F485479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 475 | 864 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0047273|Ga0496115_0047273_332_706 |
| Length | 124 |
| Sequence | MKVKKGDTVLVIAGKDKGAKGKVIQAYPDSDRILVEGVNRIKKHTKVSTTQRGAKTGGIVTQEATIHVSNVMVVDGDNKPAGGSGCPGGQVRTCDDHHRDQARHWKHRRGRREDPAPTPSPLRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 5 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 6 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 7 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 8 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 9 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 10 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 11 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 12 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 13 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 14 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 15 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 16 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 17 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 18 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 19 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 20 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 21 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 22 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 23 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 24 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 25 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 26 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 27 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 28 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 29 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 30 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 31 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 32 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 33 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 34 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 35 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 36 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 37 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 38 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 39 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 40 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 41 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 42 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 43 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 44 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 45 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 46 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 47 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 48 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 49 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 50 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 51 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 52 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 53 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 54 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 55 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 57 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 58 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 59 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 60 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 67 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 101 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 104 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 117 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 118 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 119 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 120 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 121 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 122 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 123 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 124 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 125 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 126 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 127 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 128 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 129 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 130 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 132 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 138 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 139 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 140 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 141 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 142 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 143 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 144 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 146 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 162 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 163 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 164 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 165 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 168 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 169 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 170 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 171 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 172 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 182 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 192 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 198 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 199 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 200 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 201 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 260 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 264 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 265 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 266 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 267 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 268 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 269 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 270 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 271 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 272 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 273 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 274 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 276 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 279 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 280 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 281 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 282 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 283 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 284 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 286 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 287 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 290 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 292 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 299 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 304 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 307 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 308 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 309 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 310 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 313 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 317 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 321 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 322 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 323 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 324 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 325 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 326 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 327 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 328 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 329 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 330 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 331 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 332 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 333 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 334 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 335 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 336 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 337 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 338 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 339 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 340 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 341 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 342 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 343 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 344 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 345 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 346 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 347 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 389 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 390 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 391 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 392 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 393 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 394 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 397 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 398 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 399 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 400 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 401 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 402 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 403 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 404 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 405 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 406 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 407 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 408 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 438 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 439 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 471 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 472 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 473 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 474 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 475 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.97 |
| Metatranscriptomes | 10.87 |
| Isolates | 5.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0.55 |
| Rhizoplane | 9.66 |
| Rhizosphere | 81.67 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 7.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002850 | 3300000549 | Bacteria | 2367 |
| 2 | LJQas_1002897 | 3300000549 | Bacteria | 2335 |
| 3 | JGI24752J21851_1034974 | 3300001976 | Bacteria | 667 |
| 4 | JGI24747J21853_1030775 | 3300001978 | Bacteria | 613 |
| 5 | JGI24740J21852_10072830 | 3300001979 | Bacteria | 916 |
| 6 | JGI24739J22299_10018382 | 3300001989 | Bacteria | 2513 |
| 7 | JGI24737J22298_10042080 | 3300001990 | Bacteria | 1401 |
| 8 | JGI24735J21928_10007851 | 3300002067 | Bacteria | 3467 |
| 9 | JGI24750J21931_1074411 | 3300002070 | Bacteria | 558 |
| 10 | JGI24745J21846_1000243 | 3300002073 | Bacteria | 4512 |
| 11 | JGI24738J21930_10015789 | 3300002075 | Bacteria | 1601 |
| 12 | JGI24744J21845_10012957 | 3300002077 | Bacteria | 1684 |
| 13 | JGI24744J21845_10093776 | 3300002077 | Bacteria | 552 |
| 14 | JGI24742J22300_10029422 | 3300002244 | Bacteria | 956 |
| 15 | JGI25406J46586_10001383 | 3300003203 | Bacteria | 11451 |
| 16 | Ga0058858_1396751 | 3300004785 | Bacteria | 523 |
| 17 | Ga0058859_10011668 | 3300004798 | Bacteria | 1107 |
| 18 | Ga0058859_11648364 | 3300004798 | Bacteria | 711 |
| 19 | Ga0058859_11663105 | 3300004798 | Bacteria | 961 |
| 20 | Ga0058861_11630814 | 3300004800 | Bacteria | 793 |
| 21 | Ga0058860_10023721 | 3300004801 | Bacteria | 1573 |
| 22 | Ga0058860_10092749 | 3300004801 | Bacteria | 1779 |
| 23 | Ga0058860_12065445 | 3300004801 | Bacteria | 645 |
| 24 | Ga0058860_12175289 | 3300004801 | Bacteria | 904 |
| 25 | Ga0058860_12193443 | 3300004801 | Bacteria | 1663 |
| 26 | Ga0058862_10023693 | 3300004803 | Bacteria | 1094 |
| 27 | Ga0058862_10080862 | 3300004803 | Bacteria | 689 |
| 28 | Ga0058862_10153738 | 3300004803 | Bacteria | 1625 |
| 29 | Ga0070658_10199380 | 3300005327 | Bacteria | 1688 |
| 30 | Ga0070658_11189461 | 3300005327 | Bacteria | 663 |
| 31 | Ga0070676_10189555 | 3300005328 | Bacteria | 1342 |
| 32 | Ga0070676_11186583 | 3300005328 | Bacteria | 580 |
| 33 | Ga0070683_100241319 | 3300005329 | Bacteria | 1719 |
| 34 | Ga0070683_101326100 | 3300005329 | Bacteria | 692 |
| 35 | Ga0070690_100087745 | 3300005330 | Bacteria | 2044 |
| 36 | Ga0070690_101738678 | 3300005330 | Bacteria | 508 |
| 37 | Ga0070670_100441180 | 3300005331 | Bacteria | 1153 |
| 38 | Ga0070670_100856445 | 3300005331 | Bacteria | 822 |
| 39 | Ga0070670_100997067 | 3300005331 | Bacteria | 762 |
| 40 | Ga0070670_101601817 | 3300005331 | Bacteria | 599 |
| 41 | Ga0068869_100183863 | 3300005334 | Bacteria | 1640 |
| 42 | Ga0068869_100245279 | 3300005334 | Bacteria | 1428 |
| 43 | Ga0068869_100986704 | 3300005334 | Bacteria | 733 |
| 44 | Ga0068869_101042128 | 3300005334 | Bacteria | 714 |
| 45 | Ga0068869_101520067 | 3300005334 | Bacteria | 595 |
| 46 | Ga0070666_10022861 | 3300005335 | Bacteria | 4065 |
| 47 | Ga0070666_10137813 | 3300005335 | Bacteria | 1699 |
| 48 | Ga0070666_11252481 | 3300005335 | Bacteria | 553 |
| 49 | Ga0070680_100657954 | 3300005336 | Bacteria | 900 |
| 50 | Ga0070682_100035507 | 3300005337 | Bacteria | 3044 |
| 51 | Ga0070682_100044721 | 3300005337 | Bacteria | 2742 |
| 52 | Ga0070682_100289963 | 3300005337 | Bacteria | 1196 |
| 53 | Ga0070682_100520150 | 3300005337 | Bacteria | 925 |
| 54 | Ga0070682_100521336 | 3300005337 | Bacteria | 924 |
| 55 | Ga0070682_100851960 | 3300005337 | Bacteria | 745 |
| 56 | Ga0068868_100000735 | 3300005338 | Bacteria | 22181 |
| 57 | Ga0068868_100074056 | 3300005338 | Bacteria | 2719 |
| 58 | Ga0068868_100444556 | 3300005338 | Bacteria | 1126 |
| 59 | Ga0068868_100451926 | 3300005338 | Bacteria | 1118 |
| 60 | Ga0068868_100463731 | 3300005338 | Bacteria | 1104 |
| 61 | Ga0070689_100090963 | 3300005340 | Bacteria | 2405 |
| 62 | Ga0070689_100109629 | 3300005340 | Bacteria | 2194 |
| 63 | Ga0070689_100150356 | 3300005340 | Bacteria | 1877 |
| 64 | Ga0070689_100573325 | 3300005340 | Bacteria | 975 |
| 65 | Ga0070691_10009448 | 3300005341 | Bacteria | 4450 |
| 66 | Ga0070687_100024177 | 3300005343 | Bacteria | 2896 |
| 67 | Ga0070687_100094363 | 3300005343 | Bacteria | 1661 |
| 68 | Ga0070687_100615577 | 3300005343 | Bacteria | 748 |
| 69 | Ga0070687_100886665 | 3300005343 | Bacteria | 639 |
| 70 | Ga0070661_100280908 | 3300005344 | Bacteria | 1291 |
| 71 | Ga0070661_101223581 | 3300005344 | Bacteria | 628 |
| 72 | Ga0070692_10085751 | 3300005345 | Bacteria | 1704 |
| 73 | Ga0070692_10188920 | 3300005345 | Bacteria | 1199 |
| 74 | Ga0070668_100074215 | 3300005347 | Bacteria | 2653 |
| 75 | Ga0070668_100582941 | 3300005347 | Bacteria | 977 |
| 76 | Ga0070668_100910105 | 3300005347 | Bacteria | 787 |
| 77 | Ga0070668_101856342 | 3300005347 | Bacteria | 555 |
| 78 | Ga0070669_100059808 | 3300005353 | Bacteria | 2798 |
| 79 | Ga0070675_100176989 | 3300005354 | Bacteria | 1842 |
| 80 | Ga0070675_100596012 | 3300005354 | Bacteria | 1002 |
| 81 | Ga0070675_100751621 | 3300005354 | Bacteria | 890 |
| 82 | Ga0070671_100002908 | 3300005355 | Bacteria | 13316 |
| 83 | Ga0070671_100161753 | 3300005355 | Bacteria | 1892 |
| 84 | Ga0070671_100903030 | 3300005355 | Bacteria | 772 |
| 85 | Ga0070671_101050666 | 3300005355 | Bacteria | 714 |
| 86 | Ga0070674_100107725 | 3300005356 | Bacteria | 2041 |
| 87 | Ga0070674_100237013 | 3300005356 | Bacteria | 1426 |
