047322 Bacteria 1048
780 Ga0495687_001120 3300047443 Bacteria 26041
781 Ga0495687_006439 3300047443 Bacteria 7196
782 Ga0495677_0037403 3300047445 Bacteria 1773
783 Ga0495686_0001209 3300047472 Bacteria 29698
784 Ga0495686_0001825 3300047472 Bacteria 21435
785 Ga0495602_0001510 3300048088 Bacteria 23177
786 Ga0495614_0083785 3300048089 Bacteria 1383
787 Ga0495626_0009849 3300048091 Bacteria 5138
788 Ga0496100_0167413 3300048903 Bacteria 1580
789 Ga0496102_0030220 3300048905 Bacteria 4848
790 Ga0496102_0042442 3300048905 Bacteria 4121
791 Ga0496103_0061654 3300048906 Bacteria 2333
792 Ga0496103_0120921 3300048906 Bacteria 1668
793 Ga0496104_0020868 3300048907 Bacteria 6008
794 Ga0496104_0098177 3300048907 Bacteria 2804
795 Ga0496106_0000834 3300048909 Bacteria 22319
796 Ga0496106_0032249 3300048909 Bacteria 3906
797 Ga0496106_0045581 3300048909 Bacteria 3294
798 Ga0496107_0046604 3300048910 Bacteria 3120
799 Ga0496107_0156100 3300048910 Bacteria 1690
800 Ga0496107_0204380 3300048910 Bacteria 1468
801 Ga0496107_0314167 3300048910 Bacteria 1166
802 Ga0496108_0031353 3300048911 Bacteria 4411
803 Ga0496108_0595622 3300048911 Bacteria 963
804 Ga0496109_0278429 3300048912 Bacteria 1577
805 Ga0496109_0531654 3300048912 Bacteria 1109
806 Ga0496110_0265779 3300048913 Bacteria 1562
807 Ga0496111_0202197 3300048914 Bacteria 1477
808 Ga0496112_0315805 3300048915 Bacteria 1507
809 Ga0496112_0547925 3300048915 Bacteria 1091
810 Ga0496112_0610918 3300048915 Bacteria 1022
811 Ga0496112_0641627 3300048915 Bacteria 992
812 Ga0496113_0131242 3300048916 Bacteria 1966
813 Ga0496113_0194871 3300048916 Bacteria 1609
814 Ga0496116_0002379 3300048919 Bacteria 19844
815 Ga0496117_0002276 3300048920 Bacteria 24806
816 Ga0496118_0026652 3300048921 Bacteria 4916
817 Ga0496122_0015395 3300048925 Bacteria 7314
818 Ga0496123_0018244 3300048926 Bacteria 5590
819 Ga0496125_0038198 3300048928 Bacteria 4161
820 Ga0495678_033997 3300049459 Bacteria 2101
821 Ga0501298_018491 3300049521 Bacteria 1282
822 Ga0501299_025167 3300049522 Bacteria 1116
823 Ga0501033_0108285 3300049570 Bacteria 2024
824 Ga0501036_0445463 3300049572 Bacteria 1079
825 Ga0501038_0020497 3300049574 Bacteria 5940
826 Ga0501041_0043753 3300049577 Bacteria 2722
827 Ga0501041_0127761 3300049577 Bacteria 1583
828 Ga0501042_0005696 3300049578 Bacteria 8040
829 Ga0501042_0346235 3300049578 Bacteria 1075
830 Ga0501046_0258124 3300049580 Bacteria 1281
831 Ga0501047_0153441 3300049581 Bacteria 2178
832 Ga0501048_0049392 3300049582 Bacteria 2998
833 Ga0501068_0172402 3300049584 Bacteria 1366
834 Ga0501069_0128203 3300049585 Bacteria 1452
835 Ga0501071_0030335 3300049587 Bacteria 3824
836 Ga0501071_0055109 3300049587 Bacteria 2870
837 Ga0501071_0095316 3300049587 Bacteria 2190
838 Ga0501071_0263414 3300049587 Bacteria 1302
839 Ga0501072_0115331 3300049588 Bacteria 2139
840 Ga0501074_0315803 3300049590 Bacteria 1110
841 Ga0501075_0516219 3300049591 Bacteria 912
842 Ga0501076_0054267 3300049592 Bacteria 3176
843 Ga0501076_0120138 3300049592 Bacteria 2128
844 Ga0501076_0558653 3300049592 Bacteria 944
845 Ga0501201_008382 3300049651 Bacteria 997
846 Ga0501202_010222 3300049652 Bacteria 1738
847 Ga0501207_010580 3300049654 Bacteria 1363
848 Ga0501216_009248 3300049660 Bacteria 1568
849 Ga0501217_015028 3300049661 Bacteria 1757
850 Ga0501223_012726 3300049663 Bacteria 1680
851 Ga0501224_006106 3300049664 Bacteria 1743
852 Ga0501233_040704 3300049668 Bacteria 1091
853 Ga0501243_027846 3300049675 Bacteria 955
854 Ga0501247_003827 3300049677 Bacteria 1628
855 Ga0501261_023759 3300049690 Bacteria 894
856 Ga0501221_037169 3300049704 Bacteria 1047
857 Ga0501225_0040627 3300049705 Bacteria 1282
858 Ga0501079_0030984 3300049741 Bacteria 4110
859 Ga0501080_0140288 3300049742 Bacteria 2235
860 Ga0501081_0445458 3300049743 Bacteria 962
861 Ga0501263_000507 3300049760 Bacteria 2952
862 Ga0501273_015469 3300049770 Bacteria 991
863 Ga0501035_0283680 3300049822 Bacteria 1399
864 Ga0501044_0778945 3300049823 Bacteria 837
865 Ga0501045_0018713 3300049824 Bacteria 4931
866 Ga0501045_0351132 3300049824 Bacteria 1098
867 nmdc:mga0k408_23828_c1 3300050493 Bacteria 2298
868 nmdc:mga0k408_260_c1 3300050493 Bacteria 28863
869 nmdc:mga0k408_859_c1 3300050493 Bacteria 12690
870 nmdc:mga05p37_10032_c1 3300050507 Bacteria 11242
871 nmdc:mga05p37_197765_c1 3300050507 Bacteria 2437
872 nmdc:mga05p37_21055_c1 3300050507 Bacteria 7893
873 nmdc:mga05p37_271433_c1 3300050507 Bacteria 2026
874 nmdc:mga05p37_346171_c1 3300050507 Bacteria 1751
875 nmdc:mga05p37_39517_c1 3300050507 Bacteria 5793
876 nmdc:mga09592_1094_c1 3300050508 Bacteria 21508
877 nmdc:mga09592_11444_c1 3300050508 Bacteria 7216
878 nmdc:mga09592_137492_c1 3300050508 Bacteria 2105
879 nmdc:mga09592_207144_c1 3300050508 Bacteria 1698
880 nmdc:mga09592_24524_c1 3300050508 Bacteria 4988
881 nmdc:mga09592_24982_c1 3300050508 Bacteria 4942
882 nmdc:mga09592_397145_c1 3300050508 Bacteria 1192
883 nmdc:mga0qj67_15222_c1 3300050509 Bacteria 5821
884 nmdc:mga0qj67_212774_c1 3300050509 Bacteria 1570
885 nmdc:mga0qj67_45964_c1 3300050509 Bacteria 3445
886 nmdc:mga06r32_2891_c1 3300050510 Bacteria 15411
887 nmdc:mga06r32_78179_c1 3300050510 Bacteria 3215
888 nmdc:mga08y16_178990_c1 3300050511 Bacteria 2202
889 nmdc:mga08y16_28893_c1 3300050511 Bacteria 5845
890 nmdc:mga08y16_296218_c1 3300050511 Bacteria 1668
891 nmdc:mga08y16_487978_c1 3300050511 Bacteria 1253
892 nmdc:mga08y16_58876_c1 3300050511 Bacteria 4014
893 nmdc:mga08y16_76589_c1 3300050511 Bacteria 3487
894 nmdc:mga08y16_821_c1 3300050511 Bacteria 29792
895 nmdc:mga0n895_163892_c1 3300050512 Bacteria 2254
896 nmdc:mga0n895_726655_c1 3300050512 Bacteria 987
897 nmdc:mga0rr50_139_c1 3300050513 Bacteria 40055
898 nmdc:mga0rr50_170349_c1 3300050513 Bacteria 1774
899 nmdc:mga0rr50_4236_c1 3300050513 Bacteria 8392
900 nmdc:mga08x19_3622_c1 3300050514 Bacteria 9201
901 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
902 nmdc:mga0a205_174193_c1 3300050515 Bacteria 2047
903 nmdc:mga0a205_273633_c1 3300050515 Bacteria 1565
904 nmdc:mga0a205_302050_c1 3300050515 Bacteria 1474
905 nmdc:mga0a205_63177_c1 3300050515 Bacteria 3577
906 nmdc:mga0a205_7292_c1 3300050515 Bacteria 10004
907 nmdc:mga0a205_88196_c1 3300050515 Bacteria 2998
908 Ga0495601_0153090 3300053077 Bacteria 1506
909 Ga0500635_0001015 3300053080 Bacteria 6718
910 Ga0500555_000471 3300053103 Bacteria 16699
911 Ga0500608_000203 3300053122 Bacteria 23751
912 Ga0500608_007068 3300053122 Bacteria 4615
913 Ga0500618_000037 3300053125 Bacteria 117320
914 Ga0500618_008815 3300053125 Bacteria 2788
915 Ga0500622_0001600 3300053156 Bacteria 17790
916 Ga0500624_000694 3300053157 Bacteria 8505
917 Ga0590074_040918 3300059423 Bacteria 834
918 Ga0587085_028233 3300059506 Bacteria 905
919 Ga0501082_0623385 3300060353 Bacteria 944
920 Ga0530510_0029172 3300061734 Bacteria 3959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10150889 Ga0207647_101508892 222
2 3300046507 Ga0495606_0016540 Ga0495606_0016540_2990_3709 223
3 3300002459 JGI24751J29686_10054973 JGI24751J29686_100549731 224
4 3300005288 Ga0065714_10148595 Ga0065714_101485952 224
5 3300005290 Ga0065712_10089641 Ga0065712_100896412 224
6 3300005293 Ga0065715_10343798 Ga0065715_103437981 224
7 3300005330 Ga0070690_100054471 Ga0070690_1000544712 224
8 3300005331 Ga0070670_100000767 Ga0070670_1000007676 224
9 3300005340 Ga0070689_100023397 Ga0070689_1000233974 224
10 3300005344 Ga0070661_100050498 Ga0070661_1000504982 224
11 3300005354 Ga0070675_100047495 Ga0070675_1000474953 224
12 3300005365 Ga0070688_100009040 Ga0070688_1000090404 224
13 3300005468 Ga0070707_100768365 Ga0070707_1007683651 224
14 3300005543 Ga0070672_100019003 Ga0070672_1000190032 224
15 3300005564 Ga0070664_100004294 Ga0070664_1000042942 224
16 3300005564 Ga0070664_100025146 Ga0070664_1000251463 224
17 3300005618 Ga0068864_100106485 Ga0068864_1001064852 224
18 3300006880 Ga0075429_100092571 Ga0075429_1000925712 224
19 3300009147 Ga0114129_10654159 Ga0114129_106541592 224
20 3300014325 Ga0163163_10018317 Ga0163163_100183172 224
21 3300025920 Ga0207649_10034440 Ga0207649_100344403 224
