F485479

General Info

Members Datasets Scaffolds Average Seq Length
911 475 864 106

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0047273|Ga0496115_0047273_332_706
Length 124
Sequence MKVKKGDTVLVIAGKDKGAKGKVIQAYPDSDRILVEGVNRIKKHTKVSTTQRGAKTGGIVTQEATIHVSNVMVVDGDNKPAGGSGCPGGQVRTCDDHHRDQARHWKHRRGRREDPAPTPSPLRQ

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
5 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
8 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
9 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
10 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
11 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
12 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
13 2855683550 Micromonospora sp. RP3T Isolate Unclassified
14 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
15 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
16 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
17 2858868258 Micromonospora sp. MH33 Isolate Unclassified
18 2858882152 Micromonospora noduli MED15 Isolate Nodule
19 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
20 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
21 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
22 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
23 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
24 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
25 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
26 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
27 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
28 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
29 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
30 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
31 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
32 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
33 2902582711 Micromonospora sp. AP08 Isolate Unclassified
34 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
35 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
36 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
37 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
38 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
39 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
40 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
41 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
42 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
43 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
44 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
45 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
51 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
52 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
53 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
54 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
55 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
57 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
58 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
60 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
86 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
87 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
88 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
89 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
90 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
91 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
106 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
107 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
108 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
119 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
122 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
123 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
124 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
125 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
126 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
127 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
128 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
129 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
130 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
131 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
132 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
146 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
147 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
148 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
152 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
162 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
163 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
164 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
168 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
169 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
170 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
171 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
172 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
173 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
174 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
177 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
178 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
179 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
180 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
181 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
192 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
198 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
199 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
200 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
201 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
264 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
265 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
266 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
267 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
268 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
269 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
270 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
271 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
272 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
273 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
274 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
275 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
276 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
277 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
280 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
281 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
282 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
283 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
284 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
285 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
286 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
287 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
288 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
289 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
290 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
293 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
294 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
295 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
296 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
297 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
307 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
308 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
309 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
310 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
311 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
312 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
313 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
314 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
315 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
316 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
317 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
318 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
319 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
320 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
321 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
322 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
323 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
324 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
325 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
326 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
327 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
328 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
329 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
330 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
331 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
332 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
333 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
340 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
348 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
349 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
350 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
351 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
352 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
353 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
354 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
355 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
356 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
363 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
364 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
365 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
377 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
378 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
379 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
380 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
381 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
382 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
383 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
384 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
385 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
406 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
407 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
408 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
424 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
425 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
426 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
427 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
428 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
429 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
430 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
431 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
437 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
438 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
439 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
471 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
472 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
473 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
474 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
475 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.97
Metatranscriptomes 10.87
Isolates 5.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0.55
Rhizoplane 9.66
Rhizosphere 81.67
Stem 0
Stem Tuber 0.11
Unclassified 7.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002850 3300000549 Bacteria 2367
2 LJQas_1002897 3300000549 Bacteria 2335
3 JGI24752J21851_1034974 3300001976 Bacteria 667
4 JGI24747J21853_1030775 3300001978 Bacteria 613
5 JGI24740J21852_10072830 3300001979 Bacteria 916
6 JGI24739J22299_10018382 3300001989 Bacteria 2513
7 JGI24737J22298_10042080 3300001990 Bacteria 1401
8 JGI24735J21928_10007851 3300002067 Bacteria 3467
9 JGI24750J21931_1074411 3300002070 Bacteria 558
10 JGI24745J21846_1000243 3300002073 Bacteria 4512
11 JGI24738J21930_10015789 3300002075 Bacteria 1601
12 JGI24744J21845_10012957 3300002077 Bacteria 1684
13 JGI24744J21845_10093776 3300002077 Bacteria 552
14 JGI24742J22300_10029422 3300002244 Bacteria 956
15 JGI25406J46586_10001383 3300003203 Bacteria 11451
16 Ga0058858_1396751 3300004785 Bacteria 523
17 Ga0058859_10011668 3300004798 Bacteria 1107
18 Ga0058859_11648364 3300004798 Bacteria 711
19 Ga0058859_11663105 3300004798 Bacteria 961
20 Ga0058861_11630814 3300004800 Bacteria 793
21 Ga0058860_10023721 3300004801 Bacteria 1573
22 Ga0058860_10092749 3300004801 Bacteria 1779
23 Ga0058860_12065445 3300004801 Bacteria 645
24 Ga0058860_12175289 3300004801 Bacteria 904
25 Ga0058860_12193443 3300004801 Bacteria 1663
26 Ga0058862_10023693 3300004803 Bacteria 1094
27 Ga0058862_10080862 3300004803 Bacteria 689
28 Ga0058862_10153738 3300004803 Bacteria 1625
29 Ga0070658_10199380 3300005327 Bacteria 1688
30 Ga0070658_11189461 3300005327 Bacteria 663
31 Ga0070676_10189555 3300005328 Bacteria 1342
32 Ga0070676_11186583 3300005328 Bacteria 580
33 Ga0070683_100241319 3300005329 Bacteria 1719
34 Ga0070683_101326100 3300005329 Bacteria 692
35 Ga0070690_100087745 3300005330 Bacteria 2044
36 Ga0070690_101738678 3300005330 Bacteria 508
37 Ga0070670_100441180 3300005331 Bacteria 1153
38 Ga0070670_100856445 3300005331 Bacteria 822
39 Ga0070670_100997067 3300005331 Bacteria 762
40 Ga0070670_101601817 3300005331 Bacteria 599
41 Ga0068869_100183863 3300005334 Bacteria 1640
42 Ga0068869_100245279 3300005334 Bacteria 1428
43 Ga0068869_100986704 3300005334 Bacteria 733
44 Ga0068869_101042128 3300005334 Bacteria 714
45 Ga0068869_101520067 3300005334 Bacteria 595
46 Ga0070666_10022861 3300005335 Bacteria 4065
47 Ga0070666_10137813 3300005335 Bacteria 1699
48 Ga0070666_11252481 3300005335 Bacteria 553
49 Ga0070680_100657954 3300005336 Bacteria 900
50 Ga0070682_100035507 3300005337 Bacteria 3044
51 Ga0070682_100044721 3300005337 Bacteria 2742
52 Ga0070682_100289963 3300005337 Bacteria 1196
53 Ga0070682_100520150 3300005337 Bacteria 925
54 Ga0070682_100521336 3300005337 Bacteria 924
55 Ga0070682_100851960 3300005337 Bacteria 745
56 Ga0068868_100000735 3300005338 Bacteria 22181
57 Ga0068868_100074056 3300005338 Bacteria 2719
58 Ga0068868_100444556 3300005338 Bacteria 1126
59 Ga0068868_100451926 3300005338 Bacteria 1118
60 Ga0068868_100463731 3300005338 Bacteria 1104
61 Ga0070689_100090963 3300005340 Bacteria 2405
62 Ga0070689_100109629 3300005340 Bacteria 2194
63 Ga0070689_100150356 3300005340 Bacteria 1877
64 Ga0070689_100573325 3300005340 Bacteria 975
65 Ga0070691_10009448 3300005341 Bacteria 4450
66 Ga0070687_100024177 3300005343 Bacteria 2896
67 Ga0070687_100094363 3300005343 Bacteria 1661
68 Ga0070687_100615577 3300005343 Bacteria 748
69 Ga0070687_100886665 3300005343 Bacteria 639
70 Ga0070661_100280908 3300005344 Bacteria 1291
71 Ga0070661_101223581 3300005344 Bacteria 628
72 Ga0070692_10085751 3300005345 Bacteria 1704
73 Ga0070692_10188920 3300005345 Bacteria 1199
74 Ga0070668_100074215 3300005347 Bacteria 2653
75 Ga0070668_100582941 3300005347 Bacteria 977
76 Ga0070668_100910105 3300005347 Bacteria 787
77 Ga0070668_101856342 3300005347 Bacteria 555
78 Ga0070669_100059808 3300005353 Bacteria 2798
79 Ga0070675_100176989 3300005354 Bacteria 1842
80 Ga0070675_100596012 3300005354 Bacteria 1002
81 Ga0070675_100751621 3300005354 Bacteria 890
82 Ga0070671_100002908 3300005355 Bacteria 13316
83 Ga0070671_100161753 3300005355 Bacteria 1892
84 Ga0070671_100903030 3300005355 Bacteria 772
85 Ga0070671_101050666 3300005355 Bacteria 714
86 Ga0070674_100107725 3300005356 Bacteria 2041
87 Ga0070674_100237013 3300005356 Bacteria 1426
88 Ga0070674_100459571 3300005356 Bacteria 1052
89 Ga0070673_100059361 3300005364 Bacteria 3027
90 Ga0070673_100229915 3300005364 Bacteria 1608
91 Ga0070688_100903748 3300005365 Bacteria 696
92 Ga0070659_100005602 3300005366 Bacteria 9028
93 Ga0070659_100507476 3300005366 Bacteria 1028
94 Ga0070659_101086510 3300005366 Bacteria 705
95 Ga0070667_100051219 3300005367 Bacteria 3481
96 Ga0070667_100219896 3300005367 Bacteria 1690
97 Ga0070667_100326734 3300005367 Bacteria 1385
98 Ga0070667_101075441 3300005367 Bacteria 752
99 Ga0070667_101624717 3300005367 Bacteria 608
100 Ga0070667_101957745 3300005367 Bacteria 552
101 Ga0070703_10078531 3300005406 Bacteria 1119
102 Ga0070709_10181387 3300005434 Bacteria 1479
103 Ga0070709_11005348 3300005434 Bacteria 663
104 Ga0070714_100170503 3300005435 Bacteria 1975
105 Ga0070714_100203655 3300005435 Bacteria 1811
106 Ga0070714_100255706 3300005435 Bacteria 1621
107 Ga0070714_100420008 3300005435 Bacteria 1267
108 Ga0070713_100785157 3300005436 Bacteria 912
109 Ga0070713_102150378 3300005436 Bacteria 541
110 Ga0070710_10000376 3300005437 Bacteria 20895
111 Ga0070711_100007537 3300005439 Bacteria 6624
112 Ga0070705_100014974 3300005440 Bacteria 4001
113 Ga0070700_100073217 3300005441 Bacteria 2192
114 Ga0070700_100088260 3300005441 Bacteria 2018
115 Ga0070700_100606189 3300005441 Bacteria 859
116 Ga0070694_100045954 3300005444 Bacteria 2929
117 Ga0070663_100182346 3300005455 Bacteria 1629
118 Ga0070663_100554009 3300005455 Bacteria 961
119 Ga0070663_100600304 3300005455 Bacteria 926
120 Ga0070678_100408293 3300005456 Bacteria 1181
121 Ga0070678_100938946 3300005456 Bacteria 792
122 Ga0070678_101503772 3300005456 Bacteria 630
123 Ga0070662_100010423 3300005457 Bacteria 6096
124 Ga0070662_100030788 3300005457 Bacteria 3759
125 Ga0070662_101297357 3300005457 Bacteria 626
126 Ga0070681_11527605 3300005458 Bacteria 592
127 Ga0068867_100174159 3300005459 Bacteria 1706
128 Ga0068867_100376967 3300005459 Bacteria 1191
129 Ga0070685_10056406 3300005466 Bacteria 2284
130 Ga0070685_10109043 3300005466 Bacteria 1702
131 Ga0070685_10604378 3300005466 Bacteria 790
132 Ga0070679_101895927 3300005530 Bacteria 545
133 Ga0070684_100821124 3300005535 Bacteria 869
134 Ga0070697_100142979 3300005536 Bacteria 2013
135 Ga0068853_100025062 3300005539 Bacteria 5004
136 Ga0068853_100047914 3300005539 Bacteria 3668
137 Ga0070672_100620975 3300005543 Bacteria 942
138 Ga0070686_100452261 3300005544 Bacteria 988
139 Ga0070695_100775425 3300005545 Bacteria 766
140 Ga0070696_100032405 3300005546 Bacteria 3585
141 Ga0070696_101787839 3300005546 Bacteria 531
142 Ga0070693_100022732 3300005547 Bacteria 3339
143 Ga0070693_101489498 3300005547 Bacteria 528
144 Ga0070665_100001905 3300005548 Bacteria 23586
145 Ga0070665_100094006 3300005548 Bacteria 3003
146 Ga0070665_100456554 3300005548 Bacteria 1287
147 Ga0070665_100479384 3300005548 Bacteria 1255
148 Ga0070665_101563816 3300005548 Bacteria 668
149 Ga0070704_100114220 3300005549 Bacteria 2061
150 Ga0068855_100050226 3300005563 Bacteria 4916
151 Ga0068855_100454811 3300005563 Bacteria 1397
152 Ga0070664_100193563 3300005564 Bacteria 1812
153 Ga0070664_100209730 3300005564 Bacteria 1740
154 Ga0070664_100537502 3300005564 Bacteria 1080
155 Ga0068857_102374765 3300005577 Bacteria 521
156 Ga0070702_100016667 3300005615 Bacteria 3774
157 Ga0070702_100087744 3300005615 Bacteria 1880
158 Ga0070702_100351318 3300005615 Bacteria 1038
159 Ga0068852_100222700 3300005616 Bacteria 1795
160 Ga0068852_100228323 3300005616 Bacteria 1773
161 Ga0068852_100405143 3300005616 Bacteria 1342
162 Ga0068852_100479569 3300005616 Bacteria 1236
163 Ga0068859_100147339 3300005617 Bacteria 2429
164 Ga0068859_101621091 3300005617 Bacteria 715
165 Ga0068859_102006550 3300005617 Bacteria 639
166 Ga0068859_102705462 3300005617 Bacteria 545
167 Ga0068864_100109101 3300005618 Bacteria 2463
168 Ga0068864_100444907 3300005618 Bacteria 1238
169 Ga0068864_101413849 3300005618 Bacteria 698
170 Ga0068866_10028542 3300005718 Bacteria 2660
171 Ga0068866_10138132 3300005718 Bacteria 1395
172 Ga0068861_100055597 3300005719 Bacteria 3019
173 Ga0068861_100370948 3300005719 Bacteria 1261
174 Ga0068861_100993418 3300005719 Bacteria 801
175 Ga0068851_10036865 3300005834 Bacteria 2450
176 Ga0068851_10177369 3300005834 Bacteria 1179
177 Ga0068851_10649456 3300005834 Bacteria 646
178 Ga0068851_10758542 3300005834 Bacteria 601
179 Ga0068870_10103819 3300005840 Bacteria 1611
180 Ga0068870_10691558 3300005840 Bacteria 703
181 Ga0068863_100016860 3300005841 Bacteria 7006
182 Ga0068863_100023672 3300005841 Bacteria 5860
183 Ga0068863_101146536 3300005841 Bacteria 782
184 Ga0068858_100106994 3300005842 Bacteria 2610
185 Ga0068858_100566258 3300005842 Bacteria 1100
186 Ga0068858_100820984 3300005842 Bacteria 907
187 Ga0068860_100081426 3300005843 Bacteria 3078
188 Ga0068860_100133717 3300005843 Bacteria 2381
189 Ga0068860_100648520 3300005843 Bacteria 1063
190 Ga0068862_100072571 3300005844 Bacteria 2973
191 Ga0068862_100294763 3300005844 Bacteria 1491
192 Ga0081455_10093970 3300005937 Bacteria 2423
193 Ga0081538_10016245 3300005981 Bacteria 5719
194 Ga0081540_1001718 3300005983 Bacteria 18540
195 Ga0081539_10000132 3300005985 Bacteria 175454
196 Ga0081539_10046704 3300005985 Bacteria 2479
197 Ga0070717_10133237 3300006028 Bacteria 2139
198 Ga0070717_10650961 3300006028 Bacteria 956
199 Ga0070717_10912914 3300006028 Bacteria 800
200 Ga0075432_10136715 3300006058 Bacteria 932
201 Ga0075432_10399545 3300006058 Bacteria 593
202 Ga0070715_10050715 3300006163 Bacteria 1783
203 Ga0070715_11001389 3300006163 Bacteria 521
204 Ga0070716_100006233 3300006173 Bacteria 5821
205 Ga0070712_100571499 3300006175 Bacteria 954
206 Ga0097621_100125994 3300006237 Bacteria 2175
207 Ga0097621_100709730 3300006237 Bacteria 926
208 Ga0068871_100063772 3300006358 Bacteria 3014
209 Ga0068871_100980001 3300006358 Bacteria 786
210 Ga0075430_100325873 3300006846 Bacteria 1270
211 Ga0075431_100111938 3300006847 Bacteria 2817
212 Ga0075433_10207134 3300006852 Bacteria 1743
213 Ga0075433_10605594 3300006852 Bacteria 962
214 Ga0075434_100046738 3300006871 Bacteria 4295
215 Ga0075429_100749409 3300006880 Bacteria 855
216 Ga0075429_100996159 3300006880 Bacteria 733
217 Ga0068865_100097354 3300006881 Bacteria 2147
218 Ga0075436_100061172 3300006914 Bacteria 2601
219 Ga0097620_100147323 3300006931 Bacteria 2429
220 Ga0097620_101621039 3300006931 Bacteria 715
221 Ga0097620_102006711 3300006931 Bacteria 639
222 Ga0097620_102704880 3300006931 Bacteria 545
223 Ga0075435_100031870 3300007076 Bacteria 4158
224 Ga0075435_100673010 3300007076 Bacteria 899
225 Ga0105251_10045771 3300009011 Bacteria 2108
226 Ga0105244_10250095 3300009036 Bacteria 826
227 Ga0105250_10094518 3300009092 Bacteria 1218
228 Ga0105240_10204697 3300009093 Bacteria 2311
229 Ga0111539_10237960 3300009094 Bacteria 2119
230 Ga0111539_10715946 3300009094 Bacteria 1165
231 Ga0105245_10026001 3300009098 Bacteria 5150
232 Ga0105245_10902983 3300009098 Bacteria 925
233 Ga0105245_11125141 3300009098 Bacteria 832
234 Ga0105245_11363803 3300009098 Bacteria 759
235 Ga0105245_11595489 3300009098 Bacteria 704
236 Ga0105247_10042407 3300009101 Bacteria 2787
237 Ga0105247_10168492 3300009101 Bacteria 1455
238 Ga0105247_10476135 3300009101 Bacteria 905
239 Ga0114129_11603647 3300009147 Bacteria 797
240 Ga0105243_10009722 3300009148 Bacteria 7325
241 Ga0105243_10847058 3300009148 Bacteria 905
242 Ga0105243_11125913 3300009148 Bacteria 794
243 Ga0105241_10044504 3300009174 Bacteria 3364
244 Ga0105241_11517426 3300009174 Bacteria 645
245 Ga0105241_12133436 3300009174 Bacteria 554
246 Ga0105242_10181638 3300009176 Bacteria 1856
247 Ga0105242_10405932 3300009176 Bacteria 1273
248 Ga0105242_10768747 3300009176 Bacteria 950
249 Ga0105242_11633938 3300009176 Bacteria 679
250 Ga0105248_10215631 3300009177 Bacteria 2162
251 Ga0105248_10253937 3300009177 Bacteria 1979
252 Ga0105248_11672967 3300009177 Bacteria 721
253 Ga0105237_10192300 3300009545 Bacteria 2040
254 Ga0105237_10385726 3300009545 Bacteria 1406
255 Ga0105238_10042028 3300009551 Bacteria 4629
256 Ga0105238_10322410 3300009551 Bacteria 1531
257 Ga0105238_10435505 3300009551 Bacteria 1307
258 Ga0105238_10436006 3300009551 Bacteria 1306
259 Ga0105238_10935547 3300009551 Bacteria 886
260 Ga0105238_12808358 3300009551 Bacteria 523
261 Ga0105249_10007779 3300009553 Bacteria 9340
262 Ga0105249_10792124 3300009553 Bacteria 1012
263 Ga0105249_10800817 3300009553 Bacteria 1006
264 Ga0105032_101026 3300009979 Bacteria 2606
265 Ga0105033_102590 3300009986 Bacteria 1500
266 Ga0105033_103394 3300009986 Bacteria 1338
267 Ga0105035_100358 3300009988 Bacteria 2826
268 Ga0105028_101349 3300009993 Bacteria 2586
269 Ga0105239_10330525 3300010375 Bacteria 1719
270 Ga0105239_10543736 3300010375 Bacteria 1322
271 Ga0105246_10084502 3300011119 Bacteria 2271
272 Ga0105246_10411265 3300011119 Bacteria 1126
273 Ga0105246_11043192 3300011119 Bacteria 743
274 Ga0105246_11379969 3300011119 Bacteria 657
275 Ga0157329_1012942 3300012491 Bacteria 690
276 Ga0157341_1011304 3300012494 Bacteria 771
277 Ga0157323_1000742 3300012495 Bacteria 1478
278 Ga0157324_1002822 3300012506 Bacteria 1091
279 Ga0157315_1015463 3300012508 Bacteria 744
280 Ga0157373_10461937 3300013100 Bacteria 914
281 Ga0157371_10012725 3300013102 Bacteria 6414
282 Ga0157370_10260145 3300013104 Bacteria 1604
283 Ga0157369_10086187 3300013105 Bacteria 3355
284 Ga0157369_10514077 3300013105 Bacteria 1239
285 Ga0157369_11625030 3300013105 Bacteria 657
286 Ga0157369_12114607 3300013105 Bacteria 571
287 Ga0157374_10031506 3300013296 Bacteria 4820
288 Ga0157374_10331172 3300013296 Bacteria 1510
289 Ga0157374_10720339 3300013296 Bacteria 1011
290 Ga0157374_10876269 3300013296 Bacteria 915
291 Ga0157374_11218317 3300013296 Bacteria 774
292 Ga0157378_10088855 3300013297 Bacteria 2805
293 Ga0157378_10355995 3300013297 Bacteria 1431
294 Ga0157378_11157240 3300013297 Bacteria 812
295 Ga0163162_10015117 3300013306 Bacteria 7536
296 Ga0163162_12702098 3300013306 Bacteria 571
297 Ga0157372_10039710 3300013307 Bacteria 5195
298 Ga0157372_10313074 3300013307 Bacteria 1827
299 Ga0157372_10599602 3300013307 Bacteria 1284
300 Ga0157372_11431024 3300013307 Bacteria 797
301 Ga0157372_11547638 3300013307 Bacteria 764
302 Ga0157375_10179713 3300013308 Bacteria 2267
303 Ga0157375_11087697 3300013308 Bacteria 936
304 Ga0157375_11154372 3300013308 Bacteria 908
305 Ga0157375_11413326 3300013308 Bacteria 820
306 Ga0157375_11536211 3300013308 Bacteria 786
307 Ga0157375_12027055 3300013308 Bacteria 684
308 Ga0157515_106749 3300013875 Bacteria 701
309 Ga0163163_10419870 3300014325 Bacteria 1396
310 Ga0163163_10853113 3300014325 Bacteria 974
311 Ga0163163_12490750 3300014325 Bacteria 575
312 Ga0157380_10317983 3300014326 Bacteria 1442
313 Ga0157380_10496596 3300014326 Bacteria 1184
314 Ga0157380_11554064 3300014326 Bacteria 716
315 Ga0157380_12303943 3300014326 Bacteria 603
316 Ga0157380_13022672 3300014326 Bacteria 536
317 Ga0157377_10126329 3300014745 Bacteria 1556
318 Ga0157377_10166573 3300014745 Bacteria 1375
319 Ga0157379_10009261 3300014968 Bacteria 8574
320 Ga0157379_10124714 3300014968 Bacteria 2317
321 Ga0157379_10209281 3300014968 Bacteria 1765
322 Ga0157379_10485205 3300014968 Bacteria 1144
323 Ga0157379_10778462 3300014968 Bacteria 902
324 Ga0157379_10972049 3300014968 Bacteria 808
325 Ga0157376_10089329 3300014969 Bacteria 2664
326 Ga0157376_10099488 3300014969 Bacteria 2538
327 Ga0157376_10846308 3300014969 Bacteria 930
328 Ga0157376_11393293 3300014969 Bacteria 732
329 Ga0157376_11542484 3300014969 Bacteria 698
330 Ga0163161_10006328 3300017792 Bacteria 8196
331 Ga0163161_10098940 3300017792 Bacteria 2168
332 Ga0163161_10483145 3300017792 Bacteria 1006
333 Ga0163161_11712468 3300017792 Bacteria 557
334 Ga0197907_10318291 3300020069 Bacteria 1359
335 Ga0197907_10377945 3300020069 Bacteria 8513
336 Ga0197907_10891275 3300020069 Bacteria 1108
337 Ga0206356_10247586 3300020070 Bacteria 2138
338 Ga0206356_11903330 3300020070 Bacteria 567
339 Ga0206349_1094146 3300020075 Bacteria 699
340 Ga0206349_1431413 3300020075 Bacteria 546
341 Ga0206349_1453397 3300020075 Bacteria 3920
342 Ga0206355_1109688 3300020076 Bacteria 550
343 Ga0206355_1305882 3300020076 Bacteria 607
344 Ga0206355_1410655 3300020076 Bacteria 555
345 Ga0206355_1658075 3300020076 Bacteria 1344
346 Ga0206352_10207358 3300020078 Bacteria 1492
347 Ga0206352_10616844 3300020078 Bacteria 798
348 Ga0206352_10764106 3300020078 Bacteria 611
349 Ga0206350_10688099 3300020080 Bacteria 837
350 Ga0206350_10993920 3300020080 Bacteria 1143
351 Ga0206350_11200745 3300020080 Bacteria 2647
352 Ga0206354_10278938 3300020081 Bacteria 892
353 Ga0206354_10319359 3300020081 Bacteria 978
354 Ga0206353_10692420 3300020082 Bacteria 797
355 Ga0206353_11042006 3300020082 Bacteria 1115
356 Ga0206353_11638776 3300020082 Bacteria 1648
357 Ga0154015_1161714 3300020610 Bacteria 620
358 Ga0213876_10047350 3300021384 Bacteria 2273
359 Ga0213875_10000107 3300021388 Bacteria 95120
360 Ga0213875_10004141 3300021388 Bacteria 8036
361 Ga0224712_10000575 3300022467 Bacteria 7470
362 Ga0256744_130645 3300023309 Bacteria 584
363 Ga0207656_10042243 3300025321 Bacteria 1939
364 Ga0207656_10599072 3300025321 Bacteria 563
365 Ga0207692_10000368 3300025898 Bacteria 15470
366 Ga0207692_10026602 3300025898 Bacteria 2715
367 Ga0207642_10062373 3300025899 Bacteria 1738
368 Ga0207642_10659167 3300025899 Bacteria 656
369 Ga0207642_11045914 3300025899 Bacteria 527
370 Ga0207710_10052355 3300025900 Bacteria 1835
371 Ga0207710_10261847 3300025900 Bacteria 867
372 Ga0207710_10321723 3300025900 Bacteria 784
373 Ga0207710_10439399 3300025900 Bacteria 673
374 Ga0207710_10694480 3300025900 Bacteria 534
375 Ga0207688_10005072 3300025901 Bacteria 7162
376 Ga0207688_10064689 3300025901 Bacteria 2065
377 Ga0207688_10108103 3300025901 Bacteria 1612
378 Ga0207688_10677728 3300025901 Bacteria 651
379 Ga0207688_10784479 3300025901 Bacteria 604
380 Ga0207680_10699813 3300025903 Bacteria 726
381 Ga0207647_10049984 3300025904 Bacteria 2591
382 Ga0207647_10053739 3300025904 Bacteria 2481
383 Ga0207645_10006241 3300025907 Bacteria 8563
384 Ga0207643_10011760 3300025908 Bacteria 4726
385 Ga0207643_10140578 3300025908 Bacteria 1442
386 Ga0207705_10367140 3300025909 Bacteria 1110
387 Ga0207705_11355801 3300025909 Bacteria 542
388 Ga0207654_10300849 3300025911 Bacteria 1091
389 Ga0207654_10522198 3300025911 Bacteria 841
390 Ga0207695_10328126 3300025913 Bacteria 1419
391 Ga0207695_11262625 3300025913 Bacteria 619
392 Ga0207671_10237501 3300025914 Bacteria 1431
393 Ga0207693_10001283 3300025915 Bacteria 22327
394 Ga0207663_10024245 3300025916 Bacteria 3493
395 Ga0207660_10565719 3300025917 Bacteria 925
396 Ga0207662_10009419 3300025918 Bacteria 5374
397 Ga0207662_10026906 3300025918 Bacteria 3319
398 Ga0207662_10221385 3300025918 Bacteria 1233
399 Ga0207662_10574671 3300025918 Bacteria 782
400 Ga0207657_10009138 3300025919 Bacteria 10001
401 Ga0207657_10020254 3300025919 Bacteria 6292
402 Ga0207657_10191592 3300025919 Bacteria 1649
403 Ga0207649_10615582 3300025920 Bacteria 836
404 Ga0207652_10233560 3300025921 Bacteria 1657
405 Ga0207694_10338999 3300025924 Bacteria 1243
406 Ga0207694_10823824 3300025924 Bacteria 784
407 Ga0207694_10982330 3300025924 Bacteria 714
408 Ga0207650_11288285 3300025925 Bacteria 622
409 Ga0207659_11119560 3300025926 Bacteria 677
410 Ga0207687_10345013 3300025927 Bacteria 1212
411 Ga0207687_11784570 3300025927 Bacteria 527
412 Ga0207700_10096353 3300025928 Bacteria 2349
413 Ga0207664_10017195 3300025929 Bacteria 5296
414 Ga0207664_10101806 3300025929 Bacteria 2374
415 Ga0207664_10118147 3300025929 Bacteria 2215
416 Ga0207664_10891636 3300025929 Bacteria 799
417 Ga0207664_11393969 3300025929 Bacteria 621
418 Ga0207644_10001330 3300025931 Bacteria 15853
419 Ga0207644_10331563 3300025931 Bacteria 1232
420 Ga0207644_11418999 3300025931 Bacteria 583
421 Ga0207690_10158621 3300025932 Bacteria 1684
422 Ga0207690_11021612 3300025932 Bacteria 688
423 Ga0207706_10009289 3300025933 Bacteria 9028
424 Ga0207706_10016976 3300025933 Bacteria 6567
425 Ga0207706_10708065 3300025933 Bacteria 860
426 Ga0207686_10223419 3300025934 Bacteria 1361
427 Ga0207686_10262709 3300025934 Bacteria 1266
428 Ga0207709_10052364 3300025935 Bacteria 2507
429 Ga0207709_10537233 3300025935 Bacteria 918
430 Ga0207709_10661350 3300025935 Bacteria 833
431 Ga0207670_10141571 3300025936 Bacteria 1774
432 Ga0207670_10243527 3300025936 Bacteria 1386
433 Ga0207669_10170726 3300025937 Bacteria 1547
434 Ga0207669_10515359 3300025937 Bacteria 959
435 Ga0207669_10520246 3300025937 Bacteria 955
436 Ga0207704_10162306 3300025938 Bacteria 1592
437 Ga0207704_10246965 3300025938 Bacteria 1337
438 Ga0207704_10704071 3300025938 Bacteria 836
439 Ga0207704_11013915 3300025938 Bacteria 702
440 Ga0207665_10006255 3300025939 Bacteria 7901
441 Ga0207665_10485759 3300025939 Bacteria 952
442 Ga0207691_10052644 3300025940 Bacteria 3718
443 Ga0207691_10142827 3300025940 Bacteria 2108
444 Ga0207691_10192161 3300025940 Bacteria 1780
445 Ga0207691_11634433 3300025940 Bacteria 523
446 Ga0207711_10121462 3300025941 Bacteria 2332
447 Ga0207689_10004616 3300025942 Bacteria 12458
448 Ga0207689_10017438 3300025942 Bacteria 6076
449 Ga0207689_11039171 3300025942 Bacteria 691
450 Ga0207689_11040828 3300025942 Bacteria 690
451 Ga0207661_11077097 3300025944 Bacteria 740
452 Ga0207661_11845377 3300025944 Bacteria 550
453 Ga0207679_10173702 3300025945 Bacteria 1776
454 Ga0207679_10541878 3300025945 Bacteria 1043
455 Ga0207679_11153116 3300025945 Bacteria 711
456 Ga0207667_10342259 3300025949 Bacteria 1526
457 Ga0207667_10419184 3300025949 Bacteria 1362
458 Ga0207667_11466013 3300025949 Bacteria 654
459 Ga0207651_10242789 3300025960 Bacteria 1469
460 Ga0207712_10000797 3300025961 Bacteria 23298
461 Ga0207712_10329245 3300025961 Bacteria 1263
462 Ga0207712_10527653 3300025961 Bacteria 1013
463 Ga0207668_10061079 3300025972 Bacteria 2648
464 Ga0207668_10143504 3300025972 Bacteria 1839
465 Ga0207668_10164948 3300025972 Bacteria 1731
466 Ga0207668_10392781 3300025972 Bacteria 1171
467 Ga0207668_10877481 3300025972 Bacteria 797
468 Ga0207640_10030986 3300025981 Bacteria 3300
469 Ga0207640_10461675 3300025981 Bacteria 1049
470 Ga0207658_10139424 3300025986 Bacteria 1960
471 Ga0207658_10256438 3300025986 Bacteria 1488
472 Ga0207677_10122095 3300026023 Bacteria 1962
473 Ga0207677_10378368 3300026023 Bacteria 1194
474 Ga0207677_10420102 3300026023 Bacteria 1139
475 Ga0207677_10440473 3300026023 Bacteria 1114
476 Ga0207677_10599610 3300026023 Bacteria 966
477 Ga0207703_10189049 3300026035 Bacteria 1822
478 Ga0207703_10877884 3300026035 Bacteria 858
479 Ga0207639_10617818 3300026041 Bacteria 1000
480 Ga0207678_10009664 3300026067 Bacteria 8483
481 Ga0207678_10022601 3300026067 Bacteria 5508
482 Ga0207678_10233078 3300026067 Bacteria 1576
483 Ga0207678_10514768 3300026067 Bacteria 1044
484 Ga0207678_10670754 3300026067 Bacteria 911
485 Ga0207678_11673007 3300026067 Bacteria 559
486 Ga0207708_10015459 3300026075 Bacteria 5724
487 Ga0207708_10171226 3300026075 Bacteria 1720
488 Ga0207708_10273447 3300026075 Bacteria 1367
489 Ga0207708_11584261 3300026075 Bacteria 576
490 Ga0207708_12006805 3300026075 Bacteria 506
491 Ga0207641_10003356 3300026088 Bacteria 14232
492 Ga0207641_10071941 3300026088 Bacteria 2977
493 Ga0207641_10141048 3300026088 Bacteria 2174
494 Ga0207641_10395647 3300026088 Bacteria 1326
495 Ga0207648_10008491 3300026089 Bacteria 9939
496 Ga0207648_10093298 3300026089 Bacteria 2632
497 Ga0207648_11032099 3300026089 Bacteria 770
498 Ga0207648_11479571 3300026089 Bacteria 638
499 Ga0207676_10624231 3300026095 Bacteria 1037
500 Ga0207676_10871869 3300026095 Bacteria 881
501 Ga0207676_10981772 3300026095 Bacteria 831
502 Ga0207676_11692555 3300026095 Bacteria 631
503 Ga0207674_10011658 3300026116 Bacteria 9870
504 Ga0207675_100012489 3300026118 Bacteria 7934
505 Ga0207675_100014683 3300026118 Bacteria 7303
506 Ga0207675_100251858 3300026118 Bacteria 1709
507 Ga0207675_102211584 3300026118 Bacteria 565
508 Ga0207683_10004908 3300026121 Bacteria 11507
509 Ga0207683_10030091 3300026121 Bacteria 4703
510 Ga0207683_10106701 3300026121 Bacteria 2505
511 Ga0207683_10109837 3300026121 Bacteria 2469
512 Ga0207683_10626278 3300026121 Bacteria 996
513 Ga0207698_10174299 3300026142 Bacteria 1897
514 Ga0207698_10246185 3300026142 Bacteria 1633
515 Ga0207698_10922821 3300026142 Bacteria 881
516 Ga0207698_11123404 3300026142 Bacteria 799
517 Ga0207428_10134227 3300027907 Bacteria 1893
518 Ga0268266_10084776 3300028379 Bacteria 2767
519 Ga0268266_10149683 3300028379 Bacteria 2102
520 Ga0268266_10376558 3300028379 Bacteria 1338
521 Ga0268266_10498807 3300028379 Bacteria 1162
522 Ga0268266_10636863 3300028379 Bacteria 1025
523 Ga0268266_11094681 3300028379 Bacteria 771
524 Ga0268265_10028281 3300028380 Bacteria 4013
525 Ga0268265_10197645 3300028380 Bacteria 1741
526 Ga0268265_10511968 3300028380 Bacteria 1133
527 Ga0268264_10034736 3300028381 Bacteria 4149
528 Ga0268264_10156370 3300028381 Bacteria 2049
529 Ga0268264_10816641 3300028381 Bacteria 932
530 Ga0311003_163444 3300029282 Bacteria 745
531 Ga0310981_1042594 3300029285 Bacteria 589
532 Ga0307512_10008844 3300030522 Bacteria 9767
533 Ga0316177_1073951 3300030731 Bacteria 3186
534 Ga0316176_1154284 3300030732 Bacteria 5987
535 Ga0314311_1038188 3300030733 Bacteria 3616
536 Ga0316178_1145984 3300030735 Bacteria 1300
537 Ga0316180_1057786 3300030736 Bacteria 2888
538 Ga0316183_1025727 3300030742 Bacteria 745
539 Ga0316181_1255392 3300030744 Bacteria 1806
540 Ga0316182_1026960 3300030745 Bacteria 1903
541 Ga0265327_10000165 3300031251 Bacteria 142199
542 Ga0307513_10001540 3300031456 Bacteria 33040
543 Ga0307509_10170317 3300031507 Bacteria 2058
544 Ga0307405_10290907 3300031731 Bacteria 1235
545 Ga0307413_10000820 3300031824 Bacteria 10858
546 Ga0307410_10244890 3300031852 Bacteria 1391
547 Ga0307410_10728701 3300031852 Bacteria 838
548 Ga0307409_100461078 3300031995 Bacteria 1229
549 Ga0307409_100953740 3300031995 Bacteria 874
550 Ga0307409_100958551 3300031995 Bacteria 872
551 Ga0307416_102353550 3300032002 Bacteria 633
552 Ga0307411_11601520 3300032005 Bacteria 601
553 Ga0307415_101836880 3300032126 Bacteria 587
554 Ga0373950_0005642 3300034818 Bacteria 1877
555 Ga0373938_0044535 3300034957 Bacteria 996
556 Ga0373938_0092571 3300034957 Bacteria 750
557 Ga0373929_0003284 3300035085 Bacteria 2924
558 Ga0373940_0208121 3300035088 Bacteria 645
559 Ga0373949_0021905 3300035090 Bacteria 1470
560 Ga0373952_0011882 3300035092 Bacteria 1705
561 Ga0373932_0007943 3300035112 Bacteria 2533
562 Ga0373939_0002935 3300035114 Bacteria 4010
563 Ga0373939_0205135 3300035114 Bacteria 747
564 Ga0373941_0109602 3300035115 Bacteria 972
565 Ga0373956_0470657 3300035119 Bacteria 600
566 Ga0373960_0029968 3300035121 Bacteria 1512
567 Ga0373943_0450553 3300035170 Bacteria 748
568 Ga0373946_0229974 3300035171 Bacteria 898
569 Ga0373942_0133563 3300035207 Bacteria 785
570 Ga0373962_0003137 3300035242 Bacteria 3960
571 Ga0373931_0015456 3300035691 Bacteria 3744
572 Ga0373931_0028935 3300035691 Bacteria 2841
573 Ga0373931_0493988 3300035691 Bacteria 788
574 Ga0373927_1164312 3300035695 Bacteria 509
575 Ga0373937_1727270 3300036401 Bacteria 573
576 Ga0373925_0657368 3300037068 Bacteria 864
577 Ga0373925_1195037 3300037068 Bacteria 625
578 Ga0395905_0135257 3300037471 Bacteria 2319
579 Ga0436364_0010700 3300037853 Bacteria 115369
580 Ga0436364_0184253 3300037853 Bacteria 13885
581 Ga0436364_0588322 3300037853 Bacteria 80195
582 Ga0395901_1254022 3300038443 Bacteria 705
583 Ga0436365_1725899 3300039437 Bacteria 6330
584 Ga0436363_0697187 3300039450 Bacteria 1378
585 Ga0436362_0313342 3300039453 Bacteria 734
586 Ga0436362_0494804 3300039453 Bacteria 733
587 Ga0439465_0435241 3300041413 Bacteria 502
588 Ga0451787_757127 3300041441 Bacteria 619
589 Ga0451789_0054430 3300041443 Bacteria 837
590 Ga0451794_14393 3300041446 Bacteria 994
591 Ga0451794_55151 3300041446 Bacteria 522
592 Ga0451791_1065158 3300041451 Bacteria 2248
593 Ga0451791_1865944 3300041451 Bacteria 670
594 Ga0451793_0363264 3300041452 Bacteria 625
595 Ga0451793_0871455 3300041452 Bacteria 1734
596 Ga0451797_1382881 3300041453 Bacteria 1974
597 Ga0451797_1384890 3300041453 Bacteria 631
598 Ga0451801_11751 3300041455 Bacteria 531
599 Ga0451798_0190825 3300041458 Bacteria 709
600 Ga0451800_1390558 3300041459 Bacteria 1743
601 Ga0451807_1654378 3300041486 Bacteria 1644
602 Ga0451837_0550193 3300041494 Bacteria 2300
603 Ga0451839_1054739 3300041496 Bacteria 537
604 Ga0451841_1228666 3300041498 Bacteria 1783
605 Ga0451845_0146963 3300041501 Bacteria 571
606 Ga0451849_0017685 3300041505 Bacteria 543
607 Ga0451851_1177781 3300041507 Bacteria 543
608 Ga0451855_1627071 3300041511 Bacteria 984
609 Ga0451853_1554167 3300041512 Bacteria 2526
610 Ga0439442_046897 3300042002 Bacteria 910
611 Ga0439445_0148492 3300042004 Bacteria 682
612 Ga0439448_0079846 3300042005 Bacteria 1098
613 Ga0439450_171774 3300042008 Bacteria 574
614 Ga0439463_031098 3300042016 Bacteria 1347
615 Ga0439463_129239 3300042016 Bacteria 654
616 Ga0466972_0007279 3300044658 Bacteria 5557
617 Ga0466972_0585810 3300044658 Bacteria 527
618 Ga0466965_0007902 3300044683 Bacteria 4906
619 Ga0466965_0033398 3300044683 Bacteria 2514
620 Ga0466965_0294538 3300044683 Bacteria 879
621 Ga0466966_0000383 3300044684 Bacteria 28757
622 Ga0466961_0054451 3300044693 Bacteria 2552
623 Ga0466963_0009016 3300044694 Bacteria 5991
624 Ga0466963_0320336 3300044694 Bacteria 1091
625 Ga0466963_0681869 3300044694 Bacteria 725
626 Ga0466964_0270334 3300044706 Bacteria 846
627 Ga0466964_0326363 3300044706 Bacteria 781
628 Ga0466971_0009870 3300044719 Bacteria 4169
629 Ga0466971_0422736 3300044719 Bacteria 651
630 Ga0466968_0000486 3300044735 Bacteria 13428
631 Ga0466968_0026217 3300044735 Bacteria 2391
632 Ga0466968_0030625 3300044735 Bacteria 2229
633 Ga0466970_0021508 3300044765 Bacteria 3359
634 Ga0466957_0009243 3300044842 Bacteria 5623
635 Ga0466960_0003887 3300044901 Bacteria 5793
636 Ga0466960_0007532 3300044901 Bacteria 4427
637 Ga0466960_0834377 3300044901 Bacteria 559
638 Ga0466959_0017822 3300045049 Bacteria 5209
639 Ga0466959_0461104 3300045049 Bacteria 861
640 Ga0466958_0000206 3300045836 Bacteria 21886
641 Ga0466958_0057813 3300045836 Bacteria 2357
642 Ga0466958_0334773 3300045836 Bacteria 974
643 Ga0466958_0459816 3300045836 Bacteria 824
644 Ga0466967_0048690 3300045976 Bacteria 3703
645 Ga0466967_0082652 3300045976 Bacteria 2903
646 Ga0466967_1063197 3300045976 Bacteria 806
647 Ga0466967_1184008 3300045976 Bacteria 761
648 Ga0466967_2059600 3300045976 Bacteria 567
649 Ga0495592_0409566 3300046454 Bacteria 857
650 Ga0495603_0133889 3300046455 Bacteria 1443
651 Ga0495629_0152338 3300046459 Bacteria 1607
652 Ga0495629_0501630 3300046459 Bacteria 818
653 Ga0495629_0976300 3300046459 Bacteria 552
654 Ga0495641_0097610 3300046461 Bacteria 1311
655 Ga0495641_0112967 3300046461 Bacteria 1212
656 Ga0495651_0507553 3300046462 Bacteria 771
657 Ga0495653_0426913 3300046463 Bacteria 838
658 Ga0495653_0586206 3300046463 Bacteria 687
659 Ga0495650_0271392 3300046471 Bacteria 573
660 Ga0495594_0727285 3300046499 Bacteria 561
661 Ga0495596_0130294 3300046500 Bacteria 976
662 Ga0495607_0159700 3300046501 Bacteria 1146
663 Ga0495606_0237907 3300046507 Bacteria 1017
664 Ga0495608_0361634 3300046511 Bacteria 892
665 Ga0495608_0385480 3300046511 Bacteria 859
666 Ga0495620_0095563 3300046515 Bacteria 1189
667 Ga0495620_0240301 3300046515 Bacteria 691
668 Ga0495628_0197758 3300046516 Bacteria 1516
669 Ga0495630_0270915 3300046517 Bacteria 1297
670 Ga0495643_0373764 3300046522 Bacteria 634
671 Ga0495666_0465691 3300046526 Bacteria 566
672 Ga0495665_0121367 3300046531 Bacteria 1369
673 Ga0495640_0330009 3300046533 Bacteria 944
674 Ga0495586_0296082 3300046535 Bacteria 927
675 Ga0495598_0048912 3300046537 Bacteria 1266
676 Ga0495667_0248101 3300046559 Bacteria 1133
677 Ga0495634_0303502 3300046642 Bacteria 965
678 Ga0495635_0576459 3300046663 Bacteria 736
679 Ga0495635_0812716 3300046663 Bacteria 602
680 Ga0495588_0125822 3300046674 Bacteria 1352
681 Ga0495657_0311003 3300046675 Bacteria 938
682 Ga0495657_0572344 3300046675 Bacteria 655
683 Ga0495599_0113565 3300046678 Bacteria 1686
684 Ga0495646_0139571 3300046680 Bacteria 1356
685 Ga0495647_0464116 3300046681 Bacteria 587
686 Ga0495613_0503077 3300046689 Bacteria 816
687 Ga0495624_0169708 3300046690 Bacteria 1331
688 Ga0495649_0376587 3300046694 Bacteria 715
689 Ga0495581_0119575 3300047315 Bacteria 1533
690 Ga0495604_0481382 3300047317 Bacteria 807
691 Ga0495676_0985966 3300047321 Bacteria 538
692 Ga0495680_0081426 3300047322 Bacteria 2444
693 Ga0495680_0452336 3300047322 Bacteria 879
694 Ga0495680_0694450 3300047322 Bacteria 673
695 Ga0495683_0003613 3300047323 Bacteria 8973
696 Ga0495683_0423570 3300047323 Bacteria 550
697 Ga0495593_0053150 3300047673 Bacteria 2138
698 Ga0495614_0147013 3300048089 Bacteria 1050
699 Ga0495614_0235608 3300048089 Bacteria 835
700 Ga0496100_0002817 3300048903 Bacteria 8915
701 Ga0496100_0046841 3300048903 Bacteria 2783
702 Ga0496100_0329159 3300048903 Bacteria 1149
703 Ga0496100_0374454 3300048903 Bacteria 1080
704 Ga0496100_0418445 3300048903 Bacteria 1023
705 Ga0496101_0019981 3300048904 Bacteria 4580
706 Ga0496101_0091947 3300048904 Bacteria 2258
707 Ga0496101_0153999 3300048904 Bacteria 1759
708 Ga0496101_0275312 3300048904 Bacteria 1314
709 Ga0496101_0278475 3300048904 Bacteria 1307
710 Ga0496101_0927603 3300048904 Bacteria 685
711 Ga0496102_0000521 3300048905 Bacteria 41977
712 Ga0496102_0132676 3300048905 Bacteria 2332
713 Ga0496102_0174227 3300048905 Bacteria 2025
714 Ga0496102_0600891 3300048905 Bacteria 1023
715 Ga0496103_0000453 3300048906 Bacteria 34950
716 Ga0496103_0104531 3300048906 Bacteria 1795
717 Ga0496103_0169432 3300048906 Bacteria 1402
718 Ga0496103_0278591 3300048906 Bacteria 1076
719 Ga0496104_0004123 3300048907 Bacteria 12619
720 Ga0496104_0011710 3300048907 Bacteria 7867
721 Ga0496104_0082973 3300048907 Bacteria 3057
722 Ga0496104_0283996 3300048907 Bacteria 1568
723 Ga0496104_0373568 3300048907 Bacteria 1338
724 Ga0496105_0037579 3300048908 Bacteria 3987
725 Ga0496105_0128707 3300048908 Bacteria 2088
726 Ga0496105_0275374 3300048908 Bacteria 1358
727 Ga0496105_0380333 3300048908 Bacteria 1123
728 Ga0496106_0098087 3300048909 Bacteria 2270
729 Ga0496106_0132106 3300048909 Bacteria 1958
730 Ga0496106_0376036 3300048909 Bacteria 1142
731 Ga0496106_0749813 3300048909 Bacteria 776
732 Ga0496106_1487203 3300048909 Bacteria 521
733 Ga0496107_0519136 3300048910 Bacteria 883
734 Ga0496107_0727678 3300048910 Bacteria 729
735 Ga0496107_1198345 3300048910 Bacteria 546
736 Ga0496108_0075461 3300048911 Bacteria 2848
737 Ga0496108_0103562 3300048911 Bacteria 2428
738 Ga0496108_0112101 3300048911 Bacteria 2333
739 Ga0496108_0128186 3300048911 Bacteria 2180
740 Ga0496108_0849852 3300048911 Bacteria 785
741 Ga0496109_0008622 3300048912 Bacteria 8680
742 Ga0496109_0049417 3300048912 Bacteria 3828
743 Ga0496109_0162421 3300048912 Bacteria 2093
744 Ga0496109_0368258 3300048912 Bacteria 1357
745 Ga0496109_0441050 3300048912 Bacteria 1230
746 Ga0496109_0629980 3300048912 Bacteria 1009
747 Ga0496109_0658037 3300048912 Bacteria 984
748 Ga0496109_1357651 3300048912 Bacteria 646
749 Ga0496110_0004143 3300048913 Bacteria 11207
750 Ga0496110_0110005 3300048913 Bacteria 2475
751 Ga0496110_0331538 3300048913 Bacteria 1386
752 Ga0496110_0645854 3300048913 Bacteria 958
753 Ga0496110_0883779 3300048913 Bacteria 799
754 Ga0496110_1393355 3300048913 Bacteria 610
755 Ga0496111_0000712 3300048914 Bacteria 17656
756 Ga0496111_0210201 3300048914 Bacteria 1445
757 Ga0496111_0298442 3300048914 Bacteria 1194
758 Ga0496111_0839625 3300048914 Bacteria 663
759 Ga0496112_0072471 3300048915 Bacteria 3405
760 Ga0496112_0162970 3300048915 Bacteria 2196
761 Ga0496112_0723686 3300048915 Bacteria 922
762 Ga0496113_0087743 3300048916 Bacteria 2392
763 Ga0496113_0252450 3300048916 Bacteria 1408
764 Ga0496114_0007373 3300048917 Bacteria 8689
765 Ga0496114_0014309 3300048917 Bacteria 6365
766 Ga0496114_0051545 3300048917 Bacteria 3426
767 Ga0496114_0193477 3300048917 Bacteria 1780
768 Ga0496114_0320915 3300048917 Bacteria 1368
769 Ga0496114_0386795 3300048917 Bacteria 1239
770 Ga0496114_0719552 3300048917 Bacteria 874
771 Ga0496115_0006695 3300048918 Bacteria 8450
772 Ga0496115_0047273 3300048918 Bacteria 3441
773 Ga0496115_0166871 3300048918 Bacteria 1821
774 Ga0496116_0000173 3300048919 Bacteria 129928
775 Ga0496117_0000144 3300048920 Bacteria 153831
776 Ga0496118_0000096 3300048921 Bacteria 163988
777 Ga0496119_0003189 3300048922 Bacteria 17184
778 Ga0496120_0004033 3300048923 Bacteria 12732
779 Ga0496121_0005885 3300048924 Bacteria 15525
780 Ga0496122_0175033 3300048925 Bacteria 1288
781 Ga0496124_0003352 3300048927 Bacteria 19709
782 Ga0496125_0011762 3300048928 Bacteria 8722
783 Ga0496126_0000330 3300048929 Bacteria 101064
784 Ga0501304_015291 3300049160 Bacteria 718
785 Ga0501307_020577 3300049162 Bacteria 854
786 Ga0501311_055393 3300049527 Bacteria 630
787 Ga0501314_001516 3300049530 Bacteria 1690
788 Ga0501315_001744 3300049531 Bacteria 1930
789 Ga0501317_000360 3300049533 Bacteria 3067
790 Ga0501317_049713 3300049533 Bacteria 663
791 Ga0501318_001561 3300049534 Bacteria 1831
792 Ga0501318_010783 3300049534 Bacteria 1021
793 Ga0501318_078349 3300049534 Bacteria 532
794 Ga0501322_000741 3300049538 Bacteria 1640
795 Ga0501325_018505 3300049541 Bacteria 714
796 Ga0501036_1647155 3300049572 Bacteria 518
797 Ga0501047_0989925 3300049581 Bacteria 654
798 Ga0501071_0933851 3300049587 Bacteria 670
799 Ga0501079_0443133 3300049741 Bacteria 1020
800 Ga0501045_0427182 3300049824 Bacteria 986
801 nmdc:mga09592_585309_c1 3300050508 Bacteria 957
802 nmdc:mga0qj67_612112_c1 3300050509 Bacteria 871
803 nmdc:mga06r32_136_c2 3300050510 Bacteria 3241
804 nmdc:mga08y16_580270_c1 3300050511 Bacteria 1132
805 nmdc:mga0n895_1035878_c1 3300050512 Bacteria 800
806 nmdc:mga0n895_505221_c1 3300050512 Bacteria 1218
807 nmdc:mga0rr50_61245_c1 3300050513 Bacteria 2835
808 nmdc:mga0a205_19433_c1 3300050515 Bacteria 6404
809 nmdc:mga0a205_594190_c1 3300050515 Bacteria 960
810 nmdc:mga0a205_791190_c1 3300050515 Bacteria 796
811 Ga0495601_0227312 3300053077 Bacteria 1219
812 Ga0495601_0886511 3300053077 Bacteria 564
813 Ga0495655_0097996 3300053083 Bacteria 864
814 Ga0495619_0005374 3300053085 Bacteria 8112
815 Ga0495619_0258467 3300053085 Bacteria 1207
816 Ga0495619_0338314 3300053085 Bacteria 1042
817 Ga0500643_061101 3300053087 Bacteria 1058
818 Ga0500577_0001143 3300053142 Bacteria 6808
819 Ga0590074_107646 3300059423 Bacteria 548
820 Ga0587084_042301 3300059477 Bacteria 779
821 Ga0587066_041351 3300059490 Bacteria 870
822 Ga0587066_105837 3300059490 Bacteria 646
823 Ga0587070_060091 3300059491 Bacteria 783
824 Ga0587070_151233 3300059491 Bacteria 582
825 Ga0587077_088052 3300059493 Bacteria 725
826 Ga0587080_029292 3300059503 Bacteria 950
827 Ga0587082_126319 3300059504 Bacteria 583
828 Ga0587082_145273 3300059504 Bacteria 557
829 Ga0587083_0048673 3300059505 Bacteria 916
830 Ga0587083_0116247 3300059505 Bacteria 686
831 Ga0587083_0127328 3300059505 Bacteria 665
832 Ga0587085_003511 3300059506 Bacteria 1710
833 Ga0587085_129987 3300059506 Bacteria 562
834 Ga0587088_041584 3300059508 Bacteria 868
835 Ga0587088_054133 3300059508 Bacteria 795
836 Ga0587088_065079 3300059508 Bacteria 748
837 Ga0587090_102412 3300059510 Bacteria 601
838 Ga0587091_177986 3300059511 Bacteria 558
839 Ga0587098_018155 3300059604 Bacteria 869
840 Ga0587125_014288 3300059607 Bacteria 867
841 Ga0587099_019046 3300059622 Bacteria 762
842 Ga0587101_103658 3300059623 Bacteria 569
843 Ga0587109_173845 3300059624 Bacteria 546
844 Ga0587113_041675 3300059625 Bacteria 551
845 Ga0587115_051297 3300059626 Bacteria 671
846 Ga0587117_095107 3300059627 Bacteria 561
847 Ga0587128_107440 3300059630 Bacteria 592
848 Ga0587067_018634 3300059640 Bacteria 1167
849 Ga0587067_146302 3300059640 Bacteria 590
850 Ga0587067_166836 3300059640 Bacteria 564
851 Ga0587068_138276 3300059641 Bacteria 542
852 Ga0587069_036468 3300059642 Bacteria 820
853 Ga0587072_029483 3300059643 Bacteria 1018
854 Ga0587072_070733 3300059643 Bacteria 736
855 Ga0587072_075794 3300059643 Bacteria 718
856 Ga0587075_110658 3300059644 Bacteria 558
857 Ga0587078_046642 3300059646 Bacteria 626
858 Ga0587079_198710 3300059647 Bacteria 546
859 Ga0587100_021312 3300059648 Bacteria 634
860 Ga0587107_051389 3300059652 Bacteria 700
861 Ga0587071_038380 3300060344 Bacteria 951
862 Ga0587111_0094380 3300060346 Bacteria 736
863 Ga0466962_0003094 3300061719 Bacteria 7915
864 Ga0466962_0755373 3300061719 Bacteria 500

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0047273 Ga0496115_0047273_332_706 97
2 iso_pu_bacteria 2547132424 2548693158 100
3 iso_pu_bacteria 2585427649 2586064538 100
4 iso_pu_bacteria 2744054611 2744956957 100
5 iso_pu_bacteria 2791354901 2791913116 100
6 iso_pu_bacteria 2795385472 2795795475 100
7 iso_pu_bacteria 2808606522 2809586234 100
8 iso_pu_bacteria 2816332139 2816505570 100
9 iso_pu_bacteria 2831935698 2831941114 100
10 iso_pu_bacteria 2832004796 2832006205 100
11 iso_pu_bacteria 2855676851 2855681679 100
12 iso_pu_bacteria 2855683550 2855684520 100
13 iso_pu_bacteria 2856858025 2856858865 100
14 iso_pu_bacteria 2858848962 2858850644 100
15 iso_pu_bacteria 2858868258 2858875148 100
16 iso_pu_bacteria 2858882152 2858888059 100
17 iso_pu_bacteria 2858888857 2858890989 100
18 iso_pu_bacteria 2858895516 2858897632 100
19 iso_pu_bacteria 2866065130 2866068642 100
20 iso_pu_bacteria 2866612099 2866617072 100
21 iso_pu_bacteria 2867302475 2867307164 100
22 iso_pu_bacteria 2869048445 2869050058 100
23 iso_pu_bacteria 2869061728 2869063912 100
24 iso_pu_bacteria 2869068681 2869071866 100
25 iso_pu_bacteria 2880489317 2880495228 100
26 iso_pu_bacteria 2880495981 2880497117 100
27 iso_pu_bacteria 2899359706 2899364632 100
28 iso_pu_bacteria 2899370129 2899373898 100
29 iso_pu_bacteria 2902582711 2902583752 100
30 iso_pu_bacteria 2915768154 2915769204 100
31 iso_pu_bacteria 2917736166 2917737847 100
32 iso_pu_bacteria 2919713450 2919718282 100
33 iso_pu_bacteria 2929219909 2929225716 100
34 iso_pu_bacteria 2929226422 2929231307 100
35 iso_pu_bacteria 2932398195 2932401142 100
36 iso_pu_bacteria 8003314358 8003323081 100
37 3300059508 Ga0587088_065079 Ga0587088_065079_220_546 101
38 iso_pu_bacteria 2956939328 2956940984 101
39 iso_pu_bacteria 3001119090 3001120677 101
40 iso_pu_bacteria 2855670206 2855673791 102
41 iso_pu_bacteria 2857288857 2857290716 102
42 iso_pu_bacteria 2891326441 2891331506 102
43 iso_pu_bacteria 8054704163 8054706706 102
44 iso_pu_bacteria 8054727385 8054733687 102
45 iso_pu_bacteria 8054734606 8054740753 102
46 3300003203 JGI25406J46586_10001383 JGI25406J46586_1000138310 103
47 3300004801 Ga0058860_12193443 Ga0058860_121934432 103
48 3300005985 Ga0081539_10000132 Ga0081539_10000132120 103
49 3300031824 Ga0307413_10000820 Ga0307413_1000082019 103
50 3300059490 Ga0587066_105837 Ga0587066_105837_220_540 103
51 3300059607 Ga0587125_014288 Ga0587125_014288_84_419 103
52 3300000549 LJQas_1002897 LJQas_10028972 104
53 3300001979 JGI24740J21852_10072830 JGI24740J21852_100728301 104
54 3300001989 JGI24739J22299_10018382 JGI24739J22299_100183825 104
55 3300002067 JGI24735J21928_10007851 JGI24735J21928_100078514 104
56 3300002077 JGI24744J21845_10093776 JGI24744J21845_100937762 104
57 3300004785 Ga0058858_1396751 Ga0058858_13967511 104
58 3300004798 Ga0058859_10011668 Ga0058859_100116682 104
59 3300004798 Ga0058859_11648364 Ga0058859_116483642 104
60 3300004798 Ga0058859_11663105 Ga0058859_116631051 104
61 3300004800 Ga0058861_11630814 Ga0058861_116308142 104
62 3300004801 Ga0058860_10023721 Ga0058860_100237212 104
63 3300004801 Ga0058860_10092749 Ga0058860_100927495 104
64 3300004801 Ga0058860_12065445 Ga0058860_120654452 104
65 3300004801 Ga0058860_12175289 Ga0058860_121752892 104
66 3300004803 Ga0058862_10023693 Ga0058862_100236933 104
67 3300004803 Ga0058862_10153738 Ga0058862_101537385 104
68 3300005327 Ga0070658_11189461 Ga0070658_111894612 104
69 3300005328 Ga0070676_11186583 Ga0070676_111865831 104
70 3300005329 Ga0070683_100241319 Ga0070683_1002413195 104
71 3300005329 Ga0070683_101326100 Ga0070683_1013261002 104
72 3300005330 Ga0070690_101738678 Ga0070690_1017386781 104
73 3300005331 Ga0070670_100997067 Ga0070670_1009970671 104
74 3300005331 Ga0070670_101601817 Ga0070670_1016018172 104
75 3300005334 Ga0068869_100183863 Ga0068869_1001838633 104
76 3300005334 Ga0068869_100986704 Ga0068869_1009867042 104
77 3300005334 Ga0068869_101042128 Ga0068869_1010421282 104
78 3300005334 Ga0068869_101520067 Ga0068869_1015200671 104
79 3300005335 Ga0070666_10022861 Ga0070666_100228619 104
80 3300005335 Ga0070666_11252481 Ga0070666_112524811 104
81 3300005337 Ga0070682_100035507 Ga0070682_1000355072 104
82 3300005337 Ga0070682_100044721 Ga0070682_1000447215 104
83 3300005337 Ga0070682_100289963 Ga0070682_1002899632 104
84 3300005337 Ga0070682_100851960 Ga0070682_1008519602 104
85 3300005338 Ga0068868_100000735 Ga0068868_10000073522 104
86 3300005338 Ga0068868_100444556 Ga0068868_1004445562 104
87 3300005338 Ga0068868_100451926 Ga0068868_1004519261 104
88 3300005338 Ga0068868_100463731 Ga0068868_1004637312 104
89 3300005340 Ga0070689_100109629 Ga0070689_1001096293 104
90 3300005340 Ga0070689_100150356 Ga0070689_1001503561 104
91 3300005340 Ga0070689_100573325 Ga0070689_1005733252 104
92 3300005343 Ga0070687_100094363 Ga0070687_1000943635 104
93 3300005343 Ga0070687_100615577 Ga0070687_1006155772 104
94 3300005343 Ga0070687_100886665 Ga0070687_1008866652 104
95 3300005344 Ga0070661_101223581 Ga0070661_1012235812 104
96 3300005345 Ga0070692_10085751 Ga0070692_100857513 104
97 3300005347 Ga0070668_100074215 Ga0070668_1000742156 104
98 3300005347 Ga0070668_100582941 Ga0070668_1005829412 104
99 3300005347 Ga0070668_100910105 Ga0070668_1009101051 104
100 3300005347 Ga0070668_101856342 Ga0070668_1018563422 104
101 3300005353 Ga0070669_100059808 Ga0070669_1000598086 104
102 3300005354 Ga0070675_100596012 Ga0070675_1005960122 104
103 3300005354 Ga0070675_100751621 Ga0070675_1007516212 104
104 3300005355 Ga0070671_100161753 Ga0070671_1001617534 104
105 3300005355 Ga0070671_100903030 Ga0070671_1009030302 104
106 3300005356 Ga0070674_100107725 Ga0070674_1001077255 104
107 3300005356 Ga0070674_100237013 Ga0070674_1002370133 104
108 3300005364 Ga0070673_100229915 Ga0070673_1002299152 104
109 3300005366 Ga0070659_100005602 Ga0070659_10000560212 104
110 3300005366 Ga0070659_101086510 Ga0070659_1010865101 104
111 3300005367 Ga0070667_100051219 Ga0070667_1000512197 104
112 3300005367 Ga0070667_101075441 Ga0070667_1010754412 104
113 3300005367 Ga0070667_101624717 Ga0070667_1016247171 104
114 3300005367 Ga0070667_101957745 Ga0070667_1019577452 104
115 3300005406 Ga0070703_10078531 Ga0070703_100785312 104
116 3300005434 Ga0070709_11005348 Ga0070709_110053481 104
117 3300005435 Ga0070714_100170503 Ga0070714_1001705035 104
118 3300005435 Ga0070714_100203655 Ga0070714_1002036554 104
119 3300005435 Ga0070714_100255706 Ga0070714_1002557062 104
120 3300005437 Ga0070710_10000376 Ga0070710_100003769 104
121 3300005439 Ga0070711_100007537 Ga0070711_1000075374 104
122 3300005440 Ga0070705_100014974 Ga0070705_1000149747 104
123 3300005441 Ga0070700_100088260 Ga0070700_1000882603 104
124 3300005441 Ga0070700_100606189 Ga0070700_1006061892 104
125 3300005444 Ga0070694_100045954 Ga0070694_1000459544 104
126 3300005455 Ga0070663_100182346 Ga0070663_1001823462 104
127 3300005455 Ga0070663_100600304 Ga0070663_1006003042 104
128 3300005456 Ga0070678_100938946 Ga0070678_1009389461 104
129 3300005456 Ga0070678_101503772 Ga0070678_1015037722 104
130 3300005457 Ga0070662_100030788 Ga0070662_1000307882 104
131 3300005457 Ga0070662_101297357 Ga0070662_1012973572 104
132 3300005458 Ga0070681_11527605 Ga0070681_115276052 104
133 3300005459 Ga0068867_100376967 Ga0068867_1003769673 104
134 3300005466 Ga0070685_10056406 Ga0070685_100564066 104
135 3300005466 Ga0070685_10109043 Ga0070685_101090434 104
136 3300005466 Ga0070685_10604378 Ga0070685_106043782 104
137 3300005530 Ga0070679_101895927 Ga0070679_1018959272 104
138 3300005535 Ga0070684_100821124 Ga0070684_1008211242 104
139 3300005536 Ga0070697_100142979 Ga0070697_1001429792 104
140 3300005539 Ga0068853_100025062 Ga0068853_1000250625 104
141 3300005545 Ga0070695_100775425 Ga0070695_1007754251 104
142 3300005546 Ga0070696_100032405 Ga0070696_1000324058 104
143 3300005546 Ga0070696_101787839 Ga0070696_1017878391 104
144 3300005547 Ga0070693_101489498 Ga0070693_1014894981 104
145 3300005548 Ga0070665_100094006 Ga0070665_1000940064 104
146 3300005548 Ga0070665_100456554 Ga0070665_1004565543 104
147 3300005548 Ga0070665_100479384 Ga0070665_1004793842 104
148 3300005548 Ga0070665_101563816 Ga0070665_1015638162 104
149 3300005549 Ga0070704_100114220 Ga0070704_1001142203 104
150 3300005563 Ga0068855_100050226 Ga0068855_1000502269 104
151 3300005564 Ga0070664_100209730 Ga0070664_1002097302 104
152 3300005564 Ga0070664_100537502 Ga0070664_1005375022 104
153 3300005577 Ga0068857_102374765 Ga0068857_1023747652 104
154 3300005615 Ga0070702_100016667 Ga0070702_1000166677 104
155 3300005615 Ga0070702_100087744 Ga0070702_1000877442 104
156 3300005616 Ga0068852_100222700 Ga0068852_1002227002 104
157 3300005616 Ga0068852_100228323 Ga0068852_1002283235 104
158 3300005616 Ga0068852_100405143 Ga0068852_1004051433 104
159 3300005616 Ga0068852_100479569 Ga0068852_1004795692 104
160 3300005617 Ga0068859_101621091 Ga0068859_1016210912 104
161 3300005617 Ga0068859_102006550 Ga0068859_1020065501 104
162 3300005617 Ga0068859_102705462 Ga0068859_1027054621 104
163 3300005618 Ga0068864_100109101 Ga0068864_1001091012 104
164 3300005618 Ga0068864_101413849 Ga0068864_1014138492 104
165 3300005718 Ga0068866_10028542 Ga0068866_100285423 104
166 3300005719 Ga0068861_100055597 Ga0068861_1000555976 104
167 3300005719 Ga0068861_100993418 Ga0068861_1009934182 104
168 3300005834 Ga0068851_10177369 Ga0068851_101773692 104
169 3300005834 Ga0068851_10649456 Ga0068851_106494561 104
170 3300005834 Ga0068851_10758542 Ga0068851_107585422 104
171 3300005840 Ga0068870_10103819 Ga0068870_101038193 104
172 3300005840 Ga0068870_10691558 Ga0068870_106915582 104
173 3300005841 Ga0068863_100023672 Ga0068863_10002367210 104
174 3300005842 Ga0068858_100106994 Ga0068858_1001069943 104
175 3300005842 Ga0068858_100566258 Ga0068858_1005662582 104
176 3300005843 Ga0068860_100081426 Ga0068860_1000814264 104
177 3300005844 Ga0068862_100294763 Ga0068862_1002947634 104
178 3300005981 Ga0081538_10016245 Ga0081538_100162456 104
179 3300005983 Ga0081540_1001718 Ga0081540_100171810 104
180 3300006028 Ga0070717_10133237 Ga0070717_101332373 104
181 3300006028 Ga0070717_10650961 Ga0070717_106509612 104
182 3300006058 Ga0075432_10136715 Ga0075432_101367152 104
183 3300006163 Ga0070715_10050715 Ga0070715_100507154 104
184 3300006173 Ga0070716_100006233 Ga0070716_1000062331 104
185 3300006175 Ga0070712_100571499 Ga0070712_1005714992 104
186 3300006237 Ga0097621_100125994 Ga0097621_1001259944 104
187 3300006237 Ga0097621_100709730 Ga0097621_1007097302 104
188 3300006358 Ga0068871_100063772 Ga0068871_1000637722 104
189 3300006358 Ga0068871_100980001 Ga0068871_1009800012 104
190 3300006846 Ga0075430_100325873 Ga0075430_1003258732 104
191 3300006847 Ga0075431_100111938 Ga0075431_1001119383 104
192 3300006852 Ga0075433_10207134 Ga0075433_102071343 104
193 3300006852 Ga0075433_10605594 Ga0075433_106055942 104
194 3300006871 Ga0075434_100046738 Ga0075434_1000467384 104
195 3300006880 Ga0075429_100749409 Ga0075429_1007494092 104
196 3300006914 Ga0075436_100061172 Ga0075436_1000611722 104
197 3300006931 Ga0097620_101621039 Ga0097620_1016210392 104
198 3300006931 Ga0097620_102006711 Ga0097620_1020067111 104
199 3300006931 Ga0097620_102704880 Ga0097620_1027048801 104
200 3300007076 Ga0075435_100031870 Ga0075435_1000318709 104
201 3300007076 Ga0075435_100673010 Ga0075435_1006730102 104
202 3300009036 Ga0105244_10250095 Ga0105244_102500952 104
203 3300009093 Ga0105240_10204697 Ga0105240_102046974 104
204 3300009094 Ga0111539_10715946 Ga0111539_107159462 104
205 3300009098 Ga0105245_10026001 Ga0105245_100260019 104
206 3300009098 Ga0105245_10902983 Ga0105245_109029832 104
207 3300009098 Ga0105245_11125141 Ga0105245_111251412 104
208 3300009098 Ga0105245_11595489 Ga0105245_115954892 104
209 3300009101 Ga0105247_10042407 Ga0105247_100424076 104
210 3300009101 Ga0105247_10168492 Ga0105247_101684924 104
211 3300009101 Ga0105247_10476135 Ga0105247_104761352 104
212 3300009147 Ga0114129_11603647 Ga0114129_116036471 104
213 3300009148 Ga0105243_10009722 Ga0105243_1000972211 104
214 3300009148 Ga0105243_10847058 Ga0105243_108470582 104
215 3300009174 Ga0105241_10044504 Ga0105241_100445045 104
216 3300009174 Ga0105241_11517426 Ga0105241_115174262 104
217 3300009176 Ga0105242_10181638 Ga0105242_101816385 104
218 3300009176 Ga0105242_10768747 Ga0105242_107687472 104
219 3300009177 Ga0105248_10253937 Ga0105248_102539372 104
220 3300009177 Ga0105248_11672967 Ga0105248_116729672 104
221 3300009545 Ga0105237_10192300 Ga0105237_101923002 104
222 3300009551 Ga0105238_10042028 Ga0105238_100420289 104
223 3300009551 Ga0105238_10322410 Ga0105238_103224102 104
224 3300009551 Ga0105238_10435505 Ga0105238_104355052 104
225 3300009551 Ga0105238_10935547 Ga0105238_109355472 104
226 3300009551 Ga0105238_12808358 Ga0105238_128083581 104
227 3300009553 Ga0105249_10007779 Ga0105249_100077799 104
228 3300009553 Ga0105249_10800817 Ga0105249_108008172 104
229 3300009979 Ga0105032_101026 Ga0105032_1010266 104
230 3300009986 Ga0105033_102590 Ga0105033_1025905 104
231 3300009986 Ga0105033_103394 Ga0105033_1033943 104
232 3300009988 Ga0105035_100358 Ga0105035_1003585 104
233 3300009993 Ga0105028_101349 Ga0105028_1013494 104
234 3300010375 Ga0105239_10543736 Ga0105239_105437362 104
235 3300011119 Ga0105246_10084502 Ga0105246_100845022 104
236 3300011119 Ga0105246_10411265 Ga0105246_104112652 104
237 3300011119 Ga0105246_11043192 Ga0105246_110431922 104
238 3300011119 Ga0105246_11379969 Ga0105246_113799692 104
239 3300012494 Ga0157341_1011304 Ga0157341_10113041 104
240 3300012495 Ga0157323_1000742 Ga0157323_10007424 104
241 3300012506 Ga0157324_1002822 Ga0157324_10028222 104
242 3300012508 Ga0157315_1015463 Ga0157315_10154632 104
243 3300013102 Ga0157371_10012725 Ga0157371_100127257 104
244 3300013104 Ga0157370_10260145 Ga0157370_102601452 104
245 3300013105 Ga0157369_10514077 Ga0157369_105140772 104
246 3300013105 Ga0157369_11625030 Ga0157369_116250302 104
247 3300013105 Ga0157369_12114607 Ga0157369_121146072 104
248 3300013296 Ga0157374_10031506 Ga0157374_100315062 104
249 3300013296 Ga0157374_10720339 Ga0157374_107203392 104
250 3300013296 Ga0157374_10876269 Ga0157374_108762692 104
251 3300013296 Ga0157374_11218317 Ga0157374_112183172 104
252 3300013297 Ga0157378_10355995 Ga0157378_103559952 104
253 3300013297 Ga0157378_11157240 Ga0157378_111572402 104
254 3300013306 Ga0163162_10015117 Ga0163162_100151175 104
255 3300013306 Ga0163162_12702098 Ga0163162_127020982 104
256 3300013307 Ga0157372_10039710 Ga0157372_1003971010 104
257 3300013307 Ga0157372_10599602 Ga0157372_105996021 104
258 3300013307 Ga0157372_11431024 Ga0157372_114310242 104
259 3300013307 Ga0157372_11547638 Ga0157372_115476382 104
260 3300013308 Ga0157375_11087697 Ga0157375_110876972 104
261 3300013308 Ga0157375_11154372 Ga0157375_111543722 104
262 3300013308 Ga0157375_11413326 Ga0157375_114133261 104
263 3300013308 Ga0157375_11536211 Ga0157375_115362111 104
264 3300013308 Ga0157375_12027055 Ga0157375_120270552 104
265 3300013875 Ga0157515_106749 Ga0157515_1067492 104
266 3300014325 Ga0163163_10419870 Ga0163163_104198703 104
267 3300014325 Ga0163163_10853113 Ga0163163_108531132 104
268 3300014325 Ga0163163_12490750 Ga0163163_124907502 104
269 3300014326 Ga0157380_10317983 Ga0157380_103179832 104
270 3300014326 Ga0157380_10496596 Ga0157380_104965962 104
271 3300014326 Ga0157380_11554064 Ga0157380_115540642 104
272 3300014326 Ga0157380_12303943 Ga0157380_123039432 104
273 3300014326 Ga0157380_13022672 Ga0157380_130226722 104
274 3300014745 Ga0157377_10126329 Ga0157377_101263294 104
275 3300014968 Ga0157379_10209281 Ga0157379_102092813 104
276 3300014968 Ga0157379_10485205 Ga0157379_104852052 104
277 3300014968 Ga0157379_10778462 Ga0157379_107784622 104
278 3300014968 Ga0157379_10972049 Ga0157379_109720492 104
279 3300014969 Ga0157376_10099488 Ga0157376_100994885 104
280 3300014969 Ga0157376_10846308 Ga0157376_108463082 104
281 3300014969 Ga0157376_11393293 Ga0157376_113932932 104
282 3300014969 Ga0157376_11542484 Ga0157376_115424843 104
283 3300017792 Ga0163161_10006328 Ga0163161_1000632815 104
284 3300017792 Ga0163161_10483145 Ga0163161_104831452 104
285 3300017792 Ga0163161_11712468 Ga0163161_117124681 104
286 3300020069 Ga0197907_10377945 Ga0197907_1037794514 104
287 3300020069 Ga0197907_10891275 Ga0197907_108912752 104
288 3300020070 Ga0206356_10247586 Ga0206356_102475865 104
289 3300020070 Ga0206356_11903330 Ga0206356_119033301 104
290 3300020075 Ga0206349_1094146 Ga0206349_10941462 104
291 3300020075 Ga0206349_1431413 Ga0206349_14314131 104
292 3300020075 Ga0206349_1453397 Ga0206349_14533979 104
293 3300020076 Ga0206355_1109688 Ga0206355_11096882 104
294 3300020076 Ga0206355_1305882 Ga0206355_13058822 104
295 3300020076 Ga0206355_1410655 Ga0206355_14106551 104
296 3300020076 Ga0206355_1658075 Ga0206355_16580752 104
297 3300020078 Ga0206352_10207358 Ga0206352_102073584 104
298 3300020078 Ga0206352_10616844 Ga0206352_106168442 104
299 3300020080 Ga0206350_10688099 Ga0206350_106880992 104
300 3300020080 Ga0206350_11200745 Ga0206350_112007456 104
301 3300020081 Ga0206354_10319359 Ga0206354_103193592 104
302 3300020082 Ga0206353_10692420 Ga0206353_106924202 104
303 3300020082 Ga0206353_11638776 Ga0206353_116387764 104
304 3300020610 Ga0154015_1161714 Ga0154015_11617142 104
305 3300021388 Ga0213875_10000107 Ga0213875_1000010747 104
306 3300021388 Ga0213875_10004141 Ga0213875_1000414112 104
307 3300022467 Ga0224712_10000575 Ga0224712_100005752 104
308 3300023309 Ga0256744_130645 Ga0256744_1306452 104
309 3300025321 Ga0207656_10599072 Ga0207656_105990722 104
310 3300025898 Ga0207692_10000368 Ga0207692_100003689 104
311 3300025898 Ga0207692_10026602 Ga0207692_100266026 104
312 3300025899 Ga0207642_10659167 Ga0207642_106591672 104
313 3300025899 Ga0207642_11045914 Ga0207642_110459142 104
314 3300025900 Ga0207710_10261847 Ga0207710_102618472 104
315 3300025900 Ga0207710_10321723 Ga0207710_103217232 104
316 3300025900 Ga0207710_10439399 Ga0207710_104393992 104
317 3300025900 Ga0207710_10694480 Ga0207710_106944801 104
318 3300025901 Ga0207688_10005072 Ga0207688_1000507213 104
319 3300025901 Ga0207688_10064689 Ga0207688_100646893 104
320 3300025901 Ga0207688_10677728 Ga0207688_106777282 104
321 3300025901 Ga0207688_10784479 Ga0207688_107844792 104
322 3300025904 Ga0207647_10053739 Ga0207647_100537394 104
323 3300025908 Ga0207643_10140578 Ga0207643_101405785 104
324 3300025909 Ga0207705_11355801 Ga0207705_113558011 104
325 3300025911 Ga0207654_10522198 Ga0207654_105221982 104
326 3300025913 Ga0207695_10328126 Ga0207695_103281264 104
327 3300025914 Ga0207671_10237501 Ga0207671_102375014 104
328 3300025915 Ga0207693_10001283 Ga0207693_1000128317 104
329 3300025916 Ga0207663_10024245 Ga0207663_100242454 104
330 3300025918 Ga0207662_10026906 Ga0207662_100269065 104
331 3300025918 Ga0207662_10221385 Ga0207662_102213852 104
332 3300025918 Ga0207662_10574671 Ga0207662_105746712 104
333 3300025919 Ga0207657_10009138 Ga0207657_1000913811 104
334 3300025919 Ga0207657_10191592 Ga0207657_101915925 104
335 3300025924 Ga0207694_10338999 Ga0207694_103389992 104
336 3300025924 Ga0207694_10982330 Ga0207694_109823302 104
337 3300025925 Ga0207650_11288285 Ga0207650_112882852 104
338 3300025926 Ga0207659_11119560 Ga0207659_111195601 104
339 3300025927 Ga0207687_11784570 Ga0207687_117845701 104
340 3300025929 Ga0207664_10017195 Ga0207664_100171952 104
341 3300025929 Ga0207664_10101806 Ga0207664_101018065 104
342 3300025929 Ga0207664_10891636 Ga0207664_108916362 104
343 3300025931 Ga0207644_11418999 Ga0207644_114189991 104
344 3300025932 Ga0207690_10158621 Ga0207690_101586213 104
345 3300025932 Ga0207690_11021612 Ga0207690_110216122 104
346 3300025933 Ga0207706_10009289 Ga0207706_1000928913 104
347 3300025933 Ga0207706_10708065 Ga0207706_107080652 104
348 3300025934 Ga0207686_10223419 Ga0207686_102234192 104
349 3300025934 Ga0207686_10262709 Ga0207686_102627092 104
350 3300025935 Ga0207709_10537233 Ga0207709_105372332 104
351 3300025935 Ga0207709_10661350 Ga0207709_106613502 104
352 3300025936 Ga0207670_10243527 Ga0207670_102435272 104
353 3300025937 Ga0207669_10515359 Ga0207669_105153592 104
354 3300025937 Ga0207669_10520246 Ga0207669_105202462 104
355 3300025938 Ga0207704_10162306 Ga0207704_101623062 104
356 3300025938 Ga0207704_10704071 Ga0207704_107040712 104
357 3300025938 Ga0207704_11013915 Ga0207704_110139152 104
358 3300025939 Ga0207665_10006255 Ga0207665_100062559 104
359 3300025940 Ga0207691_10142827 Ga0207691_101428275 104
360 3300025940 Ga0207691_10192161 Ga0207691_101921612 104
361 3300025940 Ga0207691_11634433 Ga0207691_116344332 104
362 3300025942 Ga0207689_10004616 Ga0207689_100046162 104
363 3300025942 Ga0207689_11039171 Ga0207689_110391711 104
364 3300025942 Ga0207689_11040828 Ga0207689_110408282 104
365 3300025944 Ga0207661_11077097 Ga0207661_110770971 104
366 3300025944 Ga0207661_11845377 Ga0207661_118453772 104
367 3300025945 Ga0207679_10173702 Ga0207679_101737022 104
368 3300025945 Ga0207679_10541878 Ga0207679_105418781 104
369 3300025949 Ga0207667_10342259 Ga0207667_103422592 104
370 3300025949 Ga0207667_11466013 Ga0207667_114660131 104
371 3300025960 Ga0207651_10242789 Ga0207651_102427894 104
372 3300025961 Ga0207712_10000797 Ga0207712_1000079725 104
373 3300025961 Ga0207712_10329245 Ga0207712_103292454 104
374 3300025972 Ga0207668_10061079 Ga0207668_100610794 104
375 3300025972 Ga0207668_10164948 Ga0207668_101649482 104
376 3300025972 Ga0207668_10392781 Ga0207668_103927811 104
377 3300025981 Ga0207640_10461675 Ga0207640_104616752 104
378 3300025986 Ga0207658_10139424 Ga0207658_101394243 104
379 3300025986 Ga0207658_10256438 Ga0207658_102564383 104
380 3300026023 Ga0207677_10122095 Ga0207677_101220953 104
381 3300026023 Ga0207677_10378368 Ga0207677_103783683 104
382 3300026023 Ga0207677_10420102 Ga0207677_104201022 104
383 3300026023 Ga0207677_10599610 Ga0207677_105996102 104
384 3300026035 Ga0207703_10189049 Ga0207703_101890491 104
385 3300026035 Ga0207703_10877884 Ga0207703_108778842 104
386 3300026041 Ga0207639_10617818 Ga0207639_106178182 104
387 3300026067 Ga0207678_10009664 Ga0207678_1000966410 104
388 3300026067 Ga0207678_10233078 Ga0207678_102330782 104
389 3300026067 Ga0207678_10514768 Ga0207678_105147682 104
390 3300026067 Ga0207678_10670754 Ga0207678_106707542 104
391 3300026067 Ga0207678_11673007 Ga0207678_116730072 104
392 3300026075 Ga0207708_10171226 Ga0207708_101712263 104
393 3300026075 Ga0207708_10273447 Ga0207708_102734471 104
394 3300026075 Ga0207708_11584261 Ga0207708_115842612 104
395 3300026075 Ga0207708_12006805 Ga0207708_120068052 104
396 3300026088 Ga0207641_10071941 Ga0207641_100719413 104
397 3300026088 Ga0207641_10395647 Ga0207641_103956472 104
398 3300026089 Ga0207648_10093298 Ga0207648_100932983 104
399 3300026089 Ga0207648_11032099 Ga0207648_110320992 104
400 3300026089 Ga0207648_11479571 Ga0207648_114795712 104
401 3300026095 Ga0207676_10871869 Ga0207676_108718692 104
402 3300026095 Ga0207676_10981772 Ga0207676_109817722 104
403 3300026095 Ga0207676_11692555 Ga0207676_116925552 104
404 3300026118 Ga0207675_100012489 Ga0207675_10001248914 104
405 3300026118 Ga0207675_100251858 Ga0207675_1002518582 104
406 3300026118 Ga0207675_102211584 Ga0207675_1022115842 104
407 3300026121 Ga0207683_10004908 Ga0207683_1000490810 104
408 3300026121 Ga0207683_10106701 Ga0207683_101067016 104
409 3300026121 Ga0207683_10109837 Ga0207683_101098376 104
410 3300026121 Ga0207683_10626278 Ga0207683_106262782 104
411 3300026142 Ga0207698_10174299 Ga0207698_101742993 104
412 3300026142 Ga0207698_10246185 Ga0207698_102461855 104
413 3300026142 Ga0207698_11123404 Ga0207698_111234042 104
414 3300027907 Ga0207428_10134227 Ga0207428_101342273 104
415 3300028379 Ga0268266_10376558 Ga0268266_103765582 104
416 3300028379 Ga0268266_10498807 Ga0268266_104988072 104
417 3300028379 Ga0268266_10636863 Ga0268266_106368632 104
418 3300028379 Ga0268266_11094681 Ga0268266_110946812 104
419 3300028380 Ga0268265_10028281 Ga0268265_100282813 104
420 3300028380 Ga0268265_10511968 Ga0268265_105119682 104
421 3300028381 Ga0268264_10816641 Ga0268264_108166412 104
422 3300029282 Ga0311003_163444 Ga0311003_1634442 104
423 3300029285 Ga0310981_1042594 Ga0310981_10425942 104
424 3300030522 Ga0307512_10008844 Ga0307512_1000884413 104
425 3300030731 Ga0316177_1073951 Ga0316177_10739515 104
426 3300030732 Ga0316176_1154284 Ga0316176_11542845 104
427 3300030733 Ga0314311_1038188 Ga0314311_10381889 104
428 3300030735 Ga0316178_1145984 Ga0316178_11459842 104
429 3300030736 Ga0316180_1057786 Ga0316180_10577865 104
430 3300030742 Ga0316183_1025727 Ga0316183_10257272 104
431 3300030744 Ga0316181_1255392 Ga0316181_12553924 104
432 3300030745 Ga0316182_1026960 Ga0316182_10269602 104
433 3300031456 Ga0307513_10001540 Ga0307513_1000154012 104
434 3300031507 Ga0307509_10170317 Ga0307509_101703175 104
435 3300031731 Ga0307405_10290907 Ga0307405_102909073 104
436 3300031852 Ga0307410_10244890 Ga0307410_102448903 104
437 3300031852 Ga0307410_10728701 Ga0307410_107287012 104
438 3300031995 Ga0307409_100461078 Ga0307409_1004610782 104
439 3300031995 Ga0307409_100958551 Ga0307409_1009585511 104
440 3300032002 Ga0307416_102353550 Ga0307416_1023535502 104
441 3300032005 Ga0307411_11601520 Ga0307411_116015202 104
442 3300032126 Ga0307415_101836880 Ga0307415_1018368802 104
443 3300034818 Ga0373950_0005642 Ga0373950_0005642_53_370 104
444 3300034957 Ga0373938_0044535 Ga0373938_0044535_72_386 104
445 3300034957 Ga0373938_0092571 Ga0373938_0092571_58_372 104
446 3300035085 Ga0373929_0003284 Ga0373929_0003284_1893_2210 104
447 3300035088 Ga0373940_0208121 Ga0373940_0208121_115_432 104
448 3300035090 Ga0373949_0021905 Ga0373949_0021905_445_762 104
449 3300035092 Ga0373952_0011882 Ga0373952_0011882_968_1285 104
450 3300035112 Ga0373932_0007943 Ga0373932_0007943_402_719 104
451 3300035114 Ga0373939_0002935 Ga0373939_0002935_3481_3798 104
452 3300035114 Ga0373939_0205135 Ga0373939_0205135_348_662 104
453 3300035121 Ga0373960_0029968 Ga0373960_0029968_543_860 104
454 3300035170 Ga0373943_0450553 Ga0373943_0450553_56_376 104
455 3300035171 Ga0373946_0229974 Ga0373946_0229974_120_440 104
456 3300035242 Ga0373962_0003137 Ga0373962_0003137_1793_2110 104
457 3300035691 Ga0373931_0015456 Ga0373931_0015456_2988_3305 104
458 3300035691 Ga0373931_0493988 Ga0373931_0493988_215_529 104
459 3300035695 Ga0373927_1164312 Ga0373927_1164312_18_332 104
460 3300036401 Ga0373937_1727270 Ga0373937_1727270_168_488 104
461 3300037068 Ga0373925_0657368 Ga0373925_0657368_457_777 104
462 3300037068 Ga0373925_1195037 Ga0373925_1195037_122_445 104
463 3300037853 Ga0436364_0010700 Ga0436364_0010700_90119_90433 104
464 3300037853 Ga0436364_0184253 Ga0436364_0184253_2596_2910 104
465 3300037853 Ga0436364_0588322 Ga0436364_0588322_67898_68212 104
466 3300039453 Ga0436362_0313342 Ga0436362_0313342_121_435 104
467 3300039453 Ga0436362_0494804 Ga0436362_0494804_315_629 104
468 3300041413 Ga0439465_0435241 Ga0439465_0435241_25_339 104
469 3300041441 Ga0451787_757127 Ga0451787_757127_74_394 104
470 3300041443 Ga0451789_0054430 Ga0451789_0054430_293_613 104
471 3300041446 Ga0451794_55151 Ga0451794_55151_49_369 104
472 3300041451 Ga0451791_1065158 Ga0451791_1065158_1705_2025 104
473 3300041452 Ga0451793_0871455 Ga0451793_0871455_1219_1539 104
474 3300041453 Ga0451797_1382881 Ga0451797_1382881_310_630 104
475 3300041453 Ga0451797_1384890 Ga0451797_1384890_100_414 104
476 3300041455 Ga0451801_11751 Ga0451801_11751_180_494 104
477 3300041458 Ga0451798_0190825 Ga0451798_0190825_351_671 104
478 3300041459 Ga0451800_1390558 Ga0451800_1390558_849_1169 104
479 3300041486 Ga0451807_1654378 Ga0451807_1654378_467_787 104
480 3300041494 Ga0451837_0550193 Ga0451837_0550193_1691_2011 104
481 3300041496 Ga0451839_1054739 Ga0451839_1054739_115_429 104
482 3300041498 Ga0451841_1228666 Ga0451841_1228666_1421_1741 104
483 3300041501 Ga0451845_0146963 Ga0451845_0146963_15_335 104
484 3300041505 Ga0451849_0017685 Ga0451849_0017685_98_418 104
485 3300041507 Ga0451851_1177781 Ga0451851_1177781_52_372 104
486 3300041511 Ga0451855_1627071 Ga0451855_1627071_190_510 104
487 3300041512 Ga0451853_1554167 Ga0451853_1554167_1931_2251 104
488 3300042002 Ga0439442_046897 Ga0439442_046897_318_632 104
489 3300042004 Ga0439445_0148492 Ga0439445_0148492_91_405 104
490 3300042016 Ga0439463_031098 Ga0439463_031098_478_792 104
491 3300044658 Ga0466972_0007279 Ga0466972_0007279_3483_3797 104
492 3300044658 Ga0466972_0585810 Ga0466972_0585810_92_406 104
493 3300044683 Ga0466965_0033398 Ga0466965_0033398_1319_1633 104
494 3300044683 Ga0466965_0294538 Ga0466965_0294538_546_860 104
495 3300044684 Ga0466966_0000383 Ga0466966_0000383_23290_23604 104
496 3300044693 Ga0466961_0054451 Ga0466961_0054451_1274_1588 104
497 3300044694 Ga0466963_0009016 Ga0466963_0009016_3772_4086 104
498 3300044706 Ga0466964_0326363 Ga0466964_0326363_358_672 104
499 3300044719 Ga0466971_0009870 Ga0466971_0009870_1661_1975 104
500 3300044735 Ga0466968_0000486 Ga0466968_0000486_1443_1757 104
501 3300044735 Ga0466968_0026217 Ga0466968_0026217_24_338 104
502 3300044735 Ga0466968_0030625 Ga0466968_0030625_1229_1543 104
503 3300044765 Ga0466970_0021508 Ga0466970_0021508_441_755 104
504 3300044842 Ga0466957_0009243 Ga0466957_0009243_1388_1702 104
505 3300044901 Ga0466960_0003887 Ga0466960_0003887_1761_2075 104
506 3300044901 Ga0466960_0834377 Ga0466960_0834377_76_390 104
507 3300045049 Ga0466959_0017822 Ga0466959_0017822_1373_1687 104
508 3300045836 Ga0466958_0000206 Ga0466958_0000206_18046_18360 104
509 3300045976 Ga0466967_0082652 Ga0466967_0082652_1327_1641 104
510 3300045976 Ga0466967_1063197 Ga0466967_1063197_431_745 104
511 3300045976 Ga0466967_2059600 Ga0466967_2059600_188_502 104
512 3300046454 Ga0495592_0409566 Ga0495592_0409566_117_437 104
513 3300046455 Ga0495603_0133889 Ga0495603_0133889_132_449 104
514 3300046459 Ga0495629_0152338 Ga0495629_0152338_216_536 104
515 3300046459 Ga0495629_0501630 Ga0495629_0501630_223_549 104
516 3300046459 Ga0495629_0976300 Ga0495629_0976300_179_499 104
517 3300046461 Ga0495641_0097610 Ga0495641_0097610_567_881 104
518 3300046461 Ga0495641_0112967 Ga0495641_0112967_821_1138 104
519 3300046462 Ga0495651_0507553 Ga0495651_0507553_283_603 104
520 3300046463 Ga0495653_0426913 Ga0495653_0426913_267_587 104
521 3300046463 Ga0495653_0586206 Ga0495653_0586206_180_494 104
522 3300046471 Ga0495650_0271392 Ga0495650_0271392_123_437 104
523 3300046499 Ga0495594_0727285 Ga0495594_0727285_80_397 104
524 3300046500 Ga0495596_0130294 Ga0495596_0130294_144_464 104
525 3300046501 Ga0495607_0159700 Ga0495607_0159700_804_1118 104
526 3300046511 Ga0495608_0361634 Ga0495608_0361634_431_751 104
527 3300046511 Ga0495608_0385480 Ga0495608_0385480_102_422 104
528 3300046515 Ga0495620_0095563 Ga0495620_0095563_438_758 104
529 3300046516 Ga0495628_0197758 Ga0495628_0197758_1085_1405 104
530 3300046517 Ga0495630_0270915 Ga0495630_0270915_560_880 104
531 3300046522 Ga0495643_0373764 Ga0495643_0373764_294_608 104
532 3300046526 Ga0495666_0465691 Ga0495666_0465691_13_330 104
533 3300046531 Ga0495665_0121367 Ga0495665_0121367_41_361 104
534 3300046533 Ga0495640_0330009 Ga0495640_0330009_520_840 104
535 3300046535 Ga0495586_0296082 Ga0495586_0296082_150_470 104
536 3300046559 Ga0495667_0248101 Ga0495667_0248101_679_999 104
537 3300046642 Ga0495634_0303502 Ga0495634_0303502_497_811 104
538 3300046663 Ga0495635_0576459 Ga0495635_0576459_287_607 104
539 3300046663 Ga0495635_0812716 Ga0495635_0812716_223_543 104
540 3300046674 Ga0495588_0125822 Ga0495588_0125822_948_1265 104
541 3300046675 Ga0495657_0311003 Ga0495657_0311003_449_769 104
542 3300046678 Ga0495599_0113565 Ga0495599_0113565_471_791 104
543 3300046680 Ga0495646_0139571 Ga0495646_0139571_362_682 104
544 3300046681 Ga0495647_0464116 Ga0495647_0464116_129_449 104
545 3300046689 Ga0495613_0503077 Ga0495613_0503077_75_395 104
546 3300046690 Ga0495624_0169708 Ga0495624_0169708_933_1250 104
547 3300047315 Ga0495581_0119575 Ga0495581_0119575_249_569 104
548 3300047317 Ga0495604_0481382 Ga0495604_0481382_328_642 104
549 3300047321 Ga0495676_0985966 Ga0495676_0985966_150_470 104
550 3300047322 Ga0495680_0081426 Ga0495680_0081426_1257_1577 104
551 3300047322 Ga0495680_0452336 Ga0495680_0452336_244_564 104
552 3300047323 Ga0495683_0003613 Ga0495683_0003613_3944_4258 104
553 3300047323 Ga0495683_0423570 Ga0495683_0423570_41_355 104
554 3300047673 Ga0495593_0053150 Ga0495593_0053150_442_762 104
555 3300048089 Ga0495614_0147013 Ga0495614_0147013_343_663 104
556 3300048089 Ga0495614_0235608 Ga0495614_0235608_440_760 104
557 3300048903 Ga0496100_0046841 Ga0496100_0046841_2162_2479 104
558 3300048903 Ga0496100_0374454 Ga0496100_0374454_745_1065 104
559 3300048903 Ga0496100_0418445 Ga0496100_0418445_295_609 104
560 3300048904 Ga0496101_0091947 Ga0496101_0091947_1926_2243 104
561 3300048904 Ga0496101_0275312 Ga0496101_0275312_476_796 104
562 3300048904 Ga0496101_0278475 Ga0496101_0278475_850_1170 104
563 3300048904 Ga0496101_0927603 Ga0496101_0927603_297_611 104
564 3300048905 Ga0496102_0132676 Ga0496102_0132676_906_1223 104
565 3300048905 Ga0496102_0600891 Ga0496102_0600891_192_512 104
566 3300048906 Ga0496103_0169432 Ga0496103_0169432_753_1073 104
567 3300048906 Ga0496103_0278591 Ga0496103_0278591_512_829 104
568 3300048907 Ga0496104_0004123 Ga0496104_0004123_426_746 104
569 3300048907 Ga0496104_0082973 Ga0496104_0082973_1812_2129 104
570 3300048907 Ga0496104_0283996 Ga0496104_0283996_1200_1514 104
571 3300048908 Ga0496105_0275374 Ga0496105_0275374_938_1258 104
572 3300048908 Ga0496105_0380333 Ga0496105_0380333_381_701 104
573 3300048909 Ga0496106_0132106 Ga0496106_0132106_1030_1347 104
574 3300048909 Ga0496106_0376036 Ga0496106_0376036_336_650 104
575 3300048909 Ga0496106_1487203 Ga0496106_1487203_32_352 104
576 3300048910 Ga0496107_0519136 Ga0496107_0519136_66_380 104
577 3300048910 Ga0496107_1198345 Ga0496107_1198345_150_470 104
578 3300048911 Ga0496108_0075461 Ga0496108_0075461_1794_2114 104
579 3300048911 Ga0496108_0112101 Ga0496108_0112101_203_520 104
580 3300048911 Ga0496108_0128186 Ga0496108_0128186_39_353 104
581 3300048911 Ga0496108_0849852 Ga0496108_0849852_316_630 104
582 3300048912 Ga0496109_0008622 Ga0496109_0008622_7080_7400 104
583 3300048912 Ga0496109_0049417 Ga0496109_0049417_829_1146 104
584 3300048912 Ga0496109_0162421 Ga0496109_0162421_103_423 104
585 3300048912 Ga0496109_0441050 Ga0496109_0441050_540_854 104
586 3300048912 Ga0496109_1357651 Ga0496109_1357651_239_553 104
587 3300048913 Ga0496110_0004143 Ga0496110_0004143_5523_5843 104
588 3300048913 Ga0496110_0331538 Ga0496110_0331538_850_1164 104
589 3300048913 Ga0496110_0645854 Ga0496110_0645854_149_469 104
590 3300048913 Ga0496110_0883779 Ga0496110_0883779_195_515 104
591 3300048914 Ga0496111_0000712 Ga0496111_0000712_15520_15840 104
592 3300048914 Ga0496111_0210201 Ga0496111_0210201_803_1117 104
593 3300048914 Ga0496111_0839625 Ga0496111_0839625_101_418 104
594 3300048915 Ga0496112_0162970 Ga0496112_0162970_1560_1880 104
595 3300048915 Ga0496112_0723686 Ga0496112_0723686_101_418 104
596 3300048916 Ga0496113_0087743 Ga0496113_0087743_1752_2069 104
597 3300048916 Ga0496113_0252450 Ga0496113_0252450_282_602 104
598 3300048917 Ga0496114_0007373 Ga0496114_0007373_6738_7052 104
599 3300048917 Ga0496114_0014309 Ga0496114_0014309_3361_3681 104
600 3300048917 Ga0496114_0051545 Ga0496114_0051545_2319_2636 104
601 3300048917 Ga0496114_0193477 Ga0496114_0193477_484_804 104
602 3300048917 Ga0496114_0320915 Ga0496114_0320915_685_999 104
603 3300048917 Ga0496114_0386795 Ga0496114_0386795_381_695 104
604 3300048917 Ga0496114_0719552 Ga0496114_0719552_54_374 104
605 3300048918 Ga0496115_0006695 Ga0496115_0006695_59_376 104
606 3300049160 Ga0501304_015291 Ga0501304_015291_209_523 104
607 3300049162 Ga0501307_020577 Ga0501307_020577_209_523 104
608 3300049527 Ga0501311_055393 Ga0501311_055393_269_583 104
609 3300049530 Ga0501314_001516 Ga0501314_001516_283_597 104
610 3300049531 Ga0501315_001744 Ga0501315_001744_1329_1643 104
611 3300049533 Ga0501317_000360 Ga0501317_000360_2310_2624 104
612 3300049534 Ga0501318_001561 Ga0501318_001561_1294_1608 104
613 3300049534 Ga0501318_010783 Ga0501318_010783_356_670 104
614 3300049534 Ga0501318_078349 Ga0501318_078349_129_443 104
615 3300049538 Ga0501322_000741 Ga0501322_000741_303_617 104
616 3300049541 Ga0501325_018505 Ga0501325_018505_182_496 104
617 3300049572 Ga0501036_1647155 Ga0501036_1647155_130_444 104
618 3300049581 Ga0501047_0989925 Ga0501047_0989925_225_539 104
619 3300049587 Ga0501071_0933851 Ga0501071_0933851_325_639 104
620 3300049741 Ga0501079_0443133 Ga0501079_0443133_557_871 104
621 3300049824 Ga0501045_0427182 Ga0501045_0427182_389_703 104
622 3300050508 nmdc:mga09592_585309_c1 nmdc:mga09592_585309_c1_273_587 104
623 3300050509 nmdc:mga0qj67_612112_c1 nmdc:mga0qj67_612112_c1_508_822 104
624 3300050510 nmdc:mga06r32_136_c2 nmdc:mga06r32_136_c2_2307_2621 104
625 3300050512 nmdc:mga0n895_1035878_c1 nmdc:mga0n895_1035878_c1_46_360 104
626 3300050512 nmdc:mga0n895_505221_c1 nmdc:mga0n895_505221_c1_834_1151 104
627 3300050513 nmdc:mga0rr50_61245_c1 nmdc:mga0rr50_61245_c1_747_1064 104
628 3300050515 nmdc:mga0a205_19433_c1 nmdc:mga0a205_19433_c1_4568_4885 104
629 3300050515 nmdc:mga0a205_594190_c1 nmdc:mga0a205_594190_c1_446_760 104
630 3300053077 Ga0495601_0227312 Ga0495601_0227312_149_469 104
631 3300053085 Ga0495619_0005374 Ga0495619_0005374_3624_3941 104
632 3300053085 Ga0495619_0258467 Ga0495619_0258467_805_1125 104
633 3300053142 Ga0500577_0001143 Ga0500577_0001143_1638_1952 104
634 3300059423 Ga0590074_107646 Ga0590074_107646_69_383 104
635 3300059477 Ga0587084_042301 Ga0587084_042301_165_479 104
636 3300059490 Ga0587066_041351 Ga0587066_041351_186_500 104
637 3300059491 Ga0587070_151233 Ga0587070_151233_158_472 104
638 3300059493 Ga0587077_088052 Ga0587077_088052_383_697 104
639 3300059504 Ga0587082_126319 Ga0587082_126319_95_409 104
640 3300059504 Ga0587082_145273 Ga0587082_145273_152_466 104
641 3300059506 Ga0587085_129987 Ga0587085_129987_99_413 104
642 3300059510 Ga0587090_102412 Ga0587090_102412_50_364 104
643 3300059511 Ga0587091_177986 Ga0587091_177986_96_410 104
644 3300059604 Ga0587098_018155 Ga0587098_018155_233_547 104
645 3300059623 Ga0587101_103658 Ga0587101_103658_232_546 104
646 3300059624 Ga0587109_173845 Ga0587109_173845_97_411 104
647 3300059625 Ga0587113_041675 Ga0587113_041675_137_451 104
648 3300059627 Ga0587117_095107 Ga0587117_095107_136_450 104
649 3300059630 Ga0587128_107440 Ga0587128_107440_72_386 104
650 3300059640 Ga0587067_166836 Ga0587067_166836_102_416 104
651 3300059641 Ga0587068_138276 Ga0587068_138276_95_409 104
652 3300059643 Ga0587072_075794 Ga0587072_075794_283_603 104
653 3300059644 Ga0587075_110658 Ga0587075_110658_83_397 104
654 3300059646 Ga0587078_046642 Ga0587078_046642_19_333 104
655 3300059648 Ga0587100_021312 Ga0587100_021312_40_354 104
656 3300061719 Ga0466962_0003094 Ga0466962_0003094_4083_4397 104
657 iso_pu_bacteria 2558860112 2558913547 104
658 iso_pu_bacteria 2870782633 2870783357 104
659 iso_pu_bacteria 2915358134 2915361152 104
660 iso_pu_bacteria 8054472261 8054477903 104
661 3300005331 Ga0070670_100441180 Ga0070670_1004411801 105
662 3300005436 Ga0070713_102150378 Ga0070713_1021503781 105
663 3300012491 Ga0157329_1012942 Ga0157329_10129421 105
664 3300025917 Ga0207660_10565719 Ga0207660_105657192 105
665 3300025929 Ga0207664_11393969 Ga0207664_113939692 105
666 3300031251 Ga0265327_10000165 Ga0265327_1000016575 105
667 3300041451 Ga0451791_1865944 Ga0451791_1865944_284_601 105
668 3300041452 Ga0451793_0363264 Ga0451793_0363264_152_469 105
669 3300042005 Ga0439448_0079846 Ga0439448_0079846_158_475 105
670 3300042008 Ga0439450_171774 Ga0439450_171774_185_502 105
671 3300042016 Ga0439463_129239 Ga0439463_129239_111_428 105
672 3300053087 Ga0500643_061101 Ga0500643_061101_538_855 105
673 3300059508 Ga0587088_041584 Ga0587088_041584_43_390 105
674 3300041446 Ga0451794_14393 Ga0451794_14393_85_408 106
675 3300046675 Ga0495657_0572344 Ga0495657_0572344_188_511 106
676 3300047322 Ga0495680_0694450 Ga0495680_0694450_118_441 106
677 3300049533 Ga0501317_049713 Ga0501317_049713_124_474 106
678 3300053077 Ga0495601_0886511 Ga0495601_0886511_125_448 106
679 3300053085 Ga0495619_0338314 Ga0495619_0338314_433_756 106
680 3300048912 Ga0496109_0629980 Ga0496109_0629980_24_362 107
681 3300000549 LJQas_1002850 LJQas_10028505 108
682 3300001976 JGI24752J21851_1034974 JGI24752J21851_10349741 108
683 3300001978 JGI24747J21853_1030775 JGI24747J21853_10307751 108
684 3300001990 JGI24737J22298_10042080 JGI24737J22298_100420802 108
685 3300002070 JGI24750J21931_1074411 JGI24750J21931_10744111 108
686 3300002073 JGI24745J21846_1000243 JGI24745J21846_10002437 108
687 3300002075 JGI24738J21930_10015789 JGI24738J21930_100157893 108
688 3300002077 JGI24744J21845_10012957 JGI24744J21845_100129575 108
689 3300002244 JGI24742J22300_10029422 JGI24742J22300_100294222 108
690 3300004803 Ga0058862_10080862 Ga0058862_100808622 108
691 3300005327 Ga0070658_10199380 Ga0070658_101993803 108
692 3300005328 Ga0070676_10189555 Ga0070676_101895552 108
693 3300005330 Ga0070690_100087745 Ga0070690_1000877452 108
694 3300005331 Ga0070670_100856445 Ga0070670_1008564452 108
695 3300005334 Ga0068869_100245279 Ga0068869_1002452792 108
696 3300005335 Ga0070666_10137813 Ga0070666_101378131 108
697 3300005336 Ga0070680_100657954 Ga0070680_1006579542 108
698 3300005337 Ga0070682_100520150 Ga0070682_1005201502 108
699 3300005337 Ga0070682_100521336 Ga0070682_1005213362 108
700 3300005338 Ga0068868_100074056 Ga0068868_1000740563 108
701 3300005340 Ga0070689_100090963 Ga0070689_1000909635 108
702 3300005341 Ga0070691_10009448 Ga0070691_100094487 108
703 3300005343 Ga0070687_100024177 Ga0070687_1000241771 108
704 3300005344 Ga0070661_100280908 Ga0070661_1002809083 108
705 3300005345 Ga0070692_10188920 Ga0070692_101889202 108
706 3300005354 Ga0070675_100176989 Ga0070675_1001769892 108
707 3300005355 Ga0070671_100002908 Ga0070671_1000029083 108
708 3300005355 Ga0070671_101050666 Ga0070671_1010506662 108
709 3300005356 Ga0070674_100459571 Ga0070674_1004595712 108
710 3300005364 Ga0070673_100059361 Ga0070673_1000593616 108
711 3300005365 Ga0070688_100903748 Ga0070688_1009037482 108
712 3300005366 Ga0070659_100507476 Ga0070659_1005074762 108
713 3300005367 Ga0070667_100219896 Ga0070667_1002198964 108
714 3300005367 Ga0070667_100326734 Ga0070667_1003267342 108
715 3300005434 Ga0070709_10181387 Ga0070709_101813871 108
716 3300005435 Ga0070714_100420008 Ga0070714_1004200082 108
717 3300005436 Ga0070713_100785157 Ga0070713_1007851572 108
718 3300005441 Ga0070700_100073217 Ga0070700_1000732171 108
719 3300005455 Ga0070663_100554009 Ga0070663_1005540092 108
720 3300005456 Ga0070678_100408293 Ga0070678_1004082933 108
721 3300005457 Ga0070662_100010423 Ga0070662_1000104234 108
722 3300005459 Ga0068867_100174159 Ga0068867_1001741594 108
723 3300005539 Ga0068853_100047914 Ga0068853_1000479147 108
724 3300005543 Ga0070672_100620975 Ga0070672_1006209752 108
725 3300005544 Ga0070686_100452261 Ga0070686_1004522611 108
726 3300005547 Ga0070693_100022732 Ga0070693_1000227326 108
727 3300005548 Ga0070665_100001905 Ga0070665_10000190525 108
728 3300005563 Ga0068855_100454811 Ga0068855_1004548114 108
729 3300005564 Ga0070664_100193563 Ga0070664_1001935633 108
730 3300005615 Ga0070702_100351318 Ga0070702_1003513182 108
731 3300005617 Ga0068859_100147339 Ga0068859_1001473396 108
732 3300005618 Ga0068864_100444907 Ga0068864_1004449072 108
733 3300005718 Ga0068866_10138132 Ga0068866_101381323 108
734 3300005719 Ga0068861_100370948 Ga0068861_1003709483 108
735 3300005834 Ga0068851_10036865 Ga0068851_100368654 108
736 3300005841 Ga0068863_100016860 Ga0068863_10001686012 108
737 3300005841 Ga0068863_101146536 Ga0068863_1011465362 108
738 3300005842 Ga0068858_100820984 Ga0068858_1008209842 108
739 3300005843 Ga0068860_100133717 Ga0068860_1001337175 108
740 3300005843 Ga0068860_100648520 Ga0068860_1006485202 108
741 3300005844 Ga0068862_100072571 Ga0068862_1000725714 108
742 3300005937 Ga0081455_10093970 Ga0081455_100939705 108
743 3300005985 Ga0081539_10046704 Ga0081539_100467046 108
744 3300006028 Ga0070717_10912914 Ga0070717_109129142 108
745 3300006058 Ga0075432_10399545 Ga0075432_103995452 108
746 3300006163 Ga0070715_11001389 Ga0070715_110013892 108
747 3300006880 Ga0075429_100996159 Ga0075429_1009961592 108
748 3300006881 Ga0068865_100097354 Ga0068865_1000973545 108
749 3300006931 Ga0097620_100147323 Ga0097620_1001473232 108
750 3300009011 Ga0105251_10045771 Ga0105251_100457712 108
751 3300009092 Ga0105250_10094518 Ga0105250_100945182 108
752 3300009094 Ga0111539_10237960 Ga0111539_102379602 108
753 3300009098 Ga0105245_11363803 Ga0105245_113638032 108
754 3300009148 Ga0105243_11125913 Ga0105243_111259132 108
755 3300009174 Ga0105241_12133436 Ga0105241_121334361 108
756 3300009176 Ga0105242_10405932 Ga0105242_104059323 108
757 3300009176 Ga0105242_11633938 Ga0105242_116339382 108
758 3300009177 Ga0105248_10215631 Ga0105248_102156312 108
759 3300009545 Ga0105237_10385726 Ga0105237_103857263 108
760 3300009551 Ga0105238_10436006 Ga0105238_104360062 108
761 3300009553 Ga0105249_10792124 Ga0105249_107921242 108
762 3300010375 Ga0105239_10330525 Ga0105239_103305252 108
763 3300013100 Ga0157373_10461937 Ga0157373_104619372 108
764 3300013105 Ga0157369_10086187 Ga0157369_100861876 108
765 3300013296 Ga0157374_10331172 Ga0157374_103311724 108
766 3300013297 Ga0157378_10088855 Ga0157378_100888552 108
767 3300013307 Ga0157372_10313074 Ga0157372_103130742 108
768 3300013308 Ga0157375_10179713 Ga0157375_101797132 108
769 3300014745 Ga0157377_10166573 Ga0157377_101665732 108
770 3300014968 Ga0157379_10009261 Ga0157379_100092616 108
771 3300014968 Ga0157379_10124714 Ga0157379_101247142 108
772 3300014969 Ga0157376_10089329 Ga0157376_100893293 108
773 3300017792 Ga0163161_10098940 Ga0163161_100989402 108
774 3300020069 Ga0197907_10318291 Ga0197907_103182912 108
775 3300020078 Ga0206352_10764106 Ga0206352_107641062 108
776 3300020080 Ga0206350_10993920 Ga0206350_109939204 108
777 3300020081 Ga0206354_10278938 Ga0206354_102789382 108
778 3300020082 Ga0206353_11042006 Ga0206353_110420062 108
779 3300021384 Ga0213876_10047350 Ga0213876_100473504 108
780 3300025321 Ga0207656_10042243 Ga0207656_100422434 108
781 3300025899 Ga0207642_10062373 Ga0207642_100623732 108
782 3300025900 Ga0207710_10052355 Ga0207710_100523551 108
783 3300025901 Ga0207688_10108103 Ga0207688_101081034 108
784 3300025903 Ga0207680_10699813 Ga0207680_106998132 108
785 3300025904 Ga0207647_10049984 Ga0207647_100499846 108
786 3300025907 Ga0207645_10006241 Ga0207645_1000624111 108
787 3300025908 Ga0207643_10011760 Ga0207643_100117606 108
788 3300025909 Ga0207705_10367140 Ga0207705_103671402 108
789 3300025911 Ga0207654_10300849 Ga0207654_103008492 108
790 3300025913 Ga0207695_11262625 Ga0207695_112626252 108
791 3300025918 Ga0207662_10009419 Ga0207662_100094197 108
792 3300025919 Ga0207657_10020254 Ga0207657_100202549 108
793 3300025920 Ga0207649_10615582 Ga0207649_106155822 108
794 3300025921 Ga0207652_10233560 Ga0207652_102335604 108
795 3300025924 Ga0207694_10823824 Ga0207694_108238241 108
796 3300025927 Ga0207687_10345013 Ga0207687_103450133 108
797 3300025928 Ga0207700_10096353 Ga0207700_100963536 108
798 3300025929 Ga0207664_10118147 Ga0207664_101181472 108
799 3300025931 Ga0207644_10001330 Ga0207644_1000133021 108
800 3300025931 Ga0207644_10331563 Ga0207644_103315634 108
801 3300025933 Ga0207706_10016976 Ga0207706_100169765 108
802 3300025935 Ga0207709_10052364 Ga0207709_100523642 108
803 3300025936 Ga0207670_10141571 Ga0207670_101415714 108
804 3300025937 Ga0207669_10170726 Ga0207669_101707263 108
805 3300025938 Ga0207704_10246965 Ga0207704_102469654 108
806 3300025939 Ga0207665_10485759 Ga0207665_104857592 108
807 3300025940 Ga0207691_10052644 Ga0207691_100526443 108
808 3300025941 Ga0207711_10121462 Ga0207711_101214625 108
809 3300025942 Ga0207689_10017438 Ga0207689_100174383 108
810 3300025945 Ga0207679_11153116 Ga0207679_111531162 108
811 3300025949 Ga0207667_10419184 Ga0207667_104191842 108
812 3300025961 Ga0207712_10527653 Ga0207712_105276532 108
813 3300025972 Ga0207668_10143504 Ga0207668_101435043 108
814 3300025972 Ga0207668_10877481 Ga0207668_108774811 108
815 3300025981 Ga0207640_10030986 Ga0207640_100309868 108
816 3300026023 Ga0207677_10440473 Ga0207677_104404732 108
817 3300026067 Ga0207678_10022601 Ga0207678_1002260111 108
818 3300026075 Ga0207708_10015459 Ga0207708_100154596 108
819 3300026088 Ga0207641_10003356 Ga0207641_1000335612 108
820 3300026088 Ga0207641_10141048 Ga0207641_101410485 108
821 3300026089 Ga0207648_10008491 Ga0207648_100084918 108
822 3300026095 Ga0207676_10624231 Ga0207676_106242312 108
823 3300026116 Ga0207674_10011658 Ga0207674_1001165810 108
824 3300026118 Ga0207675_100014683 Ga0207675_1000146834 108
825 3300026121 Ga0207683_10030091 Ga0207683_100300913 108
826 3300026142 Ga0207698_10922821 Ga0207698_109228212 108
827 3300028379 Ga0268266_10084776 Ga0268266_100847762 108
828 3300028379 Ga0268266_10149683 Ga0268266_101496835 108
829 3300028380 Ga0268265_10197645 Ga0268265_101976455 108
830 3300028381 Ga0268264_10034736 Ga0268264_100347369 108
831 3300028381 Ga0268264_10156370 Ga0268264_101563706 108
832 3300031995 Ga0307409_100953740 Ga0307409_1009537402 108
833 3300035115 Ga0373941_0109602 Ga0373941_0109602_259_588 108
834 3300035119 Ga0373956_0470657 Ga0373956_0470657_239_565 108
835 3300035207 Ga0373942_0133563 Ga0373942_0133563_164_493 108
836 3300035691 Ga0373931_0028935 Ga0373931_0028935_2391_2720 108
837 3300037471 Ga0395905_0135257 Ga0395905_0135257_754_1083 108
838 3300038443 Ga0395901_1254022 Ga0395901_1254022_104_433 108
839 3300039437 Ga0436365_1725899 Ga0436365_1725899_3739_4065 108
840 3300039450 Ga0436363_0697187 Ga0436363_0697187_617_943 108
841 3300044683 Ga0466965_0007902 Ga0466965_0007902_277_606 108
842 3300044694 Ga0466963_0320336 Ga0466963_0320336_247_573 108
843 3300044694 Ga0466963_0681869 Ga0466963_0681869_349_675 108
844 3300044706 Ga0466964_0270334 Ga0466964_0270334_15_344 108
845 3300044719 Ga0466971_0422736 Ga0466971_0422736_149_478 108
846 3300044901 Ga0466960_0007532 Ga0466960_0007532_2517_2846 108
847 3300045049 Ga0466959_0461104 Ga0466959_0461104_186_515 108
848 3300045836 Ga0466958_0057813 Ga0466958_0057813_1011_1337 108
849 3300045836 Ga0466958_0334773 Ga0466958_0334773_423_752 108
850 3300045836 Ga0466958_0459816 Ga0466958_0459816_169_495 108
851 3300045976 Ga0466967_0048690 Ga0466967_0048690_1039_1365 108
852 3300045976 Ga0466967_1184008 Ga0466967_1184008_108_434 108
853 3300046507 Ga0495606_0237907 Ga0495606_0237907_334_663 108
854 3300046515 Ga0495620_0240301 Ga0495620_0240301_315_644 108
855 3300046537 Ga0495598_0048912 Ga0495598_0048912_573_902 108
856 3300046694 Ga0495649_0376587 Ga0495649_0376587_74_403 108
857 3300048903 Ga0496100_0002817 Ga0496100_0002817_8092_8421 108
858 3300048903 Ga0496100_0329159 Ga0496100_0329159_219_548 108
859 3300048904 Ga0496101_0019981 Ga0496101_0019981_125_454 108
860 3300048904 Ga0496101_0153999 Ga0496101_0153999_878_1207 108
861 3300048905 Ga0496102_0000521 Ga0496102_0000521_18495_18824 108
862 3300048905 Ga0496102_0174227 Ga0496102_0174227_1523_1852 108
863 3300048906 Ga0496103_0000453 Ga0496103_0000453_6657_6986 108
864 3300048906 Ga0496103_0104531 Ga0496103_0104531_696_1025 108
865 3300048907 Ga0496104_0011710 Ga0496104_0011710_1900_2229 108
866 3300048907 Ga0496104_0373568 Ga0496104_0373568_78_407 108
867 3300048908 Ga0496105_0037579 Ga0496105_0037579_1201_1530 108
868 3300048908 Ga0496105_0128707 Ga0496105_0128707_378_707 108
869 3300048909 Ga0496106_0098087 Ga0496106_0098087_1658_1987 108
870 3300048909 Ga0496106_0749813 Ga0496106_0749813_252_581 108
871 3300048910 Ga0496107_0727678 Ga0496107_0727678_322_651 108
872 3300048911 Ga0496108_0103562 Ga0496108_0103562_43_372 108
873 3300048912 Ga0496109_0368258 Ga0496109_0368258_117_446 108
874 3300048912 Ga0496109_0658037 Ga0496109_0658037_157_486 108
875 3300048913 Ga0496110_0110005 Ga0496110_0110005_1958_2287 108
876 3300048913 Ga0496110_1393355 Ga0496110_1393355_123_452 108
877 3300048914 Ga0496111_0298442 Ga0496111_0298442_357_686 108
878 3300048915 Ga0496112_0072471 Ga0496112_0072471_1825_2154 108
879 3300048918 Ga0496115_0166871 Ga0496115_0166871_743_1072 108
880 3300048919 Ga0496116_0000173 Ga0496116_0000173_16333_16662 108
881 3300048920 Ga0496117_0000144 Ga0496117_0000144_146911_147240 108
882 3300048921 Ga0496118_0000096 Ga0496118_0000096_79242_79571 108
883 3300048922 Ga0496119_0003189 Ga0496119_0003189_1992_2321 108
884 3300048923 Ga0496120_0004033 Ga0496120_0004033_6573_6902 108
885 3300048924 Ga0496121_0005885 Ga0496121_0005885_1200_1529 108
886 3300048925 Ga0496122_0175033 Ga0496122_0175033_35_364 108
887 3300048927 Ga0496124_0003352 Ga0496124_0003352_11380_11709 108
888 3300048928 Ga0496125_0011762 Ga0496125_0011762_8358_8687 108
889 3300048929 Ga0496126_0000330 Ga0496126_0000330_84412_84741 108
890 3300050511 nmdc:mga08y16_580270_c1 nmdc:mga08y16_580270_c1_374_703 108
891 3300050515 nmdc:mga0a205_791190_c1 nmdc:mga0a205_791190_c1_146_475 108
892 3300053083 Ga0495655_0097996 Ga0495655_0097996_36_365 108
893 3300059491 Ga0587070_060091 Ga0587070_060091_268_597 108
894 3300059503 Ga0587080_029292 Ga0587080_029292_190_516 108
895 3300059505 Ga0587083_0048673 Ga0587083_0048673_88_417 108
896 3300059505 Ga0587083_0116247 Ga0587083_0116247_327_653 108
897 3300059505 Ga0587083_0127328 Ga0587083_0127328_110_439 108
898 3300059506 Ga0587085_003511 Ga0587085_003511_894_1223 108
899 3300059508 Ga0587088_054133 Ga0587088_054133_183_509 108
900 3300059622 Ga0587099_019046 Ga0587099_019046_398_727 108
901 3300059626 Ga0587115_051297 Ga0587115_051297_276_602 108
902 3300059640 Ga0587067_018634 Ga0587067_018634_520_846 108
903 3300059640 Ga0587067_146302 Ga0587067_146302_157_483 108
904 3300059642 Ga0587069_036468 Ga0587069_036468_292_621 108
905 3300059643 Ga0587072_029483 Ga0587072_029483_52_381 108
906 3300059643 Ga0587072_070733 Ga0587072_070733_22_348 108
907 3300059647 Ga0587079_198710 Ga0587079_198710_10_339 108
908 3300059652 Ga0587107_051389 Ga0587107_051389_242_568 108
909 3300060344 Ga0587071_038380 Ga0587071_038380_456_785 108
910 3300060346 Ga0587111_0094380 Ga0587111_0094380_197_523 108
911 3300061719 Ga0466962_0755373 Ga0466962_0755373_143_472 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

5

36

0.98

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

38

98

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9318 1 74
7mt3-assembly1.cif.gz_U mtb 70s with p/e trna 0.9307 1 107
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9272 3 108
5xym-assembly1.cif.gz_U large subunit of mycobacterium smegmatis 0.9216 1 108
7mt3-assembly1.cif.gz_U mtb 70s with p/e trna 0.9209 1 107
ID Description Score Start End Superfamily
af_P9WHB7_1_104_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9253 1 107 2.30.30.30
af_P9WHB7_1_104_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9169 1 107 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8968 1 107 2.30.30.30
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8966 3 36 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8883 1 107 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1F6WPI9-F1-model_v4 Large ribosomal subunit protein uL24 0.9355 1 108 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1CKU7-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9344 1 74 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1I4RRA6-F1-model_v4 Large ribosomal subunit protein uL24 0.9261 1 108 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G1SYH5-F1-model_v4 Large ribosomal subunit protein uL24 0.9222 1 82 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2A4TTZ3-F1-model_v4 Large ribosomal subunit protein uL24 0.9198 1 108 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
89.39 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map