| 88 | Ga0070674_100459571 | 3300005356 | Bacteria | 1052 |
| 89 | Ga0070673_100059361 | 3300005364 | Bacteria | 3027 |
| 90 | Ga0070673_100229915 | 3300005364 | Bacteria | 1608 |
| 91 | Ga0070688_100903748 | 3300005365 | Bacteria | 696 |
| 92 | Ga0070659_100005602 | 3300005366 | Bacteria | 9028 |
| 93 | Ga0070659_100507476 | 3300005366 | Bacteria | 1028 |
| 94 | Ga0070659_101086510 | 3300005366 | Bacteria | 705 |
| 95 | Ga0070667_100051219 | 3300005367 | Bacteria | 3481 |
| 96 | Ga0070667_100219896 | 3300005367 | Bacteria | 1690 |
| 97 | Ga0070667_100326734 | 3300005367 | Bacteria | 1385 |
| 98 | Ga0070667_101075441 | 3300005367 | Bacteria | 752 |
| 99 | Ga0070667_101624717 | 3300005367 | Bacteria | 608 |
| 100 | Ga0070667_101957745 | 3300005367 | Bacteria | 552 |
| 101 | Ga0070703_10078531 | 3300005406 | Bacteria | 1119 |
| 102 | Ga0070709_10181387 | 3300005434 | Bacteria | 1479 |
| 103 | Ga0070709_11005348 | 3300005434 | Bacteria | 663 |
| 104 | Ga0070714_100170503 | 3300005435 | Bacteria | 1975 |
| 105 | Ga0070714_100203655 | 3300005435 | Bacteria | 1811 |
| 106 | Ga0070714_100255706 | 3300005435 | Bacteria | 1621 |
| 107 | Ga0070714_100420008 | 3300005435 | Bacteria | 1267 |
| 108 | Ga0070713_100785157 | 3300005436 | Bacteria | 912 |
| 109 | Ga0070713_102150378 | 3300005436 | Bacteria | 541 |
| 110 | Ga0070710_10000376 | 3300005437 | Bacteria | 20895 |
| 111 | Ga0070711_100007537 | 3300005439 | Bacteria | 6624 |
| 112 | Ga0070705_100014974 | 3300005440 | Bacteria | 4001 |
| 113 | Ga0070700_100073217 | 3300005441 | Bacteria | 2192 |
| 114 | Ga0070700_100088260 | 3300005441 | Bacteria | 2018 |
| 115 | Ga0070700_100606189 | 3300005441 | Bacteria | 859 |
| 116 | Ga0070694_100045954 | 3300005444 | Bacteria | 2929 |
| 117 | Ga0070663_100182346 | 3300005455 | Bacteria | 1629 |
| 118 | Ga0070663_100554009 | 3300005455 | Bacteria | 961 |
| 119 | Ga0070663_100600304 | 3300005455 | Bacteria | 926 |
| 120 | Ga0070678_100408293 | 3300005456 | Bacteria | 1181 |
| 121 | Ga0070678_100938946 | 3300005456 | Bacteria | 792 |
| 122 | Ga0070678_101503772 | 3300005456 | Bacteria | 630 |
| 123 | Ga0070662_100010423 | 3300005457 | Bacteria | 6096 |
| 124 | Ga0070662_100030788 | 3300005457 | Bacteria | 3759 |
| 125 | Ga0070662_101297357 | 3300005457 | Bacteria | 626 |
| 126 | Ga0070681_11527605 | 3300005458 | Bacteria | 592 |
| 127 | Ga0068867_100174159 | 3300005459 | Bacteria | 1706 |
| 128 | Ga0068867_100376967 | 3300005459 | Bacteria | 1191 |
| 129 | Ga0070685_10056406 | 3300005466 | Bacteria | 2284 |
| 130 | Ga0070685_10109043 | 3300005466 | Bacteria | 1702 |
| 131 | Ga0070685_10604378 | 3300005466 | Bacteria | 790 |
| 132 | Ga0070679_101895927 | 3300005530 | Bacteria | 545 |
| 133 | Ga0070684_100821124 | 3300005535 | Bacteria | 869 |
| 134 | Ga0070697_100142979 | 3300005536 | Bacteria | 2013 |
| 135 | Ga0068853_100025062 | 3300005539 | Bacteria | 5004 |
| 136 | Ga0068853_100047914 | 3300005539 | Bacteria | 3668 |
| 137 | Ga0070672_100620975 | 3300005543 | Bacteria | 942 |
| 138 | Ga0070686_100452261 | 3300005544 | Bacteria | 988 |
| 139 | Ga0070695_100775425 | 3300005545 | Bacteria | 766 |
| 140 | Ga0070696_100032405 | 3300005546 | Bacteria | 3585 |
| 141 | Ga0070696_101787839 | 3300005546 | Bacteria | 531 |
| 142 | Ga0070693_100022732 | 3300005547 | Bacteria | 3339 |
| 143 | Ga0070693_101489498 | 3300005547 | Bacteria | 528 |
| 144 | Ga0070665_100001905 | 3300005548 | Bacteria | 23586 |
| 145 | Ga0070665_100094006 | 3300005548 | Bacteria | 3003 |
| 146 | Ga0070665_100456554 | 3300005548 | Bacteria | 1287 |
| 147 | Ga0070665_100479384 | 3300005548 | Bacteria | 1255 |
| 148 | Ga0070665_101563816 | 3300005548 | Bacteria | 668 |
| 149 | Ga0070704_100114220 | 3300005549 | Bacteria | 2061 |
| 150 | Ga0068855_100050226 | 3300005563 | Bacteria | 4916 |
| 151 | Ga0068855_100454811 | 3300005563 | Bacteria | 1397 |
| 152 | Ga0070664_100193563 | 3300005564 | Bacteria | 1812 |
| 153 | Ga0070664_100209730 | 3300005564 | Bacteria | 1740 |
| 154 | Ga0070664_100537502 | 3300005564 | Bacteria | 1080 |
| 155 | Ga0068857_102374765 | 3300005577 | Bacteria | 521 |
| 156 | Ga0070702_100016667 | 3300005615 | Bacteria | 3774 |
| 157 | Ga0070702_100087744 | 3300005615 | Bacteria | 1880 |
| 158 | Ga0070702_100351318 | 3300005615 | Bacteria | 1038 |
| 159 | Ga0068852_100222700 | 3300005616 | Bacteria | 1795 |
| 160 | Ga0068852_100228323 | 3300005616 | Bacteria | 1773 |
| 161 | Ga0068852_100405143 | 3300005616 | Bacteria | 1342 |
| 162 | Ga0068852_100479569 | 3300005616 | Bacteria | 1236 |
| 163 | Ga0068859_100147339 | 3300005617 | Bacteria | 2429 |
| 164 | Ga0068859_101621091 | 3300005617 | Bacteria | 715 |
| 165 | Ga0068859_102006550 | 3300005617 | Bacteria | 639 |
| 166 | Ga0068859_102705462 | 3300005617 | Bacteria | 545 |
| 167 | Ga0068864_100109101 | 3300005618 | Bacteria | 2463 |
| 168 | Ga0068864_100444907 | 3300005618 | Bacteria | 1238 |
| 169 | Ga0068864_101413849 | 3300005618 | Bacteria | 698 |
| 170 | Ga0068866_10028542 | 3300005718 | Bacteria | 2660 |
| 171 | Ga0068866_10138132 | 3300005718 | Bacteria | 1395 |
| 172 | Ga0068861_100055597 | 3300005719 | Bacteria | 3019 |
| 173 | Ga0068861_100370948 | 3300005719 | Bacteria | 1261 |
| 174 | Ga0068861_100993418 | 3300005719 | Bacteria | 801 |
| 175 | Ga0068851_10036865 | 3300005834 | Bacteria | 2450 |
| 176 | Ga0068851_10177369 | 3300005834 | Bacteria | 1179 |
| 177 | Ga0068851_10649456 | 3300005834 | Bacteria | 646 |
| 178 | Ga0068851_10758542 | 3300005834 | Bacteria | 601 |
| 179 | Ga0068870_10103819 | 3300005840 | Bacteria | 1611 |
| 180 | Ga0068870_10691558 | 3300005840 | Bacteria | 703 |
| 181 | Ga0068863_100016860 | 3300005841 | Bacteria | 7006 |
| 182 | Ga0068863_100023672 | 3300005841 | Bacteria | 5860 |
| 183 | Ga0068863_101146536 | 3300005841 | Bacteria | 782 |
| 184 | Ga0068858_100106994 | 3300005842 | Bacteria | 2610 |
| 185 | Ga0068858_100566258 | 3300005842 | Bacteria | 1100 |
| 186 | Ga0068858_100820984 | 3300005842 | Bacteria | 907 |
| 187 | Ga0068860_100081426 | 3300005843 | Bacteria | 3078 |
| 188 | Ga0068860_100133717 | 3300005843 | Bacteria | 2381 |
| 189 | Ga0068860_100648520 | 3300005843 | Bacteria | 1063 |
| 190 | Ga0068862_100072571 | 3300005844 | Bacteria | 2973 |
| 191 | Ga0068862_100294763 | 3300005844 | Bacteria | 1491 |
| 192 | Ga0081455_10093970 | 3300005937 | Bacteria | 2423 |
| 193 | Ga0081538_10016245 | 3300005981 | Bacteria | 5719 |
| 194 | Ga0081540_1001718 | 3300005983 | Bacteria | 18540 |
| 195 | Ga0081539_10000132 | 3300005985 | Bacteria | 175454 |
| 196 | Ga0081539_10046704 | 3300005985 | Bacteria | 2479 |
| 197 | Ga0070717_10133237 | 3300006028 | Bacteria | 2139 |
| 198 | Ga0070717_10650961 | 3300006028 | Bacteria | 956 |
| 199 | Ga0070717_10912914 | 3300006028 | Bacteria | 800 |
| 200 | Ga0075432_10136715 | 3300006058 | Bacteria | 932 |
| 201 | Ga0075432_10399545 | 3300006058 | Bacteria | 593 |
| 202 | Ga0070715_10050715 | 3300006163 | Bacteria | 1783 |
| 203 | Ga0070715_11001389 | 3300006163 | Bacteria | 521 |
| 204 | Ga0070716_100006233 | 3300006173 | Bacteria | 5821 |
| 205 | Ga0070712_100571499 | 3300006175 | Bacteria | 954 |
| 206 | Ga0097621_100125994 | 3300006237 | Bacteria | 2175 |
| 207 | Ga0097621_100709730 | 3300006237 | Bacteria | 926 |
| 208 | Ga0068871_100063772 | 3300006358 | Bacteria | 3014 |
| 209 | Ga0068871_100980001 | 3300006358 | Bacteria | 786 |
| 210 | Ga0075430_100325873 | 3300006846 | Bacteria | 1270 |
| 211 | Ga0075431_100111938 | 3300006847 | Bacteria | 2817 |
| 212 | Ga0075433_10207134 | 3300006852 | Bacteria | 1743 |
| 213 | Ga0075433_10605594 | 3300006852 | Bacteria | 962 |
| 214 | Ga0075434_100046738 | 3300006871 | Bacteria | 4295 |
| 215 | Ga0075429_100749409 | 3300006880 | Bacteria | 855 |
| 216 | Ga0075429_100996159 | 3300006880 | Bacteria | 733 |
| 217 | Ga0068865_100097354 | 3300006881 | Bacteria | 2147 |
| 218 | Ga0075436_100061172 | 3300006914 | Bacteria | 2601 |
| 219 | Ga0097620_100147323 | 3300006931 | Bacteria | 2429 |
| 220 | Ga0097620_101621039 | 3300006931 | Bacteria | 715 |
| 221 | Ga0097620_102006711 | 3300006931 | Bacteria | 639 |
| 222 | Ga0097620_102704880 | 3300006931 | Bacteria | 545 |
| 223 | Ga0075435_100031870 | 3300007076 | Bacteria | 4158 |
| 224 | Ga0075435_100673010 | 3300007076 | Bacteria | 899 |
| 225 | Ga0105251_10045771 | 3300009011 | Bacteria | 2108 |
| 226 | Ga0105244_10250095 | 3300009036 | Bacteria | 826 |
| 227 | Ga0105250_10094518 | 3300009092 | Bacteria | 1218 |
| 228 | Ga0105240_10204697 | 3300009093 | Bacteria | 2311 |
| 229 | Ga0111539_10237960 | 3300009094 | Bacteria | 2119 |
| 230 | Ga0111539_10715946 | 3300009094 | Bacteria | 1165 |
| 231 | Ga0105245_10026001 | 3300009098 | Bacteria | 5150 |
| 232 | Ga0105245_10902983 | 3300009098 | Bacteria | 925 |
| 233 | Ga0105245_11125141 | 3300009098 | Bacteria | 832 |
| 234 | Ga0105245_11363803 | 3300009098 | Bacteria | 759 |
| 235 | Ga0105245_11595489 | 3300009098 | Bacteria | 704 |
| 236 | Ga0105247_10042407 | 3300009101 | Bacteria | 2787 |
| 237 | Ga0105247_10168492 | 3300009101 | Bacteria | 1455 |
| 238 | Ga0105247_10476135 | 3300009101 | Bacteria | 905 |
| 239 | Ga0114129_11603647 | 3300009147 | Bacteria | 797 |
| 240 | Ga0105243_10009722 | 3300009148 | Bacteria | 7325 |
| 241 | Ga0105243_10847058 | 3300009148 | Bacteria | 905 |
| 242 | Ga0105243_11125913 | 3300009148 | Bacteria | 794 |
| 243 | Ga0105241_10044504 | 3300009174 | Bacteria | 3364 |
| 244 | Ga0105241_11517426 | 3300009174 | Bacteria | 645 |
| 245 | Ga0105241_12133436 | 3300009174 | Bacteria | 554 |
| 246 | Ga0105242_10181638 | 3300009176 | Bacteria | 1856 |
| 247 | Ga0105242_10405932 | 3300009176 | Bacteria | 1273 |
| 248 | Ga0105242_10768747 | 3300009176 | Bacteria | 950 |
| 249 | Ga0105242_11633938 | 3300009176 | Bacteria | 679 |
| 250 | Ga0105248_10215631 | 3300009177 | Bacteria | 2162 |
| 251 | Ga0105248_10253937 | 3300009177 | Bacteria | 1979 |
| 252 | Ga0105248_11672967 | 3300009177 | Bacteria | 721 |
| 253 | Ga0105237_10192300 | 3300009545 | Bacteria | 2040 |
| 254 | Ga0105237_10385726 | 3300009545 | Bacteria | 1406 |
| 255 | Ga0105238_10042028 | 3300009551 | Bacteria | 4629 |
| 256 | Ga0105238_10322410 | 3300009551 | Bacteria | 1531 |
| 257 | Ga0105238_10435505 | 3300009551 | Bacteria | 1307 |
| 258 | Ga0105238_10436006 | 3300009551 | Bacteria | 1306 |
| 259 | Ga0105238_10935547 | 3300009551 | Bacteria | 886 |
| 260 | Ga0105238_12808358 | 3300009551 | Bacteria | 523 |
| 261 | Ga0105249_10007779 | 3300009553 | Bacteria | 9340 |
| 262 | Ga0105249_10792124 | 3300009553 | Bacteria | 1012 |
| 263 | Ga0105249_10800817 | 3300009553 | Bacteria | 1006 |
| 264 | Ga0105032_101026 | 3300009979 | Bacteria | 2606 |
| 265 | Ga0105033_102590 | 3300009986 | Bacteria | 1500 |
| 266 | Ga0105033_103394 | 3300009986 | Bacteria | 1338 |
| 267 | Ga0105035_100358 | 3300009988 | Bacteria | 2826 |
| 268 | Ga0105028_101349 | 3300009993 | Bacteria | 2586 |
| 269 | Ga0105239_10330525 | 3300010375 | Bacteria | 1719 |
| 270 | Ga0105239_10543736 | 3300010375 | Bacteria | 1322 |
| 271 | Ga0105246_10084502 | 3300011119 | Bacteria | 2271 |
| 272 | Ga0105246_10411265 | 3300011119 | Bacteria | 1126 |
| 273 | Ga0105246_11043192 | 3300011119 | Bacteria | 743 |
| 274 | Ga0105246_11379969 | 3300011119 | Bacteria | 657 |
| 275 | Ga0157329_1012942 | 3300012491 | Bacteria | 690 |
| 276 | Ga0157341_1011304 | 3300012494 | Bacteria | 771 |
| 277 | Ga0157323_1000742 | 3300012495 | Bacteria | 1478 |
| 278 | Ga0157324_1002822 | 3300012506 | Bacteria | 1091 |
| 279 | Ga0157315_1015463 | 3300012508 | Bacteria | 744 |
| 280 | Ga0157373_10461937 | 3300013100 | Bacteria | 914 |
| 281 | Ga0157371_10012725 | 3300013102 | Bacteria | 6414 |
| 282 | Ga0157370_10260145 | 3300013104 | Bacteria | 1604 |
| 283 | Ga0157369_10086187 | 3300013105 | Bacteria | 3355 |
| 284 | Ga0157369_10514077 | 3300013105 | Bacteria | 1239 |
| 285 | Ga0157369_11625030 | 3300013105 | Bacteria | 657 |
| 286 | Ga0157369_12114607 | 3300013105 | Bacteria | 571 |
| 287 | Ga0157374_10031506 | 3300013296 | Bacteria | 4820 |
| 288 | Ga0157374_10331172 | 3300013296 | Bacteria | 1510 |
| 289 | Ga0157374_10720339 | 3300013296 | Bacteria | 1011 |
| 290 | Ga0157374_10876269 | 3300013296 | Bacteria | 915 |
| 291 | Ga0157374_11218317 | 3300013296 | Bacteria | 774 |
| 292 | Ga0157378_10088855 | 3300013297 | Bacteria | 2805 |
| 293 | Ga0157378_10355995 | 3300013297 | Bacteria | 1431 |
| 294 | Ga0157378_11157240 | 3300013297 | Bacteria | 812 |
| 295 | Ga0163162_10015117 | 3300013306 | Bacteria | 7536 |
| 296 | Ga0163162_12702098 | 3300013306 | Bacteria | 571 |
| 297 | Ga0157372_10039710 | 3300013307 | Bacteria | 5195 |
| 298 | Ga0157372_10313074 | 3300013307 | Bacteria | 1827 |
| 299 | Ga0157372_10599602 | 3300013307 | Bacteria | 1284 |
| 300 | Ga0157372_11431024 | 3300013307 | Bacteria | 797 |
| 301 | Ga0157372_11547638 | 3300013307 | Bacteria | 764 |
| 302 | Ga0157375_10179713 | 3300013308 | Bacteria | 2267 |
| 303 | Ga0157375_11087697 | 3300013308 | Bacteria | 936 |
| 304 | Ga0157375_11154372 | 3300013308 | Bacteria | 908 |
| 305 | Ga0157375_11413326 | 3300013308 | Bacteria | 820 |
| 306 | Ga0157375_11536211 | 3300013308 | Bacteria | 786 |
| 307 | Ga0157375_12027055 | 3300013308 | Bacteria | 684 |
| 308 | Ga0157515_106749 | 3300013875 | Bacteria | 701 |
| 309 | Ga0163163_10419870 | 3300014325 | Bacteria | 1396 |
| 310 | Ga0163163_10853113 | 3300014325 | Bacteria | 974 |
| 311 | Ga0163163_12490750 | 3300014325 | Bacteria | 575 |
| 312 | Ga0157380_10317983 | 3300014326 | Bacteria | 1442 |
| 313 | Ga0157380_10496596 | 3300014326 | Bacteria | 1184 |
| 314 | Ga0157380_11554064 | 3300014326 | Bacteria | 716 |
| 315 | Ga0157380_12303943 | 3300014326 | Bacteria | 603 |
| 316 | Ga0157380_13022672 | 3300014326 | Bacteria | 536 |
| 317 | Ga0157377_10126329 | 3300014745 | Bacteria | 1556 |
| 318 | Ga0157377_10166573 | 3300014745 | Bacteria | 1375 |
| 319 | Ga0157379_10009261 | 3300014968 | Bacteria | 8574 |
| 320 | Ga0157379_10124714 | 3300014968 | Bacteria | 2317 |
| 321 | Ga0157379_10209281 | 3300014968 | Bacteria | 1765 |
| 322 | Ga0157379_10485205 | 3300014968 | Bacteria | 1144 |
| 323 | Ga0157379_10778462 | 3300014968 | Bacteria | 902 |
| 324 | Ga0157379_10972049 | 3300014968 | Bacteria | 808 |
| 325 | Ga0157376_10089329 | 3300014969 | Bacteria | 2664 |
| 326 | Ga0157376_10099488 | 3300014969 | Bacteria | 2538 |
| 327 | Ga0157376_10846308 | 3300014969 | Bacteria | 930 |
| 328 | Ga0157376_11393293 | 3300014969 | Bacteria | 732 |
| 329 | Ga0157376_11542484 | 3300014969 | Bacteria | 698 |
| 330 | Ga0163161_10006328 | 3300017792 | Bacteria | 8196 |
| 331 | Ga0163161_10098940 | 3300017792 | Bacteria | 2168 |
| 332 | Ga0163161_10483145 | 3300017792 | Bacteria | 1006 |
| 333 | Ga0163161_11712468 | 3300017792 | Bacteria | 557 |
| 334 | Ga0197907_10318291 | 3300020069 | Bacteria | 1359 |
| 335 | Ga0197907_10377945 | 3300020069 | Bacteria | 8513 |
| 336 | Ga0197907_10891275 | 3300020069 | Bacteria | 1108 |
| 337 | Ga0206356_10247586 | 3300020070 | Bacteria | 2138 |
| 338 | Ga0206356_11903330 | 3300020070 | Bacteria | 567 |
| 339 | Ga0206349_1094146 | 3300020075 | Bacteria | 699 |
| 340 | Ga0206349_1431413 | 3300020075 | Bacteria | 546 |
| 341 | Ga0206349_1453397 | 3300020075 | Bacteria | 3920 |
| 342 | Ga0206355_1109688 | 3300020076 | Bacteria | 550 |
| 343 | Ga0206355_1305882 | 3300020076 | Bacteria | 607 |
| 344 | Ga0206355_1410655 | 3300020076 | Bacteria | 555 |
| 345 | Ga0206355_1658075 | 3300020076 | Bacteria | 1344 |
| 346 | Ga0206352_10207358 | 3300020078 | Bacteria | 1492 |
| 347 | Ga0206352_10616844 | 3300020078 | Bacteria | 798 |
| 348 | Ga0206352_10764106 | 3300020078 | Bacteria | 611 |
| 349 | Ga0206350_10688099 | 3300020080 | Bacteria | 837 |
| 350 | Ga0206350_10993920 | 3300020080 | Bacteria | 1143 |
| 351 | Ga0206350_11200745 | 3300020080 | Bacteria | 2647 |
| 352 | Ga0206354_10278938 | 3300020081 | Bacteria | 892 |
| 353 | Ga0206354_10319359 | 3300020081 | Bacteria | 978 |
| 354 | Ga0206353_10692420 | 3300020082 | Bacteria | 797 |
| 355 | Ga0206353_11042006 | 3300020082 | Bacteria | 1115 |
| 356 | Ga0206353_11638776 | 3300020082 | Bacteria | 1648 |