22 3300025925 Ga0207650_10002299 Ga0207650_100022996 224
23 3300025926 Ga0207659_10013295 Ga0207659_100132952 224
24 3300025931 Ga0207644_10073528 Ga0207644_100735282 224
25 3300025936 Ga0207670_10035418 Ga0207670_100354182 224
26 3300025940 Ga0207691_10005500 Ga0207691_100055005 224
27 3300025945 Ga0207679_10001977 Ga0207679_100019778 224
28 3300025945 Ga0207679_10025207 Ga0207679_100252073 224
29 3300026075 Ga0207708_10664032 Ga0207708_106640322 224
30 3300026095 Ga0207676_10090487 Ga0207676_100904873 224
31 3300031548 Ga0307408_100149571 Ga0307408_1001495712 224
32 3300031731 Ga0307405_10001983 Ga0307405_100019833 224
33 3300031824 Ga0307413_10036294 Ga0307413_100362942 224
34 3300031852 Ga0307410_10002169 Ga0307410_100021697 224
35 3300031852 Ga0307410_10390195 Ga0307410_103901951 224
36 3300031901 Ga0307406_10091712 Ga0307406_100917122 224
37 3300031911 Ga0307412_10045347 Ga0307412_100453473 224
38 3300031911 Ga0307412_10284247 Ga0307412_102842472 224
39 3300031995 Ga0307409_100007363 Ga0307409_1000073634 224
40 3300032002 Ga0307416_100001756 Ga0307416_1000017562 224
41 3300032002 Ga0307416_100042843 Ga0307416_1000428434 224
42 3300032005 Ga0307411_10000610 Ga0307411_1000061013 224
43 3300032126 Ga0307415_100405665 Ga0307415_1004056652 224
44 3300046459 Ga0495629_0126159 Ga0495629_0126159_694_1395 224
45 3300046531 Ga0495665_0052354 Ga0495665_0052354_1043_1744 224
46 3300046558 Ga0495633_0015320 Ga0495633_0015320_87_791 224
47 3300046681 Ga0495647_0005287 Ga0495647_0005287_3441_4142 224
48 3300046681 Ga0495647_0023171 Ga0495647_0023171_156_860 224
49 3300046683 Ga0495658_0075837 Ga0495658_0075837_1038_1742 224
50 3300046683 Ga0495658_0191774 Ga0495658_0191774_429_1130 224
51 3300046691 Ga0495670_0061831 Ga0495670_0061831_319_1023 224
52 3300048088 Ga0495602_0001510 Ga0495602_0001510_4172_4870 224
53 3300049572 Ga0501036_0445463 Ga0501036_0445463_356_1057 224
54 3300049587 Ga0501071_0095316 Ga0501071_0095316_1412_2113 224
55 3300049741 Ga0501079_0030984 Ga0501079_0030984_1269_1970 224
56 3300049743 Ga0501081_0445458 Ga0501081_0445458_35_745 224
57 3300050508 nmdc:mga09592_137492_c1 nmdc:mga09592_137492_c1_1277_1981 224
58 3300005334 Ga0068869_100080076 Ga0068869_1000800762 225
59 3300005336 Ga0070680_100302537 Ga0070680_1003025372 225
60 3300005336 Ga0070680_100458117 Ga0070680_1004581172 225
61 3300005340 Ga0070689_100779276 Ga0070689_1007792761 225
62 3300005341 Ga0070691_10113953 Ga0070691_101139532 225
63 3300005341 Ga0070691_10313527 Ga0070691_103135272 225
64 3300005345 Ga0070692_10031317 Ga0070692_100313172 225
65 3300005438 Ga0070701_10026549 Ga0070701_100265492 225
66 3300005441 Ga0070700_100118473 Ga0070700_1001184732 225
67 3300005444 Ga0070694_100029319 Ga0070694_1000293192 225
68 3300005444 Ga0070694_100359661 Ga0070694_1003596611 225
69 3300005444 Ga0070694_100696880 Ga0070694_1006968801 225
70 3300005459 Ga0068867_100512828 Ga0068867_1005128282 225
71 3300005545 Ga0070695_100174986 Ga0070695_1001749862 225
72 3300005549 Ga0070704_100098350 Ga0070704_1000983502 225
73 3300005617 Ga0068859_100169538 Ga0068859_1001695382 225
74 3300005719 Ga0068861_100126572 Ga0068861_1001265722 225
75 3300005844 Ga0068862_100033821 Ga0068862_1000338214 225
76 3300005937 Ga0081455_10422222 Ga0081455_104222222 225
77 3300006846 Ga0075430_100066766 Ga0075430_1000667663 225
78 3300006871 Ga0075434_100000831 Ga0075434_1000008313 225
79 3300006871 Ga0075434_100706617 Ga0075434_1007066171 225
80 3300006880 Ga0075429_100031368 Ga0075429_1000313686 225
81 3300006881 Ga0068865_100071929 Ga0068865_1000719292 225
82 3300006931 Ga0097620_100169531 Ga0097620_1001695312 225
83 3300009148 Ga0105243_10133231 Ga0105243_101332312 225
84 3300014326 Ga0157380_11116714 Ga0157380_111167141 225
85 3300025911 Ga0207654_10425683 Ga0207654_104256831 225
86 3300025917 Ga0207660_10032391 Ga0207660_100323913 225
87 3300025917 Ga0207660_10119374 Ga0207660_101193742 225
88 3300025938 Ga0207704_10101785 Ga0207704_101017852 225
89 3300025942 Ga0207689_10066062 Ga0207689_100660622 225
90 3300026075 Ga0207708_10039998 Ga0207708_100399982 225
91 3300026075 Ga0207708_10184541 Ga0207708_101845411 225
92 3300026089 Ga0207648_10317344 Ga0207648_103173441 225
93 3300026116 Ga0207674_10145605 Ga0207674_101456052 225
94 3300026118 Ga0207675_100184473 Ga0207675_1001844732 225
95 3300026118 Ga0207675_100484499 Ga0207675_1004844992 225
96 3300028380 Ga0268265_10018602 Ga0268265_100186022 225
97 3300031824 Ga0307413_10001627 Ga0307413_100016273 225
98 3300031995 Ga0307409_100817175 Ga0307409_1008171752 225
99 3300046664 Ga0495659_0016122 Ga0495659_0016122_831_1544 225
100 3300049588 Ga0501072_0115331 Ga0501072_0115331_874_1575 225
101 3300049590 Ga0501074_0315803 Ga0501074_0315803_219_920 225
102 3300049591 Ga0501075_0516219 Ga0501075_0516219_177_878 225
103 3300050509 nmdc:mga0qj67_45964_c1 nmdc:mga0qj67_45964_c1_558_1259 225
104 3300050511 nmdc:mga08y16_296218_c1 nmdc:mga08y16_296218_c1_748_1449 225
105 3300050515 nmdc:mga0a205_63177_c1 nmdc:mga0a205_63177_c1_1773_2486 225
106 iso_pu_bacteria 2738541284 2738762616 225
107 iso_pu_bacteria 2842903701 2842906507 225
108 3300005295 Ga0065707_10322946 Ga0065707_103229461 226
109 3300005334 Ga0068869_100165587 Ga0068869_1001655872 226
110 3300005340 Ga0070689_100000816 Ga0070689_1000008165 226
111 3300005353 Ga0070669_100011817 Ga0070669_1000118173 226
112 3300005365 Ga0070688_100000427 Ga0070688_1000004275 226
113 3300005444 Ga0070694_100005028 Ga0070694_1000050286 226
114 3300005467 Ga0070706_100037115 Ga0070706_1000371151 226
115 3300005536 Ga0070697_100101472 Ga0070697_1001014722 226
116 3300005549 Ga0070704_100031410 Ga0070704_1000314102 226
117 3300005843 Ga0068860_100027839 Ga0068860_1000278394 226
118 3300005844 Ga0068862_100038785 Ga0068862_1000387853 226
119 3300006852 Ga0075433_10015116 Ga0075433_100151165 226
120 3300006852 Ga0075433_10282341 Ga0075433_102823412 226
121 3300006871 Ga0075434_100010744 Ga0075434_1000107442 226
122 3300006880 Ga0075429_100011725 Ga0075429_1000117256 226
123 3300006914 Ga0075436_100389832 Ga0075436_1003898322 226
124 3300007076 Ga0075435_100095774 Ga0075435_1000957742 226
125 3300009098 Ga0105245_10607140 Ga0105245_106071401 226
126 3300009147 Ga0114129_10007783 Ga0114129_1000778314 226
127 3300009147 Ga0114129_10018669 Ga0114129_100186693 226
128 3300009176 Ga0105242_10256131 Ga0105242_102561312 226
129 3300009553 Ga0105249_10013986 Ga0105249_100139869 226
130 3300013297 Ga0157378_10039044 Ga0157378_100390444 226
131 3300013306 Ga0163162_10033657 Ga0163162_100336575 226
132 3300014968 Ga0157379_10047882 Ga0157379_100478823 226
133 3300025910 Ga0207684_10007514 Ga0207684_100075148 226
134 3300025922 Ga0207646_10026415 Ga0207646_100264154 226
135 3300025931 Ga0207644_10425065 Ga0207644_104250652 226
136 3300025936 Ga0207670_10000065 Ga0207670_1000006556 226
137 3300025940 Ga0207691_10056180 Ga0207691_100561802 226
138 3300025960 Ga0207651_10042500 Ga0207651_100425002 226
139 3300025972 Ga0207668_10338072 Ga0207668_103380721 226
140 3300025986 Ga0207658_10234206 Ga0207658_102342062 226
141 3300026067 Ga0207678_10021588 Ga0207678_100215883 226
142 3300026088 Ga0207641_10669928 Ga0207641_106699282 226
143 3300027876 Ga0209974_10003508 Ga0209974_100035083 226
144 3300028380 Ga0268265_10026095 Ga0268265_100260953 226
145 3300031249 Ga0265339_10084041 Ga0265339_100840412 226
146 3300031250 Ga0265331_10075889 Ga0265331_100758892 226
147 3300031344 Ga0265316_10220112 Ga0265316_102201122 226
148 3300035242 Ga0373962_0030121 Ga0373962_0030121_118_837 226
149 3300042461 Ga0439460_0036907 Ga0439460_0036907_543_1244 226
150 3300045051 Ga0451576_0046399 Ga0451576_0046399_3672_4391 226
151 3300045976 Ga0466967_0097786 Ga0466967_0097786_1542_2252 226
152 3300048905 Ga0496102_0042442 Ga0496102_0042442_3368_4087 226
153 3300048910 Ga0496107_0156100 Ga0496107_0156100_459_1178 226
154 3300049578 Ga0501042_0346235 Ga0501042_0346235_181_936 226
155 3300049584 Ga0501068_0172402 Ga0501068_0172402_239_973 226
156 3300049585 Ga0501069_0128203 Ga0501069_0128203_581_1291 226
157 3300050507 nmdc:mga05p37_39517_c1 nmdc:mga05p37_39517_c1_3142_3855 226