| 357 | Ga0154015_1161714 | 3300020610 | Bacteria | 620 |
| 358 | Ga0213876_10047350 | 3300021384 | Bacteria | 2273 |
| 359 | Ga0213875_10000107 | 3300021388 | Bacteria | 95120 |
| 360 | Ga0213875_10004141 | 3300021388 | Bacteria | 8036 |
| 361 | Ga0224712_10000575 | 3300022467 | Bacteria | 7470 |
| 362 | Ga0256744_130645 | 3300023309 | Bacteria | 584 |
| 363 | Ga0207656_10042243 | 3300025321 | Bacteria | 1939 |
| 364 | Ga0207656_10599072 | 3300025321 | Bacteria | 563 |
| 365 | Ga0207692_10000368 | 3300025898 | Bacteria | 15470 |
| 366 | Ga0207692_10026602 | 3300025898 | Bacteria | 2715 |
| 367 | Ga0207642_10062373 | 3300025899 | Bacteria | 1738 |
| 368 | Ga0207642_10659167 | 3300025899 | Bacteria | 656 |
| 369 | Ga0207642_11045914 | 3300025899 | Bacteria | 527 |
| 370 | Ga0207710_10052355 | 3300025900 | Bacteria | 1835 |
| 371 | Ga0207710_10261847 | 3300025900 | Bacteria | 867 |
| 372 | Ga0207710_10321723 | 3300025900 | Bacteria | 784 |
| 373 | Ga0207710_10439399 | 3300025900 | Bacteria | 673 |
| 374 | Ga0207710_10694480 | 3300025900 | Bacteria | 534 |
| 375 | Ga0207688_10005072 | 3300025901 | Bacteria | 7162 |
| 376 | Ga0207688_10064689 | 3300025901 | Bacteria | 2065 |
| 377 | Ga0207688_10108103 | 3300025901 | Bacteria | 1612 |
| 378 | Ga0207688_10677728 | 3300025901 | Bacteria | 651 |
| 379 | Ga0207688_10784479 | 3300025901 | Bacteria | 604 |
| 380 | Ga0207680_10699813 | 3300025903 | Bacteria | 726 |
| 381 | Ga0207647_10049984 | 3300025904 | Bacteria | 2591 |
| 382 | Ga0207647_10053739 | 3300025904 | Bacteria | 2481 |
| 383 | Ga0207645_10006241 | 3300025907 | Bacteria | 8563 |
| 384 | Ga0207643_10011760 | 3300025908 | Bacteria | 4726 |
| 385 | Ga0207643_10140578 | 3300025908 | Bacteria | 1442 |
| 386 | Ga0207705_10367140 | 3300025909 | Bacteria | 1110 |
| 387 | Ga0207705_11355801 | 3300025909 | Bacteria | 542 |
| 388 | Ga0207654_10300849 | 3300025911 | Bacteria | 1091 |
| 389 | Ga0207654_10522198 | 3300025911 | Bacteria | 841 |
| 390 | Ga0207695_10328126 | 3300025913 | Bacteria | 1419 |
| 391 | Ga0207695_11262625 | 3300025913 | Bacteria | 619 |
| 392 | Ga0207671_10237501 | 3300025914 | Bacteria | 1431 |
| 393 | Ga0207693_10001283 | 3300025915 | Bacteria | 22327 |
| 394 | Ga0207663_10024245 | 3300025916 | Bacteria | 3493 |
| 395 | Ga0207660_10565719 | 3300025917 | Bacteria | 925 |
| 396 | Ga0207662_10009419 | 3300025918 | Bacteria | 5374 |
| 397 | Ga0207662_10026906 | 3300025918 | Bacteria | 3319 |
| 398 | Ga0207662_10221385 | 3300025918 | Bacteria | 1233 |
| 399 | Ga0207662_10574671 | 3300025918 | Bacteria | 782 |
| 400 | Ga0207657_10009138 | 3300025919 | Bacteria | 10001 |
| 401 | Ga0207657_10020254 | 3300025919 | Bacteria | 6292 |
| 402 | Ga0207657_10191592 | 3300025919 | Bacteria | 1649 |
| 403 | Ga0207649_10615582 | 3300025920 | Bacteria | 836 |
| 404 | Ga0207652_10233560 | 3300025921 | Bacteria | 1657 |
| 405 | Ga0207694_10338999 | 3300025924 | Bacteria | 1243 |
| 406 | Ga0207694_10823824 | 3300025924 | Bacteria | 784 |
| 407 | Ga0207694_10982330 | 3300025924 | Bacteria | 714 |
| 408 | Ga0207650_11288285 | 3300025925 | Bacteria | 622 |
| 409 | Ga0207659_11119560 | 3300025926 | Bacteria | 677 |
| 410 | Ga0207687_10345013 | 3300025927 | Bacteria | 1212 |
| 411 | Ga0207687_11784570 | 3300025927 | Bacteria | 527 |
| 412 | Ga0207700_10096353 | 3300025928 | Bacteria | 2349 |
| 413 | Ga0207664_10017195 | 3300025929 | Bacteria | 5296 |
| 414 | Ga0207664_10101806 | 3300025929 | Bacteria | 2374 |
| 415 | Ga0207664_10118147 | 3300025929 | Bacteria | 2215 |
| 416 | Ga0207664_10891636 | 3300025929 | Bacteria | 799 |
| 417 | Ga0207664_11393969 | 3300025929 | Bacteria | 621 |
| 418 | Ga0207644_10001330 | 3300025931 | Bacteria | 15853 |
| 419 | Ga0207644_10331563 | 3300025931 | Bacteria | 1232 |
| 420 | Ga0207644_11418999 | 3300025931 | Bacteria | 583 |
| 421 | Ga0207690_10158621 | 3300025932 | Bacteria | 1684 |
| 422 | Ga0207690_11021612 | 3300025932 | Bacteria | 688 |
| 423 | Ga0207706_10009289 | 3300025933 | Bacteria | 9028 |
| 424 | Ga0207706_10016976 | 3300025933 | Bacteria | 6567 |
| 425 | Ga0207706_10708065 | 3300025933 | Bacteria | 860 |
| 426 | Ga0207686_10223419 | 3300025934 | Bacteria | 1361 |
| 427 | Ga0207686_10262709 | 3300025934 | Bacteria | 1266 |
| 428 | Ga0207709_10052364 | 3300025935 | Bacteria | 2507 |
| 429 | Ga0207709_10537233 | 3300025935 | Bacteria | 918 |
| 430 | Ga0207709_10661350 | 3300025935 | Bacteria | 833 |
| 431 | Ga0207670_10141571 | 3300025936 | Bacteria | 1774 |
| 432 | Ga0207670_10243527 | 3300025936 | Bacteria | 1386 |
| 433 | Ga0207669_10170726 | 3300025937 | Bacteria | 1547 |
| 434 | Ga0207669_10515359 | 3300025937 | Bacteria | 959 |
| 435 | Ga0207669_10520246 | 3300025937 | Bacteria | 955 |
| 436 | Ga0207704_10162306 | 3300025938 | Bacteria | 1592 |
| 437 | Ga0207704_10246965 | 3300025938 | Bacteria | 1337 |
| 438 | Ga0207704_10704071 | 3300025938 | Bacteria | 836 |
| 439 | Ga0207704_11013915 | 3300025938 | Bacteria | 702 |
| 440 | Ga0207665_10006255 | 3300025939 | Bacteria | 7901 |
| 441 | Ga0207665_10485759 | 3300025939 | Bacteria | 952 |
| 442 | Ga0207691_10052644 | 3300025940 | Bacteria | 3718 |
| 443 | Ga0207691_10142827 | 3300025940 | Bacteria | 2108 |
| 444 | Ga0207691_10192161 | 3300025940 | Bacteria | 1780 |
| 445 | Ga0207691_11634433 | 3300025940 | Bacteria | 523 |
| 446 | Ga0207711_10121462 | 3300025941 | Bacteria | 2332 |
| 447 | Ga0207689_10004616 | 3300025942 | Bacteria | 12458 |
| 448 | Ga0207689_10017438 | 3300025942 | Bacteria | 6076 |
| 449 | Ga0207689_11039171 | 3300025942 | Bacteria | 691 |
| 450 | Ga0207689_11040828 | 3300025942 | Bacteria | 690 |
| 451 | Ga0207661_11077097 | 3300025944 | Bacteria | 740 |
| 452 | Ga0207661_11845377 | 3300025944 | Bacteria | 550 |
| 453 | Ga0207679_10173702 | 3300025945 | Bacteria | 1776 |
| 454 | Ga0207679_10541878 | 3300025945 | Bacteria | 1043 |
| 455 | Ga0207679_11153116 | 3300025945 | Bacteria | 711 |
| 456 | Ga0207667_10342259 | 3300025949 | Bacteria | 1526 |
| 457 | Ga0207667_10419184 | 3300025949 | Bacteria | 1362 |
| 458 | Ga0207667_11466013 | 3300025949 | Bacteria | 654 |
| 459 | Ga0207651_10242789 | 3300025960 | Bacteria | 1469 |
| 460 | Ga0207712_10000797 | 3300025961 | Bacteria | 23298 |
| 461 | Ga0207712_10329245 | 3300025961 | Bacteria | 1263 |
| 462 | Ga0207712_10527653 | 3300025961 | Bacteria | 1013 |
| 463 | Ga0207668_10061079 | 3300025972 | Bacteria | 2648 |
| 464 | Ga0207668_10143504 | 3300025972 | Bacteria | 1839 |
| 465 | Ga0207668_10164948 | 3300025972 | Bacteria | 1731 |
| 466 | Ga0207668_10392781 | 3300025972 | Bacteria | 1171 |
| 467 | Ga0207668_10877481 | 3300025972 | Bacteria | 797 |
| 468 | Ga0207640_10030986 | 3300025981 | Bacteria | 3300 |
| 469 | Ga0207640_10461675 | 3300025981 | Bacteria | 1049 |
| 470 | Ga0207658_10139424 | 3300025986 | Bacteria | 1960 |
| 471 | Ga0207658_10256438 | 3300025986 | Bacteria | 1488 |
| 472 | Ga0207677_10122095 | 3300026023 | Bacteria | 1962 |
| 473 | Ga0207677_10378368 | 3300026023 | Bacteria | 1194 |
| 474 | Ga0207677_10420102 | 3300026023 | Bacteria | 1139 |
| 475 | Ga0207677_10440473 | 3300026023 | Bacteria | 1114 |
| 476 | Ga0207677_10599610 | 3300026023 | Bacteria | 966 |
| 477 | Ga0207703_10189049 | 3300026035 | Bacteria | 1822 |
| 478 | Ga0207703_10877884 | 3300026035 | Bacteria | 858 |
| 479 | Ga0207639_10617818 | 3300026041 | Bacteria | 1000 |
| 480 | Ga0207678_10009664 | 3300026067 | Bacteria | 8483 |
| 481 | Ga0207678_10022601 | 3300026067 | Bacteria | 5508 |
| 482 | Ga0207678_10233078 | 3300026067 | Bacteria | 1576 |
| 483 | Ga0207678_10514768 | 3300026067 | Bacteria | 1044 |
| 484 | Ga0207678_10670754 | 3300026067 | Bacteria | 911 |
| 485 | Ga0207678_11673007 | 3300026067 | Bacteria | 559 |
| 486 | Ga0207708_10015459 | 3300026075 | Bacteria | 5724 |
| 487 | Ga0207708_10171226 | 3300026075 | Bacteria | 1720 |
| 488 | Ga0207708_10273447 | 3300026075 | Bacteria | 1367 |
| 489 | Ga0207708_11584261 | 3300026075 | Bacteria | 576 |
| 490 | Ga0207708_12006805 | 3300026075 | Bacteria | 506 |
| 491 | Ga0207641_10003356 | 3300026088 | Bacteria | 14232 |
| 492 | Ga0207641_10071941 | 3300026088 | Bacteria | 2977 |
| 493 | Ga0207641_10141048 | 3300026088 | Bacteria | 2174 |
| 494 | Ga0207641_10395647 | 3300026088 | Bacteria | 1326 |
| 495 | Ga0207648_10008491 | 3300026089 | Bacteria | 9939 |
| 496 | Ga0207648_10093298 | 3300026089 | Bacteria | 2632 |
| 497 | Ga0207648_11032099 | 3300026089 | Bacteria | 770 |
| 498 | Ga0207648_11479571 | 3300026089 | Bacteria | 638 |
| 499 | Ga0207676_10624231 | 3300026095 | Bacteria | 1037 |
| 500 | Ga0207676_10871869 | 3300026095 | Bacteria | 881 |
| 501 | Ga0207676_10981772 | 3300026095 | Bacteria | 831 |
| 502 | Ga0207676_11692555 | 3300026095 | Bacteria | 631 |
| 503 | Ga0207674_10011658 | 3300026116 | Bacteria | 9870 |
| 504 | Ga0207675_100012489 | 3300026118 | Bacteria | 7934 |
| 505 | Ga0207675_100014683 | 3300026118 | Bacteria | 7303 |
| 506 | Ga0207675_100251858 | 3300026118 | Bacteria | 1709 |
| 507 | Ga0207675_102211584 | 3300026118 | Bacteria | 565 |
| 508 | Ga0207683_10004908 | 3300026121 | Bacteria | 11507 |
| 509 | Ga0207683_10030091 | 3300026121 | Bacteria | 4703 |
| 510 | Ga0207683_10106701 | 3300026121 | Bacteria | 2505 |
| 511 | Ga0207683_10109837 | 3300026121 | Bacteria | 2469 |
| 512 | Ga0207683_10626278 | 3300026121 | Bacteria | 996 |
| 513 | Ga0207698_10174299 | 3300026142 | Bacteria | 1897 |
| 514 | Ga0207698_10246185 | 3300026142 | Bacteria | 1633 |
| 515 | Ga0207698_10922821 | 3300026142 | Bacteria | 881 |
| 516 | Ga0207698_11123404 | 3300026142 | Bacteria | 799 |
| 517 | Ga0207428_10134227 | 3300027907 | Bacteria | 1893 |
| 518 | Ga0268266_10084776 | 3300028379 | Bacteria | 2767 |
| 519 | Ga0268266_10149683 | 3300028379 | Bacteria | 2102 |
| 520 | Ga0268266_10376558 | 3300028379 | Bacteria | 1338 |
| 521 | Ga0268266_10498807 | 3300028379 | Bacteria | 1162 |
| 522 | Ga0268266_10636863 | 3300028379 | Bacteria | 1025 |
| 523 | Ga0268266_11094681 | 3300028379 | Bacteria | 771 |
| 524 | Ga0268265_10028281 | 3300028380 | Bacteria | 4013 |
| 525 | Ga0268265_10197645 | 3300028380 | Bacteria | 1741 |
| 526 | Ga0268265_10511968 | 3300028380 | Bacteria | 1133 |
| 527 | Ga0268264_10034736 | 3300028381 | Bacteria | 4149 |
| 528 | Ga0268264_10156370 | 3300028381 | Bacteria | 2049 |
| 529 | Ga0268264_10816641 | 3300028381 | Bacteria | 932 |
| 530 | Ga0311003_163444 | 3300029282 | Bacteria | 745 |
| 531 | Ga0310981_1042594 | 3300029285 | Bacteria | 589 |
| 532 | Ga0307512_10008844 | 3300030522 | Bacteria | 9767 |
| 533 | Ga0316177_1073951 | 3300030731 | Bacteria | 3186 |
| 534 | Ga0316176_1154284 | 3300030732 | Bacteria | 5987 |
| 535 | Ga0314311_1038188 | 3300030733 | Bacteria | 3616 |
| 536 | Ga0316178_1145984 | 3300030735 | Bacteria | 1300 |
| 537 | Ga0316180_1057786 | 3300030736 | Bacteria | 2888 |
| 538 | Ga0316183_1025727 | 3300030742 | Bacteria | 745 |
| 539 | Ga0316181_1255392 | 3300030744 | Bacteria | 1806 |
| 540 | Ga0316182_1026960 | 3300030745 | Bacteria | 1903 |
| 541 | Ga0265327_10000165 | 3300031251 | Bacteria | 142199 |
| 542 | Ga0307513_10001540 | 3300031456 | Bacteria | 33040 |
| 543 | Ga0307509_10170317 | 3300031507 | Bacteria | 2058 |
| 544 | Ga0307405_10290907 | 3300031731 | Bacteria | 1235 |
| 545 | Ga0307413_10000820 | 3300031824 | Bacteria | 10858 |
| 546 | Ga0307410_10244890 | 3300031852 | Bacteria | 1391 |
| 547 | Ga0307410_10728701 | 3300031852 | Bacteria | 838 |
| 548 | Ga0307409_100461078 | 3300031995 | Bacteria | 1229 |
| 549 | Ga0307409_100953740 | 3300031995 | Bacteria | 874 |
| 550 | Ga0307409_100958551 | 3300031995 | Bacteria | 872 |
| 551 | Ga0307416_102353550 | 3300032002 | Bacteria | 633 |
| 552 | Ga0307411_11601520 | 3300032005 | Bacteria | 601 |
| 553 | Ga0307415_101836880 | 3300032126 | Bacteria | 587 |
| 554 | Ga0373950_0005642 | 3300034818 | Bacteria | 1877 |
| 555 | Ga0373938_0044535 | 3300034957 | Bacteria | 996 |
| 556 | Ga0373938_0092571 | 3300034957 | Bacteria | 750 |
| 557 | Ga0373929_0003284 | 3300035085 | Bacteria | 2924 |
| 558 | Ga0373940_0208121 | 3300035088 | Bacteria | 645 |
| 559 | Ga0373949_0021905 | 3300035090 | Bacteria | 1470 |
| 560 | Ga0373952_0011882 | 3300035092 | Bacteria | 1705 |
| 561 | Ga0373932_0007943 | 3300035112 | Bacteria | 2533 |
| 562 | Ga0373939_0002935 | 3300035114 | Bacteria | 4010 |
| 563 | Ga0373939_0205135 | 3300035114 | Bacteria | 747 |
| 564 | Ga0373941_0109602 | 3300035115 | Bacteria | 972 |
| 565 | Ga0373956_0470657 | 3300035119 | Bacteria | 600 |
| 566 | Ga0373960_0029968 | 3300035121 | Bacteria | 1512 |
| 567 | Ga0373943_0450553 | 3300035170 | Bacteria | 748 |
| 568 | Ga0373946_0229974 | 3300035171 | Bacteria | 898 |
| 569 | Ga0373942_0133563 | 3300035207 | Bacteria | 785 |
| 570 | Ga0373962_0003137 | 3300035242 | Bacteria | 3960 |
| 571 | Ga0373931_0015456 | 3300035691 | Bacteria | 3744 |
| 572 | Ga0373931_0028935 | 3300035691 | Bacteria | 2841 |
| 573 | Ga0373931_0493988 | 3300035691 | Bacteria | 788 |
| 574 | Ga0373927_1164312 | 3300035695 | Bacteria | 509 |
| 575 | Ga0373937_1727270 | 3300036401 | Bacteria | 573 |
| 576 | Ga0373925_0657368 | 3300037068 | Bacteria | 864 |
| 577 | Ga0373925_1195037 | 3300037068 | Bacteria | 625 |
| 578 | Ga0395905_0135257 | 3300037471 | Bacteria | 2319 |
| 579 | Ga0436364_0010700 | 3300037853 | Bacteria | 115369 |
| 580 | Ga0436364_0184253 | 3300037853 | Bacteria | 13885 |
| 581 | Ga0436364_0588322 | 3300037853 | Bacteria | 80195 |
| 582 | Ga0395901_1254022 | 3300038443 | Bacteria | 705 |
| 583 | Ga0436365_1725899 | 3300039437 | Bacteria | 6330 |
| 584 | Ga0436363_0697187 | 3300039450 | Bacteria | 1378 |
| 585 | Ga0436362_0313342 | 3300039453 | Bacteria | 734 |
| 586 | Ga0436362_0494804 | 3300039453 | Bacteria | 733 |
| 587 | Ga0439465_0435241 | 3300041413 | Bacteria | 502 |
| 588 | Ga0451787_757127 | 3300041441 | Bacteria | 619 |
| 589 | Ga0451789_0054430 | 3300041443 | Bacteria | 837 |
| 590 | Ga0451794_14393 | 3300041446 | Bacteria | 994 |
| 591 | Ga0451794_55151 | 3300041446 | Bacteria | 522 |
| 592 | Ga0451791_1065158 | 3300041451 | Bacteria | 2248 |
| 593 | Ga0451791_1865944 | 3300041451 | Bacteria | 670 |
| 594 | Ga0451793_0363264 | 3300041452 | Bacteria | 625 |
| 595 | Ga0451793_0871455 | 3300041452 | Bacteria | 1734 |
| 596 | Ga0451797_1382881 | 3300041453 | Bacteria | 1974 |
| 597 | Ga0451797_1384890 | 3300041453 | Bacteria | 631 |
| 598 | Ga0451801_11751 | 3300041455 | Bacteria | 531 |
| 599 | Ga0451798_0190825 | 3300041458 | Bacteria | 709 |
| 600 | Ga0451800_1390558 | 3300041459 | Bacteria | 1743 |
| 601 | Ga0451807_1654378 | 3300041486 | Bacteria | 1644 |
| 602 | Ga0451837_0550193 | 3300041494 | Bacteria | 2300 |
| 603 | Ga0451839_1054739 | 3300041496 | Bacteria | 537 |
| 604 | Ga0451841_1228666 | 3300041498 | Bacteria | 1783 |
| 605 | Ga0451845_0146963 | 3300041501 | Bacteria | 571 |
| 606 | Ga0451849_0017685 | 3300041505 | Bacteria | 543 |
| 607 | Ga0451851_1177781 | 3300041507 | Bacteria | 543 |
| 608 | Ga0451855_1627071 | 3300041511 | Bacteria | 984 |
| 609 | Ga0451853_1554167 | 3300041512 | Bacteria | 2526 |
| 610 | Ga0439442_046897 | 3300042002 | Bacteria | 910 |
| 611 | Ga0439445_0148492 | 3300042004 | Bacteria | 682 |
| 612 | Ga0439448_0079846 | 3300042005 | Bacteria | 1098 |
| 613 | Ga0439450_171774 | 3300042008 | Bacteria | 574 |
| 614 | Ga0439463_031098 | 3300042016 | Bacteria | 1347 |
| 615 | Ga0439463_129239 | 3300042016 | Bacteria | 654 |
| 616 | Ga0466972_0007279 | 3300044658 | Bacteria | 5557 |
| 617 | Ga0466972_0585810 | 3300044658 | Bacteria | 527 |
| 618 | Ga0466965_0007902 | 3300044683 | Bacteria | 4906 |
| 619 | Ga0466965_0033398 | 3300044683 | Bacteria | 2514 |
| 620 | Ga0466965_0294538 | 3300044683 | Bacteria | 879 |
| 621 | Ga0466966_0000383 | 3300044684 | Bacteria | 28757 |
| 622 | Ga0466961_0054451 | 3300044693 | Bacteria | 2552 |
| 623 | Ga0466963_0009016 | 3300044694 | Bacteria | 5991 |
| 624 | Ga0466963_0320336 | 3300044694 | Bacteria | 1091 |
| 625 | Ga0466963_0681869 | 3300044694 | Bacteria | 725 |
| 626 | Ga0466964_0270334 | 3300044706 | Bacteria | 846 |
| 627 | Ga0466964_0326363 | 3300044706 | Bacteria | 781 |
| 628 | Ga0466971_0009870 | 3300044719 | Bacteria | 4169 |
| 629 | Ga0466971_0422736 | 3300044719 | Bacteria | 651 |
| 630 | Ga0466968_0000486 | 3300044735 | Bacteria | 13428 |
| 631 | Ga0466968_0026217 | 3300044735 | Bacteria | 2391 |
| 632 | Ga0466968_0030625 | 3300044735 | Bacteria | 2229 |
| 633 | Ga0466970_0021508 | 3300044765 | Bacteria | 3359 |
| 634 | Ga0466957_0009243 | 3300044842 | Bacteria | 5623 |
| 635 | Ga0466960_0003887 | 3300044901 | Bacteria | 5793 |
| 636 | Ga0466960_0007532 | 3300044901 | Bacteria | 4427 |
| 637 | Ga0466960_0834377 | 3300044901 | Bacteria | 559 |
| 638 | Ga0466959_0017822 | 3300045049 | Bacteria | 5209 |
| 639 | Ga0466959_0461104 | 3300045049 | Bacteria | 861 |
| 640 | Ga0466958_0000206 | 3300045836 | Bacteria | 21886 |
| 641 | Ga0466958_0057813 | 3300045836 | Bacteria | 2357 |
| 642 | Ga0466958_0334773 | 3300045836 | Bacteria | 974 |
| 643 | Ga0466958_0459816 | 3300045836 | Bacteria | 824 |
| 644 | Ga0466967_0048690 | 3300045976 | Bacteria | 3703 |
| 645 | Ga0466967_0082652 | 3300045976 | Bacteria | 2903 |
| 646 | Ga0466967_1063197 | 3300045976 | Bacteria | 806 |
| 647 | Ga0466967_1184008 | 3300045976 | Bacteria | 761 |
| 648 | Ga0466967_2059600 | 3300045976 | Bacteria | 567 |
| 649 | Ga0495592_0409566 | 3300046454 | Bacteria | 857 |
| 650 | Ga0495603_0133889 | 3300046455 | Bacteria | 1443 |
| 651 | Ga0495629_0152338 | 3300046459 | Bacteria | 1607 |
| 652 | Ga0495629_0501630 | 3300046459 | Bacteria | 818 |
| 653 | Ga0495629_0976300 | 3300046459 | Bacteria | 552 |
| 654 | Ga0495641_0097610 | 3300046461 | Bacteria | 1311 |
| 655 | Ga0495641_0112967 | 3300046461 | Bacteria | 1212 |
| 656 | Ga0495651_0507553 | 3300046462 | Bacteria | 771 |
| 657 | Ga0495653_0426913 | 3300046463 | Bacteria | 838 |
| 658 | Ga0495653_0586206 | 3300046463 | Bacteria | 687 |
| 659 | Ga0495650_0271392 | 3300046471 | Bacteria | 573 |
| 660 | Ga0495594_0727285 | 3300046499 | Bacteria | 561 |
| 661 | Ga0495596_0130294 | 3300046500 | Bacteria | 976 |
| 662 | Ga0495607_0159700 | 3300046501 | Bacteria | 1146 |
| 663 | Ga0495606_0237907 | 3300046507 | Bacteria | 1017 |
| 664 | Ga0495608_0361634 | 3300046511 | Bacteria | 892 |
| 665 | Ga0495608_0385480 | 3300046511 | Bacteria | 859 |
| 666 | Ga0495620_0095563 | 3300046515 | Bacteria | 1189 |
| 667 | Ga0495620_0240301 | 3300046515 | Bacteria | 691 |
| 668 | Ga0495628_0197758 | 3300046516 | Bacteria | 1516 |
| 669 | Ga0495630_0270915 | 3300046517 | Bacteria | 1297 |
| 670 | Ga0495643_0373764 | 3300046522 | Bacteria | 634 |
| 671 | Ga0495666_0465691 | 3300046526 | Bacteria | 566 |
| 672 | Ga0495665_0121367 | 3300046531 | Bacteria | 1369 |
| 673 | Ga0495640_0330009 | 3300046533 | Bacteria | 944 |
| 674 | Ga0495586_0296082 | 3300046535 | Bacteria | 927 |
| 675 | Ga0495598_0048912 | 3300046537 | Bacteria | 1266 |
| 676 | Ga0495667_0248101 | 3300046559 | Bacteria | 1133 |
| 677 | Ga0495634_0303502 | 3300046642 | Bacteria | 965 |
| 678 | Ga0495635_0576459 | 3300046663 | Bacteria | 736 |
| 679 | Ga0495635_0812716 | 3300046663 | Bacteria | 602 |
| 680 | Ga0495588_0125822 | 3300046674 | Bacteria | 1352 |
| 681 | Ga0495657_0311003 | 3300046675 | Bacteria | 938 |
| 682 | Ga0495657_0572344 | 3300046675 | Bacteria | 655 |
| 683 | Ga0495599_0113565 | 3300046678 | Bacteria | 1686 |
| 684 | Ga0495646_0139571 | 3300046680 | Bacteria | 1356 |
| 685 | Ga0495647_0464116 | 3300046681 | Bacteria | 587 |
| 686 | Ga0495613_0503077 | 3300046689 | Bacteria | 816 |
| 687 | Ga0495624_0169708 | 3300046690 | Bacteria | 1331 |
| 688 | Ga0495649_0376587 | 3300046694 | Bacteria | 715 |
| 689 | Ga0495581_0119575 | 3300047315 | Bacteria | 1533 |
| 690 | Ga0495604_0481382 | 3300047317 | Bacteria | 807 |
| 691 | Ga0495676_0985966 | 3300047321 | Bacteria | 538 |
| 692 | Ga0495680_0081426 | 3300047322 | Bacteria | 2444 |
| 693 | Ga0495680_0452336 | 3300047322 | Bacteria | 879 |
| 694 | Ga0495680_0694450 | 3300047322 | Bacteria | 673 |
| 695 | Ga0495683_0003613 | 3300047323 | Bacteria | 8973 |
| 696 | Ga0495683_0423570 | 3300047323 | Bacteria | 550 |
| 697 | Ga0495593_0053150 | 3300047673 | Bacteria | 2138 |
| 698 | Ga0495614_0147013 | 3300048089 | Bacteria | 1050 |
| 699 | Ga0495614_0235608 | 3300048089 | Bacteria | 835 |
| 700 | Ga0496100_0002817 | 3300048903 | Bacteria | 8915 |
| 701 | Ga0496100_0046841 | 3300048903 | Bacteria | 2783 |
| 702 | Ga0496100_0329159 | 3300048903 | Bacteria | 1149 |
| 703 | Ga0496100_0374454 | 3300048903 | Bacteria | 1080 |
| 704 | Ga0496100_0418445 | 3300048903 | Bacteria | 1023 |
| 705 | Ga0496101_0019981 | 3300048904 | Bacteria | 4580 |
| 706 | Ga0496101_0091947 | 3300048904 | Bacteria | 2258 |
| 707 | Ga0496101_0153999 | 3300048904 | Bacteria | 1759 |
| 708 | Ga0496101_0275312 | 3300048904 | Bacteria | 1314 |
| 709 | Ga0496101_0278475 | 3300048904 | Bacteria | 1307 |
| 710 | Ga0496101_0927603 | 3300048904 | Bacteria | 685 |
| 711 | Ga0496102_0000521 | 3300048905 | Bacteria | 41977 |
| 712 | Ga0496102_0132676 | 3300048905 | Bacteria | 2332 |
| 713 | Ga0496102_0174227 | 3300048905 | Bacteria | 2025 |
| 714 | Ga0496102_0600891 | 3300048905 | Bacteria | 1023 |
| 715 | Ga0496103_0000453 | 3300048906 | Bacteria | 34950 |
| 716 | Ga0496103_0104531 | 3300048906 | Bacteria | 1795 |
| 717 | Ga0496103_0169432 | 3300048906 | Bacteria | 1402 |
| 718 | Ga0496103_0278591 | 3300048906 | Bacteria | 1076 |
| 719 | Ga0496104_0004123 | 3300048907 | Bacteria | 12619 |
| 720 | Ga0496104_0011710 | 3300048907 | Bacteria | 7867 |
| 721 | Ga0496104_0082973 | 3300048907 | Bacteria | 3057 |
| 722 | Ga0496104_0283996 | 3300048907 | Bacteria | 1568 |
| 723 | Ga0496104_0373568 | 3300048907 | Bacteria | 1338 |
| 724 | Ga0496105_0037579 | 3300048908 | Bacteria | 3987 |
| 725 | Ga0496105_0128707 | 3300048908 | Bacteria | 2088 |
| 726 | Ga0496105_0275374 | 3300048908 | Bacteria | 1358 |
| 727 | Ga0496105_0380333 | 3300048908 | Bacteria | 1123 |
| 728 | Ga0496106_0098087 | 3300048909 | Bacteria | 2270 |
| 729 | Ga0496106_0132106 | 3300048909 | Bacteria | 1958 |
| 730 | Ga0496106_0376036 | 3300048909 | Bacteria | 1142 |
| 731 | Ga0496106_0749813 | 3300048909 | Bacteria | 776 |
| 732 | Ga0496106_1487203 | 3300048909 | Bacteria | 521 |
| 733 | Ga0496107_0519136 | 3300048910 | Bacteria | 883 |
| 734 | Ga0496107_0727678 | 3300048910 | Bacteria | 729 |
| 735 | Ga0496107_1198345 | 3300048910 | Bacteria | 546 |
| 736 | Ga0496108_0075461 | 3300048911 | Bacteria | 2848 |
| 737 | Ga0496108_0103562 | 3300048911 | Bacteria | 2428 |
| 738 | Ga0496108_0112101 | 3300048911 | Bacteria | 2333 |
| 739 | Ga0496108_0128186 | 3300048911 | Bacteria | 2180 |
| 740 | Ga0496108_0849852 | 3300048911 | Bacteria | 785 |
| 741 | Ga0496109_0008622 | 3300048912 | Bacteria | 8680 |
| 742 | Ga0496109_0049417 | 3300048912 | Bacteria | 3828 |
| 743 | Ga0496109_0162421 | 3300048912 | Bacteria | 2093 |
| 744 | Ga0496109_0368258 | 3300048912 | Bacteria | 1357 |
| 745 | Ga0496109_0441050 | 3300048912 | Bacteria | 1230 |
| 746 | Ga0496109_0629980 | 3300048912 | Bacteria | 1009 |
| 747 | Ga0496109_0658037 | 3300048912 | Bacteria | 984 |
| 748 | Ga0496109_1357651 | 3300048912 | Bacteria | 646 |
| 749 | Ga0496110_0004143 | 3300048913 | Bacteria | 11207 |
| 750 | Ga0496110_0110005 | 3300048913 | Bacteria | 2475 |
| 751 | Ga0496110_0331538 | 3300048913 | Bacteria | 1386 |
| 752 | Ga0496110_0645854 | 3300048913 | Bacteria | 958 |
| 753 | Ga0496110_0883779 | 3300048913 | Bacteria | 799 |
| 754 | Ga0496110_1393355 | 3300048913 | Bacteria | 610 |
| 755 | Ga0496111_0000712 | 3300048914 | Bacteria | 17656 |
| 756 | Ga0496111_0210201 | 3300048914 | Bacteria | 1445 |
| 757 | Ga0496111_0298442 | 3300048914 | Bacteria | 1194 |
| 758 | Ga0496111_0839625 | 3300048914 | Bacteria | 663 |
| 759 | Ga0496112_0072471 | 3300048915 | Bacteria | 3405 |
| 760 | Ga0496112_0162970 | 3300048915 | Bacteria | 2196 |
| 761 | Ga0496112_0723686 | 3300048915 | Bacteria | 922 |
| 762 | Ga0496113_0087743 | 3300048916 | Bacteria | 2392 |
| 763 | Ga0496113_0252450 | 3300048916 | Bacteria | 1408 |
| 764 | Ga0496114_0007373 | 3300048917 | Bacteria | 8689 |
| 765 | Ga0496114_0014309 | 3300048917 | Bacteria | 6365 |
| 766 | Ga0496114_0051545 | 3300048917 | Bacteria | 3426 |
| 767 | Ga0496114_0193477 | 3300048917 | Bacteria | 1780 |
| 768 | Ga0496114_0320915 | 3300048917 | Bacteria | 1368 |
| 769 | Ga0496114_0386795 | 3300048917 | Bacteria | 1239 |
| 770 | Ga0496114_0719552 | 3300048917 | Bacteria | 874 |
| 771 | Ga0496115_0006695 | 3300048918 | Bacteria | 8450 |
| 772 | Ga0496115_0047273 | 3300048918 | Bacteria | 3441 |
| 773 | Ga0496115_0166871 | 3300048918 | Bacteria | 1821 |
| 774 | Ga0496116_0000173 | 3300048919 | Bacteria | 129928 |
| 775 | Ga0496117_0000144 | 3300048920 | Bacteria | 153831 |
| 776 | Ga0496118_0000096 | 3300048921 | Bacteria | 163988 |
| 777 | Ga0496119_0003189 | 3300048922 | Bacteria | 17184 |
| 778 | Ga0496120_0004033 | 3300048923 | Bacteria | 12732 |
| 779 | Ga0496121_0005885 | 3300048924 | Bacteria | 15525 |
| 780 | Ga0496122_0175033 | 3300048925 | Bacteria | 1288 |
| 781 | Ga0496124_0003352 | 3300048927 | Bacteria | 19709 |
| 782 | Ga0496125_0011762 | 3300048928 | Bacteria | 8722 |
| 783 | Ga0496126_0000330 | 3300048929 | Bacteria | 101064 |
| 784 | Ga0501304_015291 | 3300049160 | Bacteria | 718 |
| 785 | Ga0501307_020577 | 3300049162 | Bacteria | 854 |
| 786 | Ga0501311_055393 | 3300049527 | Bacteria | 630 |
| 787 | Ga0501314_001516 | 3300049530 | Bacteria | 1690 |
| 788 | Ga0501315_001744 | 3300049531 | Bacteria | 1930 |
| 789 | Ga0501317_000360 | 3300049533 | Bacteria | 3067 |
| 790 | Ga0501317_049713 | 3300049533 | Bacteria | 663 |
| 791 | Ga0501318_001561 | 3300049534 | Bacteria | 1831 |
| 792 | Ga0501318_010783 | 3300049534 | Bacteria | 1021 |
| 793 | Ga0501318_078349 | 3300049534 | Bacteria | 532 |
| 794 | Ga0501322_000741 | 3300049538 | Bacteria | 1640 |
| 795 | Ga0501325_018505 | 3300049541 | Bacteria | 714 |
| 796 | Ga0501036_1647155 | 3300049572 | Bacteria | 518 |
| 797 | Ga0501047_0989925 | 3300049581 | Bacteria | 654 |
| 798 | Ga0501071_0933851 | 3300049587 | Bacteria | 670 |
| 799 | Ga0501079_0443133 | 3300049741 | Bacteria | 1020 |
| 800 | Ga0501045_0427182 | 3300049824 | Bacteria | 986 |
| 801 | nmdc:mga09592_585309_c1 | 3300050508 | Bacteria | 957 |
| 802 | nmdc:mga0qj67_612112_c1 | 3300050509 | Bacteria | 871 |
| 803 | nmdc:mga06r32_136_c2 | 3300050510 | Bacteria | 3241 |
| 804 | nmdc:mga08y16_580270_c1 | 3300050511 | Bacteria | 1132 |
| 805 | nmdc:mga0n895_1035878_c1 | 3300050512 | Bacteria | 800 |
| 806 | nmdc:mga0n895_505221_c1 | 3300050512 | Bacteria | 1218 |
| 807 | nmdc:mga0rr50_61245_c1 | 3300050513 | Bacteria | 2835 |
| 808 | nmdc:mga0a205_19433_c1 | 3300050515 | Bacteria | 6404 |
| 809 | nmdc:mga0a205_594190_c1 | 3300050515 | Bacteria | 960 |
| 810 | nmdc:mga0a205_791190_c1 | 3300050515 | Bacteria | 796 |
| 811 | Ga0495601_0227312 | 3300053077 | Bacteria | 1219 |
| 812 | Ga0495601_0886511 | 3300053077 | Bacteria | 564 |
| 813 | Ga0495655_0097996 | 3300053083 | Bacteria | 864 |
| 814 | Ga0495619_0005374 | 3300053085 | Bacteria | 8112 |
| 815 | Ga0495619_0258467 | 3300053085 | Bacteria | 1207 |
| 816 | Ga0495619_0338314 | 3300053085 | Bacteria | 1042 |
| 817 | Ga0500643_061101 | 3300053087 | Bacteria | 1058 |
| 818 | Ga0500577_0001143 | 3300053142 | Bacteria | 6808 |
| 819 | Ga0590074_107646 | 3300059423 | Bacteria | 548 |
| 820 | Ga0587084_042301 | 3300059477 | Bacteria | 779 |
| 821 | Ga0587066_041351 | 3300059490 | Bacteria | 870 |
| 822 | Ga0587066_105837 | 3300059490 | Bacteria | 646 |
| 823 | Ga0587070_060091 | 3300059491 | Bacteria | 783 |
| 824 | Ga0587070_151233 | 3300059491 | Bacteria | 582 |
| 825 | Ga0587077_088052 | 3300059493 | Bacteria | 725 |
| 826 | Ga0587080_029292 | 3300059503 | Bacteria | 950 |
| 827 | Ga0587082_126319 | 3300059504 | Bacteria | 583 |
| 828 | Ga0587082_145273 | 3300059504 | Bacteria | 557 |
| 829 | Ga0587083_0048673 | 3300059505 | Bacteria | 916 |
| 830 | Ga0587083_0116247 | 3300059505 | Bacteria | 686 |
| 831 | Ga0587083_0127328 | 3300059505 | Bacteria | 665 |
| 832 | Ga0587085_003511 | 3300059506 | Bacteria | 1710 |
| 833 | Ga0587085_129987 | 3300059506 | Bacteria | 562 |
| 834 | Ga0587088_041584 | 3300059508 | Bacteria | 868 |
| 835 | Ga0587088_054133 | 3300059508 | Bacteria | 795 |
| 836 | Ga0587088_065079 | 3300059508 | Bacteria | 748 |
| 837 | Ga0587090_102412 | 3300059510 | Bacteria | 601 |
| 838 | Ga0587091_177986 | 3300059511 | Bacteria | 558 |
| 839 | Ga0587098_018155 | 3300059604 | Bacteria | 869 |
| 840 | Ga0587125_014288 | 3300059607 | Bacteria | 867 |
| 841 | Ga0587099_019046 | 3300059622 | Bacteria | 762 |
| 842 | Ga0587101_103658 | 3300059623 | Bacteria | 569 |
| 843 | Ga0587109_173845 | 3300059624 | Bacteria | 546 |
| 844 | Ga0587113_041675 | 3300059625 | Bacteria | 551 |
| 845 | Ga0587115_051297 | 3300059626 | Bacteria | 671 |
| 846 | Ga0587117_095107 | 3300059627 | Bacteria | 561 |
| 847 | Ga0587128_107440 | 3300059630 | Bacteria | 592 |
| 848 | Ga0587067_018634 | 3300059640 | Bacteria | 1167 |
| 849 | Ga0587067_146302 | 3300059640 | Bacteria | 590 |
| 850 | Ga0587067_166836 | 3300059640 | Bacteria | 564 |
| 851 | Ga0587068_138276 | 3300059641 | Bacteria | 542 |
| 852 | Ga0587069_036468 | 3300059642 | Bacteria | 820 |
| 853 | Ga0587072_029483 | 3300059643 | Bacteria | 1018 |
| 854 | Ga0587072_070733 | 3300059643 | Bacteria | 736 |
| 855 | Ga0587072_075794 | 3300059643 | Bacteria | 718 |
| 856 | Ga0587075_110658 | 3300059644 | Bacteria | 558 |
| 857 | Ga0587078_046642 | 3300059646 | Bacteria | 626 |
| 858 | Ga0587079_198710 | 3300059647 | Bacteria | 546 |
| 859 | Ga0587100_021312 | 3300059648 | Bacteria | 634 |
| 860 | Ga0587107_051389 | 3300059652 | Bacteria | 700 |
| 861 | Ga0587071_038380 | 3300060344 | Bacteria | 951 |
| 862 | Ga0587111_0094380 | 3300060346 | Bacteria | 736 |
| 863 | Ga0466962_0003094 | 3300061719 | Bacteria | 7915 |
| 864 | Ga0466962_0755373 | 3300061719 | Bacteria | 500 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0047273 | Ga0496115_0047273_332_706 | 97 |
| 2 | iso_pu_bacteria | 2547132424 | 2548693158 | 100 |
| 3 | iso_pu_bacteria | 2585427649 | 2586064538 | 100 |
| 4 | iso_pu_bacteria | 2744054611 | 2744956957 | 100 |
| 5 | iso_pu_bacteria | 2791354901 | 2791913116 | 100 |
| 6 | iso_pu_bacteria | 2795385472 | 2795795475 | 100 |
| 7 | iso_pu_bacteria | 2808606522 | 2809586234 | 100 |
| 8 | iso_pu_bacteria | 2816332139 | 2816505570 | 100 |
| 9 | iso_pu_bacteria | 2831935698 | 2831941114 | 100 |
| 10 | iso_pu_bacteria | 2832004796 | 2832006205 | 100 |
| 11 | iso_pu_bacteria | 2855676851 | 2855681679 | 100 |
| 12 | iso_pu_bacteria | 2855683550 | 2855684520 | 100 |
| 13 | iso_pu_bacteria | 2856858025 | 2856858865 | 100 |
| 14 | iso_pu_bacteria | 2858848962 | 2858850644 | 100 |
| 15 | iso_pu_bacteria | 2858868258 | 2858875148 | 100 |
| 16 | iso_pu_bacteria | 2858882152 | 2858888059 | 100 |
| 17 | iso_pu_bacteria | 2858888857 | 2858890989 | 100 |
| 18 | iso_pu_bacteria | 2858895516 | 2858897632 | 100 |
| 19 | iso_pu_bacteria | 2866065130 | 2866068642 | 100 |
| 20 | iso_pu_bacteria | 2866612099 | 2866617072 | 100 |
| 21 | iso_pu_bacteria | 2867302475 | 2867307164 | 100 |
| 22 | iso_pu_bacteria | 2869048445 | 2869050058 | 100 |
| 23 | iso_pu_bacteria | 2869061728 | 2869063912 | 100 |
| 24 | iso_pu_bacteria | 2869068681 | 2869071866 | 100 |
| 25 | iso_pu_bacteria | 2880489317 | 2880495228 | 100 |
| 26 | iso_pu_bacteria | 2880495981 | 2880497117 | 100 |
| 27 | iso_pu_bacteria | 2899359706 | 2899364632 | 100 |
| 28 | iso_pu_bacteria | 2899370129 | 2899373898 | 100 |
| 29 | iso_pu_bacteria | 2902582711 | 2902583752 | 100 |
| 30 | iso_pu_bacteria | 2915768154 | 2915769204 | 100 |
| 31 | iso_pu_bacteria | 2917736166 | 2917737847 | 100 |
| 32 | iso_pu_bacteria | 2919713450 | 2919718282 | 100 |
| 33 | iso_pu_bacteria | 2929219909 | 2929225716 | 100 |
| 34 | iso_pu_bacteria | 2929226422 | 2929231307 | 100 |
| 35 | iso_pu_bacteria | 2932398195 | 2932401142 | 100 |
| 36 | iso_pu_bacteria | 8003314358 | 8003323081 | 100 |
| 37 | 3300059508 | Ga0587088_065079 | Ga0587088_065079_220_546 | 101 |
| 38 | iso_pu_bacteria | 2956939328 | 2956940984 | 101 |
| 39 | iso_pu_bacteria | 3001119090 | 3001120677 | 101 |