158 3300050511 nmdc:mga08y16_178990_c1 nmdc:mga08y16_178990_c1_767_1501 226
159 3300050511 nmdc:mga08y16_487978_c1 nmdc:mga08y16_487978_c1_167_892 226
160 3300050512 nmdc:mga0n895_726655_c1 nmdc:mga0n895_726655_c1_110_829 226
161 3300050515 nmdc:mga0a205_273633_c1 nmdc:mga0a205_273633_c1_199_918 226
162 3300050515 nmdc:mga0a205_7292_c1 nmdc:mga0a205_7292_c1_5510_6223 226
163 3300060353 Ga0501082_0623385 Ga0501082_0623385_153_908 226
164 iso_pu_bacteria 2721755487 2722726500 226
165 iso_pu_bacteria 2896317667 2896319414 226
166 iso_pu_bacteria 2904780799 2904783635 226
167 iso_pu_bacteria 2919177583 2919182186 226
168 iso_pu_bacteria 3003233435 3003233521 226
169 iso_pu_bacteria 8055588893 8055590801 226
170 3300005290 Ga0065712_10204759 Ga0065712_102047592 227
171 3300005293 Ga0065715_10443342 Ga0065715_104433421 227
172 3300005353 Ga0070669_100324176 Ga0070669_1003241762 227
173 3300005355 Ga0070671_100208803 Ga0070671_1002088032 227
174 3300005441 Ga0070700_100199413 Ga0070700_1001994131 227
175 3300005467 Ga0070706_100049046 Ga0070706_1000490463 227
176 3300005536 Ga0070697_100213432 Ga0070697_1002134322 227
177 3300005546 Ga0070696_100008944 Ga0070696_1000089445 227
178 3300005564 Ga0070664_100461099 Ga0070664_1004610992 227
179 3300005841 Ga0068863_100210158 Ga0068863_1002101582 227
180 3300006846 Ga0075430_100088661 Ga0075430_1000886612 227
181 3300006852 Ga0075433_10366468 Ga0075433_103664682 227
182 3300006931 Ga0097620_100011064 Ga0097620_1000110643 227
183 3300007076 Ga0075435_100032986 Ga0075435_1000329864 227
184 3300009147 Ga0114129_10843987 Ga0114129_108439872 227
185 3300009551 Ga0105238_11076560 Ga0105238_110765601 227
186 3300013306 Ga0163162_10110885 Ga0163162_101108852 227
187 3300025910 Ga0207684_10121834 Ga0207684_101218342 227
188 3300025923 Ga0207681_10264841 Ga0207681_102648412 227
189 3300025931 Ga0207644_10096507 Ga0207644_100965072 227
190 3300025942 Ga0207689_10380763 Ga0207689_103807631 227
191 3300025945 Ga0207679_10547559 Ga0207679_105475591 227
192 3300025961 Ga0207712_10476213 Ga0207712_104762132 227
193 3300026088 Ga0207641_10175600 Ga0207641_101756002 227
194 3300027907 Ga0207428_10001623 Ga0207428_100016232 227
195 3300031548 Ga0307408_100016223 Ga0307408_1000162234 227
196 3300036401 Ga0373937_0273069 Ga0373937_0273069_522_1229 227
197 3300036401 Ga0373937_0498038 Ga0373937_0498038_402_1103 227
198 3300042439 Ga0439464_0003170 Ga0439464_0003170_583_1293 227
199 3300045051 Ga0451576_0005569 Ga0451576_0005569_6600_7316 227
200 3300045051 Ga0451576_0023567 Ga0451576_0023567_2235_2951 227
201 3300046455 Ga0495603_0042271 Ga0495603_0042271_1071_1796 227
202 3300046472 Ga0495580_0378928 Ga0495580_0378928_51_776 227
203 3300046477 Ga0495664_0059927 Ga0495664_0059927_639_1346 227
204 3300046491 Ga0495584_0088190 Ga0495584_0088190_353_1063 227
205 3300046528 Ga0495642_0034662 Ga0495642_0034662_1126_1836 227
206 3300046538 Ga0495609_0052156 Ga0495609_0052156_169_879 227
207 3300046664 Ga0495659_0068983 Ga0495659_0068983_187_897 227
208 3300046683 Ga0495658_0163109 Ga0495658_0163109_617_1324 227
209 3300046684 Ga0495669_0010075 Ga0495669_0010075_2336_3046 227
210 3300047321 Ga0495676_0248657 Ga0495676_0248657_327_1052 227
211 3300047322 Ga0495680_0339732 Ga0495680_0339732_150_857 227
212 3300049522 Ga0501299_025167 Ga0501299_025167_245_955 227
213 3300049577 Ga0501041_0043753 Ga0501041_0043753_1949_2656 227
214 3300049587 Ga0501071_0055109 Ga0501071_0055109_466_1173 227
215 3300049592 Ga0501076_0054267 Ga0501076_0054267_1771_2478 227
216 3300049668 Ga0501233_040704 Ga0501233_040704_344_1054 227
217 3300049690 Ga0501261_023759 Ga0501261_023759_141_851 227
218 3300049742 Ga0501080_0140288 Ga0501080_0140288_437_1144 227
219 3300049770 Ga0501273_015469 Ga0501273_015469_53_763 227
220 3300049824 Ga0501045_0018713 Ga0501045_0018713_618_1325 227
221 3300050507 nmdc:mga05p37_10032_c1 nmdc:mga05p37_10032_c1_710_1420 227
222 3300050507 nmdc:mga05p37_197765_c1 nmdc:mga05p37_197765_c1_1680_2399 227
223 3300050507 nmdc:mga05p37_271433_c1 nmdc:mga05p37_271433_c1_1212_1913 227
224 3300050508 nmdc:mga09592_1094_c1 nmdc:mga09592_1094_c1_3591_4301 227
225 3300050509 nmdc:mga0qj67_15222_c1 nmdc:mga0qj67_15222_c1_2725_3435 227
226 3300050510 nmdc:mga06r32_2891_c1 nmdc:mga06r32_2891_c1_343_1053 227
227 3300050511 nmdc:mga08y16_821_c1 nmdc:mga08y16_821_c1_16941_17651 227
228 3300050513 nmdc:mga0rr50_170349_c1 nmdc:mga0rr50_170349_c1_230_949 227
229 3300050515 nmdc:mga0a205_302050_c1 nmdc:mga0a205_302050_c1_158_877 227
230 3300053077 Ga0495601_0153090 Ga0495601_0153090_245_952 227
231 3300059423 Ga0590074_040918 Ga0590074_040918_19_717 227
232 3300001915 JGI24741J21665_1012612 JGI24741J21665_10126122 228
233 3300001979 JGI24740J21852_10016887 JGI24740J21852_100168872 228
234 3300002077 JGI24744J21845_10002026 JGI24744J21845_100020263 228
235 3300002737 JGI25162J39368_1000498 JGI25162J39368_100049815 228
236 3300002741 JGI25157J39369_1005927 JGI25157J39369_10059272 228
237 3300003214 JGI25165J46597_1000618 JGI25165J46597_100061813 228
238 3300003320 rootH2_10018591 rootH2_1001859114 228
239 3300003320 rootH2_10039562 rootH2_100395622 228
240 3300003320 rootH2_10186211 rootH2_101862112 228
241 3300003323 rootH1_10010194 rootH1_1001019418 228
242 3300003323 rootH1_10105642 rootH1_101056421 228
243 3300003323 rootH1_10379396 rootH1_103793961 228
244 3300004799 Ga0058863_11791471 Ga0058863_117914712 228
245 3300004800 Ga0058861_11760232 Ga0058861_117602321 228
246 3300004803 Ga0058862_12416007 Ga0058862_124160072 228
247 3300005327 Ga0070658_10000018 Ga0070658_10000018120 228
248 3300005327 Ga0070658_10080753 Ga0070658_100807535 228
249 3300005327 Ga0070658_10338790 Ga0070658_103387902 228
250 3300005327 Ga0070658_10563895 Ga0070658_105638951 228
251 3300005328 Ga0070676_10004488 Ga0070676_100044882 228
252 3300005338 Ga0068868_100013908 Ga0068868_1000139085 228
253 3300005339 Ga0070660_100091736 Ga0070660_1000917363 228
254 3300005355 Ga0070671_100027615 Ga0070671_1000276155 228
255 3300005364 Ga0070673_100008881 Ga0070673_1000088813 228
256 3300005366 Ga0070659_100018374 Ga0070659_1000183746 228
257 3300005366 Ga0070659_100026796 Ga0070659_1000267964 228
258 3300005456 Ga0070678_100018207 Ga0070678_1000182076 228
259 3300005457 Ga0070662_100000626 Ga0070662_1000006269 228
260 3300005458 Ga0070681_10022542 Ga0070681_100225425 228
261 3300005459 Ga0068867_100016777 Ga0068867_1000167772 228
262 3300005530 Ga0070679_100008363 Ga0070679_1000083634 228
263 3300005539 Ga0068853_100019819 Ga0068853_1000198198 228
264 3300005548 Ga0070665_100000072 Ga0070665_10000007279 228
265 3300005563 Ga0068855_100000070 Ga0068855_10000007067 228
266 3300005563 Ga0068855_100000268 Ga0068855_1000002687 228
267 3300005563 Ga0068855_100012445 Ga0068855_10001244510 228
268 3300005563 Ga0068855_100063242 Ga0068855_1000632424 228
269 3300005563 Ga0068855_100416203 Ga0068855_1004162032 228
270 3300005614 Ga0068856_100000897 Ga0068856_10000089732 228
271 3300005614 Ga0068856_100003887 Ga0068856_10000388712 228
272 3300005614 Ga0068856_100009016 Ga0068856_1000090162 228
273 3300005614 Ga0068856_100013111 Ga0068856_1000131114 228
274 3300005614 Ga0068856_100194332 Ga0068856_1001943322 228
275 3300005616 Ga0068852_100017595 Ga0068852_1000175953 228
276 3300005718 Ga0068866_10017052 Ga0068866_100170522 228
277 3300005842 Ga0068858_100269722 Ga0068858_1002697222 228
278 3300006195 Ga0075366_10001711 Ga0075366_100017117 228
279 3300006237 Ga0097621_100000028 Ga0097621_1000000283 228
280 3300006358 Ga0068871_100006906 Ga0068871_10000690610 228
281 3300006881 Ga0068865_100000127 Ga0068865_10000012719 228
282 3300009093 Ga0105240_10000237 Ga0105240_1000023716 228
283 3300009093 Ga0105240_10014965 Ga0105240_100149652 228
284 3300009093 Ga0105240_10020594 Ga0105240_100205944 228
285 3300009093 Ga0105240_10048025 Ga0105240_100480255 228
286 3300009093 Ga0105240_10187598 Ga0105240_101875984 228
287 3300009093 Ga0105240_10227132 Ga0105240_102271324 228
288 3300009174 Ga0105241_10535967 Ga0105241_105359672 228
289 3300009176 Ga0105242_10029494 Ga0105242_100294941 228