| 40 | iso_pu_bacteria | 2855670206 | 2855673791 | 102 |
| 41 | iso_pu_bacteria | 2857288857 | 2857290716 | 102 |
| 42 | iso_pu_bacteria | 2891326441 | 2891331506 | 102 |
| 43 | iso_pu_bacteria | 8054704163 | 8054706706 | 102 |
| 44 | iso_pu_bacteria | 8054727385 | 8054733687 | 102 |
| 45 | iso_pu_bacteria | 8054734606 | 8054740753 | 102 |
| 46 | 3300003203 | JGI25406J46586_10001383 | JGI25406J46586_1000138310 | 103 |
| 47 | 3300004801 | Ga0058860_12193443 | Ga0058860_121934432 | 103 |
| 48 | 3300005985 | Ga0081539_10000132 | Ga0081539_10000132120 | 103 |
| 49 | 3300031824 | Ga0307413_10000820 | Ga0307413_1000082019 | 103 |
| 50 | 3300059490 | Ga0587066_105837 | Ga0587066_105837_220_540 | 103 |
| 51 | 3300059607 | Ga0587125_014288 | Ga0587125_014288_84_419 | 103 |
| 52 | 3300000549 | LJQas_1002897 | LJQas_10028972 | 104 |
| 53 | 3300001979 | JGI24740J21852_10072830 | JGI24740J21852_100728301 | 104 |
| 54 | 3300001989 | JGI24739J22299_10018382 | JGI24739J22299_100183825 | 104 |
| 55 | 3300002067 | JGI24735J21928_10007851 | JGI24735J21928_100078514 | 104 |
| 56 | 3300002077 | JGI24744J21845_10093776 | JGI24744J21845_100937762 | 104 |
| 57 | 3300004785 | Ga0058858_1396751 | Ga0058858_13967511 | 104 |
| 58 | 3300004798 | Ga0058859_10011668 | Ga0058859_100116682 | 104 |
| 59 | 3300004798 | Ga0058859_11648364 | Ga0058859_116483642 | 104 |
| 60 | 3300004798 | Ga0058859_11663105 | Ga0058859_116631051 | 104 |
| 61 | 3300004800 | Ga0058861_11630814 | Ga0058861_116308142 | 104 |
| 62 | 3300004801 | Ga0058860_10023721 | Ga0058860_100237212 | 104 |
| 63 | 3300004801 | Ga0058860_10092749 | Ga0058860_100927495 | 104 |
| 64 | 3300004801 | Ga0058860_12065445 | Ga0058860_120654452 | 104 |
| 65 | 3300004801 | Ga0058860_12175289 | Ga0058860_121752892 | 104 |
| 66 | 3300004803 | Ga0058862_10023693 | Ga0058862_100236933 | 104 |
| 67 | 3300004803 | Ga0058862_10153738 | Ga0058862_101537385 | 104 |
| 68 | 3300005327 | Ga0070658_11189461 | Ga0070658_111894612 | 104 |
| 69 | 3300005328 | Ga0070676_11186583 | Ga0070676_111865831 | 104 |
| 70 | 3300005329 | Ga0070683_100241319 | Ga0070683_1002413195 | 104 |
| 71 | 3300005329 | Ga0070683_101326100 | Ga0070683_1013261002 | 104 |
| 72 | 3300005330 | Ga0070690_101738678 | Ga0070690_1017386781 | 104 |
| 73 | 3300005331 | Ga0070670_100997067 | Ga0070670_1009970671 | 104 |
| 74 | 3300005331 | Ga0070670_101601817 | Ga0070670_1016018172 | 104 |
| 75 | 3300005334 | Ga0068869_100183863 | Ga0068869_1001838633 | 104 |
| 76 | 3300005334 | Ga0068869_100986704 | Ga0068869_1009867042 | 104 |
| 77 | 3300005334 | Ga0068869_101042128 | Ga0068869_1010421282 | 104 |
| 78 | 3300005334 | Ga0068869_101520067 | Ga0068869_1015200671 | 104 |
| 79 | 3300005335 | Ga0070666_10022861 | Ga0070666_100228619 | 104 |
| 80 | 3300005335 | Ga0070666_11252481 | Ga0070666_112524811 | 104 |
| 81 | 3300005337 | Ga0070682_100035507 | Ga0070682_1000355072 | 104 |
| 82 | 3300005337 | Ga0070682_100044721 | Ga0070682_1000447215 | 104 |
| 83 | 3300005337 | Ga0070682_100289963 | Ga0070682_1002899632 | 104 |
| 84 | 3300005337 | Ga0070682_100851960 | Ga0070682_1008519602 | 104 |
| 85 | 3300005338 | Ga0068868_100000735 | Ga0068868_10000073522 | 104 |
| 86 | 3300005338 | Ga0068868_100444556 | Ga0068868_1004445562 | 104 |
| 87 | 3300005338 | Ga0068868_100451926 | Ga0068868_1004519261 | 104 |
| 88 | 3300005338 | Ga0068868_100463731 | Ga0068868_1004637312 | 104 |
| 89 | 3300005340 | Ga0070689_100109629 | Ga0070689_1001096293 | 104 |
| 90 | 3300005340 | Ga0070689_100150356 | Ga0070689_1001503561 | 104 |
| 91 | 3300005340 | Ga0070689_100573325 | Ga0070689_1005733252 | 104 |
| 92 | 3300005343 | Ga0070687_100094363 | Ga0070687_1000943635 | 104 |
| 93 | 3300005343 | Ga0070687_100615577 | Ga0070687_1006155772 | 104 |
| 94 | 3300005343 | Ga0070687_100886665 | Ga0070687_1008866652 | 104 |
| 95 | 3300005344 | Ga0070661_101223581 | Ga0070661_1012235812 | 104 |
| 96 | 3300005345 | Ga0070692_10085751 | Ga0070692_100857513 | 104 |
| 97 | 3300005347 | Ga0070668_100074215 | Ga0070668_1000742156 | 104 |
| 98 | 3300005347 | Ga0070668_100582941 | Ga0070668_1005829412 | 104 |
| 99 | 3300005347 | Ga0070668_100910105 | Ga0070668_1009101051 | 104 |
| 100 | 3300005347 | Ga0070668_101856342 | Ga0070668_1018563422 | 104 |
| 101 | 3300005353 | Ga0070669_100059808 | Ga0070669_1000598086 | 104 |
| 102 | 3300005354 | Ga0070675_100596012 | Ga0070675_1005960122 | 104 |
| 103 | 3300005354 | Ga0070675_100751621 | Ga0070675_1007516212 | 104 |
| 104 | 3300005355 | Ga0070671_100161753 | Ga0070671_1001617534 | 104 |
| 105 | 3300005355 | Ga0070671_100903030 | Ga0070671_1009030302 | 104 |
| 106 | 3300005356 | Ga0070674_100107725 | Ga0070674_1001077255 | 104 |
| 107 | 3300005356 | Ga0070674_100237013 | Ga0070674_1002370133 | 104 |
| 108 | 3300005364 | Ga0070673_100229915 | Ga0070673_1002299152 | 104 |
| 109 | 3300005366 | Ga0070659_100005602 | Ga0070659_10000560212 | 104 |
| 110 | 3300005366 | Ga0070659_101086510 | Ga0070659_1010865101 | 104 |
| 111 | 3300005367 | Ga0070667_100051219 | Ga0070667_1000512197 | 104 |
| 112 | 3300005367 | Ga0070667_101075441 | Ga0070667_1010754412 | 104 |
| 113 | 3300005367 | Ga0070667_101624717 | Ga0070667_1016247171 | 104 |
| 114 | 3300005367 | Ga0070667_101957745 | Ga0070667_1019577452 | 104 |
| 115 | 3300005406 | Ga0070703_10078531 | Ga0070703_100785312 | 104 |
| 116 | 3300005434 | Ga0070709_11005348 | Ga0070709_110053481 | 104 |
| 117 | 3300005435 | Ga0070714_100170503 | Ga0070714_1001705035 | 104 |
| 118 | 3300005435 | Ga0070714_100203655 | Ga0070714_1002036554 | 104 |
| 119 | 3300005435 | Ga0070714_100255706 | Ga0070714_1002557062 | 104 |
| 120 | 3300005437 | Ga0070710_10000376 | Ga0070710_100003769 | 104 |
| 121 | 3300005439 | Ga0070711_100007537 | Ga0070711_1000075374 | 104 |
| 122 | 3300005440 | Ga0070705_100014974 | Ga0070705_1000149747 | 104 |
| 123 | 3300005441 | Ga0070700_100088260 | Ga0070700_1000882603 | 104 |
| 124 | 3300005441 | Ga0070700_100606189 | Ga0070700_1006061892 | 104 |
| 125 | 3300005444 | Ga0070694_100045954 | Ga0070694_1000459544 | 104 |
| 126 | 3300005455 | Ga0070663_100182346 | Ga0070663_1001823462 | 104 |
| 127 | 3300005455 | Ga0070663_100600304 | Ga0070663_1006003042 | 104 |
| 128 | 3300005456 | Ga0070678_100938946 | Ga0070678_1009389461 | 104 |
| 129 | 3300005456 | Ga0070678_101503772 | Ga0070678_1015037722 | 104 |
| 130 | 3300005457 | Ga0070662_100030788 | Ga0070662_1000307882 | 104 |
| 131 | 3300005457 | Ga0070662_101297357 | Ga0070662_1012973572 | 104 |
| 132 | 3300005458 | Ga0070681_11527605 | Ga0070681_115276052 | 104 |
| 133 | 3300005459 | Ga0068867_100376967 | Ga0068867_1003769673 | 104 |
| 134 | 3300005466 | Ga0070685_10056406 | Ga0070685_100564066 | 104 |
| 135 | 3300005466 | Ga0070685_10109043 | Ga0070685_101090434 | 104 |
| 136 | 3300005466 | Ga0070685_10604378 | Ga0070685_106043782 | 104 |
| 137 | 3300005530 | Ga0070679_101895927 | Ga0070679_1018959272 | 104 |
| 138 | 3300005535 | Ga0070684_100821124 | Ga0070684_1008211242 | 104 |
| 139 | 3300005536 | Ga0070697_100142979 | Ga0070697_1001429792 | 104 |
| 140 | 3300005539 | Ga0068853_100025062 | Ga0068853_1000250625 | 104 |
| 141 | 3300005545 | Ga0070695_100775425 | Ga0070695_1007754251 | 104 |
| 142 | 3300005546 | Ga0070696_100032405 | Ga0070696_1000324058 | 104 |
| 143 | 3300005546 | Ga0070696_101787839 | Ga0070696_1017878391 | 104 |
| 144 | 3300005547 | Ga0070693_101489498 | Ga0070693_1014894981 | 104 |
| 145 | 3300005548 | Ga0070665_100094006 | Ga0070665_1000940064 | 104 |
| 146 | 3300005548 | Ga0070665_100456554 | Ga0070665_1004565543 | 104 |
| 147 | 3300005548 | Ga0070665_100479384 | Ga0070665_1004793842 | 104 |
| 148 | 3300005548 | Ga0070665_101563816 | Ga0070665_1015638162 | 104 |
| 149 | 3300005549 | Ga0070704_100114220 | Ga0070704_1001142203 | 104 |
| 150 | 3300005563 | Ga0068855_100050226 | Ga0068855_1000502269 | 104 |
| 151 | 3300005564 | Ga0070664_100209730 | Ga0070664_1002097302 | 104 |
| 152 | 3300005564 | Ga0070664_100537502 | Ga0070664_1005375022 | 104 |
| 153 | 3300005577 | Ga0068857_102374765 | Ga0068857_1023747652 | 104 |
| 154 | 3300005615 | Ga0070702_100016667 | Ga0070702_1000166677 | 104 |
| 155 | 3300005615 | Ga0070702_100087744 | Ga0070702_1000877442 | 104 |
| 156 | 3300005616 | Ga0068852_100222700 | Ga0068852_1002227002 | 104 |
| 157 | 3300005616 | Ga0068852_100228323 | Ga0068852_1002283235 | 104 |
| 158 | 3300005616 | Ga0068852_100405143 | Ga0068852_1004051433 | 104 |
| 159 | 3300005616 | Ga0068852_100479569 | Ga0068852_1004795692 | 104 |
| 160 | 3300005617 | Ga0068859_101621091 | Ga0068859_1016210912 | 104 |
| 161 | 3300005617 | Ga0068859_102006550 | Ga0068859_1020065501 | 104 |
| 162 | 3300005617 | Ga0068859_102705462 | Ga0068859_1027054621 | 104 |
| 163 | 3300005618 | Ga0068864_100109101 | Ga0068864_1001091012 | 104 |
| 164 | 3300005618 | Ga0068864_101413849 | Ga0068864_1014138492 | 104 |
| 165 | 3300005718 | Ga0068866_10028542 | Ga0068866_100285423 | 104 |
| 166 | 3300005719 | Ga0068861_100055597 | Ga0068861_1000555976 | 104 |
| 167 | 3300005719 | Ga0068861_100993418 | Ga0068861_1009934182 | 104 |
| 168 | 3300005834 | Ga0068851_10177369 | Ga0068851_101773692 | 104 |
| 169 | 3300005834 | Ga0068851_10649456 | Ga0068851_106494561 | 104 |
| 170 | 3300005834 | Ga0068851_10758542 | Ga0068851_107585422 | 104 |
| 171 | 3300005840 | Ga0068870_10103819 | Ga0068870_101038193 | 104 |
| 172 | 3300005840 | Ga0068870_10691558 | Ga0068870_106915582 | 104 |
| 173 | 3300005841 | Ga0068863_100023672 | Ga0068863_10002367210 | 104 |
| 174 | 3300005842 | Ga0068858_100106994 | Ga0068858_1001069943 | 104 |
| 175 | 3300005842 | Ga0068858_100566258 | Ga0068858_1005662582 | 104 |
| 176 | 3300005843 | Ga0068860_100081426 | Ga0068860_1000814264 | 104 |
| 177 | 3300005844 | Ga0068862_100294763 | Ga0068862_1002947634 | 104 |
| 178 | 3300005981 | Ga0081538_10016245 | Ga0081538_100162456 | 104 |
| 179 | 3300005983 | Ga0081540_1001718 | Ga0081540_100171810 | 104 |
| 180 | 3300006028 | Ga0070717_10133237 | Ga0070717_101332373 | 104 |
| 181 | 3300006028 | Ga0070717_10650961 | Ga0070717_106509612 | 104 |
| 182 | 3300006058 | Ga0075432_10136715 | Ga0075432_101367152 | 104 |
| 183 | 3300006163 | Ga0070715_10050715 | Ga0070715_100507154 | 104 |
| 184 | 3300006173 | Ga0070716_100006233 | Ga0070716_1000062331 | 104 |
| 185 | 3300006175 | Ga0070712_100571499 | Ga0070712_1005714992 | 104 |
| 186 | 3300006237 | Ga0097621_100125994 | Ga0097621_1001259944 | 104 |
| 187 | 3300006237 | Ga0097621_100709730 | Ga0097621_1007097302 | 104 |
| 188 | 3300006358 | Ga0068871_100063772 | Ga0068871_1000637722 | 104 |
| 189 | 3300006358 | Ga0068871_100980001 | Ga0068871_1009800012 | 104 |
| 190 | 3300006846 | Ga0075430_100325873 | Ga0075430_1003258732 | 104 |
| 191 | 3300006847 | Ga0075431_100111938 | Ga0075431_1001119383 | 104 |
| 192 | 3300006852 | Ga0075433_10207134 | Ga0075433_102071343 | 104 |
| 193 | 3300006852 | Ga0075433_10605594 | Ga0075433_106055942 | 104 |
| 194 | 3300006871 | Ga0075434_100046738 | Ga0075434_1000467384 | 104 |
| 195 | 3300006880 | Ga0075429_100749409 | Ga0075429_1007494092 | 104 |
| 196 | 3300006914 | Ga0075436_100061172 | Ga0075436_1000611722 | 104 |
| 197 | 3300006931 | Ga0097620_101621039 | Ga0097620_1016210392 | 104 |
| 198 | 3300006931 | Ga0097620_102006711 | Ga0097620_1020067111 | 104 |
| 199 | 3300006931 | Ga0097620_102704880 | Ga0097620_1027048801 | 104 |
| 200 | 3300007076 | Ga0075435_100031870 | Ga0075435_1000318709 | 104 |
| 201 | 3300007076 | Ga0075435_100673010 | Ga0075435_1006730102 | 104 |
| 202 | 3300009036 | Ga0105244_10250095 | Ga0105244_102500952 | 104 |
| 203 | 3300009093 | Ga0105240_10204697 | Ga0105240_102046974 | 104 |
| 204 | 3300009094 | Ga0111539_10715946 | Ga0111539_107159462 | 104 |
| 205 | 3300009098 | Ga0105245_10026001 | Ga0105245_100260019 | 104 |
| 206 | 3300009098 | Ga0105245_10902983 | Ga0105245_109029832 | 104 |
| 207 | 3300009098 | Ga0105245_11125141 | Ga0105245_111251412 | 104 |
| 208 | 3300009098 | Ga0105245_11595489 | Ga0105245_115954892 | 104 |
| 209 | 3300009101 | Ga0105247_10042407 | Ga0105247_100424076 | 104 |
| 210 | 3300009101 | Ga0105247_10168492 | Ga0105247_101684924 | 104 |
| 211 | 3300009101 | Ga0105247_10476135 | Ga0105247_104761352 | 104 |
| 212 | 3300009147 | Ga0114129_11603647 | Ga0114129_116036471 | 104 |
| 213 | 3300009148 | Ga0105243_10009722 | Ga0105243_1000972211 | 104 |
| 214 | 3300009148 | Ga0105243_10847058 | Ga0105243_108470582 | 104 |
| 215 | 3300009174 | Ga0105241_10044504 | Ga0105241_100445045 | 104 |
| 216 | 3300009174 | Ga0105241_11517426 | Ga0105241_115174262 | 104 |
| 217 | 3300009176 | Ga0105242_10181638 | Ga0105242_101816385 | 104 |
| 218 | 3300009176 | Ga0105242_10768747 | Ga0105242_107687472 | 104 |
| 219 | 3300009177 | Ga0105248_10253937 | Ga0105248_102539372 | 104 |
| 220 | 3300009177 | Ga0105248_11672967 | Ga0105248_116729672 | 104 |
| 221 | 3300009545 | Ga0105237_10192300 | Ga0105237_101923002 | 104 |
| 222 | 3300009551 | Ga0105238_10042028 | Ga0105238_100420289 | 104 |
| 223 | 3300009551 | Ga0105238_10322410 | Ga0105238_103224102 | 104 |
| 224 | 3300009551 | Ga0105238_10435505 | Ga0105238_104355052 | 104 |
| 225 | 3300009551 | Ga0105238_10935547 | Ga0105238_109355472 | 104 |
| 226 | 3300009551 | Ga0105238_12808358 | Ga0105238_128083581 | 104 |
| 227 | 3300009553 | Ga0105249_10007779 | Ga0105249_100077799 | 104 |
| 228 | 3300009553 | Ga0105249_10800817 | Ga0105249_108008172 | 104 |
| 229 | 3300009979 | Ga0105032_101026 | Ga0105032_1010266 | 104 |
| 230 | 3300009986 | Ga0105033_102590 | Ga0105033_1025905 | 104 |
| 231 | 3300009986 | Ga0105033_103394 | Ga0105033_1033943 | 104 |
| 232 | 3300009988 | Ga0105035_100358 | Ga0105035_1003585 | 104 |
| 233 | 3300009993 | Ga0105028_101349 | Ga0105028_1013494 | 104 |
| 234 | 3300010375 | Ga0105239_10543736 | Ga0105239_105437362 | 104 |
| 235 | 3300011119 | Ga0105246_10084502 | Ga0105246_100845022 | 104 |
| 236 | 3300011119 | Ga0105246_10411265 | Ga0105246_104112652 | 104 |
| 237 | 3300011119 | Ga0105246_11043192 | Ga0105246_110431922 | 104 |
| 238 | 3300011119 | Ga0105246_11379969 | Ga0105246_113799692 | 104 |
| 239 | 3300012494 | Ga0157341_1011304 | Ga0157341_10113041 | 104 |
| 240 | 3300012495 | Ga0157323_1000742 | Ga0157323_10007424 | 104 |
| 241 | 3300012506 | Ga0157324_1002822 | Ga0157324_10028222 | 104 |
| 242 | 3300012508 | Ga0157315_1015463 | Ga0157315_10154632 | 104 |
| 243 | 3300013102 | Ga0157371_10012725 | Ga0157371_100127257 | 104 |
| 244 | 3300013104 | Ga0157370_10260145 | Ga0157370_102601452 | 104 |
| 245 | 3300013105 | Ga0157369_10514077 | Ga0157369_105140772 | 104 |
| 246 | 3300013105 | Ga0157369_11625030 | Ga0157369_116250302 | 104 |
| 247 | 3300013105 | Ga0157369_12114607 | Ga0157369_121146072 | 104 |
| 248 | 3300013296 | Ga0157374_10031506 | Ga0157374_100315062 | 104 |
| 249 | 3300013296 | Ga0157374_10720339 | Ga0157374_107203392 | 104 |
| 250 | 3300013296 | Ga0157374_10876269 | Ga0157374_108762692 | 104 |
| 251 | 3300013296 | Ga0157374_11218317 | Ga0157374_112183172 | 104 |
| 252 | 3300013297 | Ga0157378_10355995 | Ga0157378_103559952 | 104 |
| 253 | 3300013297 | Ga0157378_11157240 | Ga0157378_111572402 | 104 |
| 254 | 3300013306 | Ga0163162_10015117 | Ga0163162_100151175 | 104 |
| 255 | 3300013306 | Ga0163162_12702098 | Ga0163162_127020982 | 104 |
| 256 | 3300013307 | Ga0157372_10039710 | Ga0157372_1003971010 | 104 |
| 257 | 3300013307 | Ga0157372_10599602 | Ga0157372_105996021 | 104 |
| 258 | 3300013307 | Ga0157372_11431024 | Ga0157372_114310242 | 104 |
| 259 | 3300013307 | Ga0157372_11547638 | Ga0157372_115476382 | 104 |
| 260 | 3300013308 | Ga0157375_11087697 | Ga0157375_110876972 | 104 |
| 261 | 3300013308 | Ga0157375_11154372 | Ga0157375_111543722 | 104 |
| 262 | 3300013308 | Ga0157375_11413326 | Ga0157375_114133261 | 104 |
| 263 | 3300013308 | Ga0157375_11536211 | Ga0157375_115362111 | 104 |
| 264 | 3300013308 | Ga0157375_12027055 | Ga0157375_120270552 | 104 |
| 265 | 3300013875 | Ga0157515_106749 | Ga0157515_1067492 | 104 |
| 266 | 3300014325 | Ga0163163_10419870 | Ga0163163_104198703 | 104 |
| 267 | 3300014325 | Ga0163163_10853113 | Ga0163163_108531132 | 104 |
| 268 | 3300014325 | Ga0163163_12490750 | Ga0163163_124907502 | 104 |
| 269 | 3300014326 | Ga0157380_10317983 | Ga0157380_103179832 | 104 |
| 270 | 3300014326 | Ga0157380_10496596 | Ga0157380_104965962 | 104 |
| 271 | 3300014326 | Ga0157380_11554064 | Ga0157380_115540642 | 104 |
| 272 | 3300014326 | Ga0157380_12303943 | Ga0157380_123039432 | 104 |
| 273 | 3300014326 | Ga0157380_13022672 | Ga0157380_130226722 | 104 |
| 274 | 3300014745 | Ga0157377_10126329 | Ga0157377_101263294 | 104 |
| 275 | 3300014968 | Ga0157379_10209281 | Ga0157379_102092813 | 104 |
| 276 | 3300014968 | Ga0157379_10485205 | Ga0157379_104852052 | 104 |
| 277 | 3300014968 | Ga0157379_10778462 | Ga0157379_107784622 | 104 |
| 278 | 3300014968 | Ga0157379_10972049 | Ga0157379_109720492 | 104 |
| 279 | 3300014969 | Ga0157376_10099488 | Ga0157376_100994885 | 104 |
| 280 | 3300014969 | Ga0157376_10846308 | Ga0157376_108463082 | 104 |
| 281 | 3300014969 | Ga0157376_11393293 | Ga0157376_113932932 | 104 |
| 282 | 3300014969 | Ga0157376_11542484 | Ga0157376_115424843 | 104 |
| 283 | 3300017792 | Ga0163161_10006328 | Ga0163161_1000632815 | 104 |
| 284 | 3300017792 | Ga0163161_10483145 | Ga0163161_104831452 | 104 |
| 285 | 3300017792 | Ga0163161_11712468 | Ga0163161_117124681 | 104 |
| 286 | 3300020069 | Ga0197907_10377945 | Ga0197907_1037794514 | 104 |
| 287 | 3300020069 | Ga0197907_10891275 | Ga0197907_108912752 | 104 |
| 288 | 3300020070 | Ga0206356_10247586 | Ga0206356_102475865 | 104 |
| 289 | 3300020070 | Ga0206356_11903330 | Ga0206356_119033301 | 104 |
| 290 | 3300020075 | Ga0206349_1094146 | Ga0206349_10941462 | 104 |
| 291 | 3300020075 | Ga0206349_1431413 | Ga0206349_14314131 | 104 |
| 292 | 3300020075 | Ga0206349_1453397 | Ga0206349_14533979 | 104 |
| 293 | 3300020076 | Ga0206355_1109688 | Ga0206355_11096882 | 104 |
| 294 | 3300020076 | Ga0206355_1305882 | Ga0206355_13058822 | 104 |
| 295 | 3300020076 | Ga0206355_1410655 | Ga0206355_14106551 | 104 |
| 296 | 3300020076 | Ga0206355_1658075 | Ga0206355_16580752 | 104 |
| 297 | 3300020078 | Ga0206352_10207358 | Ga0206352_102073584 | 104 |
| 298 | 3300020078 | Ga0206352_10616844 | Ga0206352_106168442 | 104 |
| 299 | 3300020080 | Ga0206350_10688099 | Ga0206350_106880992 | 104 |
| 300 | 3300020080 | Ga0206350_11200745 | Ga0206350_112007456 | 104 |
| 301 | 3300020081 | Ga0206354_10319359 | Ga0206354_103193592 | 104 |
| 302 | 3300020082 | Ga0206353_10692420 | Ga0206353_106924202 | 104 |
| 303 | 3300020082 | Ga0206353_11638776 | Ga0206353_116387764 | 104 |
| 304 | 3300020610 | Ga0154015_1161714 | Ga0154015_11617142 | 104 |
| 305 | 3300021388 | Ga0213875_10000107 | Ga0213875_1000010747 | 104 |
| 306 | 3300021388 | Ga0213875_10004141 | Ga0213875_1000414112 | 104 |
| 307 | 3300022467 | Ga0224712_10000575 | Ga0224712_100005752 | 104 |
| 308 | 3300023309 | Ga0256744_130645 | Ga0256744_1306452 | 104 |
| 309 | 3300025321 | Ga0207656_10599072 | Ga0207656_105990722 | 104 |
| 310 | 3300025898 | Ga0207692_10000368 | Ga0207692_100003689 | 104 |
| 311 | 3300025898 | Ga0207692_10026602 | Ga0207692_100266026 | 104 |
| 312 | 3300025899 | Ga0207642_10659167 | Ga0207642_106591672 | 104 |
| 313 | 3300025899 | Ga0207642_11045914 | Ga0207642_110459142 | 104 |
| 314 | 3300025900 | Ga0207710_10261847 | Ga0207710_102618472 | 104 |
| 315 | 3300025900 | Ga0207710_10321723 | Ga0207710_103217232 | 104 |
| 316 | 3300025900 | Ga0207710_10439399 | Ga0207710_104393992 | 104 |
| 317 | 3300025900 | Ga0207710_10694480 | Ga0207710_106944801 | 104 |
| 318 | 3300025901 | Ga0207688_10005072 | Ga0207688_1000507213 | 104 |
| 319 | 3300025901 | Ga0207688_10064689 | Ga0207688_100646893 | 104 |
| 320 | 3300025901 | Ga0207688_10677728 | Ga0207688_106777282 | 104 |
| 321 | 3300025901 | Ga0207688_10784479 | Ga0207688_107844792 | 104 |
| 322 | 3300025904 | Ga0207647_10053739 | Ga0207647_100537394 | 104 |
| 323 | 3300025908 | Ga0207643_10140578 | Ga0207643_101405785 | 104 |
| 324 | 3300025909 | Ga0207705_11355801 | Ga0207705_113558011 | 104 |
| 325 | 3300025911 | Ga0207654_10522198 | Ga0207654_105221982 | 104 |
| 326 | 3300025913 | Ga0207695_10328126 | Ga0207695_103281264 | 104 |
| 327 | 3300025914 | Ga0207671_10237501 | Ga0207671_102375014 | 104 |
| 328 | 3300025915 | Ga0207693_10001283 | Ga0207693_1000128317 | 104 |
| 329 | 3300025916 | Ga0207663_10024245 | Ga0207663_100242454 | 104 |
| 330 | 3300025918 | Ga0207662_10026906 | Ga0207662_100269065 | 104 |
| 331 | 3300025918 | Ga0207662_10221385 | Ga0207662_102213852 | 104 |
| 332 | 3300025918 | Ga0207662_10574671 | Ga0207662_105746712 | 104 |
| 333 | 3300025919 | Ga0207657_10009138 | Ga0207657_1000913811 | 104 |
| 334 | 3300025919 | Ga0207657_10191592 | Ga0207657_101915925 | 104 |
| 335 | 3300025924 | Ga0207694_10338999 | Ga0207694_103389992 | 104 |
| 336 | 3300025924 | Ga0207694_10982330 | Ga0207694_109823302 | 104 |
| 337 | 3300025925 | Ga0207650_11288285 | Ga0207650_112882852 | 104 |
| 338 | 3300025926 | Ga0207659_11119560 | Ga0207659_111195601 | 104 |
| 339 | 3300025927 | Ga0207687_11784570 | Ga0207687_117845701 | 104 |
| 340 | 3300025929 | Ga0207664_10017195 | Ga0207664_100171952 | 104 |
| 341 | 3300025929 | Ga0207664_10101806 | Ga0207664_101018065 | 104 |
| 342 | 3300025929 | Ga0207664_10891636 | Ga0207664_108916362 | 104 |
| 343 | 3300025931 | Ga0207644_11418999 | Ga0207644_114189991 | 104 |
| 344 | 3300025932 | Ga0207690_10158621 | Ga0207690_101586213 | 104 |
| 345 | 3300025932 | Ga0207690_11021612 | Ga0207690_110216122 | 104 |
| 346 | 3300025933 | Ga0207706_10009289 | Ga0207706_1000928913 | 104 |
| 347 | 3300025933 | Ga0207706_10708065 | Ga0207706_107080652 | 104 |
| 348 | 3300025934 | Ga0207686_10223419 | Ga0207686_102234192 | 104 |
| 349 | 3300025934 | Ga0207686_10262709 | Ga0207686_102627092 | 104 |
| 350 | 3300025935 | Ga0207709_10537233 | Ga0207709_105372332 | 104 |
| 351 | 3300025935 | Ga0207709_10661350 | Ga0207709_106613502 | 104 |
| 352 | 3300025936 | Ga0207670_10243527 | Ga0207670_102435272 | 104 |
| 353 | 3300025937 | Ga0207669_10515359 | Ga0207669_105153592 | 104 |
| 354 | 3300025937 | Ga0207669_10520246 | Ga0207669_105202462 | 104 |
| 355 | 3300025938 | Ga0207704_10162306 | Ga0207704_101623062 | 104 |
| 356 | 3300025938 | Ga0207704_10704071 | Ga0207704_107040712 | 104 |
| 357 | 3300025938 | Ga0207704_11013915 | Ga0207704_110139152 | 104 |
| 358 | 3300025939 | Ga0207665_10006255 | Ga0207665_100062559 | 104 |
| 359 | 3300025940 | Ga0207691_10142827 | Ga0207691_101428275 | 104 |
| 360 | 3300025940 | Ga0207691_10192161 | Ga0207691_101921612 | 104 |
| 361 | 3300025940 | Ga0207691_11634433 | Ga0207691_116344332 | 104 |
| 362 | 3300025942 | Ga0207689_10004616 | Ga0207689_100046162 | 104 |
| 363 | 3300025942 | Ga0207689_11039171 | Ga0207689_110391711 | 104 |
| 364 | 3300025942 | Ga0207689_11040828 | Ga0207689_110408282 | 104 |
| 365 | 3300025944 | Ga0207661_11077097 | Ga0207661_110770971 | 104 |
| 366 | 3300025944 | Ga0207661_11845377 | Ga0207661_118453772 | 104 |
| 367 | 3300025945 | Ga0207679_10173702 | Ga0207679_101737022 | 104 |
| 368 | 3300025945 | Ga0207679_10541878 | Ga0207679_105418781 | 104 |
| 369 | 3300025949 | Ga0207667_10342259 | Ga0207667_103422592 | 104 |
| 370 | 3300025949 | Ga0207667_11466013 | Ga0207667_114660131 | 104 |
| 371 | 3300025960 | Ga0207651_10242789 | Ga0207651_102427894 | 104 |
| 372 | 3300025961 | Ga0207712_10000797 | Ga0207712_1000079725 | 104 |
| 373 | 3300025961 | Ga0207712_10329245 | Ga0207712_103292454 | 104 |
| 374 | 3300025972 | Ga0207668_10061079 | Ga0207668_100610794 | 104 |
| 375 | 3300025972 | Ga0207668_10164948 | Ga0207668_101649482 | 104 |
| 376 | 3300025972 | Ga0207668_10392781 | Ga0207668_103927811 | 104 |
| 377 | 3300025981 | Ga0207640_10461675 | Ga0207640_104616752 | 104 |
| 378 | 3300025986 | Ga0207658_10139424 | Ga0207658_101394243 | 104 |
| 379 | 3300025986 | Ga0207658_10256438 | Ga0207658_102564383 | 104 |
| 380 | 3300026023 | Ga0207677_10122095 | Ga0207677_101220953 | 104 |
| 381 | 3300026023 | Ga0207677_10378368 | Ga0207677_103783683 | 104 |
| 382 | 3300026023 | Ga0207677_10420102 | Ga0207677_104201022 | 104 |
| 383 | 3300026023 | Ga0207677_10599610 | Ga0207677_105996102 | 104 |
| 384 | 3300026035 | Ga0207703_10189049 | Ga0207703_101890491 | 104 |
| 385 | 3300026035 | Ga0207703_10877884 | Ga0207703_108778842 | 104 |
| 386 | 3300026041 | Ga0207639_10617818 | Ga0207639_106178182 | 104 |
| 387 | 3300026067 | Ga0207678_10009664 | Ga0207678_1000966410 | 104 |
| 388 | 3300026067 | Ga0207678_10233078 | Ga0207678_102330782 | 104 |
| 389 | 3300026067 | Ga0207678_10514768 | Ga0207678_105147682 | 104 |
| 390 | 3300026067 | Ga0207678_10670754 | Ga0207678_106707542 | 104 |
| 391 | 3300026067 | Ga0207678_11673007 | Ga0207678_116730072 | 104 |
| 392 | 3300026075 | Ga0207708_10171226 | Ga0207708_101712263 | 104 |
| 393 | 3300026075 | Ga0207708_10273447 | Ga0207708_102734471 | 104 |
| 394 | 3300026075 | Ga0207708_11584261 | Ga0207708_115842612 | 104 |
| 395 | 3300026075 | Ga0207708_12006805 | Ga0207708_120068052 | 104 |
| 396 | 3300026088 | Ga0207641_10071941 | Ga0207641_100719413 | 104 |
| 397 | 3300026088 | Ga0207641_10395647 | Ga0207641_103956472 | 104 |
| 398 | 3300026089 | Ga0207648_10093298 | Ga0207648_100932983 | 104 |
| 399 | 3300026089 | Ga0207648_11032099 | Ga0207648_110320992 | 104 |
| 400 | 3300026089 | Ga0207648_11479571 | Ga0207648_114795712 | 104 |
| 401 | 3300026095 | Ga0207676_10871869 | Ga0207676_108718692 | 104 |
| 402 | 3300026095 | Ga0207676_10981772 | Ga0207676_109817722 | 104 |
| 403 | 3300026095 | Ga0207676_11692555 | Ga0207676_116925552 | 104 |
| 404 | 3300026118 | Ga0207675_100012489 | Ga0207675_10001248914 | 104 |
| 405 | 3300026118 | Ga0207675_100251858 | Ga0207675_1002518582 | 104 |
| 406 | 3300026118 | Ga0207675_102211584 | Ga0207675_1022115842 | 104 |
| 407 | 3300026121 | Ga0207683_10004908 | Ga0207683_1000490810 | 104 |
| 408 | 3300026121 | Ga0207683_10106701 | Ga0207683_101067016 | 104 |
| 409 | 3300026121 | Ga0207683_10109837 | Ga0207683_101098376 | 104 |
| 410 | 3300026121 | Ga0207683_10626278 | Ga0207683_106262782 | 104 |
| 411 | 3300026142 | Ga0207698_10174299 | Ga0207698_101742993 | 104 |
| 412 | 3300026142 | Ga0207698_10246185 | Ga0207698_102461855 | 104 |
| 413 | 3300026142 | Ga0207698_11123404 | Ga0207698_111234042 | 104 |
| 414 | 3300027907 | Ga0207428_10134227 | Ga0207428_101342273 | 104 |
| 415 | 3300028379 | Ga0268266_10376558 | Ga0268266_103765582 | 104 |
| 416 | 3300028379 | Ga0268266_10498807 | Ga0268266_104988072 | 104 |
| 417 | 3300028379 | Ga0268266_10636863 | Ga0268266_106368632 | 104 |
| 418 | 3300028379 | Ga0268266_11094681 | Ga0268266_110946812 | 104 |
| 419 | 3300028380 | Ga0268265_10028281 | Ga0268265_100282813 | 104 |
| 420 | 3300028380 | Ga0268265_10511968 | Ga0268265_105119682 | 104 |
| 421 | 3300028381 | Ga0268264_10816641 | Ga0268264_108166412 | 104 |
| 422 | 3300029282 | Ga0311003_163444 | Ga0311003_1634442 | 104 |
| 423 | 3300029285 | Ga0310981_1042594 | Ga0310981_10425942 | 104 |
| 424 | 3300030522 | Ga0307512_10008844 | Ga0307512_1000884413 | 104 |
| 425 | 3300030731 | Ga0316177_1073951 | Ga0316177_10739515 | 104 |
| 426 | 3300030732 | Ga0316176_1154284 | Ga0316176_11542845 | 104 |
| 427 | 3300030733 | Ga0314311_1038188 | Ga0314311_10381889 | 104 |
| 428 | 3300030735 | Ga0316178_1145984 | Ga0316178_11459842 | 104 |
| 429 | 3300030736 | Ga0316180_1057786 | Ga0316180_10577865 | 104 |
| 430 | 3300030742 | Ga0316183_1025727 | Ga0316183_10257272 | 104 |
| 431 | 3300030744 | Ga0316181_1255392 | Ga0316181_12553924 | 104 |
| 432 | 3300030745 | Ga0316182_1026960 | Ga0316182_10269602 | 104 |
| 433 | 3300031456 | Ga0307513_10001540 | Ga0307513_1000154012 | 104 |
| 434 | 3300031507 | Ga0307509_10170317 | Ga0307509_101703175 | 104 |
| 435 | 3300031731 | Ga0307405_10290907 | Ga0307405_102909073 | 104 |
| 436 | 3300031852 | Ga0307410_10244890 | Ga0307410_102448903 | 104 |
| 437 | 3300031852 | Ga0307410_10728701 | Ga0307410_107287012 | 104 |
| 438 | 3300031995 | Ga0307409_100461078 | Ga0307409_1004610782 | 104 |
| 439 | 3300031995 | Ga0307409_100958551 | Ga0307409_1009585511 | 104 |
| 440 | 3300032002 | Ga0307416_102353550 | Ga0307416_1023535502 | 104 |
| 441 | 3300032005 | Ga0307411_11601520 | Ga0307411_116015202 | 104 |
| 442 | 3300032126 | Ga0307415_101836880 | Ga0307415_1018368802 | 104 |
| 443 | 3300034818 | Ga0373950_0005642 | Ga0373950_0005642_53_370 | 104 |
| 444 | 3300034957 | Ga0373938_0044535 | Ga0373938_0044535_72_386 | 104 |
| 445 | 3300034957 | Ga0373938_0092571 | Ga0373938_0092571_58_372 | 104 |
| 446 | 3300035085 | Ga0373929_0003284 | Ga0373929_0003284_1893_2210 | 104 |
| 447 | 3300035088 | Ga0373940_0208121 | Ga0373940_0208121_115_432 | 104 |
| 448 | 3300035090 | Ga0373949_0021905 | Ga0373949_0021905_445_762 | 104 |
| 449 | 3300035092 | Ga0373952_0011882 | Ga0373952_0011882_968_1285 | 104 |
| 450 | 3300035112 | Ga0373932_0007943 | Ga0373932_0007943_402_719 | 104 |
| 451 | 3300035114 | Ga0373939_0002935 | Ga0373939_0002935_3481_3798 | 104 |
| 452 | 3300035114 | Ga0373939_0205135 | Ga0373939_0205135_348_662 | 104 |
| 453 | 3300035121 | Ga0373960_0029968 | Ga0373960_0029968_543_860 | 104 |
| 454 | 3300035170 | Ga0373943_0450553 | Ga0373943_0450553_56_376 | 104 |
| 455 | 3300035171 | Ga0373946_0229974 | Ga0373946_0229974_120_440 | 104 |
| 456 | 3300035242 | Ga0373962_0003137 | Ga0373962_0003137_1793_2110 | 104 |
| 457 | 3300035691 | Ga0373931_0015456 | Ga0373931_0015456_2988_3305 | 104 |
| 458 | 3300035691 | Ga0373931_0493988 | Ga0373931_0493988_215_529 | 104 |
| 459 | 3300035695 | Ga0373927_1164312 | Ga0373927_1164312_18_332 | 104 |
| 460 | 3300036401 | Ga0373937_1727270 | Ga0373937_1727270_168_488 | 104 |
| 461 | 3300037068 | Ga0373925_0657368 | Ga0373925_0657368_457_777 | 104 |
| 462 | 3300037068 | Ga0373925_1195037 | Ga0373925_1195037_122_445 | 104 |
| 463 | 3300037853 | Ga0436364_0010700 | Ga0436364_0010700_90119_90433 | 104 |
| 464 | 3300037853 | Ga0436364_0184253 | Ga0436364_0184253_2596_2910 | 104 |
| 465 | 3300037853 | Ga0436364_0588322 | Ga0436364_0588322_67898_68212 | 104 |
| 466 | 3300039453 | Ga0436362_0313342 | Ga0436362_0313342_121_435 | 104 |
| 467 | 3300039453 | Ga0436362_0494804 | Ga0436362_0494804_315_629 | 104 |
| 468 | 3300041413 | Ga0439465_0435241 | Ga0439465_0435241_25_339 | 104 |
| 469 | 3300041441 | Ga0451787_757127 | Ga0451787_757127_74_394 | 104 |
| 470 | 3300041443 | Ga0451789_0054430 | Ga0451789_0054430_293_613 | 104 |
| 471 | 3300041446 | Ga0451794_55151 | Ga0451794_55151_49_369 | 104 |
| 472 | 3300041451 | Ga0451791_1065158 | Ga0451791_1065158_1705_2025 | 104 |
| 473 | 3300041452 | Ga0451793_0871455 | Ga0451793_0871455_1219_1539 | 104 |
| 474 | 3300041453 | Ga0451797_1382881 | Ga0451797_1382881_310_630 | 104 |
| 475 | 3300041453 | Ga0451797_1384890 | Ga0451797_1384890_100_414 | 104 |
| 476 | 3300041455 | Ga0451801_11751 | Ga0451801_11751_180_494 | 104 |
| 477 | 3300041458 | Ga0451798_0190825 | Ga0451798_0190825_351_671 | 104 |
| 478 | 3300041459 | Ga0451800_1390558 | Ga0451800_1390558_849_1169 | 104 |
| 479 | 3300041486 | Ga0451807_1654378 | Ga0451807_1654378_467_787 | 104 |
| 480 | 3300041494 | Ga0451837_0550193 | Ga0451837_0550193_1691_2011 | 104 |
| 481 | 3300041496 | Ga0451839_1054739 | Ga0451839_1054739_115_429 | 104 |
| 482 | 3300041498 | Ga0451841_1228666 | Ga0451841_1228666_1421_1741 | 104 |
| 483 | 3300041501 | Ga0451845_0146963 | Ga0451845_0146963_15_335 | 104 |
| 484 | 3300041505 | Ga0451849_0017685 | Ga0451849_0017685_98_418 | 104 |
| 485 | 3300041507 | Ga0451851_1177781 | Ga0451851_1177781_52_372 | 104 |
| 486 | 3300041511 | Ga0451855_1627071 | Ga0451855_1627071_190_510 | 104 |
| 487 | 3300041512 | Ga0451853_1554167 | Ga0451853_1554167_1931_2251 | 104 |
| 488 | 3300042002 | Ga0439442_046897 | Ga0439442_046897_318_632 | 104 |
| 489 | 3300042004 | Ga0439445_0148492 | Ga0439445_0148492_91_405 | 104 |
| 490 | 3300042016 | Ga0439463_031098 | Ga0439463_031098_478_792 | 104 |
| 491 | 3300044658 | Ga0466972_0007279 | Ga0466972_0007279_3483_3797 | 104 |
| 492 | 3300044658 | Ga0466972_0585810 | Ga0466972_0585810_92_406 | 104 |
| 493 | 3300044683 | Ga0466965_0033398 | Ga0466965_0033398_1319_1633 | 104 |
| 494 | 3300044683 | Ga0466965_0294538 | Ga0466965_0294538_546_860 | 104 |
| 495 | 3300044684 | Ga0466966_0000383 | Ga0466966_0000383_23290_23604 | 104 |