290 3300009545 Ga0105237_10000224 Ga0105237_1000022444 228
291 3300009545 Ga0105237_10000485 Ga0105237_1000048540 228
292 3300009545 Ga0105237_10037976 Ga0105237_100379763 228
293 3300009545 Ga0105237_10041051 Ga0105237_100410512 228
294 3300009545 Ga0105237_10385476 Ga0105237_103854762 228
295 3300009545 Ga0105237_10411591 Ga0105237_104115912 228
296 3300009551 Ga0105238_10133400 Ga0105238_101334003 228
297 3300009553 Ga0105249_10237828 Ga0105249_102378282 228
298 3300010375 Ga0105239_10000039 Ga0105239_10000039154 228
299 3300010375 Ga0105239_10000120 Ga0105239_1000012073 228
300 3300010375 Ga0105239_10004436 Ga0105239_1000443612 228
301 3300010375 Ga0105239_10013753 Ga0105239_100137538 228
302 3300010375 Ga0105239_10023687 Ga0105239_100236876 228
303 3300010375 Ga0105239_10025250 Ga0105239_100252504 228
304 3300010375 Ga0105239_10826509 Ga0105239_108265092 228
305 3300011119 Ga0105246_10172179 Ga0105246_101721792 228
306 3300013100 Ga0157373_10000208 Ga0157373_1000020824 228
307 3300013100 Ga0157373_10076454 Ga0157373_100764542 228
308 3300013102 Ga0157371_10000263 Ga0157371_1000026322 228
309 3300013104 Ga0157370_10095584 Ga0157370_100955843 228
310 3300013105 Ga0157369_10617552 Ga0157369_106175522 228
311 3300013296 Ga0157374_10001845 Ga0157374_1000184518 228
312 3300013296 Ga0157374_10044113 Ga0157374_100441131 228
313 3300013296 Ga0157374_10155428 Ga0157374_101554283 228
314 3300013297 Ga0157378_10043262 Ga0157378_100432623 228
315 3300013306 Ga0163162_10000010 Ga0163162_1000001048 228
316 3300013306 Ga0163162_10064255 Ga0163162_100642551 228
317 3300013307 Ga0157372_10000050 Ga0157372_10000050114 228
318 3300013307 Ga0157372_10000635 Ga0157372_1000063539 228
319 3300013307 Ga0157372_10001419 Ga0157372_1000141913 228
320 3300013307 Ga0157372_10189979 Ga0157372_101899792 228
321 3300013307 Ga0157372_10403929 Ga0157372_104039291 228
322 3300013308 Ga0157375_10021385 Ga0157375_100213853 228
323 3300025231 Ga0207427_100172 Ga0207427_10017278 228
324 3300025233 Ga0209437_100034 Ga0209437_100034183 228
325 3300025250 Ga0209026_1000728 Ga0209026_10007282 228
326 3300025250 Ga0209026_1003634 Ga0209026_10036343 228
327 3300025250 Ga0209026_1015127 Ga0209026_10151271 228
328 3300025254 Ga0209148_1017175 Ga0209148_10171751 228
329 3300025261 Ga0209233_1000038 Ga0209233_1000038183 228
330 3300025261 Ga0209233_1001428 Ga0209233_10014281 228
331 3300025261 Ga0209233_1013109 Ga0209233_10131093 228
332 3300025261 Ga0209233_1019675 Ga0209233_10196752 228
333 3300025272 Ga0209455_1000861 Ga0209455_100086112 228
334 3300025904 Ga0207647_10000076 Ga0207647_100000767 228
335 3300025907 Ga0207645_10017477 Ga0207645_100174773 228
336 3300025909 Ga0207705_10000036 Ga0207705_1000003675 228
337 3300025911 Ga0207654_10118633 Ga0207654_101186332 228
338 3300025912 Ga0207707_10030350 Ga0207707_100303504 228
339 3300025913 Ga0207695_10000013 Ga0207695_1000001317 228
340 3300025913 Ga0207695_10004656 Ga0207695_1000465615 228
341 3300025913 Ga0207695_10016549 Ga0207695_1001654911 228
342 3300025913 Ga0207695_10033191 Ga0207695_100331916 228
343 3300025913 Ga0207695_10318305 Ga0207695_103183053 228
344 3300025914 Ga0207671_10002707 Ga0207671_1000270715 228
345 3300025914 Ga0207671_10011316 Ga0207671_100113161 228
346 3300025914 Ga0207671_10037577 Ga0207671_100375772 228
347 3300025919 Ga0207657_10020956 Ga0207657_100209563 228
348 3300025924 Ga0207694_10146670 Ga0207694_101466703 228
349 3300025931 Ga0207644_10062324 Ga0207644_100623245 228
350 3300025932 Ga0207690_10011536 Ga0207690_100115364 228
351 3300025932 Ga0207690_10015769 Ga0207690_100157694 228
352 3300025933 Ga0207706_10006487 Ga0207706_100064878 228
353 3300025938 Ga0207704_10000044 Ga0207704_1000004436 228
354 3300025949 Ga0207667_10000009 Ga0207667_10000009445 228
355 3300025949 Ga0207667_10000971 Ga0207667_1000097134 228
356 3300025949 Ga0207667_10051802 Ga0207667_100518024 228
357 3300025949 Ga0207667_10085702 Ga0207667_100857023 228
358 3300025949 Ga0207667_10553159 Ga0207667_105531591 228
359 3300025949 Ga0207667_10758902 Ga0207667_107589021 228
360 3300025960 Ga0207651_10018113 Ga0207651_100181136 228
361 3300025961 Ga0207712_10142459 Ga0207712_101424592 228
362 3300026041 Ga0207639_10004531 Ga0207639_100045319 228
363 3300026041 Ga0207639_10015887 Ga0207639_100158876 228
364 3300026078 Ga0207702_10000507 Ga0207702_1000050727 228
365 3300026078 Ga0207702_10005892 Ga0207702_100058923 228
366 3300026078 Ga0207702_10038199 Ga0207702_100381993 228
367 3300026078 Ga0207702_10056941 Ga0207702_100569414 228
368 3300026078 Ga0207702_10499778 Ga0207702_104997782 228
369 3300026089 Ga0207648_10000529 Ga0207648_100005293 228
370 3300026121 Ga0207683_10031312 Ga0207683_100313123 228
371 3300026142 Ga0207698_10005251 Ga0207698_100052511 228
372 3300028379 Ga0268266_10000089 Ga0268266_1000008978 228
373 3300028786 Ga0307517_10003551 Ga0307517_1000355118 228
374 3300031691 Ga0316579_10043400 Ga0316579_100434003 228
375 3300031727 Ga0316576_10127932 Ga0316576_101279322 228
376 3300031911 Ga0307412_10077908 Ga0307412_100779082 228
377 3300031911 Ga0307412_10406460 Ga0307412_104064602 228
378 3300032137 Ga0316585_10039603 Ga0316585_100396031 228
379 3300032139 Ga0316580_10007805 Ga0316580_100078053 228
380 3300036647 Ga0316582_0022813 Ga0316582_0022813_1880_2578 228
381 3300036712 Ga0316584_0052688 Ga0316584_0052688_1562_2260 228
382 3300036712 Ga0316584_0057497 Ga0316584_0057497_1347_2045 228
383 3300037312 Ga0395899_0000033 Ga0395899_0000033_44899_45621 228
384 3300037312 Ga0395899_0000659 Ga0395899_0000659_7500_8225 228
385 3300037312 Ga0395899_0001109 Ga0395899_0001109_6542_7288 228
386 3300037312 Ga0395899_0021085 Ga0395899_0021085_1803_2522 228
387 3300037418 Ga0395900_0000277 Ga0395900_0000277_25183_25929 228
388 3300037418 Ga0395900_0001234 Ga0395900_0001234_5567_6289 228
389 3300037418 Ga0395900_0019640 Ga0395900_0019640_448_1167 228
390 3300037466 Ga0395898_0001918 Ga0395898_0001918_1662_2408 228
391 3300037471 Ga0395905_0000068 Ga0395905_0000068_65337_66083 228
392 3300037471 Ga0395905_0000348 Ga0395905_0000348_56477_57205 228
393 3300037471 Ga0395905_0004443 Ga0395905_0004443_347_1066 228
394 3300038443 Ga0395901_0000199 Ga0395901_0000199_2862_3608 228
395 3300038443 Ga0395901_0005268 Ga0395901_0005268_8570_9289 228
396 3300038443 Ga0395901_0140444 Ga0395901_0140444_772_1491 228
397 3300039447 Ga0436361_0742208 Ga0436361_0742208_454_1200 228
398 3300042005 Ga0439448_0020387 Ga0439448_0020387_370_1116 228
399 3300042876 Ga0451577_0000034 Ga0451577_0000034_356589_357287 228
400 3300042876 Ga0451577_0003212 Ga0451577_0003212_14685_15389 228
401 3300042876 Ga0451577_0025370 Ga0451577_0025370_2521_3219 228
402 3300042876 Ga0451577_0132698 Ga0451577_0132698_615_1364 228
403 3300044656 Ga0466969_0032580 Ga0466969_0032580_584_1309 228
404 3300044673 Ga0453683_0000005 Ga0453683_0000005_508418_509116 228
405 3300044673 Ga0453683_0000122 Ga0453683_0000122_114793_115491 228
406 3300044673 Ga0453683_0004573 Ga0453683_0004573_7353_8102 228
407 3300044673 Ga0453683_0127057 Ga0453683_0127057_47_796 228
408 3300044684 Ga0466966_0016086 Ga0466966_0016086_432_1157 228
409 3300044693 Ga0466961_0102343 Ga0466961_0102343_431_1156 228
410 3300044712 Ga0453684_0000098 Ga0453684_0000098_356589_357287 228
411 3300044712 Ga0453684_0000467 Ga0453684_0000467_47986_48684 228
412 3300044712 Ga0453684_0000603 Ga0453684_0000603_42139_42843 228
413 3300044712 Ga0453684_0001278 Ga0453684_0001278_44321_45019 228
414 3300044712 Ga0453684_0065621 Ga0453684_0065621_2148_2897 228
415 3300044712 Ga0453684_0268672 Ga0453684_0268672_493_1242 228
416 3300044735 Ga0466968_0072467 Ga0466968_0072467_142_864 228
417 3300045051 Ga0451576_0000036 Ga0451576_0000036_18897_19595 228
418 3300045051 Ga0451576_0000397 Ga0451576_0000397_89586_90290 228
419 3300045051 Ga0451576_0114207 Ga0451576_0114207_1882_2580 228
420 3300046500 Ga0495596_0018700 Ga0495596_0018700_1452_2195 228
421 3300046518 Ga0495631_0087772 Ga0495631_0087772_250_993 228
422 3300046519 Ga0495632_0230054 Ga0495632_0230054_84_806 228
423 3300046523 Ga0495644_0051316 Ga0495644_0051316_667_1389 228
424 3300046529 Ga0495652_0157877 Ga0495652_0157877_730_1455 228
425 3300047443 Ga0495687_006439 Ga0495687_006439_6120_6866 228
426 3300047445 Ga0495677_0037403 Ga0495677_0037403_756_1478 228
427 3300047472 Ga0495686_0001825 Ga0495686_0001825_3243_3971 228
428 3300050493 nmdc:mga0k408_260_c1 nmdc:mga0k408_260_c1_11983_12705 228
429 3300053122 Ga0500608_000203 Ga0500608_000203_19045_19767 228
430 3300030731 Ga0316177_1009900 Ga0316177_10099001 229
431 3300030732 Ga0316176_1141979 Ga0316176_114197911 229
432 3300030742 Ga0316183_1118483 Ga0316183_111848335 229
433 3300030744 Ga0316181_1033622 Ga0316181_10336224 229
434 3300006880 Ga0075429_100234498 Ga0075429_1002344982 230
435 3300048919 Ga0496116_0002379 Ga0496116_0002379_16545_17303 230
436 3300048920 Ga0496117_0002276 Ga0496117_0002276_9493_10251 230
437 3300048921 Ga0496118_0026652 Ga0496118_0026652_1087_1845 230
438 3300048925 Ga0496122_0015395 Ga0496122_0015395_3255_4013 230
439 3300048926 Ga0496123_0018244 Ga0496123_0018244_1300_2058 230
440 3300048928 Ga0496125_0038198 Ga0496125_0038198_1427_2185 230
441 3300049570 Ga0501033_0108285 Ga0501033_0108285_646_1407 230
442 3300049577 Ga0501041_0127761 Ga0501041_0127761_759_1481 230
443 3300049582 Ga0501048_0049392 Ga0501048_0049392_148_870 230
444 3300049822 Ga0501035_0283680 Ga0501035_0283680_255_977 230
445 3300049823 Ga0501044_0778945 Ga0501044_0778945_95_817 230
446 3300050508 nmdc:mga09592_397145_c1 nmdc:mga09592_397145_c1_135_872 230
447 iso_pu_bacteria 2599185184 2599477068 230
448 iso_pu_bacteria 2919437846 2919442232 230
449 iso_pu_bacteria 2928078545 2928078981 230
450 iso_pu_bacteria 2928147474 2928148652 230
451 iso_pu_bacteria 2932082852 2932085628 230
452 3300005617 Ga0068859_100112551 Ga0068859_1001125512 231
453 3300006931 Ga0097620_100112549 Ga0097620_1001125492 231
454 3300009094 Ga0111539_10079406 Ga0111539_100794063 231
455 3300027907 Ga0207428_10117762 Ga0207428_101177622 231
456 3300032005 Ga0307411_10121123 Ga0307411_101211232 231
457 3300048091 Ga0495626_0009849 Ga0495626_0009849_1776_2510 231
458 3300049578 Ga0501042_0005696 Ga0501042_0005696_735_1460 231
459 3300050511 nmdc:mga08y16_76589_c1 nmdc:mga08y16_76589_c1_954_1670 231
460 iso_pu_bacteria 2852623160 2852626917 231
461 iso_pu_bacteria 2884933994 2884938030 231
462 3300050508 nmdc:mga09592_11444_c1 nmdc:mga09592_11444_c1_4899_5642 232
463 3300053103 Ga0500555_000471 Ga0500555_000471_6106_6810 232
464 3300009545 Ga0105237_10553924 Ga0105237_105539241 233
465 3300028794 Ga0307515_10001481 Ga0307515_1000148136 233
466 3300028794 Ga0307515_10001997 Ga0307515_1000199741 233
467 3300033179 Ga0307507_10000015 Ga0307507_1000001560 233
468 3300046492 Ga0495585_0003658 Ga0495585_0003658_7027_7782 233
469 3300046518 Ga0495631_0109135 Ga0495631_0109135_421_1176 233
470 3300046538 Ga0495609_0005281 Ga0495609_0005281_5739_6485 233
471 3300046557 Ga0495622_0041224 Ga0495622_0041224_1133_1888 233
472 3300046558 Ga0495633_0000035 Ga0495633_0000035_126140_126886 233
473 3300046616 Ga0495668_0000032 Ga0495668_0000032_77455_78210 233
474 3300046660 Ga0495625_0000753 Ga0495625_0000753_487_1233 233
475 3300046660 Ga0495625_0001432 Ga0495625_0001432_2510_3265 233
476 3300046660 Ga0495625_0082121 Ga0495625_0082121_1330_2067 233
477 3300046660 Ga0495625_0099251 Ga0495625_0099251_1025_1762 233
478 3300046660 Ga0495625_0301139 Ga0495625_0301139_117_896 233
479 3300046683 Ga0495658_0136364 Ga0495658_0136364_379_1134 233
480 3300048089 Ga0495614_0083785 Ga0495614_0083785_190_945 233
481 3300050493 nmdc:mga0k408_859_c1 nmdc:mga0k408_859_c1_11252_11998 233
482 3300053080 Ga0500635_0001015 Ga0500635_0001015_2898_3632 233
483 3300053122 Ga0500608_007068 Ga0500608_007068_2880_3617 233
484 3300053156 Ga0500622_0001600 Ga0500622_0001600_14264_15001 233
485 3300001990 JGI24737J22298_10000143 JGI24737J22298_100001434 234
486 3300002067 JGI24735J21928_10000006 JGI24735J21928_10000006260 234
487 3300002737 JGI25162J39368_1000089 JGI25162J39368_100008957 234
488 3300003316 rootH1_10029777 rootH1_100297778 234
489 3300003322 rootL2_10211276 rootL2_102112761 234
490 3300005563 Ga0068855_100152225 Ga0068855_1001522254 234
491 3300005577 Ga0068857_100164685 Ga0068857_1001646853 234
492 3300009093 Ga0105240_10365364 Ga0105240_103653642 234
493 3300009093 Ga0105240_11082324 Ga0105240_110823241 234
494 3300009545 Ga0105237_10065000 Ga0105237_100650003 234
495 3300009545 Ga0105237_10279937 Ga0105237_102799372 234
496 3300010375 Ga0105239_10005560 Ga0105239_1000556013 234
497 3300010375 Ga0105239_10012917 Ga0105239_100129174 234
498 3300013306 Ga0163162_10013931 Ga0163162_100139312 234
499 3300013306 Ga0163162_10610738 Ga0163162_106107381 234
500 3300013307 Ga0157372_10002231 Ga0157372_100022314 234
501 3300017792 Ga0163161_10027541 Ga0163161_100275414 234
502 3300025233 Ga0209437_100221 Ga0209437_10022151 234
503 3300025913 Ga0207695_10058909 Ga0207695_100589092 234
504 3300025914 Ga0207671_10024807 Ga0207671_100248074 234
505 3300025949 Ga0207667_10205066 Ga0207667_102050663 234
506 3300026116 Ga0207674_10483995 Ga0207674_104839952 234
507 3300046460 Ga0495638_0102196 Ga0495638_0102196_243_983 234
508 3300046460 Ga0495638_0235657 Ga0495638_0235657_95_835 234
509 3300046471 Ga0495650_0000014 Ga0495650_0000014_286458_287198 234
510 3300046492 Ga0495585_0001521 Ga0495585_0001521_13351_14091 234
511 3300046507 Ga0495606_0000528 Ga0495606_0000528_8696_9436 234
512 3300046507 Ga0495606_0005674 Ga0495606_0005674_10194_10958 234
513 3300046512 Ga0495610_0006009 Ga0495610_0006009_4036_4776 234
514 3300046513 Ga0495616_0005759 Ga0495616_0005759_5806_6546 234
515 3300046513 Ga0495616_0023741 Ga0495616_0023741_2416_3156 234
516 3300046558 Ga0495633_0011158 Ga0495633_0011158_3889_4629 234
517 3300046660 Ga0495625_0000009 Ga0495625_0000009_340207_340947 234
518 3300046665 Ga0495661_0004079 Ga0495661_0004079_6360_7100 234
519 3300046694 Ga0495649_0000002 Ga0495649_0000002_1058117_1058857 234
520 3300047443 Ga0495687_001120 Ga0495687_001120_20440_21180 234
521 3300047472 Ga0495686_0001209 Ga0495686_0001209_9237_9977 234
522 3300049459 Ga0495678_033997 Ga0495678_033997_1185_1925 234
523 3300050493 nmdc:mga0k408_23828_c1 nmdc:mga0k408_23828_c1_696_1436 234
524 3300053125 Ga0500618_000037 Ga0500618_000037_5646_6407 234
525 3300053125 Ga0500618_008815 Ga0500618_008815_797_1537 234
526 3300053157 Ga0500624_000694 Ga0500624_000694_4201_4941 234
527 3300005545 Ga0070695_100035049 Ga0070695_1000350492 235
528 3300049664 Ga0501224_006106 Ga0501224_006106_232_939 235
529 3300006847 Ga0075431_100095920 Ga0075431_1000959201 236
530 3300009545 Ga0105237_10001308 Ga0105237_100013088 236
531 3300025914 Ga0207671_10011004 Ga0207671_100110048 236
532 3300025942 Ga0207689_10270225 Ga0207689_102702252 236
533 3300028794 Ga0307515_10100898 Ga0307515_101008983 236
534 3300046665 Ga0495661_0000707 Ga0495661_0000707_7729_8505 236
535 3300050510 nmdc:mga06r32_78179_c1 nmdc:mga06r32_78179_c1_47_814 236
536 3300014326 Ga0157380_10093550 Ga0157380_100935503 237
537 3300028800 Ga0265338_10015871 Ga0265338_100158716 237
538 3300049581 Ga0501047_0153441 Ga0501047_0153441_561_1328 237
539 3300046473 Ga0495582_0004387 Ga0495582_0004387_6016_6765 238
540 3300046642 Ga0495634_0237511 Ga0495634_0237511_340_1059 238
541 3300046683 Ga0495658_0000570 Ga0495658_0000570_13091_13840 238
542 3300013308 Ga0157375_11236598 Ga0157375_112365981 239
543 3300049587 Ga0501071_0030335 Ga0501071_0030335_1886_2644 239
544 3300009101 Ga0105247_10009777 Ga0105247_100097772 240
545 3300013100 Ga0157373_10170348 Ga0157373_101703482 240
546 3300015261 Ga0182006_1091847 Ga0182006_10918472 240
547 3300028380 Ga0268265_10355986 Ga0268265_103559862 240
548 3300035088 Ga0373940_0085463 Ga0373940_0085463_30_752 240
549 3300035091 Ga0373951_0004432 Ga0373951_0004432_1230_1952 240
550 3300038996 Ga0242420_003202 Ga0242420_003202_536_1258 240
551 3300048906 Ga0496103_0120921 Ga0496103_0120921_613_1335 240
552 3300048909 Ga0496106_0032249 Ga0496106_0032249_1036_1758 240
553 3300048912 Ga0496109_0531654 Ga0496109_0531654_18_740 240