| 496 | 3300044693 | Ga0466961_0054451 | Ga0466961_0054451_1274_1588 | 104 |
| 497 | 3300044694 | Ga0466963_0009016 | Ga0466963_0009016_3772_4086 | 104 |
| 498 | 3300044706 | Ga0466964_0326363 | Ga0466964_0326363_358_672 | 104 |
| 499 | 3300044719 | Ga0466971_0009870 | Ga0466971_0009870_1661_1975 | 104 |
| 500 | 3300044735 | Ga0466968_0000486 | Ga0466968_0000486_1443_1757 | 104 |
| 501 | 3300044735 | Ga0466968_0026217 | Ga0466968_0026217_24_338 | 104 |
| 502 | 3300044735 | Ga0466968_0030625 | Ga0466968_0030625_1229_1543 | 104 |
| 503 | 3300044765 | Ga0466970_0021508 | Ga0466970_0021508_441_755 | 104 |
| 504 | 3300044842 | Ga0466957_0009243 | Ga0466957_0009243_1388_1702 | 104 |
| 505 | 3300044901 | Ga0466960_0003887 | Ga0466960_0003887_1761_2075 | 104 |
| 506 | 3300044901 | Ga0466960_0834377 | Ga0466960_0834377_76_390 | 104 |
| 507 | 3300045049 | Ga0466959_0017822 | Ga0466959_0017822_1373_1687 | 104 |
| 508 | 3300045836 | Ga0466958_0000206 | Ga0466958_0000206_18046_18360 | 104 |
| 509 | 3300045976 | Ga0466967_0082652 | Ga0466967_0082652_1327_1641 | 104 |
| 510 | 3300045976 | Ga0466967_1063197 | Ga0466967_1063197_431_745 | 104 |
| 511 | 3300045976 | Ga0466967_2059600 | Ga0466967_2059600_188_502 | 104 |
| 512 | 3300046454 | Ga0495592_0409566 | Ga0495592_0409566_117_437 | 104 |
| 513 | 3300046455 | Ga0495603_0133889 | Ga0495603_0133889_132_449 | 104 |
| 514 | 3300046459 | Ga0495629_0152338 | Ga0495629_0152338_216_536 | 104 |
| 515 | 3300046459 | Ga0495629_0501630 | Ga0495629_0501630_223_549 | 104 |
| 516 | 3300046459 | Ga0495629_0976300 | Ga0495629_0976300_179_499 | 104 |
| 517 | 3300046461 | Ga0495641_0097610 | Ga0495641_0097610_567_881 | 104 |
| 518 | 3300046461 | Ga0495641_0112967 | Ga0495641_0112967_821_1138 | 104 |
| 519 | 3300046462 | Ga0495651_0507553 | Ga0495651_0507553_283_603 | 104 |
| 520 | 3300046463 | Ga0495653_0426913 | Ga0495653_0426913_267_587 | 104 |
| 521 | 3300046463 | Ga0495653_0586206 | Ga0495653_0586206_180_494 | 104 |
| 522 | 3300046471 | Ga0495650_0271392 | Ga0495650_0271392_123_437 | 104 |
| 523 | 3300046499 | Ga0495594_0727285 | Ga0495594_0727285_80_397 | 104 |
| 524 | 3300046500 | Ga0495596_0130294 | Ga0495596_0130294_144_464 | 104 |
| 525 | 3300046501 | Ga0495607_0159700 | Ga0495607_0159700_804_1118 | 104 |
| 526 | 3300046511 | Ga0495608_0361634 | Ga0495608_0361634_431_751 | 104 |
| 527 | 3300046511 | Ga0495608_0385480 | Ga0495608_0385480_102_422 | 104 |
| 528 | 3300046515 | Ga0495620_0095563 | Ga0495620_0095563_438_758 | 104 |
| 529 | 3300046516 | Ga0495628_0197758 | Ga0495628_0197758_1085_1405 | 104 |
| 530 | 3300046517 | Ga0495630_0270915 | Ga0495630_0270915_560_880 | 104 |
| 531 | 3300046522 | Ga0495643_0373764 | Ga0495643_0373764_294_608 | 104 |
| 532 | 3300046526 | Ga0495666_0465691 | Ga0495666_0465691_13_330 | 104 |
| 533 | 3300046531 | Ga0495665_0121367 | Ga0495665_0121367_41_361 | 104 |
| 534 | 3300046533 | Ga0495640_0330009 | Ga0495640_0330009_520_840 | 104 |
| 535 | 3300046535 | Ga0495586_0296082 | Ga0495586_0296082_150_470 | 104 |
| 536 | 3300046559 | Ga0495667_0248101 | Ga0495667_0248101_679_999 | 104 |
| 537 | 3300046642 | Ga0495634_0303502 | Ga0495634_0303502_497_811 | 104 |
| 538 | 3300046663 | Ga0495635_0576459 | Ga0495635_0576459_287_607 | 104 |
| 539 | 3300046663 | Ga0495635_0812716 | Ga0495635_0812716_223_543 | 104 |
| 540 | 3300046674 | Ga0495588_0125822 | Ga0495588_0125822_948_1265 | 104 |
| 541 | 3300046675 | Ga0495657_0311003 | Ga0495657_0311003_449_769 | 104 |
| 542 | 3300046678 | Ga0495599_0113565 | Ga0495599_0113565_471_791 | 104 |
| 543 | 3300046680 | Ga0495646_0139571 | Ga0495646_0139571_362_682 | 104 |
| 544 | 3300046681 | Ga0495647_0464116 | Ga0495647_0464116_129_449 | 104 |
| 545 | 3300046689 | Ga0495613_0503077 | Ga0495613_0503077_75_395 | 104 |
| 546 | 3300046690 | Ga0495624_0169708 | Ga0495624_0169708_933_1250 | 104 |
| 547 | 3300047315 | Ga0495581_0119575 | Ga0495581_0119575_249_569 | 104 |
| 548 | 3300047317 | Ga0495604_0481382 | Ga0495604_0481382_328_642 | 104 |
| 549 | 3300047321 | Ga0495676_0985966 | Ga0495676_0985966_150_470 | 104 |
| 550 | 3300047322 | Ga0495680_0081426 | Ga0495680_0081426_1257_1577 | 104 |
| 551 | 3300047322 | Ga0495680_0452336 | Ga0495680_0452336_244_564 | 104 |
| 552 | 3300047323 | Ga0495683_0003613 | Ga0495683_0003613_3944_4258 | 104 |
| 553 | 3300047323 | Ga0495683_0423570 | Ga0495683_0423570_41_355 | 104 |
| 554 | 3300047673 | Ga0495593_0053150 | Ga0495593_0053150_442_762 | 104 |
| 555 | 3300048089 | Ga0495614_0147013 | Ga0495614_0147013_343_663 | 104 |
| 556 | 3300048089 | Ga0495614_0235608 | Ga0495614_0235608_440_760 | 104 |
| 557 | 3300048903 | Ga0496100_0046841 | Ga0496100_0046841_2162_2479 | 104 |
| 558 | 3300048903 | Ga0496100_0374454 | Ga0496100_0374454_745_1065 | 104 |
| 559 | 3300048903 | Ga0496100_0418445 | Ga0496100_0418445_295_609 | 104 |
| 560 | 3300048904 | Ga0496101_0091947 | Ga0496101_0091947_1926_2243 | 104 |
| 561 | 3300048904 | Ga0496101_0275312 | Ga0496101_0275312_476_796 | 104 |
| 562 | 3300048904 | Ga0496101_0278475 | Ga0496101_0278475_850_1170 | 104 |
| 563 | 3300048904 | Ga0496101_0927603 | Ga0496101_0927603_297_611 | 104 |
| 564 | 3300048905 | Ga0496102_0132676 | Ga0496102_0132676_906_1223 | 104 |
| 565 | 3300048905 | Ga0496102_0600891 | Ga0496102_0600891_192_512 | 104 |
| 566 | 3300048906 | Ga0496103_0169432 | Ga0496103_0169432_753_1073 | 104 |
| 567 | 3300048906 | Ga0496103_0278591 | Ga0496103_0278591_512_829 | 104 |
| 568 | 3300048907 | Ga0496104_0004123 | Ga0496104_0004123_426_746 | 104 |
| 569 | 3300048907 | Ga0496104_0082973 | Ga0496104_0082973_1812_2129 | 104 |
| 570 | 3300048907 | Ga0496104_0283996 | Ga0496104_0283996_1200_1514 | 104 |
| 571 | 3300048908 | Ga0496105_0275374 | Ga0496105_0275374_938_1258 | 104 |
| 572 | 3300048908 | Ga0496105_0380333 | Ga0496105_0380333_381_701 | 104 |
| 573 | 3300048909 | Ga0496106_0132106 | Ga0496106_0132106_1030_1347 | 104 |
| 574 | 3300048909 | Ga0496106_0376036 | Ga0496106_0376036_336_650 | 104 |
| 575 | 3300048909 | Ga0496106_1487203 | Ga0496106_1487203_32_352 | 104 |
| 576 | 3300048910 | Ga0496107_0519136 | Ga0496107_0519136_66_380 | 104 |
| 577 | 3300048910 | Ga0496107_1198345 | Ga0496107_1198345_150_470 | 104 |
| 578 | 3300048911 | Ga0496108_0075461 | Ga0496108_0075461_1794_2114 | 104 |
| 579 | 3300048911 | Ga0496108_0112101 | Ga0496108_0112101_203_520 | 104 |
| 580 | 3300048911 | Ga0496108_0128186 | Ga0496108_0128186_39_353 | 104 |
| 581 | 3300048911 | Ga0496108_0849852 | Ga0496108_0849852_316_630 | 104 |
| 582 | 3300048912 | Ga0496109_0008622 | Ga0496109_0008622_7080_7400 | 104 |
| 583 | 3300048912 | Ga0496109_0049417 | Ga0496109_0049417_829_1146 | 104 |
| 584 | 3300048912 | Ga0496109_0162421 | Ga0496109_0162421_103_423 | 104 |
| 585 | 3300048912 | Ga0496109_0441050 | Ga0496109_0441050_540_854 | 104 |
| 586 | 3300048912 | Ga0496109_1357651 | Ga0496109_1357651_239_553 | 104 |
| 587 | 3300048913 | Ga0496110_0004143 | Ga0496110_0004143_5523_5843 | 104 |
| 588 | 3300048913 | Ga0496110_0331538 | Ga0496110_0331538_850_1164 | 104 |
| 589 | 3300048913 | Ga0496110_0645854 | Ga0496110_0645854_149_469 | 104 |
| 590 | 3300048913 | Ga0496110_0883779 | Ga0496110_0883779_195_515 | 104 |
| 591 | 3300048914 | Ga0496111_0000712 | Ga0496111_0000712_15520_15840 | 104 |
| 592 | 3300048914 | Ga0496111_0210201 | Ga0496111_0210201_803_1117 | 104 |
| 593 | 3300048914 | Ga0496111_0839625 | Ga0496111_0839625_101_418 | 104 |
| 594 | 3300048915 | Ga0496112_0162970 | Ga0496112_0162970_1560_1880 | 104 |
| 595 | 3300048915 | Ga0496112_0723686 | Ga0496112_0723686_101_418 | 104 |
| 596 | 3300048916 | Ga0496113_0087743 | Ga0496113_0087743_1752_2069 | 104 |
| 597 | 3300048916 | Ga0496113_0252450 | Ga0496113_0252450_282_602 | 104 |
| 598 | 3300048917 | Ga0496114_0007373 | Ga0496114_0007373_6738_7052 | 104 |
| 599 | 3300048917 | Ga0496114_0014309 | Ga0496114_0014309_3361_3681 | 104 |
| 600 | 3300048917 | Ga0496114_0051545 | Ga0496114_0051545_2319_2636 | 104 |
| 601 | 3300048917 | Ga0496114_0193477 | Ga0496114_0193477_484_804 | 104 |
| 602 | 3300048917 | Ga0496114_0320915 | Ga0496114_0320915_685_999 | 104 |
| 603 | 3300048917 | Ga0496114_0386795 | Ga0496114_0386795_381_695 | 104 |
| 604 | 3300048917 | Ga0496114_0719552 | Ga0496114_0719552_54_374 | 104 |
| 605 | 3300048918 | Ga0496115_0006695 | Ga0496115_0006695_59_376 | 104 |
| 606 | 3300049160 | Ga0501304_015291 | Ga0501304_015291_209_523 | 104 |
| 607 | 3300049162 | Ga0501307_020577 | Ga0501307_020577_209_523 | 104 |
| 608 | 3300049527 | Ga0501311_055393 | Ga0501311_055393_269_583 | 104 |
| 609 | 3300049530 | Ga0501314_001516 | Ga0501314_001516_283_597 | 104 |
| 610 | 3300049531 | Ga0501315_001744 | Ga0501315_001744_1329_1643 | 104 |
| 611 | 3300049533 | Ga0501317_000360 | Ga0501317_000360_2310_2624 | 104 |
| 612 | 3300049534 | Ga0501318_001561 | Ga0501318_001561_1294_1608 | 104 |
| 613 | 3300049534 | Ga0501318_010783 | Ga0501318_010783_356_670 | 104 |
| 614 | 3300049534 | Ga0501318_078349 | Ga0501318_078349_129_443 | 104 |
| 615 | 3300049538 | Ga0501322_000741 | Ga0501322_000741_303_617 | 104 |
| 616 | 3300049541 | Ga0501325_018505 | Ga0501325_018505_182_496 | 104 |
| 617 | 3300049572 | Ga0501036_1647155 | Ga0501036_1647155_130_444 | 104 |
| 618 | 3300049581 | Ga0501047_0989925 | Ga0501047_0989925_225_539 | 104 |
| 619 | 3300049587 | Ga0501071_0933851 | Ga0501071_0933851_325_639 | 104 |
| 620 | 3300049741 | Ga0501079_0443133 | Ga0501079_0443133_557_871 | 104 |
| 621 | 3300049824 | Ga0501045_0427182 | Ga0501045_0427182_389_703 | 104 |
| 622 | 3300050508 | nmdc:mga09592_585309_c1 | nmdc:mga09592_585309_c1_273_587 | 104 |
| 623 | 3300050509 | nmdc:mga0qj67_612112_c1 | nmdc:mga0qj67_612112_c1_508_822 | 104 |
| 624 | 3300050510 | nmdc:mga06r32_136_c2 | nmdc:mga06r32_136_c2_2307_2621 | 104 |
| 625 | 3300050512 | nmdc:mga0n895_1035878_c1 | nmdc:mga0n895_1035878_c1_46_360 | 104 |
| 626 | 3300050512 | nmdc:mga0n895_505221_c1 | nmdc:mga0n895_505221_c1_834_1151 | 104 |
| 627 | 3300050513 | nmdc:mga0rr50_61245_c1 | nmdc:mga0rr50_61245_c1_747_1064 | 104 |
| 628 | 3300050515 | nmdc:mga0a205_19433_c1 | nmdc:mga0a205_19433_c1_4568_4885 | 104 |
| 629 | 3300050515 | nmdc:mga0a205_594190_c1 | nmdc:mga0a205_594190_c1_446_760 | 104 |
| 630 | 3300053077 | Ga0495601_0227312 | Ga0495601_0227312_149_469 | 104 |
| 631 | 3300053085 | Ga0495619_0005374 | Ga0495619_0005374_3624_3941 | 104 |
| 632 | 3300053085 | Ga0495619_0258467 | Ga0495619_0258467_805_1125 | 104 |
| 633 | 3300053142 | Ga0500577_0001143 | Ga0500577_0001143_1638_1952 | 104 |
| 634 | 3300059423 | Ga0590074_107646 | Ga0590074_107646_69_383 | 104 |
| 635 | 3300059477 | Ga0587084_042301 | Ga0587084_042301_165_479 | 104 |
| 636 | 3300059490 | Ga0587066_041351 | Ga0587066_041351_186_500 | 104 |
| 637 | 3300059491 | Ga0587070_151233 | Ga0587070_151233_158_472 | 104 |
| 638 | 3300059493 | Ga0587077_088052 | Ga0587077_088052_383_697 | 104 |
| 639 | 3300059504 | Ga0587082_126319 | Ga0587082_126319_95_409 | 104 |
| 640 | 3300059504 | Ga0587082_145273 | Ga0587082_145273_152_466 | 104 |
| 641 | 3300059506 | Ga0587085_129987 | Ga0587085_129987_99_413 | 104 |
| 642 | 3300059510 | Ga0587090_102412 | Ga0587090_102412_50_364 | 104 |
| 643 | 3300059511 | Ga0587091_177986 | Ga0587091_177986_96_410 | 104 |
| 644 | 3300059604 | Ga0587098_018155 | Ga0587098_018155_233_547 | 104 |
| 645 | 3300059623 | Ga0587101_103658 | Ga0587101_103658_232_546 | 104 |
| 646 | 3300059624 | Ga0587109_173845 | Ga0587109_173845_97_411 | 104 |
| 647 | 3300059625 | Ga0587113_041675 | Ga0587113_041675_137_451 | 104 |
| 648 | 3300059627 | Ga0587117_095107 | Ga0587117_095107_136_450 | 104 |
| 649 | 3300059630 | Ga0587128_107440 | Ga0587128_107440_72_386 | 104 |
| 650 | 3300059640 | Ga0587067_166836 | Ga0587067_166836_102_416 | 104 |
| 651 | 3300059641 | Ga0587068_138276 | Ga0587068_138276_95_409 | 104 |
| 652 | 3300059643 | Ga0587072_075794 | Ga0587072_075794_283_603 | 104 |
| 653 | 3300059644 | Ga0587075_110658 | Ga0587075_110658_83_397 | 104 |
| 654 | 3300059646 | Ga0587078_046642 | Ga0587078_046642_19_333 | 104 |
| 655 | 3300059648 | Ga0587100_021312 | Ga0587100_021312_40_354 | 104 |
| 656 | 3300061719 | Ga0466962_0003094 | Ga0466962_0003094_4083_4397 | 104 |
| 657 | iso_pu_bacteria | 2558860112 | 2558913547 | 104 |
| 658 | iso_pu_bacteria | 2870782633 | 2870783357 | 104 |
| 659 | iso_pu_bacteria | 2915358134 | 2915361152 | 104 |
| 660 | iso_pu_bacteria | 8054472261 | 8054477903 | 104 |
| 661 | 3300005331 | Ga0070670_100441180 | Ga0070670_1004411801 | 105 |
| 662 | 3300005436 | Ga0070713_102150378 | Ga0070713_1021503781 | 105 |
| 663 | 3300012491 | Ga0157329_1012942 | Ga0157329_10129421 | 105 |
| 664 | 3300025917 | Ga0207660_10565719 | Ga0207660_105657192 | 105 |
| 665 | 3300025929 | Ga0207664_11393969 | Ga0207664_113939692 | 105 |
| 666 | 3300031251 | Ga0265327_10000165 | Ga0265327_1000016575 | 105 |
| 667 | 3300041451 | Ga0451791_1865944 | Ga0451791_1865944_284_601 | 105 |
| 668 | 3300041452 | Ga0451793_0363264 | Ga0451793_0363264_152_469 | 105 |
| 669 | 3300042005 | Ga0439448_0079846 | Ga0439448_0079846_158_475 | 105 |
| 670 | 3300042008 | Ga0439450_171774 | Ga0439450_171774_185_502 | 105 |
| 671 | 3300042016 | Ga0439463_129239 | Ga0439463_129239_111_428 | 105 |
| 672 | 3300053087 | Ga0500643_061101 | Ga0500643_061101_538_855 | 105 |
| 673 | 3300059508 | Ga0587088_041584 | Ga0587088_041584_43_390 | 105 |
| 674 | 3300041446 | Ga0451794_14393 | Ga0451794_14393_85_408 | 106 |
| 675 | 3300046675 | Ga0495657_0572344 | Ga0495657_0572344_188_511 | 106 |
| 676 | 3300047322 | Ga0495680_0694450 | Ga0495680_0694450_118_441 | 106 |
| 677 | 3300049533 | Ga0501317_049713 | Ga0501317_049713_124_474 | 106 |
| 678 | 3300053077 | Ga0495601_0886511 | Ga0495601_0886511_125_448 | 106 |
| 679 | 3300053085 | Ga0495619_0338314 | Ga0495619_0338314_433_756 | 106 |
| 680 | 3300048912 | Ga0496109_0629980 | Ga0496109_0629980_24_362 | 107 |
| 681 | 3300000549 | LJQas_1002850 | LJQas_10028505 | 108 |
| 682 | 3300001976 | JGI24752J21851_1034974 | JGI24752J21851_10349741 | 108 |
| 683 | 3300001978 | JGI24747J21853_1030775 | JGI24747J21853_10307751 | 108 |
| 684 | 3300001990 | JGI24737J22298_10042080 | JGI24737J22298_100420802 | 108 |
| 685 | 3300002070 | JGI24750J21931_1074411 | JGI24750J21931_10744111 | 108 |
| 686 | 3300002073 | JGI24745J21846_1000243 | JGI24745J21846_10002437 | 108 |
| 687 | 3300002075 | JGI24738J21930_10015789 | JGI24738J21930_100157893 | 108 |
| 688 | 3300002077 | JGI24744J21845_10012957 | JGI24744J21845_100129575 | 108 |
| 689 | 3300002244 | JGI24742J22300_10029422 | JGI24742J22300_100294222 | 108 |
| 690 | 3300004803 | Ga0058862_10080862 | Ga0058862_100808622 | 108 |
| 691 | 3300005327 | Ga0070658_10199380 | Ga0070658_101993803 | 108 |
| 692 | 3300005328 | Ga0070676_10189555 | Ga0070676_101895552 | 108 |
| 693 | 3300005330 | Ga0070690_100087745 | Ga0070690_1000877452 | 108 |
| 694 | 3300005331 | Ga0070670_100856445 | Ga0070670_1008564452 | 108 |
| 695 | 3300005334 | Ga0068869_100245279 | Ga0068869_1002452792 | 108 |
| 696 | 3300005335 | Ga0070666_10137813 | Ga0070666_101378131 | 108 |
| 697 | 3300005336 | Ga0070680_100657954 | Ga0070680_1006579542 | 108 |
| 698 | 3300005337 | Ga0070682_100520150 | Ga0070682_1005201502 | 108 |
| 699 | 3300005337 | Ga0070682_100521336 | Ga0070682_1005213362 | 108 |
| 700 | 3300005338 | Ga0068868_100074056 | Ga0068868_1000740563 | 108 |
| 701 | 3300005340 | Ga0070689_100090963 | Ga0070689_1000909635 | 108 |
| 702 | 3300005341 | Ga0070691_10009448 | Ga0070691_100094487 | 108 |
| 703 | 3300005343 | Ga0070687_100024177 | Ga0070687_1000241771 | 108 |
| 704 | 3300005344 | Ga0070661_100280908 | Ga0070661_1002809083 | 108 |
| 705 | 3300005345 | Ga0070692_10188920 | Ga0070692_101889202 | 108 |
| 706 | 3300005354 | Ga0070675_100176989 | Ga0070675_1001769892 | 108 |
| 707 | 3300005355 | Ga0070671_100002908 | Ga0070671_1000029083 | 108 |
| 708 | 3300005355 | Ga0070671_101050666 | Ga0070671_1010506662 | 108 |
| 709 | 3300005356 | Ga0070674_100459571 | Ga0070674_1004595712 | 108 |
| 710 | 3300005364 | Ga0070673_100059361 | Ga0070673_1000593616 | 108 |
| 711 | 3300005365 | Ga0070688_100903748 | Ga0070688_1009037482 | 108 |