554 3300048914 Ga0496111_0202197 Ga0496111_0202197_737_1459 240
555 3300048915 Ga0496112_0315805 Ga0496112_0315805_309_1031 240
556 3300048915 Ga0496112_0547925 Ga0496112_0547925_339_1064 240
557 3300048915 Ga0496112_0641627 Ga0496112_0641627_33_755 240
558 3300048916 Ga0496113_0131242 Ga0496113_0131242_357_1079 240
559 3300049705 Ga0501225_0040627 Ga0501225_0040627_280_1002 240
560 3300050507 nmdc:mga05p37_346171_c1 nmdc:mga05p37_346171_c1_296_1024 242
561 3300002074 JGI24748J21848_1000051 JGI24748J21848_100005139 243
562 3300002239 JGI24034J26672_10000030 JGI24034J26672_1000003013 243
563 3300005842 Ga0068858_100000405 Ga0068858_1000004052 243
564 3300009101 Ga0105247_10000153 Ga0105247_1000015312 243
565 3300013297 Ga0157378_10235654 Ga0157378_102356542 243
566 3300014968 Ga0157379_10059280 Ga0157379_100592802 243
567 3300025223 Ga0207672_1000067 Ga0207672_100006711 243
568 3300025900 Ga0207710_10000001 Ga0207710_100000011447 243
569 3300025931 Ga0207644_10000882 Ga0207644_100008827 243
570 3300025960 Ga0207651_10397315 Ga0207651_103973152 243
571 3300026035 Ga0207703_10000045 Ga0207703_1000004515 243
572 3300025901 Ga0207688_10102635 Ga0207688_101026352 244
573 3300031901 Ga0307406_10441028 Ga0307406_104410281 244
574 3300032005 Ga0307411_10256934 Ga0307411_102569341 244
575 3300032126 Ga0307415_100117087 Ga0307415_1001170872 244
576 3300049580 Ga0501046_0258124 Ga0501046_0258124_104_877 244
577 3300049592 Ga0501076_0120138 Ga0501076_0120138_70_843 244
578 3300000532 CNAas_1000829 CNAas_10008292 245
579 3300014326 Ga0157380_10012995 Ga0157380_100129954 245
580 3300005578 Ga0068854_100095077 Ga0068854_1000950772 249
581 3300005328 Ga0070676_10149873 Ga0070676_101498731 250
582 3300005328 Ga0070676_10503680 Ga0070676_105036801 250
583 3300005334 Ga0068869_100035202 Ga0068869_1000352024 250
584 3300005364 Ga0070673_100014675 Ga0070673_1000146752 250
585 3300005445 Ga0070708_100002619 Ga0070708_1000026195 250
586 3300005467 Ga0070706_100005626 Ga0070706_1000056267 250
587 3300005468 Ga0070707_100029831 Ga0070707_1000298313 250
588 3300005471 Ga0070698_100005014 Ga0070698_10000501410 250
589 3300005518 Ga0070699_100001336 Ga0070699_10000133610 250
590 3300005536 Ga0070697_100003936 Ga0070697_1000039364 250
591 3300005536 Ga0070697_100259760 Ga0070697_1002597602 250
592 3300005543 Ga0070672_100235441 Ga0070672_1002354412 250
593 3300005545 Ga0070695_100011147 Ga0070695_1000111472 250
594 3300006852 Ga0075433_10049863 Ga0075433_100498632 250
595 3300006871 Ga0075434_100147427 Ga0075434_1001474272 250
596 3300007076 Ga0075435_100281110 Ga0075435_1002811102 250
597 3300009098 Ga0105245_10243938 Ga0105245_102439382 250
598 3300009148 Ga0105243_10000785 Ga0105243_1000078510 250
599 3300009176 Ga0105242_10001383 Ga0105242_1000138312 250
600 3300009177 Ga0105248_10015522 Ga0105248_100155225 250
601 3300013297 Ga0157378_10000002 Ga0157378_10000002123 250
602 3300013306 Ga0163162_10010070 Ga0163162_100100705 250
603 3300013306 Ga0163162_10016331 Ga0163162_100163316 250
604 3300025907 Ga0207645_10087794 Ga0207645_100877943 250
605 3300025910 Ga0207684_10022905 Ga0207684_100229054 250
606 3300025934 Ga0207686_10000952 Ga0207686_1000095211 250
607 3300025935 Ga0207709_10000524 Ga0207709_1000052416 250
608 3300025940 Ga0207691_10265208 Ga0207691_102652082 250
609 3300025941 Ga0207711_10013164 Ga0207711_100131646 250
610 3300025942 Ga0207689_10026884 Ga0207689_100268842 250
611 3300025960 Ga0207651_10016587 Ga0207651_100165874 250
612 3300025981 Ga0207640_10177008 Ga0207640_101770082 250
613 3300026035 Ga0207703_10424570 Ga0207703_104245701 250
614 3300026118 Ga0207675_100000849 Ga0207675_10000084923 250
615 3300038996 Ga0242420_011217 Ga0242420_011217_321_1079 250
616 3300048903 Ga0496100_0167413 Ga0496100_0167413_592_1350 250
617 3300048909 Ga0496106_0000834 Ga0496106_0000834_17715_18473 250
618 3300050515 nmdc:mga0a205_88196_c1 nmdc:mga0a205_88196_c1_775_1533 250
619 3300005330 Ga0070690_100225321 Ga0070690_1002253212 251
620 3300005334 Ga0068869_100090184 Ga0068869_1000901842 251
621 3300005367 Ga0070667_100139335 Ga0070667_1001393352 251
622 3300005445 Ga0070708_100259342 Ga0070708_1002593422 251
623 3300005445 Ga0070708_100369972 Ga0070708_1003699722 251
624 3300005456 Ga0070678_100110744 Ga0070678_1001107442 251
625 3300005457 Ga0070662_100173729 Ga0070662_1001737291 251
626 3300005459 Ga0068867_100219256 Ga0068867_1002192562 251
627 3300005471 Ga0070698_100051295 Ga0070698_1000512952 251
628 3300005471 Ga0070698_100209354 Ga0070698_1002093542 251
629 3300005518 Ga0070699_100049669 Ga0070699_1000496693 251
630 3300005543 Ga0070672_100104518 Ga0070672_1001045182 251
631 3300005543 Ga0070672_100124054 Ga0070672_1001240542 251
632 3300005544 Ga0070686_100011130 Ga0070686_1000111302 251
633 3300005548 Ga0070665_100149900 Ga0070665_1001499002 251
634 3300005615 Ga0070702_100340747 Ga0070702_1003407471 251
635 3300005616 Ga0068852_100230360 Ga0068852_1002303602 251
636 3300005618 Ga0068864_100002141 Ga0068864_1000021412 251
637 3300005718 Ga0068866_10012210 Ga0068866_100122102 251
638 3300005719 Ga0068861_100512790 Ga0068861_1005127902 251
639 3300005842 Ga0068858_100014535 Ga0068858_1000145356 251
640 3300005983 Ga0081540_1097925 Ga0081540_10979252 251
641 3300006163 Ga0070715_10000024 Ga0070715_1000002463 251
642 3300006237 Ga0097621_100006010 Ga0097621_1000060106 251
643 3300006358 Ga0068871_100024567 Ga0068871_1000245673 251
644 3300006914 Ga0075436_100327712 Ga0075436_1003277122 251
645 3300007265 Ga0099794_10001218 Ga0099794_100012183 251
646 3300009177 Ga0105248_10015913 Ga0105248_100159135 251
647 3300013296 Ga0157374_10357088 Ga0157374_103570882 251
648 3300013297 Ga0157378_10009280 Ga0157378_100092808 251
649 3300013297 Ga0157378_10046779 Ga0157378_100467792 251
650 3300013306 Ga0163162_10005005 Ga0163162_100050052 251
651 3300013308 Ga0157375_10055045 Ga0157375_100550453 251
652 3300014325 Ga0163163_10002079 Ga0163163_100020792 251
653 3300014325 Ga0163163_10004729 Ga0163163_1000472910 251
654 3300014326 Ga0157380_10925475 Ga0157380_109254751 251
655 3300014969 Ga0157376_10027794 Ga0157376_100277942 251
656 3300025905 Ga0207685_10000018 Ga0207685_1000001859 251
657 3300025918 Ga0207662_10305117 Ga0207662_103051172 251
658 3300025931 Ga0207644_10263654 Ga0207644_102636542 251
659 3300025933 Ga0207706_10178930 Ga0207706_101789302 251
660 3300025940 Ga0207691_10237566 Ga0207691_102375662 251
661 3300025941 Ga0207711_10018170 Ga0207711_100181704 251
662 3300025942 Ga0207689_10041222 Ga0207689_100412222 251
663 3300025942 Ga0207689_10041530 Ga0207689_100415303 251
664 3300025960 Ga0207651_10104905 Ga0207651_101049052 251
665 3300025986 Ga0207658_10101237 Ga0207658_101012372 251
666 3300026023 Ga0207677_10089034 Ga0207677_100890342 251
667 3300026035 Ga0207703_10097306 Ga0207703_100973062 251
668 3300026088 Ga0207641_10073847 Ga0207641_100738472 251
669 3300026121 Ga0207683_10273793 Ga0207683_102737932 251
670 3300026142 Ga0207698_10117485 Ga0207698_101174852 251
671 3300027671 Ga0209588_1010709 Ga0209588_10107092 251
672 3300028379 Ga0268266_10088905 Ga0268266_100889052 251
673 3300028381 Ga0268264_10080774 Ga0268264_100807742 251
674 3300036401 Ga0373937_0110636 Ga0373937_0110636_893_1654 251
675 2162886007 SwRhRL2b_contig_731410 SwRhRL2b_0575.00004840 252
676 3300005288 Ga0065714_10064422 Ga0065714_10064422102 252
677 3300005289 Ga0065704_10009526 Ga0065704_100095262 252
678 3300005289 Ga0065704_10023815 Ga0065704_100238152 252
679 3300005289 Ga0065704_10092483 Ga0065704_100924832 252
680 3300005289 Ga0065704_10092834 Ga0065704_100928342 252
681 3300005290 Ga0065712_10067728 Ga0065712_1006772863 252
682 3300005293 Ga0065715_10004474 Ga0065715_100044742 252
683 3300005293 Ga0065715_10089181 Ga0065715_100891812 252
684 3300005293 Ga0065715_10095696 Ga0065715_100956961 252
685 3300005293 Ga0065715_10105987 Ga0065715_101059872 252
686 3300005295 Ga0065707_10091424 Ga0065707_100914243 252
687 3300005295 Ga0065707_10190589 Ga0065707_101905892 252
688 3300005295 Ga0065707_10246444 Ga0065707_102464442 252
689 3300005328 Ga0070676_10093607 Ga0070676_100936072 252
690 3300005329 Ga0070683_100301639 Ga0070683_1003016392 252
691 3300005330 Ga0070690_100219957 Ga0070690_1002199572 252
692 3300005331 Ga0070670_100000165 Ga0070670_10000016517 252
693 3300005331 Ga0070670_100224439 Ga0070670_1002244392 252
694 3300005334 Ga0068869_100184623 Ga0068869_1001846232 252
695 3300005337 Ga0070682_100041994 Ga0070682_1000419942 252
696 3300005343 Ga0070687_100057385 Ga0070687_1000573852 252
697 3300005343 Ga0070687_100226986 Ga0070687_1002269861 252
698 3300005345 Ga0070692_10016459 Ga0070692_100164592 252
699 3300005345 Ga0070692_10060528 Ga0070692_100605282 252
700 3300005345 Ga0070692_10203511 Ga0070692_102035112 252
701 3300005353 Ga0070669_100026199 Ga0070669_1000261992 252
702 3300005364 Ga0070673_100028970 Ga0070673_1000289703 252
703 3300005438 Ga0070701_10065272 Ga0070701_100652722 252
704 3300005440 Ga0070705_100022136 Ga0070705_1000221363 252
705 3300005440 Ga0070705_100193364 Ga0070705_1001933642 252
706 3300005441 Ga0070700_100004173 Ga0070700_1000041735 252
707 3300005441 Ga0070700_100138605 Ga0070700_1001386052 252
708 3300005444 Ga0070694_100067292 Ga0070694_1000672922 252
709 3300005444 Ga0070694_100200135 Ga0070694_1002001352 252
710 3300005444 Ga0070694_100210428 Ga0070694_1002104282 252
711 3300005445 Ga0070708_100329329 Ga0070708_1003293292 252
712 3300005458 Ga0070681_10001768 Ga0070681_1000176818 252
713 3300005458 Ga0070681_10029377 Ga0070681_100293772 252
714 3300005467 Ga0070706_100000128 Ga0070706_10000012846 252
715 3300005467 Ga0070706_100018438 Ga0070706_1000184382 252
716 3300005467 Ga0070706_100093641 Ga0070706_1000936411 252
717 3300005467 Ga0070706_100223588 Ga0070706_1002235882 252
718 3300005467 Ga0070706_100539125 Ga0070706_1005391251 252
719 3300005468 Ga0070707_100006408 Ga0070707_1000064082 252
720 3300005468 Ga0070707_100078663 Ga0070707_1000786632 252
721 3300005468 Ga0070707_100180455 Ga0070707_1001804552 252
722 3300005468 Ga0070707_100180813 Ga0070707_1001808132 252
723 3300005471 Ga0070698_100000663 Ga0070698_10000066311 252
724 3300005471 Ga0070698_100004577 Ga0070698_10000457710 252
725 3300005471 Ga0070698_100053534 Ga0070698_1000535342 252
726 3300005471 Ga0070698_100185010 Ga0070698_1001850102 252
727 3300005518 Ga0070699_100014592 Ga0070699_1000145923 252
728 3300005518 Ga0070699_100576079 Ga0070699_1005760791 252
729 3300005530 Ga0070679_100111586 Ga0070679_1001115862 252
730 3300005536 Ga0070697_100036822 Ga0070697_1000368222 252
731 3300005536 Ga0070697_100063878 Ga0070697_1000638782 252
732 3300005536 Ga0070697_100094122 Ga0070697_1000941222 252
733 3300005536 Ga0070697_100182476 Ga0070697_1001824762 252
734 3300005539 Ga0068853_100014510 Ga0068853_1000145104 252
735 3300005539 Ga0068853_100167119 Ga0068853_1001671192 252
736 3300005539 Ga0068853_100234649 Ga0068853_1002346492 252
737 3300005539 Ga0068853_100695547 Ga0068853_1006955471 252
738 3300005544 Ga0070686_100014560 Ga0070686_1000145602 252
739 3300005545 Ga0070695_100051867 Ga0070695_1000518672 252
740 3300005545 Ga0070695_100172942 Ga0070695_1001729422 252
741 3300005545 Ga0070695_100356052 Ga0070695_1003560522 252
742 3300005546 Ga0070696_100123279 Ga0070696_1001232792 252
743 3300005547 Ga0070693_100031294 Ga0070693_1000312942 252
744 3300005547 Ga0070693_100303516 Ga0070693_1003035161 252
745 3300005549 Ga0070704_100288435 Ga0070704_1002884352 252
746 3300005563 Ga0068855_100204197 Ga0068855_1002041972 252
747 3300005564 Ga0070664_100549184 Ga0070664_1005491842 252
748 3300005577 Ga0068857_100006559 Ga0068857_1000065593 252
749 3300005577 Ga0068857_100127604 Ga0068857_1001276042 252
750 3300005577 Ga0068857_100578922 Ga0068857_1005789222 252
751 3300005578 Ga0068854_100271233 Ga0068854_1002712332 252
752 3300005614 Ga0068856_100005676 Ga0068856_1000056763 252
753 3300005615 Ga0070702_100001061 Ga0070702_1000010618 252
754 3300005615 Ga0070702_100184429 Ga0070702_1001844292 252
755 3300005617 Ga0068859_100054835 Ga0068859_1000548353 252
756 3300005617 Ga0068859_100079747 Ga0068859_1000797472 252
757 3300005617 Ga0068859_100287541 Ga0068859_1002875412 252
758 3300005617 Ga0068859_100411653 Ga0068859_1004116532 252
759 3300005618 Ga0068864_100034796 Ga0068864_1000347964 252
760 3300005618 Ga0068864_100652402 Ga0068864_1006524022 252
761 3300005719 Ga0068861_100002200 Ga0068861_1000022007 252
762 3300005840 Ga0068870_10064483 Ga0068870_100644832 252
763 3300005840 Ga0068870_10203280 Ga0068870_102032802 252
764 3300005841 Ga0068863_100092530 Ga0068863_1000925302 252
765 3300005841 Ga0068863_100257220 Ga0068863_1002572202 252
766 3300005842 Ga0068858_100058092 Ga0068858_1000580923 252
767 3300005842 Ga0068858_100068571 Ga0068858_1000685712 252
768 3300005842 Ga0068858_100089413 Ga0068858_1000894133 252
769 3300005843 Ga0068860_100002487 Ga0068860_1000024872 252
770 3300005843 Ga0068860_100096792 Ga0068860_1000967922 252
771 3300005843 Ga0068860_100195015 Ga0068860_1001950152 252
772 3300005844 Ga0068862_100102426 Ga0068862_1001024262 252
773 3300005985 Ga0081539_10000858 Ga0081539_1000085815 252
774 3300006173 Ga0070716_100015207 Ga0070716_1000152072 252
775 3300006237 Ga0097621_100003157 Ga0097621_10000315711 252
776 3300006358 Ga0068871_100037044 Ga0068871_1000370442 252
777 3300006846 Ga0075430_100014761 Ga0075430_1000147614 252
778 3300006846 Ga0075430_100017128 Ga0075430_1000171282 252
779 3300006847 Ga0075431_100166135 Ga0075431_1001661352 252
780 3300006852 Ga0075433_10021849 Ga0075433_100218494 252
781 3300006871 Ga0075434_100160548 Ga0075434_1001605482 252
782 3300006880 Ga0075429_100018935 Ga0075429_1000189354 252
783 3300006881 Ga0068865_100032927 Ga0068865_1000329272 252
784 3300006881 Ga0068865_100305617 Ga0068865_1003056172 252
785 3300006914 Ga0075436_100000020 Ga0075436_10000002057 252
786 3300006931 Ga0097620_100054836 Ga0097620_1000548363 252
787 3300006931 Ga0097620_100079748 Ga0097620_1000797482 252
788 3300006931 Ga0097620_100287541 Ga0097620_1002875412 252
789 3300006931 Ga0097620_100411662 Ga0097620_1004116622 252
790 3300007076 Ga0075435_100000165 Ga0075435_10000016523 252
791 3300009011 Ga0105251_10061955 Ga0105251_100619552 252
792 3300009011 Ga0105251_10116981 Ga0105251_101169812 252
793 3300009094 Ga0111539_10211199 Ga0111539_102111992 252
794 3300009101 Ga0105247_10005769 Ga0105247_100057695 252
795 3300009147 Ga0114129_10213288 Ga0114129_102132882 252
796 3300009148 Ga0105243_10080793 Ga0105243_100807932 252
797 3300009148 Ga0105243_10189222 Ga0105243_101892222 252
798 3300009148 Ga0105243_10298058 Ga0105243_102980582 252
799 3300009176 Ga0105242_10187229 Ga0105242_101872292 252
800 3300009177 Ga0105248_10165246 Ga0105248_101652461 252
801 3300009545 Ga0105237_10093882 Ga0105237_100938822 252
802 3300009545 Ga0105237_10442625 Ga0105237_104426251 252
803 3300009553 Ga0105249_10063134 Ga0105249_100631342 252
804 3300009553 Ga0105249_10087773 Ga0105249_100877732 252
805 3300010375 Ga0105239_10146195 Ga0105239_101461952 252
806 3300011119 Ga0105246_10039466 Ga0105246_100394662 252
807 3300013297 Ga0157378_10010199 Ga0157378_100101995 252
808 3300013297 Ga0157378_10322829 Ga0157378_103228292 252
809 3300013306 Ga0163162_10003107 Ga0163162_1000310710 252
810 3300013306 Ga0163162_10727211 Ga0163162_107272112 252
811 3300013308 Ga0157375_10007015 Ga0157375_100070159 252
812 3300014325 Ga0163163_10014695 Ga0163163_100146955 252
813 3300014325 Ga0163163_10215737 Ga0163163_102157371 252
814 3300014326 Ga0157380_10001101 Ga0157380_1000110110 252
815 3300014326 Ga0157380_10027529 Ga0157380_100275293 252
816 3300014326 Ga0157380_10534322 Ga0157380_105343221 252
817 3300025900 Ga0207710_10000702 Ga0207710_1000070214 252
818 3300025900 Ga0207710_10071792 Ga0207710_100717921 252
819 3300025904 Ga0207647_10002660 Ga0207647_100026606 252
820 3300025904 Ga0207647_10101115 Ga0207647_101011152 252
821 3300025910 Ga0207684_10000150 Ga0207684_1000015046 252
822 3300025910 Ga0207684_10004744 Ga0207684_1000474410 252
823 3300025910 Ga0207684_10017828 Ga0207684_100178282 252
824 3300025910 Ga0207684_10297695 Ga0207684_102976952 252
825 3300025910 Ga0207684_10361659 Ga0207684_103616592 252
826 3300025911 Ga0207654_10103132 Ga0207654_101031322 252
827 3300025912 Ga0207707_10000016 Ga0207707_1000001683 252
828 3300025912 Ga0207707_10268130 Ga0207707_102681301 252
829 3300025917 Ga0207660_10000805 Ga0207660_1000080511 252
830 3300025918 Ga0207662_10106779 Ga0207662_101067792 252
831 3300025918 Ga0207662_10253872 Ga0207662_102538722 252
832 3300025920 Ga0207649_10177370 Ga0207649_101773702 252
833 3300025921 Ga0207652_10000693 Ga0207652_1000069320 252
834 3300025921 Ga0207652_10298145 Ga0207652_102981452 252
835 3300025922 Ga0207646_10004823 Ga0207646_100048234 252
836 3300025922 Ga0207646_10073942 Ga0207646_100739422 252
837 3300025922 Ga0207646_10298506 Ga0207646_102985062 252
838 3300025923 Ga0207681_10012288 Ga0207681_100122882 252
839 3300025924 Ga0207694_10049255 Ga0207694_100492552 252
840 3300025925 Ga0207650_10000011 Ga0207650_10000011211 252
841 3300025935 Ga0207709_10002326 Ga0207709_1000232612 252
842 3300025935 Ga0207709_10036889 Ga0207709_100368892 252
843 3300025935 Ga0207709_10264132 Ga0207709_102641322 252
844 3300025938 Ga0207704_10013016 Ga0207704_100130162 252
845 3300025938 Ga0207704_10211159 Ga0207704_102111592 252
846 3300025942 Ga0207689_10009519 Ga0207689_100095192 252
847 3300025942 Ga0207689_10024086 Ga0207689_100240862 252
848 3300025942 Ga0207689_10064294 Ga0207689_100642942 252
849 3300025945 Ga0207679_10414295 Ga0207679_104142951 252
850 3300025960 Ga0207651_10030254 Ga0207651_100302543 252
851 3300025960 Ga0207651_10095736 Ga0207651_100957362 252
852 3300025961 Ga0207712_10027437 Ga0207712_100274375 252
853 3300025961 Ga0207712_10075328 Ga0207712_100753282 252
854 3300025981 Ga0207640_10267992 Ga0207640_102679921 252
855 3300026023 Ga0207677_10104836 Ga0207677_101048362 252
856 3300026035 Ga0207703_10102201 Ga0207703_101022012 252
857 3300026041 Ga0207639_10018588 Ga0207639_100185882 252
858 3300026041 Ga0207639_10547352 Ga0207639_105473521 252
859 3300026075 Ga0207708_10003530 Ga0207708_100035304 252
860 3300026078 Ga0207702_10011829 Ga0207702_100118295 252
861 3300026089 Ga0207648_10228044 Ga0207648_102280442 252
862 3300026089 Ga0207648_10308551 Ga0207648_103085512 252
863 3300026095 Ga0207676_10085282 Ga0207676_100852821 252
864 3300026095 Ga0207676_10710559 Ga0207676_107105592 252
865 3300026095 Ga0207676_10833183 Ga0207676_108331832 252
866 3300026116 Ga0207674_10020588 Ga0207674_100205886 252
867 3300026116 Ga0207674_10123397 Ga0207674_101233971 252
868 3300026118 Ga0207675_100004603 Ga0207675_1000046033 252
869 3300026118 Ga0207675_100144676 Ga0207675_1001446762 252
870 3300027907 Ga0207428_10135769 Ga0207428_101357692 252
871 3300028380 Ga0268265_10026318 Ga0268265_100263182 252
872 3300028381 Ga0268264_10007034 Ga0268264_100070345 252
873 3300028381 Ga0268264_10069792 Ga0268264_100697922 252
874 3300028381 Ga0268264_10128605 Ga0268264_101286052 252
875 3300031548 Ga0307408_100058015 Ga0307408_1000580152 252
876 3300031731 Ga0307405_10058440 Ga0307405_100584402 252
877 3300031852 Ga0307410_10435734 Ga0307410_104357342 252
878 3300031901 Ga0307406_10042010 Ga0307406_100420102 252
879 3300031903 Ga0307407_10067696 Ga0307407_100676962 252
880 3300031911 Ga0307412_10052264 Ga0307412_100522642 252
881 3300031995 Ga0307409_100056497 Ga0307409_1000564972 252
882 3300032002 Ga0307416_100013314 Ga0307416_1000133144 252
883 3300032004 Ga0307414_10041283 Ga0307414_100412832 252
884 3300032126 Ga0307415_100051090 Ga0307415_1000510902 252
885 3300032126 Ga0307415_100151684 Ga0307415_1001516842 252
886 3300035115 Ga0373941_0107012 Ga0373941_0107012_182_949 252
887 3300035207 Ga0373942_0019143 Ga0373942_0019143_583_1344 252
888 3300037418 Ga0395900_0127856 Ga0395900_0127856_840_1601 252
889 3300038443 Ga0395901_0173777 Ga0395901_0173777_441_1202 252
890 3300039437 Ga0436365_0065130 Ga0436365_0065130_39378_40184 252
891 3300044673 Ga0453683_0156419 Ga0453683_0156419_251_1018 252
892 3300048905 Ga0496102_0030220 Ga0496102_0030220_780_1541 252
893 3300048906 Ga0496103_0061654 Ga0496103_0061654_1188_1949 252
894 3300048907 Ga0496104_0020868 Ga0496104_0020868_1404_2165 252
895 3300048907 Ga0496104_0098177 Ga0496104_0098177_953_1714 252
896 3300048909 Ga0496106_0045581 Ga0496106_0045581_1336_2097 252
897 3300048910 Ga0496107_0046604 Ga0496107_0046604_1110_1871 252
898 3300048910 Ga0496107_0204380 Ga0496107_0204380_178_939 252
899 3300048910 Ga0496107_0314167 Ga0496107_0314167_35_796 252
900 3300048911 Ga0496108_0031353 Ga0496108_0031353_2658_3419 252
901 3300048911 Ga0496108_0595622 Ga0496108_0595622_151_915 252
902 3300048912 Ga0496109_0278429 Ga0496109_0278429_318_1079 252
903 3300048913 Ga0496110_0265779 Ga0496110_0265779_213_974 252
904 3300048915 Ga0496112_0610918 Ga0496112_0610918_166_927 252
905 3300048916 Ga0496113_0194871 Ga0496113_0194871_288_1049 252
906 3300049521 Ga0501298_018491 Ga0501298_018491_412_1173 252
907 3300049574 Ga0501038_0020497 Ga0501038_0020497_1976_2749 252
908 3300049587 Ga0501071_0263414 Ga0501071_0263414_46_807 252
909 3300049592 Ga0501076_0558653 Ga0501076_0558653_168_929 252
910 3300049651 Ga0501201_008382 Ga0501201_008382_21_782 252
911 3300049652 Ga0501202_010222 Ga0501202_010222_748_1509 252
912 3300049654 Ga0501207_010580 Ga0501207_010580_279_1040 252
913 3300049660 Ga0501216_009248 Ga0501216_009248_306_1067 252
914 3300049661 Ga0501217_015028 Ga0501217_015028_382_1143 252
915 3300049663 Ga0501223_012726 Ga0501223_012726_698_1459 252
916 3300049675 Ga0501243_027846 Ga0501243_027846_23_784 252
917 3300049677 Ga0501247_003827 Ga0501247_003827_406_1167 252
918 3300049704 Ga0501221_037169 Ga0501221_037169_276_1037 252
919 3300049760 Ga0501263_000507 Ga0501263_000507_558_1319 252
920 3300049824 Ga0501045_0351132 Ga0501045_0351132_212_973 252
921 3300050507 nmdc:mga05p37_21055_c1 nmdc:mga05p37_21055_c1_5574_6335 252
922 3300050508 nmdc:mga09592_207144_c1 nmdc:mga09592_207144_c1_416_1177 252
923 3300050508 nmdc:mga09592_24524_c1 nmdc:mga09592_24524_c1_3050_3811 252
924 3300050508 nmdc:mga09592_24982_c1 nmdc:mga09592_24982_c1_250_1014 252
925 3300050509 nmdc:mga0qj67_212774_c1 nmdc:mga0qj67_212774_c1_96_857 252
926 3300050511 nmdc:mga08y16_28893_c1 nmdc:mga08y16_28893_c1_2743_3501 252
927 3300050511 nmdc:mga08y16_58876_c1 nmdc:mga08y16_58876_c1_2666_3424 252
928 3300050512 nmdc:mga0n895_163892_c1 nmdc:mga0n895_163892_c1_1200_1961 252
929 3300050513 nmdc:mga0rr50_139_c1 nmdc:mga0rr50_139_c1_14168_14935 252
930 3300050513 nmdc:mga0rr50_4236_c1 nmdc:mga0rr50_4236_c1_2155_2916 252
931 3300050514 nmdc:mga08x19_3622_c1 nmdc:mga08x19_3622_c1_3252_4013 252
932 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_481882_482649 252
933 3300050515 nmdc:mga0a205_174193_c1 nmdc:mga0a205_174193_c1_210_971 252
934 3300059506 Ga0587085_028233 Ga0587085_028233_35_796 252
935 3300061734 Ga0530510_0029172 Ga0530510_0029172_2884_3645 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

71

220

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.989 27 249
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9869 27 249
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9776 25 250
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9749 26 252
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9713 27 249
ID Description Score Start End Superfamily
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.989 27 249 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 55 251 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9729 28 250 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9723 27 252 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9722 27 252 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1H5S202-F1-model_v4 deleted 0.9979 28 250
AF-A0A1Q6ERV0-F1-model_v4 deleted 0.9961 31 250
AF-A0A1V4HEF9-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9906 28 251 GO:0005524
GO:0016887
AF-A0A7V4MYJ4-F1-model_v4 ABC transporter ATP-binding protein 0.9881 25 250 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A428XK65-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9869 26 251 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
89.54 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map