| 712 | 3300005366 | Ga0070659_100507476 | Ga0070659_1005074762 | 108 |
| 713 | 3300005367 | Ga0070667_100219896 | Ga0070667_1002198964 | 108 |
| 714 | 3300005367 | Ga0070667_100326734 | Ga0070667_1003267342 | 108 |
| 715 | 3300005434 | Ga0070709_10181387 | Ga0070709_101813871 | 108 |
| 716 | 3300005435 | Ga0070714_100420008 | Ga0070714_1004200082 | 108 |
| 717 | 3300005436 | Ga0070713_100785157 | Ga0070713_1007851572 | 108 |
| 718 | 3300005441 | Ga0070700_100073217 | Ga0070700_1000732171 | 108 |
| 719 | 3300005455 | Ga0070663_100554009 | Ga0070663_1005540092 | 108 |
| 720 | 3300005456 | Ga0070678_100408293 | Ga0070678_1004082933 | 108 |
| 721 | 3300005457 | Ga0070662_100010423 | Ga0070662_1000104234 | 108 |
| 722 | 3300005459 | Ga0068867_100174159 | Ga0068867_1001741594 | 108 |
| 723 | 3300005539 | Ga0068853_100047914 | Ga0068853_1000479147 | 108 |
| 724 | 3300005543 | Ga0070672_100620975 | Ga0070672_1006209752 | 108 |
| 725 | 3300005544 | Ga0070686_100452261 | Ga0070686_1004522611 | 108 |
| 726 | 3300005547 | Ga0070693_100022732 | Ga0070693_1000227326 | 108 |
| 727 | 3300005548 | Ga0070665_100001905 | Ga0070665_10000190525 | 108 |
| 728 | 3300005563 | Ga0068855_100454811 | Ga0068855_1004548114 | 108 |
| 729 | 3300005564 | Ga0070664_100193563 | Ga0070664_1001935633 | 108 |
| 730 | 3300005615 | Ga0070702_100351318 | Ga0070702_1003513182 | 108 |
| 731 | 3300005617 | Ga0068859_100147339 | Ga0068859_1001473396 | 108 |
| 732 | 3300005618 | Ga0068864_100444907 | Ga0068864_1004449072 | 108 |
| 733 | 3300005718 | Ga0068866_10138132 | Ga0068866_101381323 | 108 |
| 734 | 3300005719 | Ga0068861_100370948 | Ga0068861_1003709483 | 108 |
| 735 | 3300005834 | Ga0068851_10036865 | Ga0068851_100368654 | 108 |
| 736 | 3300005841 | Ga0068863_100016860 | Ga0068863_10001686012 | 108 |
| 737 | 3300005841 | Ga0068863_101146536 | Ga0068863_1011465362 | 108 |
| 738 | 3300005842 | Ga0068858_100820984 | Ga0068858_1008209842 | 108 |
| 739 | 3300005843 | Ga0068860_100133717 | Ga0068860_1001337175 | 108 |
| 740 | 3300005843 | Ga0068860_100648520 | Ga0068860_1006485202 | 108 |
| 741 | 3300005844 | Ga0068862_100072571 | Ga0068862_1000725714 | 108 |
| 742 | 3300005937 | Ga0081455_10093970 | Ga0081455_100939705 | 108 |
| 743 | 3300005985 | Ga0081539_10046704 | Ga0081539_100467046 | 108 |
| 744 | 3300006028 | Ga0070717_10912914 | Ga0070717_109129142 | 108 |
| 745 | 3300006058 | Ga0075432_10399545 | Ga0075432_103995452 | 108 |
| 746 | 3300006163 | Ga0070715_11001389 | Ga0070715_110013892 | 108 |
| 747 | 3300006880 | Ga0075429_100996159 | Ga0075429_1009961592 | 108 |
| 748 | 3300006881 | Ga0068865_100097354 | Ga0068865_1000973545 | 108 |
| 749 | 3300006931 | Ga0097620_100147323 | Ga0097620_1001473232 | 108 |
| 750 | 3300009011 | Ga0105251_10045771 | Ga0105251_100457712 | 108 |
| 751 | 3300009092 | Ga0105250_10094518 | Ga0105250_100945182 | 108 |
| 752 | 3300009094 | Ga0111539_10237960 | Ga0111539_102379602 | 108 |
| 753 | 3300009098 | Ga0105245_11363803 | Ga0105245_113638032 | 108 |
| 754 | 3300009148 | Ga0105243_11125913 | Ga0105243_111259132 | 108 |
| 755 | 3300009174 | Ga0105241_12133436 | Ga0105241_121334361 | 108 |
| 756 | 3300009176 | Ga0105242_10405932 | Ga0105242_104059323 | 108 |
| 757 | 3300009176 | Ga0105242_11633938 | Ga0105242_116339382 | 108 |
| 758 | 3300009177 | Ga0105248_10215631 | Ga0105248_102156312 | 108 |
| 759 | 3300009545 | Ga0105237_10385726 | Ga0105237_103857263 | 108 |
| 760 | 3300009551 | Ga0105238_10436006 | Ga0105238_104360062 | 108 |
| 761 | 3300009553 | Ga0105249_10792124 | Ga0105249_107921242 | 108 |
| 762 | 3300010375 | Ga0105239_10330525 | Ga0105239_103305252 | 108 |
| 763 | 3300013100 | Ga0157373_10461937 | Ga0157373_104619372 | 108 |
| 764 | 3300013105 | Ga0157369_10086187 | Ga0157369_100861876 | 108 |
| 765 | 3300013296 | Ga0157374_10331172 | Ga0157374_103311724 | 108 |
| 766 | 3300013297 | Ga0157378_10088855 | Ga0157378_100888552 | 108 |
| 767 | 3300013307 | Ga0157372_10313074 | Ga0157372_103130742 | 108 |
| 768 | 3300013308 | Ga0157375_10179713 | Ga0157375_101797132 | 108 |
| 769 | 3300014745 | Ga0157377_10166573 | Ga0157377_101665732 | 108 |
| 770 | 3300014968 | Ga0157379_10009261 | Ga0157379_100092616 | 108 |
| 771 | 3300014968 | Ga0157379_10124714 | Ga0157379_101247142 | 108 |
| 772 | 3300014969 | Ga0157376_10089329 | Ga0157376_100893293 | 108 |
| 773 | 3300017792 | Ga0163161_10098940 | Ga0163161_100989402 | 108 |
| 774 | 3300020069 | Ga0197907_10318291 | Ga0197907_103182912 | 108 |
| 775 | 3300020078 | Ga0206352_10764106 | Ga0206352_107641062 | 108 |
| 776 | 3300020080 | Ga0206350_10993920 | Ga0206350_109939204 | 108 |
| 777 | 3300020081 | Ga0206354_10278938 | Ga0206354_102789382 | 108 |
| 778 | 3300020082 | Ga0206353_11042006 | Ga0206353_110420062 | 108 |
| 779 | 3300021384 | Ga0213876_10047350 | Ga0213876_100473504 | 108 |
| 780 | 3300025321 | Ga0207656_10042243 | Ga0207656_100422434 | 108 |
| 781 | 3300025899 | Ga0207642_10062373 | Ga0207642_100623732 | 108 |
| 782 | 3300025900 | Ga0207710_10052355 | Ga0207710_100523551 | 108 |
| 783 | 3300025901 | Ga0207688_10108103 | Ga0207688_101081034 | 108 |
| 784 | 3300025903 | Ga0207680_10699813 | Ga0207680_106998132 | 108 |
| 785 | 3300025904 | Ga0207647_10049984 | Ga0207647_100499846 | 108 |
| 786 | 3300025907 | Ga0207645_10006241 | Ga0207645_1000624111 | 108 |
| 787 | 3300025908 | Ga0207643_10011760 | Ga0207643_100117606 | 108 |
| 788 | 3300025909 | Ga0207705_10367140 | Ga0207705_103671402 | 108 |
| 789 | 3300025911 | Ga0207654_10300849 | Ga0207654_103008492 | 108 |
| 790 | 3300025913 | Ga0207695_11262625 | Ga0207695_112626252 | 108 |
| 791 | 3300025918 | Ga0207662_10009419 | Ga0207662_100094197 | 108 |
| 792 | 3300025919 | Ga0207657_10020254 | Ga0207657_100202549 | 108 |
| 793 | 3300025920 | Ga0207649_10615582 | Ga0207649_106155822 | 108 |
| 794 | 3300025921 | Ga0207652_10233560 | Ga0207652_102335604 | 108 |
| 795 | 3300025924 | Ga0207694_10823824 | Ga0207694_108238241 | 108 |
| 796 | 3300025927 | Ga0207687_10345013 | Ga0207687_103450133 | 108 |
| 797 | 3300025928 | Ga0207700_10096353 | Ga0207700_100963536 | 108 |
| 798 | 3300025929 | Ga0207664_10118147 | Ga0207664_101181472 | 108 |
| 799 | 3300025931 | Ga0207644_10001330 | Ga0207644_1000133021 | 108 |
| 800 | 3300025931 | Ga0207644_10331563 | Ga0207644_103315634 | 108 |
| 801 | 3300025933 | Ga0207706_10016976 | Ga0207706_100169765 | 108 |
| 802 | 3300025935 | Ga0207709_10052364 | Ga0207709_100523642 | 108 |
| 803 | 3300025936 | Ga0207670_10141571 | Ga0207670_101415714 | 108 |
| 804 | 3300025937 | Ga0207669_10170726 | Ga0207669_101707263 | 108 |
| 805 | 3300025938 | Ga0207704_10246965 | Ga0207704_102469654 | 108 |
| 806 | 3300025939 | Ga0207665_10485759 | Ga0207665_104857592 | 108 |
| 807 | 3300025940 | Ga0207691_10052644 | Ga0207691_100526443 | 108 |
| 808 | 3300025941 | Ga0207711_10121462 | Ga0207711_101214625 | 108 |
| 809 | 3300025942 | Ga0207689_10017438 | Ga0207689_100174383 | 108 |
| 810 | 3300025945 | Ga0207679_11153116 | Ga0207679_111531162 | 108 |
| 811 | 3300025949 | Ga0207667_10419184 | Ga0207667_104191842 | 108 |
| 812 | 3300025961 | Ga0207712_10527653 | Ga0207712_105276532 | 108 |
| 813 | 3300025972 | Ga0207668_10143504 | Ga0207668_101435043 | 108 |
| 814 | 3300025972 | Ga0207668_10877481 | Ga0207668_108774811 | 108 |
| 815 | 3300025981 | Ga0207640_10030986 | Ga0207640_100309868 | 108 |
| 816 | 3300026023 | Ga0207677_10440473 | Ga0207677_104404732 | 108 |
| 817 | 3300026067 | Ga0207678_10022601 | Ga0207678_1002260111 | 108 |
| 818 | 3300026075 | Ga0207708_10015459 | Ga0207708_100154596 | 108 |
| 819 | 3300026088 | Ga0207641_10003356 | Ga0207641_1000335612 | 108 |
| 820 | 3300026088 | Ga0207641_10141048 | Ga0207641_101410485 | 108 |
| 821 | 3300026089 | Ga0207648_10008491 | Ga0207648_100084918 | 108 |
| 822 | 3300026095 | Ga0207676_10624231 | Ga0207676_106242312 | 108 |
| 823 | 3300026116 | Ga0207674_10011658 | Ga0207674_1001165810 | 108 |
| 824 | 3300026118 | Ga0207675_100014683 | Ga0207675_1000146834 | 108 |
| 825 | 3300026121 | Ga0207683_10030091 | Ga0207683_100300913 | 108 |
| 826 | 3300026142 | Ga0207698_10922821 | Ga0207698_109228212 | 108 |
| 827 | 3300028379 | Ga0268266_10084776 | Ga0268266_100847762 | 108 |
| 828 | 3300028379 | Ga0268266_10149683 | Ga0268266_101496835 | 108 |
| 829 | 3300028380 | Ga0268265_10197645 | Ga0268265_101976455 | 108 |
| 830 | 3300028381 | Ga0268264_10034736 | Ga0268264_100347369 | 108 |
| 831 | 3300028381 | Ga0268264_10156370 | Ga0268264_101563706 | 108 |
| 832 | 3300031995 | Ga0307409_100953740 | Ga0307409_1009537402 | 108 |
| 833 | 3300035115 | Ga0373941_0109602 | Ga0373941_0109602_259_588 | 108 |
| 834 | 3300035119 | Ga0373956_0470657 | Ga0373956_0470657_239_565 | 108 |
| 835 | 3300035207 | Ga0373942_0133563 | Ga0373942_0133563_164_493 | 108 |
| 836 | 3300035691 | Ga0373931_0028935 | Ga0373931_0028935_2391_2720 | 108 |
| 837 | 3300037471 | Ga0395905_0135257 | Ga0395905_0135257_754_1083 | 108 |
| 838 | 3300038443 | Ga0395901_1254022 | Ga0395901_1254022_104_433 | 108 |
| 839 | 3300039437 | Ga0436365_1725899 | Ga0436365_1725899_3739_4065 | 108 |
| 840 | 3300039450 | Ga0436363_0697187 | Ga0436363_0697187_617_943 | 108 |
| 841 | 3300044683 | Ga0466965_0007902 | Ga0466965_0007902_277_606 | 108 |
| 842 | 3300044694 | Ga0466963_0320336 | Ga0466963_0320336_247_573 | 108 |
| 843 | 3300044694 | Ga0466963_0681869 | Ga0466963_0681869_349_675 | 108 |
| 844 | 3300044706 | Ga0466964_0270334 | Ga0466964_0270334_15_344 | 108 |
| 845 | 3300044719 | Ga0466971_0422736 | Ga0466971_0422736_149_478 | 108 |
| 846 | 3300044901 | Ga0466960_0007532 | Ga0466960_0007532_2517_2846 | 108 |
| 847 | 3300045049 | Ga0466959_0461104 | Ga0466959_0461104_186_515 | 108 |
| 848 | 3300045836 | Ga0466958_0057813 | Ga0466958_0057813_1011_1337 | 108 |
| 849 | 3300045836 | Ga0466958_0334773 | Ga0466958_0334773_423_752 | 108 |
| 850 | 3300045836 | Ga0466958_0459816 | Ga0466958_0459816_169_495 | 108 |
| 851 | 3300045976 | Ga0466967_0048690 | Ga0466967_0048690_1039_1365 | 108 |
| 852 | 3300045976 | Ga0466967_1184008 | Ga0466967_1184008_108_434 | 108 |
| 853 | 3300046507 | Ga0495606_0237907 | Ga0495606_0237907_334_663 | 108 |
| 854 | 3300046515 | Ga0495620_0240301 | Ga0495620_0240301_315_644 | 108 |
| 855 | 3300046537 | Ga0495598_0048912 | Ga0495598_0048912_573_902 | 108 |
| 856 | 3300046694 | Ga0495649_0376587 | Ga0495649_0376587_74_403 | 108 |
| 857 | 3300048903 | Ga0496100_0002817 | Ga0496100_0002817_8092_8421 | 108 |
| 858 | 3300048903 | Ga0496100_0329159 | Ga0496100_0329159_219_548 | 108 |
| 859 | 3300048904 | Ga0496101_0019981 | Ga0496101_0019981_125_454 | 108 |
| 860 | 3300048904 | Ga0496101_0153999 | Ga0496101_0153999_878_1207 | 108 |
| 861 | 3300048905 | Ga0496102_0000521 | Ga0496102_0000521_18495_18824 | 108 |
| 862 | 3300048905 | Ga0496102_0174227 | Ga0496102_0174227_1523_1852 | 108 |
| 863 | 3300048906 | Ga0496103_0000453 | Ga0496103_0000453_6657_6986 | 108 |
| 864 | 3300048906 | Ga0496103_0104531 | Ga0496103_0104531_696_1025 | 108 |
| 865 | 3300048907 | Ga0496104_0011710 | Ga0496104_0011710_1900_2229 | 108 |
| 866 | 3300048907 | Ga0496104_0373568 | Ga0496104_0373568_78_407 | 108 |
| 867 | 3300048908 | Ga0496105_0037579 | Ga0496105_0037579_1201_1530 | 108 |
| 868 | 3300048908 | Ga0496105_0128707 | Ga0496105_0128707_378_707 | 108 |
| 869 | 3300048909 | Ga0496106_0098087 | Ga0496106_0098087_1658_1987 | 108 |
| 870 | 3300048909 | Ga0496106_0749813 | Ga0496106_0749813_252_581 | 108 |
| 871 | 3300048910 | Ga0496107_0727678 | Ga0496107_0727678_322_651 | 108 |
| 872 | 3300048911 | Ga0496108_0103562 | Ga0496108_0103562_43_372 | 108 |
| 873 | 3300048912 | Ga0496109_0368258 | Ga0496109_0368258_117_446 | 108 |
| 874 | 3300048912 | Ga0496109_0658037 | Ga0496109_0658037_157_486 | 108 |
| 875 | 3300048913 | Ga0496110_0110005 | Ga0496110_0110005_1958_2287 | 108 |
| 876 | 3300048913 | Ga0496110_1393355 | Ga0496110_1393355_123_452 | 108 |
| 877 | 3300048914 | Ga0496111_0298442 | Ga0496111_0298442_357_686 | 108 |
| 878 | 3300048915 | Ga0496112_0072471 | Ga0496112_0072471_1825_2154 | 108 |
| 879 | 3300048918 | Ga0496115_0166871 | Ga0496115_0166871_743_1072 | 108 |
| 880 | 3300048919 | Ga0496116_0000173 | Ga0496116_0000173_16333_16662 | 108 |
| 881 | 3300048920 | Ga0496117_0000144 | Ga0496117_0000144_146911_147240 | 108 |
| 882 | 3300048921 | Ga0496118_0000096 | Ga0496118_0000096_79242_79571 | 108 |
| 883 | 3300048922 | Ga0496119_0003189 | Ga0496119_0003189_1992_2321 | 108 |
| 884 | 3300048923 | Ga0496120_0004033 | Ga0496120_0004033_6573_6902 | 108 |
| 885 | 3300048924 | Ga0496121_0005885 | Ga0496121_0005885_1200_1529 | 108 |
| 886 | 3300048925 | Ga0496122_0175033 | Ga0496122_0175033_35_364 | 108 |
| 887 | 3300048927 | Ga0496124_0003352 | Ga0496124_0003352_11380_11709 | 108 |
| 888 | 3300048928 | Ga0496125_0011762 | Ga0496125_0011762_8358_8687 | 108 |
| 889 | 3300048929 | Ga0496126_0000330 | Ga0496126_0000330_84412_84741 | 108 |
| 890 | 3300050511 | nmdc:mga08y16_580270_c1 | nmdc:mga08y16_580270_c1_374_703 | 108 |
| 891 | 3300050515 | nmdc:mga0a205_791190_c1 | nmdc:mga0a205_791190_c1_146_475 | 108 |
| 892 | 3300053083 | Ga0495655_0097996 | Ga0495655_0097996_36_365 | 108 |
| 893 | 3300059491 | Ga0587070_060091 | Ga0587070_060091_268_597 | 108 |
| 894 | 3300059503 | Ga0587080_029292 | Ga0587080_029292_190_516 | 108 |
| 895 | 3300059505 | Ga0587083_0048673 | Ga0587083_0048673_88_417 | 108 |
| 896 | 3300059505 | Ga0587083_0116247 | Ga0587083_0116247_327_653 | 108 |
| 897 | 3300059505 | Ga0587083_0127328 | Ga0587083_0127328_110_439 | 108 |
| 898 | 3300059506 | Ga0587085_003511 | Ga0587085_003511_894_1223 | 108 |
| 899 | 3300059508 | Ga0587088_054133 | Ga0587088_054133_183_509 | 108 |
| 900 | 3300059622 | Ga0587099_019046 | Ga0587099_019046_398_727 | 108 |
| 901 | 3300059626 | Ga0587115_051297 | Ga0587115_051297_276_602 | 108 |
| 902 | 3300059640 | Ga0587067_018634 | Ga0587067_018634_520_846 | 108 |
| 903 | 3300059640 | Ga0587067_146302 | Ga0587067_146302_157_483 | 108 |
| 904 | 3300059642 | Ga0587069_036468 | Ga0587069_036468_292_621 | 108 |
| 905 | 3300059643 | Ga0587072_029483 | Ga0587072_029483_52_381 | 108 |
| 906 | 3300059643 | Ga0587072_070733 | Ga0587072_070733_22_348 | 108 |
| 907 | 3300059647 | Ga0587079_198710 | Ga0587079_198710_10_339 | 108 |
| 908 | 3300059652 | Ga0587107_051389 | Ga0587107_051389_242_568 | 108 |
| 909 | 3300060344 | Ga0587071_038380 | Ga0587071_038380_456_785 | 108 |
| 910 | 3300060346 | Ga0587111_0094380 | Ga0587111_0094380_197_523 | 108 |
| 911 | 3300061719 | Ga0466962_0755373 | Ga0466962_0755373_143_472 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9318 | 1 | 74 |
| 7mt3-assembly1.cif.gz_U | mtb 70s with p/e trna | 0.9307 | 1 | 107 |
| 6wru-assembly1.cif.gz_G | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.9272 | 3 | 108 |
| 5xym-assembly1.cif.gz_U | large subunit of mycobacterium smegmatis | 0.9216 | 1 | 108 |
| 7mt3-assembly1.cif.gz_U | mtb 70s with p/e trna | 0.9209 | 1 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHB7_1_104_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9253 | 1 | 107 | 2.30.30.30 |
| af_P9WHB7_1_104_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9169 | 1 | 107 | 2.30.30.30 |
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8968 | 1 | 107 | 2.30.30.30 |
| af_Q69T55_240_282_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8966 | 3 | 36 | 2.30.30.30 |
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8883 | 1 | 107 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F6WPI9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9355 | 1 | 108 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G1CKU7-F1-model_v4 | Large ribosomal subunit protein uL24 (50S ribosomal protein L24) | 0.9344 | 1 | 74 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1I4RRA6-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9261 | 1 | 108 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0G1SYH5-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9222 | 1 | 82 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2A4TTZ3-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9198 | 1 | 108 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar