F485334
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 906 | 416 | 814 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_100940233|Ga0307415_1009402331 |
| Length | 149 |
| Sequence | LIGRDESLTAVRPMRAGVEEVNGDMAERDEPTGALVRPYAVTRGRTRPKLEIAIEALIETTVRGRTAGSRPGGGHGQEQQYIATLCDGRLQSLAEIAARLHLPLGVARVLIADMAADGLVAIYEPTSLDDNEAVGTELLERVLSGLRRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 5 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 6 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 7 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 8 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 9 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 10 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 11 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 12 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 13 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 14 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 15 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 16 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 17 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 18 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 19 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 20 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 21 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 22 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 23 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 24 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 25 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 26 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 27 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 28 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 29 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 30 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 31 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 32 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 33 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 34 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 35 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 36 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 37 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 38 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 39 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 40 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 41 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 43 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 44 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 45 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 46 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 47 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 48 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 49 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 51 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 52 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 54 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 55 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 62 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 116 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 119 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 120 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 121 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 122 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Metatranscriptome | Rhizosphere |
| 145 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 146 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 168 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 235 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 236 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 237 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 238 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 239 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 261 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 262 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 263 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 283 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 284 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 287 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 290 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 293 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 296 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 297 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 298 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 299 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 300 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 301 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 305 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 306 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 354 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 355 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 356 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 358 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 359 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 361 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 363 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 364 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 365 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 366 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 367 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 368 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 408 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 409 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 410 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 411 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 412 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 413 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 414 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 415 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 416 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.16 |
| Metatranscriptomes | 13.69 |
| Isolates | 10.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 1.32 |
| Rhizoplane | 3.64 |
| Rhizosphere | 80.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10012362 | 3300003203 | Bacteria | 3708 |
| 2 | JGI25406J46586_10039243 | 3300003203 | Bacteria | 1689 |
| 3 | JGI25406J46586_10043635 | 3300003203 | Bacteria | 1559 |
| 4 | JGI25406J46586_10113656 | 3300003203 | Bacteria | 800 |
| 5 | JGI25406J46586_10128039 | 3300003203 | Bacteria | 745 |
| 6 | Ga0006770J48903_1026830 | 3300003305 | Bacteria | 674 |
| 7 | rootH1_10044904 | 3300003316 | Bacteria | 2174 |
| 8 | rootH2_10116321 | 3300003320 | Bacteria | 1028 |
| 9 | rootH2_10187251 | 3300003320 | Bacteria | 1097 |
| 10 | rootL2_10032490 | 3300003322 | Bacteria | 4318 |
| 11 | Ga0007410J51695_1024025 | 3300003574 | Bacteria | 730 |
| 12 | Ga0007410J51695_1063768 | 3300003574 | Bacteria | 803 |
| 13 | Ga0007409J51694_1018812 | 3300003575 | Bacteria | 1399 |
| 14 | Ga0007409J51694_1041147 | 3300003575 | Bacteria | 996 |
| 15 | Ga0007429J51699_1034608 | 3300003579 | Bacteria | 816 |
| 16 | JGI25404J52841_10051272 | 3300003659 | Bacteria | 867 |
| 17 | Ga0032354_1071614 | 3300003693 | Bacteria | 861 |
| 18 | Ga0058859_11596728 | 3300004798 | Bacteria | 564 |
| 19 | Ga0058859_11644820 | 3300004798 | Bacteria | 589 |
| 20 | Ga0058863_10043464 | 3300004799 | Bacteria | 1988 |
| 21 | Ga0058861_11653156 | 3300004800 | Bacteria | 517 |
| 22 | Ga0058861_12059710 | 3300004800 | Bacteria | 1245 |
| 23 | Ga0058861_12062396 | 3300004800 | Bacteria | 1825 |
| 24 | Ga0058861_12065553 | 3300004800 | Bacteria | 1083 |
| 25 | Ga0058860_11858986 | 3300004801 | Bacteria | 740 |
| 26 | Ga0058860_12019907 | 3300004801 | Bacteria | 1157 |
| 27 | Ga0058860_12177233 | 3300004801 | Bacteria | 585 |
| 28 | Ga0058860_12192533 | 3300004801 | Bacteria | 756 |
| 29 | Ga0058862_10032891 | 3300004803 | Bacteria | 1201 |
| 30 | Ga0058862_12802035 | 3300004803 | Bacteria | 1218 |
| 31 | Ga0058862_12846367 | 3300004803 | Bacteria | 1536 |
| 32 | Ga0070658_10057542 | 3300005327 | Bacteria | 3162 |
| 33 | Ga0070658_10264029 | 3300005327 | Bacteria | 1463 |
| 34 | Ga0070658_10359098 | 3300005327 | Bacteria | 1247 |
| 35 | Ga0070658_10390122 | 3300005327 | Bacteria | 1195 |
| 36 | Ga0070658_10818781 | 3300005327 | Bacteria | 809 |
| 37 | Ga0070676_10247585 | 3300005328 | Bacteria | 1188 |
| 38 | Ga0070683_100001644 | 3300005329 | Bacteria | 17313 |
| 39 | Ga0070683_100003973 | 3300005329 | Bacteria | 12112 |
| 40 | Ga0070683_100042177 | 3300005329 | Bacteria | 4201 |
| 41 | Ga0070683_100049068 | 3300005329 | Bacteria | 3903 |
| 42 | Ga0070683_100119646 | 3300005329 | Bacteria | 2487 |
| 43 | Ga0070683_100289651 | 3300005329 | Bacteria | 1557 |
| 44 | Ga0070670_100611799 | 3300005331 | Bacteria | 975 |
| 45 | Ga0070670_100866441 | 3300005331 | Bacteria | 818 |
| 46 | Ga0070677_10289611 | 3300005333 | Bacteria | 828 |
| 47 | Ga0070677_10760558 | 3300005333 | Bacteria | 550 |
| 48 | Ga0068869_100117816 | 3300005334 | Bacteria | 2028 |
| 49 | Ga0068869_100178734 | 3300005334 | Bacteria | 1663 |
| 50 | Ga0068869_100228360 | 3300005334 | Bacteria | 1478 |
| 51 | Ga0068869_100354269 | 3300005334 | Bacteria | 1197 |
| 52 | Ga0070680_100070645 | 3300005336 | Bacteria | 2868 |
| 53 | Ga0070680_100294094 | 3300005336 | Bacteria | 1376 |
| 54 | Ga0070682_100087308 | 3300005337 | Bacteria | 2033 |
| 55 | Ga0070682_100865929 | 3300005337 | Bacteria | 739 |
| 56 | Ga0068868_100010441 | 3300005338 | Bacteria | 6724 |
| 57 | Ga0068868_100577292 | 3300005338 | Bacteria | 994 |
| 58 | Ga0070660_100061410 | 3300005339 | Bacteria | 2918 |
| 59 | Ga0070660_100404803 | 3300005339 | Bacteria | 1129 |
| 60 | Ga0070660_100573757 | 3300005339 | Bacteria | 942 |
| 61 | Ga0070660_100706809 | 3300005339 | Bacteria | 845 |
| 62 | Ga0070689_101351714 | 3300005340 | Bacteria | 643 |
| 63 | Ga0070687_100200866 | 3300005343 | Bacteria | 1208 |
| 64 | Ga0070687_100361330 | 3300005343 | Bacteria | 940 |
| 65 | Ga0070687_100534801 | 3300005343 | Bacteria | 795 |
| 66 | Ga0070661_100030405 | 3300005344 | Bacteria | 3901 |
| 67 | Ga0070661_100229387 | 3300005344 | Bacteria | 1427 |
| 68 | Ga0070661_100280911 | 3300005344 | Bacteria | 1291 |
| 69 | Ga0070661_100541372 | 3300005344 | Bacteria | 936 |
| 70 | Ga0070692_10002983 | 3300005345 | Bacteria | 6735 |
| 71 | Ga0070692_10358057 | 3300005345 | Bacteria | 909 |
| 72 | Ga0070668_100000126 | 3300005347 | Bacteria | 47281 |
| 73 | Ga0070668_100022741 | 3300005347 | Bacteria | 4740 |
| 74 | Ga0070668_100159106 | 3300005347 | Bacteria | 1831 |
| 75 | Ga0070668_101642979 | 3300005347 | Bacteria | 589 |
| 76 | Ga0070668_102190034 | 3300005347 | Bacteria | 511 |
| 77 | Ga0070669_100378824 | 3300005353 | Bacteria | 1154 |
| 78 | Ga0070675_100000194 | 3300005354 | Bacteria | 38282 |
| 79 | Ga0070675_100251209 | 3300005354 | Bacteria | 1548 |
| 80 | Ga0070675_100614969 | 3300005354 | Bacteria | 986 |
| 81 | Ga0070671_100320938 | 3300005355 | Bacteria | 1320 |
| 82 | Ga0070671_100589219 | 3300005355 | Bacteria | 960 |
| 83 | Ga0070674_100348052 | 3300005356 | Bacteria | 1196 |
| 84 | Ga0070674_101075450 | 3300005356 | Bacteria | 709 |
| 85 | Ga0070674_101921241 | 3300005356 | Bacteria | 538 |
| 86 | Ga0070673_101161221 | 3300005364 | Bacteria | 723 |
| 87 | Ga0070659_100009047 | 3300005366 | Bacteria | 7309 |
| 88 | Ga0070659_100048390 | 3300005366 | Bacteria | 3340 |
| 89 | Ga0070659_100391499 | 3300005366 | Bacteria | 1172 |
| 90 | Ga0070659_100749949 | 3300005366 | Bacteria | 847 |
| 91 | Ga0070667_100129491 | 3300005367 | Bacteria | 2201 |
| 92 | Ga0070667_100389770 | 3300005367 | Bacteria | 1266 |
| 93 | Ga0070714_100146372 | 3300005435 | Bacteria | 2125 |
| 94 | Ga0070714_100911484 | 3300005435 | Bacteria | 854 |
| 95 | Ga0070713_100266695 | 3300005436 | Bacteria | 1567 |
| 96 | Ga0070713_100660855 | 3300005436 | Bacteria | 996 |
| 97 | Ga0070710_10962731 | 3300005437 | Bacteria | 620 |
| 98 | Ga0070701_11400369 | 3300005438 | Bacteria | 503 |
| 99 | Ga0070700_100034264 | 3300005441 | Bacteria | 3065 |
| 100 | Ga0070700_100205353 | 3300005441 | Bacteria | 1387 |
| 101 | Ga0070663_100015500 | 3300005455 | Bacteria | 4923 |
| 102 | Ga0070663_100818533 | 3300005455 | Bacteria | 800 |
| 103 | Ga0070663_101263779 | 3300005455 | Bacteria | 650 |
| 104 | Ga0070678_100450820 | 3300005456 | Bacteria | 1127 |
| 105 | Ga0070678_100657221 | 3300005456 | Bacteria | 941 |
| 106 | Ga0070678_101816675 | 3300005456 | Bacteria | 575 |
| 107 | Ga0070662_101005278 | 3300005457 | Bacteria | 714 |
| 108 | Ga0070681_10084464 | 3300005458 | Bacteria | 3127 |
| 109 | Ga0070681_10381844 | 3300005458 | Bacteria | 1319 |
| 110 | Ga0070681_10744943 | 3300005458 | Bacteria | 896 |
| 111 | Ga0070681_11389505 | 3300005458 | Bacteria | 626 |
| 112 | Ga0068867_100351501 | 3300005459 | Bacteria | 1230 |
| 113 | Ga0070685_10160370 | 3300005466 | Bacteria | 1433 |
| 114 | Ga0070685_10425769 | 3300005466 | Bacteria | 925 |
| 115 | Ga0070707_101038696 | 3300005468 | Bacteria | 785 |
| 116 | Ga0070679_100027945 | 3300005530 | Bacteria | 5558 |
| 117 | Ga0070679_100231361 | 3300005530 | Bacteria | 1808 |
| 118 | Ga0070679_100280689 | 3300005530 | Bacteria | 1618 |
| 119 | Ga0070679_100701460 | 3300005530 | Bacteria | 955 |
| 120 | Ga0070684_100028161 | 3300005535 | Bacteria | 4750 |
| 121 | Ga0070684_100160975 | 3300005535 | Bacteria | 2036 |
| 122 | Ga0070684_100188002 | 3300005535 | Bacteria | 1879 |
| 123 | Ga0070684_100297880 | 3300005535 | Bacteria | 1479 |
| 124 | Ga0070684_100436533 | 3300005535 | Bacteria | 1209 |
| 125 | Ga0070684_102332171 | 3300005535 | Bacteria | 504 |
| 126 | Ga0068853_100703932 | 3300005539 | Bacteria | 964 |
| 127 | Ga0070672_100285363 | 3300005543 | Bacteria | 1397 |
| 128 | Ga0070672_100971668 | 3300005543 | Bacteria | 752 |
| 129 | Ga0070686_101007179 | 3300005544 | Bacteria | 683 |
| 130 | Ga0070693_100259783 | 3300005547 | Bacteria | 1155 |
| 131 | Ga0070665_100067482 | 3300005548 | Bacteria | 3586 |
| 132 | Ga0070665_102562061 | 3300005548 | Bacteria | 511 |
| 133 | Ga0068855_100088846 | 3300005563 | Bacteria | 3569 |
| 134 | Ga0070664_100017966 | 3300005564 | Bacteria | 5806 |
| 135 | Ga0070664_100088470 | 3300005564 | Bacteria | 2678 |
| 136 | Ga0070664_100195172 | 3300005564 | Bacteria | 1805 |
| 137 | Ga0070664_100373939 | 3300005564 | Bacteria | 1300 |
| 138 | Ga0070664_100536600 | 3300005564 | Bacteria | 1081 |
| 139 | Ga0068857_100016006 | 3300005577 | Bacteria | 6569 |
| 140 | Ga0068857_100119203 | 3300005577 | Bacteria | 2375 |
| 141 | Ga0068857_100306850 | 3300005577 | Bacteria | 1464 |
| 142 | Ga0068857_100514229 | 3300005577 | Bacteria | 1125 |
| 143 | Ga0068857_100552620 | 3300005577 | Bacteria | 1085 |
| 144 | Ga0068857_101208539 | 3300005577 | Bacteria | 732 |
| 145 | Ga0068857_102425929 | 3300005577 | Bacteria | 515 |
| 146 | Ga0068854_100026591 | 3300005578 | Bacteria | 3979 |
| 147 | Ga0068854_100619828 | 3300005578 | Bacteria | 926 |
| 148 | Ga0068854_100964990 | 3300005578 | Bacteria | 753 |
| 149 | Ga0068856_100490313 | 3300005614 | Bacteria | 1250 |
| 150 | Ga0068856_100582038 | 3300005614 | Bacteria | 1141 |
| 151 | Ga0068856_101569564 | 3300005614 | Bacteria | 671 |
| 152 | Ga0070702_100662863 | 3300005615 | Bacteria | 791 |
| 153 | Ga0068852_100442175 | 3300005616 | Bacteria | 1286 |
| 154 | Ga0068852_100465942 | 3300005616 | Bacteria | 1253 |
| 155 | Ga0068852_101259875 | 3300005616 | Bacteria | 761 |
| 156 | Ga0068859_100014477 | 3300005617 | Bacteria | 7919 |
| 157 | Ga0068859_102983866 | 3300005617 | Unclassified | 517 |
| 158 | Ga0068864_100042591 | 3300005618 | Bacteria | 3885 |
| 159 | Ga0068864_100362633 | 3300005618 | Bacteria | 1370 |
| 160 | Ga0068864_100502654 | 3300005618 | Bacteria | 1166 |
| 161 | Ga0068864_100656277 | 3300005618 | Bacteria | 1022 |
| 162 | Ga0068864_100661645 | 3300005618 | Bacteria | 1018 |
| 163 | Ga0068864_101253775 | 3300005618 | Bacteria | 741 |
| 164 | Ga0068866_10295739 | 3300005718 | Bacteria | 1009 |
| 165 | Ga0068866_10404499 | 3300005718 | Bacteria | 881 |
| 166 | Ga0068861_100267902 | 3300005719 | Bacteria | 1465 |
| 167 | Ga0068851_10092566 | 3300005834 | Bacteria | 1593 |
| 168 | Ga0068851_10501590 | 3300005834 | Bacteria | 728 |
| 169 | Ga0068870_10044752 | 3300005840 | Bacteria | 2314 |
| 170 | Ga0068870_10661307 | 3300005840 | Bacteria | 717 |
| 171 | Ga0068863_100000632 | 3300005841 | Bacteria | 35693 |
| 172 | Ga0068863_100132089 | 3300005841 | Bacteria | 2384 |
| 173 | Ga0068863_100143887 | 3300005841 | Bacteria | 2280 |
| 174 | Ga0068863_100859999 | 3300005841 | Bacteria | 906 |
| 175 | Ga0068858_100109760 | 3300005842 | Bacteria | 2576 |
| 176 | Ga0068860_100593481 | 3300005843 | Bacteria | 1112 |
| 177 | Ga0068862_100107057 | 3300005844 | Bacteria | 2452 |
| 178 | Ga0068862_100258938 | 3300005844 | Bacteria | 1588 |
| 179 | Ga0081455_10228212 | 3300005937 | Bacteria | 1376 |
| 180 | Ga0081455_10240129 | 3300005937 | Bacteria | 1332 |
| 181 | Ga0081455_10246158 | 3300005937 | Bacteria | 1311 |
| 182 | Ga0081540_1004328 | 3300005983 | Bacteria | 10873 |
| 183 | Ga0081540_1017361 | 3300005983 | Bacteria | 4459 |
| 184 | Ga0081540_1025318 | 3300005983 | Bacteria | 3417 |
| 185 | Ga0081540_1079648 | 3300005983 | Bacteria | 1480 |
| 186 | Ga0081540_1098328 | 3300005983 | Bacteria | 1267 |
| 187 | Ga0081540_1109584 | 3300005983 | Bacteria | 1170 |
| 188 | Ga0081539_10000109 | 3300005985 | Bacteria | 193696 |
| 189 | Ga0081539_10000320 | 3300005985 | Bacteria | 106935 |
| 190 | Ga0081539_10000733 | 3300005985 | Bacteria | 65742 |
| 191 | Ga0081539_10000837 | 3300005985 | Bacteria | 59104 |
| 192 | Ga0081539_10007335 | 3300005985 | Bacteria | 10114 |
| 193 | Ga0081539_10009471 | 3300005985 | Bacteria | 8130 |
| 194 | Ga0081539_10037514 | 3300005985 | Bacteria | 2886 |
| 195 | Ga0081539_10133643 | 3300005985 | Bacteria | 1215 |
| 196 | Ga0081539_10393405 | 3300005985 | Bacteria | 577 |
| 197 | Ga0070717_10155328 | 3300006028 | Bacteria | 1982 |
| 198 | Ga0075368_10179885 | 3300006042 | Bacteria | 891 |
| 199 | Ga0075363_101008540 | 3300006048 | Unclassified | 513 |
| 200 | Ga0075364_10930321 | 3300006051 | Bacteria | 592 |
| 201 | Ga0075432_10375371 | 3300006058 | Bacteria | 608 |
| 202 | Ga0070716_100273420 | 3300006173 | Bacteria | 1162 |
| 203 | Ga0070716_100505932 | 3300006173 | Bacteria | 892 |
| 204 | Ga0070712_101089074 | 3300006175 | Bacteria | 693 |
| 205 | Ga0070712_101396244 | 3300006175 | Bacteria | 611 |
| 206 | Ga0097621_100500147 | 3300006237 | Bacteria | 1101 |
| 207 | Ga0068871_100910378 | 3300006358 | Bacteria | 815 |
| 208 | Ga0075428_100014457 | 3300006844 | Bacteria | 8766 |
| 209 | Ga0075428_100086491 | 3300006844 | Bacteria | 3419 |
| 210 | Ga0075428_100090825 | 3300006844 | Bacteria | 3332 |
| 211 | Ga0075428_100103739 | 3300006844 | Bacteria | 3101 |
| 212 | Ga0075428_100503717 | 3300006844 | Bacteria | 1295 |
| 213 | Ga0075428_101124767 | 3300006844 | Bacteria | 829 |
| 214 | Ga0075430_100010210 | 3300006846 | Bacteria | 7952 |
| 215 | Ga0075430_100023905 | 3300006846 | Bacteria | 5203 |
| 216 | Ga0075430_100165479 | 3300006846 | Bacteria | 1840 |
| 217 | Ga0075430_100243280 | 3300006846 | Bacteria | 1491 |
| 218 | Ga0075430_100247684 | 3300006846 | Bacteria | 1477 |
| 219 | Ga0075430_100321619 | 3300006846 | Bacteria | 1279 |
| 220 | Ga0075430_100573517 | 3300006846 | Bacteria | 931 |
| 221 | Ga0075431_100002426 | 3300006847 | Bacteria | 17944 |
| 222 | Ga0075431_100034622 | 3300006847 | Bacteria | 5203 |
| 223 | Ga0075431_100045971 | 3300006847 | Bacteria | 4501 |
| 224 | Ga0075431_100182905 | 3300006847 | Bacteria | 2151 |
| 225 | Ga0075431_100339915 | 3300006847 | Bacteria | 1511 |
| 226 | Ga0075431_100668531 | 3300006847 | Bacteria | 1018 |
| 227 | Ga0075431_100965606 | 3300006847 | Bacteria | 820 |
| 228 | Ga0075431_101009764 | 3300006847 | Bacteria | 799 |
| 229 | Ga0075433_10501645 | 3300006852 | Bacteria | 1068 |
| 230 | Ga0075433_10723782 | 3300006852 | Bacteria | 871 |
| 231 | Ga0075434_100824137 | 3300006871 | Bacteria | 944 |
| 232 | Ga0075429_100004467 | 3300006880 | Bacteria | 12035 |
| 233 | Ga0075429_100007135 | 3300006880 | Bacteria | 9705 |
| 234 | Ga0075429_100010682 | 3300006880 | Bacteria | 7944 |
| 235 | Ga0075429_100014430 | 3300006880 | Bacteria | 6846 |
| 236 | Ga0075429_100052579 | 3300006880 | Bacteria | 3544 |
| 237 | Ga0075429_100115105 | 3300006880 | Bacteria | 2351 |
| 238 | Ga0075429_100755267 | 3300006880 | Bacteria | 852 |
| 239 | Ga0068865_100547816 | 3300006881 | Bacteria | 971 |
| 240 | Ga0097620_100014477 | 3300006931 | Bacteria | 7919 |
| 241 | Ga0097620_102983700 | 3300006931 | Unclassified | 517 |
| 242 | Ga0111539_10000420 | 3300009094 | Bacteria | 53146 |
| 243 | Ga0111539_10805438 | 3300009094 | Bacteria | 1093 |
| 244 | Ga0111539_11374582 | 3300009094 | Bacteria | 819 |
| 245 | Ga0105245_10001054 | 3300009098 | Bacteria | 24973 |
| 246 | Ga0105245_10406434 | 3300009098 | Bacteria | 1362 |
| 247 | Ga0105245_10743998 | 3300009098 | Bacteria | 1016 |
| 248 | Ga0105247_10647567 | 3300009101 | Bacteria | 789 |
| 249 | Ga0105247_11199179 | 3300009101 | Bacteria | 604 |
| 250 | Ga0114129_10000001 | 3300009147 | Bacteria | 292978 |
| 251 | Ga0114129_10000007 | 3300009147 | Bacteria | 156645 |
| 252 | Ga0114129_10000011 | 3300009147 | Bacteria | 139000 |
| 253 | Ga0114129_10005056 | 3300009147 | Bacteria | 18560 |
| 254 | Ga0114129_10010562 | 3300009147 | Bacteria | 13168 |
| 255 | Ga0114129_10011584 | 3300009147 | Bacteria | 12556 |
| 256 | Ga0114129_10143303 | 3300009147 | Bacteria | 3274 |
| 257 | Ga0114129_12004404 | 3300009147 | Bacteria | 700 |
| 258 | Ga0105243_10132383 | 3300009148 | Bacteria | 2117 |
| 259 | Ga0105243_10209725 | 3300009148 | Bacteria | 1715 |
| 260 | Ga0105243_10398273 | 3300009148 | Bacteria | 1278 |
| 261 | Ga0105241_10281781 | 3300009174 | Bacteria | 1420 |
| 262 | Ga0105241_10950814 | 3300009174 | Bacteria | 801 |
| 263 | Ga0105241_10963185 | 3300009174 | Bacteria | 796 |
| 264 | Ga0105248_10059038 | 3300009177 | Bacteria | 4308 |
| 265 | Ga0105248_10182532 | 3300009177 | Bacteria | 2364 |
| 266 | Ga0105248_10544617 | 3300009177 | Bacteria | 1309 |
| 267 | Ga0105248_11628617 | 3300009177 | Bacteria | 731 |
| 268 | Ga0105237_10349594 | 3300009545 | Bacteria | 1483 |
| 269 | Ga0105237_10363384 | 3300009545 | Bacteria | 1452 |
| 270 | Ga0105237_10910313 | 3300009545 | Bacteria | 886 |
| 271 | Ga0105237_10951776 | 3300009545 | Bacteria | 866 |
| 272 | Ga0105238_10469442 | 3300009551 | Bacteria | 1257 |
| 273 | Ga0105238_10590867 | 3300009551 | Bacteria | 1117 |
| 274 | Ga0105238_10695772 | 3300009551 | Bacteria | 1028 |
| 275 | Ga0105249_10064284 | 3300009553 | Bacteria | 3373 |
| 276 | Ga0105249_10362331 | 3300009553 | Bacteria | 1471 |
| 277 | Ga0105249_10408678 | 3300009553 | Bacteria | 1389 |
| 278 | Ga0130087_1016194 | 3300009828 | Bacteria | 634 |
| 279 | Ga0130086_1083337 | 3300009829 | Bacteria | 634 |
| 280 | Ga0130084_1114510 | 3300009835 | Bacteria | 634 |
| 281 | Ga0105239_10126206 | 3300010375 | Bacteria | 2844 |
| 282 | Ga0105246_12046664 | 3300011119 | Bacteria | 553 |
| 283 | Ga0154014_111627 | 3300013052 | Bacteria | 619 |
| 284 | Ga0157371_10693643 | 3300013102 | Bacteria | 762 |
| 285 | Ga0157371_11130049 | 3300013102 | Bacteria | 602 |
| 286 | Ga0157370_10105609 | 3300013104 | Bacteria | 2636 |
| 287 | Ga0157370_11541017 | 3300013104 | Bacteria | 597 |
| 288 | Ga0157369_10019823 | 3300013105 | Bacteria | 7525 |
| 289 | Ga0157369_10315884 | 3300013105 | Bacteria | 1624 |
| 290 | Ga0157369_11411422 | 3300013105 | Bacteria | 709 |
| 291 | Ga0157374_10482842 | 3300013296 | Bacteria | 1242 |
| 292 | Ga0157374_10799193 | 3300013296 | Bacteria | 959 |
| 293 | Ga0157378_10186509 | 3300013297 | Bacteria | 1954 |
| 294 | Ga0157378_12247256 | 3300013297 | Bacteria | 597 |
| 295 | Ga0163162_10222729 | 3300013306 | Bacteria | 2016 |
| 296 | Ga0163162_10413803 | 3300013306 | Bacteria | 1480 |
| 297 | Ga0157372_10180794 | 3300013307 | Bacteria | 2441 |
| 298 | Ga0157372_10423042 | 3300013307 | Bacteria | 1552 |
| 299 | Ga0157372_10699909 | 3300013307 | Bacteria | 1179 |
| 300 | Ga0157375_10409705 | 3300013308 | Bacteria | 1522 |
| 301 | Ga0157375_10500694 | 3300013308 | Bacteria | 1379 |
| 302 | Ga0157375_13204886 | 3300013308 | Bacteria | 546 |
| 303 | Ga0163163_10146872 | 3300014325 | Bacteria | 2402 |
| 304 | Ga0163163_10167476 | 3300014325 | Bacteria | 2244 |
| 305 | Ga0163163_10189475 | 3300014325 | Bacteria | 2105 |
| 306 | Ga0163163_10790094 | 3300014325 | Bacteria | 1012 |
| 307 | Ga0163163_11135515 | 3300014325 | Bacteria | 844 |
| 308 | Ga0157380_10582896 | 3300014326 | Bacteria | 1103 |
| 309 | Ga0182008_10165419 | 3300014497 | Bacteria | 1115 |
| 310 | Ga0182008_10297557 | 3300014497 | Bacteria | 844 |
| 311 | Ga0182008_10373499 | 3300014497 | Bacteria | 761 |
| 312 | Ga0157377_10004597 | 3300014745 | Bacteria | 6378 |
| 313 | Ga0157377_10500484 | 3300014745 | Bacteria | 849 |
| 314 | Ga0157377_10713388 | 3300014745 | Bacteria | 730 |
| 315 | Ga0157376_10178350 | 3300014969 | Bacteria | 1940 |
| 316 | Ga0163161_10495591 | 3300017792 | Bacteria | 994 |
| 317 | Ga0197907_10060655 | 3300020069 | Bacteria | 1813 |
| 318 | Ga0197907_10379184 | 3300020069 | Bacteria | 982 |
| 319 | Ga0197907_10658708 | 3300020069 | Bacteria | 1702 |
| 320 | Ga0197907_10891682 | 3300020069 | Bacteria | 1918 |
| 321 | Ga0206356_10184226 | 3300020070 | Bacteria | 591 |
| 322 | Ga0206356_10193519 | 3300020070 | Bacteria | 6950 |
| 323 | Ga0206356_10445206 | 3300020070 | Bacteria | 1443 |
| 324 | Ga0206356_10842913 | 3300020070 | Bacteria | 1258 |
| 325 | Ga0206356_11028553 | 3300020070 | Bacteria | 1688 |
| 326 | Ga0206356_11645676 | 3300020070 | Bacteria | 1121 |
| 327 | Ga0206349_1106262 | 3300020075 | Bacteria | 2340 |
| 328 | Ga0206349_1890871 | 3300020075 | Bacteria | 1914 |
| 329 | Ga0206355_1173917 | 3300020076 | Bacteria | 1009 |
| 330 | Ga0206351_10395379 | 3300020077 | Bacteria | 894 |
| 331 | Ga0206351_10442925 | 3300020077 | Bacteria | 1410 |
| 332 | Ga0206352_10306061 | 3300020078 | Bacteria | 1307 |
| 333 | Ga0206352_10317914 | 3300020078 | Bacteria | 2302 |
| 334 | Ga0206352_10523430 | 3300020078 | Bacteria | 1520 |
| 335 | Ga0206352_10681363 | 3300020078 | Bacteria | 1937 |
| 336 | Ga0206352_11031132 | 3300020078 | Bacteria | 1603 |
| 337 | Ga0206350_10138868 | 3300020080 | Bacteria | 2325 |
| 338 | Ga0206350_10428956 | 3300020080 | Bacteria | 1691 |
| 339 | Ga0206350_11582926 | 3300020080 | Bacteria | 831 |
| 340 | Ga0206354_10309334 | 3300020081 | Bacteria | 591 |
| 341 | Ga0206354_10790976 | 3300020081 | Bacteria | 2558 |
| 342 | Ga0206354_11025538 | 3300020081 | Bacteria | 4111 |
| 343 | Ga0206354_11540779 | 3300020081 | Bacteria | 1920 |
| 344 | Ga0206353_10000897 | 3300020082 | Bacteria | 616 |
| 345 | Ga0206353_10005794 | 3300020082 | Bacteria | 4115 |
| 346 | Ga0206353_11941442 | 3300020082 | Bacteria | 3727 |
| 347 | Ga0224712_10006660 | 3300022467 | Bacteria | 3312 |
| 348 | Ga0224712_10009696 | 3300022467 | Bacteria | 2914 |
| 349 | Ga0224712_10029395 | 3300022467 | Bacteria | 1973 |
| 350 | Ga0224712_10083285 | 3300022467 | Bacteria | 1325 |
| 351 | Ga0224712_10213763 | 3300022467 | Bacteria | 880 |
| 352 | Ga0207656_10038352 | 3300025321 | Bacteria | 2021 |
| 353 | Ga0207682_10135378 | 3300025893 | Bacteria | 1102 |
| 354 | Ga0207642_10975051 | 3300025899 | Bacteria | 545 |
| 355 | Ga0207710_10054824 | 3300025900 | Bacteria | 1796 |
| 356 | Ga0207688_10406618 | 3300025901 | Bacteria | 845 |
| 357 | Ga0207688_10641425 | 3300025901 | Bacteria | 670 |
| 358 | Ga0207699_10263491 | 3300025906 | Bacteria | 1192 |
| 359 | Ga0207699_10660478 | 3300025906 | Bacteria | 764 |
| 360 | Ga0207643_10529355 | 3300025908 | Bacteria | 755 |
| 361 | Ga0207705_10007873 | 3300025909 | Bacteria | 7823 |
| 362 | Ga0207705_10096461 | 3300025909 | Bacteria | 2171 |
| 363 | Ga0207705_10201781 | 3300025909 | Bacteria | 1507 |
| 364 | Ga0207705_10819910 | 3300025909 | Bacteria | 722 |
| 365 | Ga0207705_10863602 | 3300025909 | Bacteria | 701 |
| 366 | Ga0207684_10324576 | 3300025910 | Bacteria | 1327 |
| 367 | Ga0207654_10245715 | 3300025911 | Bacteria | 1197 |
| 368 | Ga0207707_10211280 | 3300025912 | Bacteria | 1690 |
| 369 | Ga0207707_10282952 | 3300025912 | Bacteria | 1436 |
| 370 | Ga0207707_10575654 | 3300025912 | Bacteria | 955 |
| 371 | Ga0207671_10208093 | 3300025914 | Bacteria | 1529 |
| 372 | Ga0207671_11444621 | 3300025914 | Bacteria | 532 |
| 373 | Ga0207693_10836526 | 3300025915 | Bacteria | 708 |
| 374 | Ga0207660_10270825 | 3300025917 | Bacteria | 1345 |
| 375 | Ga0207660_10377267 | 3300025917 | Bacteria | 1139 |
| 376 | Ga0207660_10405620 | 3300025917 | Bacteria | 1098 |
| 377 | Ga0207662_10156312 | 3300025918 | Bacteria | 1454 |
| 378 | Ga0207662_10342361 | 3300025918 | Bacteria | 1002 |
| 379 | Ga0207662_10679978 | 3300025918 | Bacteria | 720 |
| 380 | Ga0207657_10043531 | 3300025919 | Bacteria | 3954 |
| 381 | Ga0207657_10230689 | 3300025919 | Bacteria | 1480 |
| 382 | Ga0207657_10373933 | 3300025919 | Bacteria | 1123 |
| 383 | Ga0207657_10494880 | 3300025919 | Bacteria | 958 |
| 384 | Ga0207649_10019283 | 3300025920 | Bacteria | 3896 |
| 385 | Ga0207649_10090026 | 3300025920 | Bacteria | 2007 |
| 386 | Ga0207652_10066451 | 3300025921 | Bacteria | 3125 |
| 387 | Ga0207652_10215544 | 3300025921 | Bacteria | 1729 |
| 388 | Ga0207652_10367554 | 3300025921 | Bacteria | 1298 |
| 389 | Ga0207681_10109141 | 3300025923 | Bacteria | 2010 |
| 390 | Ga0207694_10265261 | 3300025924 | Bacteria | 1408 |
| 391 | Ga0207694_10489807 | 3300025924 | Bacteria | 1029 |
| 392 | Ga0207694_10958766 | 3300025924 | Bacteria | 724 |
| 393 | Ga0207650_10414713 | 3300025925 | Bacteria | 1116 |
| 394 | Ga0207650_10556329 | 3300025925 | Bacteria | 962 |
| 395 | Ga0207659_10071819 | 3300025926 | Bacteria | 2528 |
| 396 | Ga0207659_10151986 | 3300025926 | Bacteria | 1809 |
| 397 | Ga0207659_11479883 | 3300025926 | Bacteria | 581 |
| 398 | Ga0207687_10005904 | 3300025927 | Bacteria | 8101 |
| 399 | Ga0207687_10049584 | 3300025927 | Bacteria | 2920 |
| 400 | Ga0207687_10498322 | 3300025927 | Bacteria | 1016 |
| 401 | Ga0207700_10024274 | 3300025928 | Bacteria | 4194 |
| 402 | Ga0207700_10238980 | 3300025928 | Bacteria | 1547 |
| 403 | Ga0207700_11008099 | 3300025928 | Bacteria | 745 |
| 404 | Ga0207664_10082843 | 3300025929 | Bacteria | 2613 |
| 405 | Ga0207664_10121965 | 3300025929 | Bacteria | 2183 |
| 406 | Ga0207690_10041486 | 3300025932 | Bacteria | 3016 |
| 407 | Ga0207690_10246257 | 3300025932 | Bacteria | 1379 |
| 408 | Ga0207706_10103463 | 3300025933 | Bacteria | 2505 |
| 409 | Ga0207709_10140868 | 3300025935 | Bacteria | 1657 |
| 410 | Ga0207709_11869913 | 3300025935 | Bacteria | 500 |
| 411 | Ga0207669_10825359 | 3300025937 | Bacteria | 770 |
| 412 | Ga0207665_10119443 | 3300025939 | Bacteria | 1861 |
| 413 | Ga0207665_10518277 | 3300025939 | Bacteria | 923 |
| 414 | Ga0207665_10651685 | 3300025939 | Bacteria | 825 |
| 415 | Ga0207691_10139279 | 3300025940 | Bacteria | 2139 |
| 416 | Ga0207691_10480228 | 3300025940 | Bacteria | 1056 |
| 417 | Ga0207711_10079484 | 3300025941 | Bacteria | 2863 |
| 418 | Ga0207711_10958595 | 3300025941 | Bacteria | 794 |
| 419 | Ga0207689_10007698 | 3300025942 | Bacteria | 9429 |
| 420 | Ga0207689_10107564 | 3300025942 | Bacteria | 2292 |
| 421 | Ga0207689_10177263 | 3300025942 | Bacteria | 1758 |
| 422 | Ga0207689_10282866 | 3300025942 | Bacteria | 1373 |
| 423 | Ga0207661_10001034 | 3300025944 | Bacteria | 18464 |
| 424 | Ga0207661_10002942 | 3300025944 | Bacteria | 11785 |
| 425 | Ga0207661_10011053 | 3300025944 | Bacteria | 6525 |
| 426 | Ga0207661_10066024 | 3300025944 | Bacteria | 2938 |
| 427 | Ga0207661_10138752 | 3300025944 | Bacteria | 2090 |
| 428 | Ga0207661_10440763 | 3300025944 | Bacteria | 1185 |
| 429 | Ga0207661_10487345 | 3300025944 | Bacteria | 1126 |
| 430 | Ga0207661_10664547 | 3300025944 | Bacteria | 958 |
| 431 | Ga0207679_10027761 | 3300025945 | Bacteria | 3919 |
| 432 | Ga0207679_10222785 | 3300025945 | Bacteria | 1588 |
| 433 | Ga0207679_10321274 | 3300025945 | Bacteria | 1340 |
| 434 | Ga0207679_10491558 | 3300025945 | Bacteria | 1094 |
| 435 | Ga0207667_10158906 | 3300025949 | Bacteria | 2325 |
| 436 | Ga0207667_10209048 | 3300025949 | Bacteria | 2000 |
| 437 | Ga0207712_10062584 | 3300025961 | Bacteria | 2646 |
| 438 | Ga0207712_10647591 | 3300025961 | Bacteria | 918 |
| 439 | Ga0207668_10002695 | 3300025972 | Bacteria | 10388 |
| 440 | Ga0207668_10133071 | 3300025972 | Bacteria | 1901 |
| 441 | Ga0207668_11086926 | 3300025972 | Bacteria | 717 |
| 442 | Ga0207640_10976507 | 3300025981 | Bacteria | 744 |
| 443 | Ga0207658_10173886 | 3300025986 | Bacteria | 1777 |
| 444 | Ga0207658_10361002 | 3300025986 | Bacteria | 1267 |
| 445 | Ga0207677_10012422 | 3300026023 | Bacteria | 4895 |
| 446 | Ga0207703_10332913 | 3300026035 | Bacteria | 1393 |
| 447 | Ga0207639_10504187 | 3300026041 | Bacteria | 1106 |
| 448 | Ga0207678_10031471 | 3300026067 | Bacteria | 4628 |
| 449 | Ga0207678_10502440 | 3300026067 | Bacteria | 1057 |
| 450 | Ga0207678_10939728 | 3300026067 | Bacteria | 765 |
| 451 | Ga0207678_11674474 | 3300026067 | Bacteria | 559 |
| 452 | Ga0207708_10028322 | 3300026075 | Bacteria | 4243 |
| 453 | Ga0207708_10197130 | 3300026075 | Bacteria | 1605 |
| 454 | Ga0207702_10293338 | 3300026078 | Bacteria | 1541 |
| 455 | Ga0207702_10316852 | 3300026078 | Bacteria | 1484 |
| 456 | Ga0207702_10692305 | 3300026078 | Bacteria | 1004 |
| 457 | Ga0207641_10007184 | 3300026088 | Bacteria | 9286 |
| 458 | Ga0207641_10177265 | 3300026088 | Bacteria | 1950 |
| 459 | Ga0207641_11287326 | 3300026088 | Bacteria | 731 |
| 460 | Ga0207641_12225018 | 3300026088 | Bacteria | 548 |
| 461 | Ga0207648_10328976 | 3300026089 | Bacteria | 1374 |
| 462 | Ga0207648_11010857 | 3300026089 | Bacteria | 779 |
| 463 | Ga0207676_10130236 | 3300026095 | Bacteria | 2138 |
| 464 | Ga0207676_10144071 | 3300026095 | Bacteria | 2044 |
| 465 | Ga0207676_10192216 | 3300026095 | Bacteria | 1797 |
| 466 | Ga0207676_10433084 | 3300026095 | Bacteria | 1236 |
| 467 | Ga0207676_10530023 | 3300026095 | Bacteria | 1122 |
| 468 | Ga0207676_11940952 | 3300026095 | Bacteria | 587 |
| 469 | Ga0207674_10004069 | 3300026116 | Bacteria | 17718 |
| 470 | Ga0207674_10082509 | 3300026116 | Bacteria | 3216 |
| 471 | Ga0207674_10084146 | 3300026116 | Bacteria | 3180 |
| 472 | Ga0207674_10313186 | 3300026116 | Bacteria | 1519 |
| 473 | Ga0207674_10684865 | 3300026116 | Bacteria | 990 |
| 474 | Ga0207674_11172099 | 3300026116 | Bacteria | 738 |
| 475 | Ga0207674_12187768 | 3300026116 | Bacteria | 516 |
| 476 | Ga0207675_100510410 | 3300026118 | Bacteria | 1198 |
| 477 | Ga0207675_101268673 | 3300026118 | Bacteria | 757 |
| 478 | Ga0207683_10074623 | 3300026121 | Bacteria | 3001 |
| 479 | Ga0207683_10382122 | 3300026121 | Bacteria | 1294 |
| 480 | Ga0207698_10455517 | 3300026142 | Bacteria | 1236 |
| 481 | Ga0207698_10933798 | 3300026142 | Bacteria | 876 |
| 482 | Ga0209813_10294289 | 3300027866 | Bacteria | 629 |
| 483 | Ga0207428_10035191 | 3300027907 | Bacteria | 4096 |
| 484 | Ga0268266_10238228 | 3300028379 | Bacteria | 1678 |
| 485 | Ga0268266_10414557 | 3300028379 | Bacteria | 1276 |
| 486 | Ga0268266_12002855 | 3300028379 | Bacteria | 552 |
| 487 | Ga0268265_10094774 | 3300028380 | Bacteria | 2395 |
| 488 | Ga0268265_11476194 | 3300028380 | Bacteria | 683 |
| 489 | Ga0268264_10173608 | 3300028381 | Bacteria | 1951 |
| 490 | Ga0307517_10018569 | 3300028786 | Bacteria | 8985 |
| 491 | Ga0307515_10000088 | 3300028794 | Bacteria | 215810 |
| 492 | Ga0307515_10013108 | 3300028794 | Bacteria | 15519 |
| 493 | Ga0307515_10018950 | 3300028794 | Bacteria | 12421 |
| 494 | Ga0307515_10039781 | 3300028794 | Bacteria | 7462 |
| 495 | Ga0307512_10027644 | 3300030522 | Bacteria | 4987 |
| 496 | Ga0307512_10071268 | 3300030522 | Bacteria | 2581 |
| 497 | Ga0307512_10224937 | 3300030522 | Bacteria | 974 |
| 498 | Ga0316176_1081199 | 3300030732 | Bacteria | 884 |
| 499 | Ga0316178_1168392 | 3300030735 | Bacteria | 1140 |
| 500 | Ga0316183_1108901 | 3300030742 | Bacteria | 908 |
| 501 | Ga0316182_1249122 | 3300030745 | Bacteria | 2013 |
| 502 | Ga0265328_10019234 | 3300031239 | Bacteria | 2626 |
| 503 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 504 | Ga0307513_10006081 | 3300031456 | Bacteria | 15836 |
| 505 | Ga0307513_10038166 | 3300031456 | Bacteria | 5336 |
| 506 | Ga0307513_10039091 | 3300031456 | Bacteria | 5261 |
| 507 | Ga0307509_10018036 | 3300031507 | Bacteria | 8104 |
| 508 | Ga0307509_10485771 | 3300031507 | Bacteria | 922 |
| 509 | Ga0307408_100268714 | 3300031548 | Bacteria | 1415 |
| 510 | Ga0307508_10001033 | 3300031616 | Bacteria | 32282 |
| 511 | Ga0307508_10073119 | 3300031616 | Bacteria | 3004 |
| 512 | Ga0307508_10084883 | 3300031616 | Bacteria | 2749 |
| 513 | Ga0307508_10149718 | 3300031616 | Bacteria | 1938 |
| 514 | Ga0307508_10601568 | 3300031616 | Bacteria | 701 |
| 515 | Ga0307514_10265715 | 3300031649 | Bacteria | 999 |
| 516 | Ga0307516_10006674 | 3300031730 | Bacteria | 13487 |
| 517 | Ga0307516_10011094 | 3300031730 | Bacteria | 9839 |
| 518 | Ga0307516_10043491 | 3300031730 | Bacteria | 4451 |
| 519 | Ga0307516_10069749 | 3300031730 | Bacteria | 3379 |
| 520 | Ga0307516_10070013 | 3300031730 | Bacteria | 3373 |
| 521 | Ga0307405_10028362 | 3300031731 | Bacteria | 3259 |
| 522 | Ga0307405_10031643 | 3300031731 | Bacteria | 3117 |
| 523 | Ga0307405_10170756 | 3300031731 | Bacteria | 1551 |
| 524 | Ga0307405_10212786 | 3300031731 | Bacteria | 1413 |
| 525 | Ga0316577_10833132 | 3300031733 | Unclassified | 523 |
| 526 | Ga0307413_10095009 | 3300031824 | Bacteria | 1953 |
| 527 | Ga0307413_10269399 | 3300031824 | Bacteria | 1274 |
| 528 | Ga0307413_10340493 | 3300031824 | Bacteria | 1153 |
| 529 | Ga0307413_11159118 | 3300031824 | Bacteria | 670 |
| 530 | Ga0307413_11493271 | 3300031824 | Bacteria | 597 |
| 531 | Ga0307410_10012558 | 3300031852 | Bacteria | 4905 |
| 532 | Ga0307410_10237645 | 3300031852 | Bacteria | 1410 |
| 533 | Ga0307410_10372017 | 3300031852 | Bacteria | 1147 |
| 534 | Ga0307410_10585175 | 3300031852 | Bacteria | 929 |
| 535 | Ga0326468_10000899 | 3300031889 | Bacteria | 2901 |
| 536 | Ga0307406_10016567 | 3300031901 | Bacteria | 4286 |
| 537 | Ga0307406_10156900 | 3300031901 | Bacteria | 1631 |
| 538 | Ga0307406_10174835 | 3300031901 | Bacteria | 1558 |
| 539 | Ga0307406_10180017 | 3300031901 | Bacteria | 1538 |
| 540 | Ga0307406_10228031 | 3300031901 | Bacteria | 1389 |
| 541 | Ga0307406_10327321 | 3300031901 | Bacteria | 1188 |
| 542 | Ga0307406_10722871 | 3300031901 | Bacteria | 833 |
| 543 | Ga0307406_10828271 | 3300031901 | Bacteria | 783 |
| 544 | Ga0307406_11946697 | 3300031901 | Bacteria | 525 |
| 545 | Ga0307407_10025296 | 3300031903 | Bacteria | 3127 |
| 546 | Ga0307407_10371117 | 3300031903 | Bacteria | 1019 |
| 547 | Ga0307407_10789307 | 3300031903 | Bacteria | 722 |
| 548 | Ga0307412_10487105 | 3300031911 | Bacteria | 1024 |
| 549 | Ga0307412_10488276 | 3300031911 | Bacteria | 1023 |
| 550 | Ga0307409_100016211 | 3300031995 | Bacteria | 4922 |
| 551 | Ga0307409_100042084 | 3300031995 | Bacteria | 3418 |
| 552 | Ga0307409_100280632 | 3300031995 | Bacteria | 1539 |
| 553 | Ga0307409_100587903 | 3300031995 | Bacteria | 1098 |
| 554 | Ga0307409_101169721 | 3300031995 | Bacteria | 792 |
| 555 | Ga0307409_101641228 | 3300031995 | Bacteria | 671 |
| 556 | Ga0307416_100019576 | 3300032002 | Bacteria | 4804 |
| 557 | Ga0307416_100025289 | 3300032002 | Bacteria | 4350 |
| 558 | Ga0307416_100069430 | 3300032002 | Bacteria | 2916 |
| 559 | Ga0307416_100110893 | 3300032002 | Bacteria | 2417 |
| 560 | Ga0307416_100359102 | 3300032002 | Bacteria | 1478 |
| 561 | Ga0307416_100462737 | 3300032002 | Bacteria | 1324 |
| 562 | Ga0307416_101111190 | 3300032002 | Bacteria | 895 |
| 563 | Ga0307416_103528277 | 3300032002 | Bacteria | 523 |
| 564 | Ga0307414_10371006 | 3300032004 | Bacteria | 1234 |
| 565 | Ga0307411_10391579 | 3300032005 | Bacteria | 1146 |
| 566 | Ga0307411_10750411 | 3300032005 | Bacteria | 855 |
| 567 | Ga0307411_11023821 | 3300032005 | Bacteria | 740 |
| 568 | Ga0307415_100012069 | 3300032126 | Bacteria | 4980 |
| 569 | Ga0307415_100023474 | 3300032126 | Bacteria | 3829 |
| 570 | Ga0307415_100128838 | 3300032126 | Bacteria | 1912 |
| 571 | Ga0307415_100170426 | 3300032126 | Bacteria | 1697 |
| 572 | Ga0307415_100186987 | 3300032126 | Bacteria | 1631 |
| 573 | Ga0307415_100729765 | 3300032126 | Bacteria | 897 |
| 574 | Ga0307415_100865144 | 3300032126 | Bacteria | 830 |
| 575 | Ga0307415_100940233 | 3300032126 | Bacteria | 799 |
| 576 | Ga0316593_10023349 | 3300032168 | Bacteria | 1950 |
| 577 | Ga0307507_10036964 | 3300033179 | Bacteria | 4977 |
| 578 | Ga0373948_0020911 | 3300034817 | Bacteria | 1250 |
| 579 | Ga0373938_0044520 | 3300034957 | Bacteria | 996 |
| 580 | Ga0373928_0103906 | 3300035084 | Bacteria | 744 |
| 581 | Ga0373940_0009036 | 3300035088 | Bacteria | 2305 |
| 582 | Ga0373951_0000348 | 3300035091 | Bacteria | 14059 |
| 583 | Ga0373932_0011494 | 3300035112 | Bacteria | 2164 |
| 584 | Ga0373939_0197378 | 3300035114 | Bacteria | 759 |
| 585 | Ga0373941_0059789 | 3300035115 | Bacteria | 1237 |
| 586 | Ga0373954_0374955 | 3300035118 | Bacteria | 703 |
| 587 | Ga0373942_0002690 | 3300035207 | Bacteria | 4258 |
| 588 | Ga0373942_0047849 | 3300035207 | Bacteria | 1189 |
| 589 | Ga0373962_0080915 | 3300035242 | Bacteria | 986 |
| 590 | Ga0373931_0859209 | 3300035691 | Bacteria | 608 |
| 591 | Ga0373935_0002590 | 3300035692 | Bacteria | 10386 |
| 592 | Ga0373947_0339306 | 3300035725 | Bacteria | 1007 |
| 593 | Ga0373937_1197649 | 3300036401 | Bacteria | 708 |
| 594 | Ga0395899_0063911 | 3300037312 | Bacteria | 2707 |
| 595 | Ga0395899_0967143 | 3300037312 | Bacteria | 515 |
| 596 | Ga0395899_1011728 | 3300037312 | Bacteria | 501 |
| 597 | Ga0395900_0012064 | 3300037418 | Bacteria | 8832 |
| 598 | Ga0395900_0016074 | 3300037418 | Bacteria | 7626 |
| 599 | Ga0395900_0268680 | 3300037418 | Bacteria | 1701 |
| 600 | Ga0395898_0022252 | 3300037466 | Bacteria | 6423 |
| 601 | Ga0395898_0050171 | 3300037466 | Bacteria | 4085 |
| 602 | Ga0395905_0014625 | 3300037471 | Bacteria | 7486 |
| 603 | Ga0395905_0205827 | 3300037471 | Bacteria | 1844 |
| 604 | Ga0436364_0604116 | 3300037853 | Bacteria | 1655 |
| 605 | Ga0395901_0016631 | 3300038443 | Bacteria | 7494 |
| 606 | Ga0395901_0053127 | 3300038443 | Bacteria | 4210 |
| 607 | Ga0395901_0076026 | 3300038443 | Bacteria | 3503 |
| 608 | Ga0439436_0172020 | 3300041404 | Bacteria | 614 |
| 609 | Ga0439438_037414 | 3300041405 | Bacteria | 1269 |
| 610 | Ga0451787_658154 | 3300041441 | Bacteria | 748 |
| 611 | Ga0451789_1288412 | 3300041443 | Bacteria | 1339 |
| 612 | Ga0451794_30919 | 3300041446 | Bacteria | 588 |
| 613 | Ga0451791_0746435 | 3300041451 | Bacteria | 2242 |
| 614 | Ga0451793_1415064 | 3300041452 | Bacteria | 917 |
| 615 | Ga0451801_32288 | 3300041455 | Bacteria | 814 |
| 616 | Ga0451800_0112694 | 3300041459 | Bacteria | 671 |
| 617 | Ga0451800_0243129 | 3300041459 | Bacteria | 512 |
| 618 | Ga0451802_1455243 | 3300041460 | Bacteria | 732 |
| 619 | Ga0451805_030692 | 3300041461 | Bacteria | 790 |
| 620 | Ga0451805_084038 | 3300041461 | Bacteria | 546 |
| 621 | Ga0451804_0532200 | 3300041463 | Bacteria | 957 |
| 622 | Ga0451807_0946012 | 3300041486 | Bacteria | 579 |
| 623 | Ga0451835_0182726 | 3300041492 | Bacteria | 516 |
| 624 | Ga0451846_49640 | 3300041502 | Bacteria | 663 |
| 625 | Ga0451849_0766240 | 3300041505 | Bacteria | 887 |
| 626 | Ga0451853_2990416 | 3300041512 | Bacteria | 1090 |
| 627 | Ga0451853_3286472 | 3300041512 | Bacteria | 1880 |
| 628 | Ga0439448_0128714 | 3300042005 | Bacteria | 872 |
| 629 | Ga0439449_0223832 | 3300042007 | Bacteria | 705 |
| 630 | Ga0450908_099342 | 3300042184 | Bacteria | 532 |
| 631 | Ga0466961_0183679 | 3300044693 | Bacteria | 1298 |
| 632 | Ga0466963_1258665 | 3300044694 | Bacteria | 520 |
| 633 | Ga0466971_0310346 | 3300044719 | Bacteria | 759 |
| 634 | Ga0466957_0079358 | 3300044842 | Bacteria | 2042 |
| 635 | Ga0466960_0412244 | 3300044901 | Bacteria | 780 |
| 636 | Ga0466960_0584332 | 3300044901 | Bacteria | 662 |
| 637 | Ga0466958_0817147 | 3300045836 | Bacteria | 608 |
| 638 | Ga0466967_0061324 | 3300045976 | Bacteria | 3336 |
| 639 | Ga0466967_0519673 | 3300045976 | Bacteria | 1170 |
| 640 | Ga0495629_0030517 | 3300046459 | Bacteria | 3821 |
| 641 | Ga0495629_0056195 | 3300046459 | Bacteria | 2753 |
| 642 | Ga0495638_0455539 | 3300046460 | Bacteria | 652 |
| 643 | Ga0495594_0096546 | 3300046499 | Bacteria | 1661 |
| 644 | Ga0495594_0101277 | 3300046499 | Bacteria | 1620 |
| 645 | Ga0495594_0117613 | 3300046499 | Bacteria | 1501 |
| 646 | Ga0495632_0021178 | 3300046519 | Bacteria | 3507 |
| 647 | Ga0495632_0145463 | 3300046519 | Bacteria | 1098 |
| 648 | Ga0495622_0136589 | 3300046557 | Bacteria | 1115 |
| 649 | Ga0495668_0010448 | 3300046616 | Bacteria | 5617 |
| 650 | Ga0495625_0011061 | 3300046660 | Bacteria | 7394 |
| 651 | Ga0495581_0492374 | 3300047315 | Bacteria | 713 |
| 652 | Ga0495636_0208701 | 3300047318 | Bacteria | 894 |
| 653 | Ga0495683_0026250 | 3300047323 | Bacteria | 2981 |
| 654 | Ga0495626_0002023 | 3300048091 | Bacteria | 14913 |
| 655 | Ga0496104_0070355 | 3300048907 | Bacteria | 3326 |
| 656 | Ga0496105_0090253 | 3300048908 | Bacteria | 2531 |
| 657 | Ga0496106_1470990 | 3300048909 | Bacteria | 525 |
| 658 | Ga0496108_0000019 | 3300048911 | Bacteria | 234657 |
| 659 | Ga0496108_1473386 | 3300048911 | Bacteria | 567 |
| 660 | Ga0496109_0207436 | 3300048912 | Bacteria | 1843 |
| 661 | Ga0496109_0317178 | 3300048912 | Bacteria | 1471 |
| 662 | Ga0496109_1659842 | 3300048912 | Bacteria | 573 |
| 663 | Ga0496110_0112143 | 3300048913 | Bacteria | 2452 |
| 664 | Ga0496110_0710050 | 3300048913 | Bacteria | 907 |
| 665 | Ga0496110_1175428 | 3300048913 | Bacteria | 676 |
| 666 | Ga0496110_1531537 | 3300048913 | Bacteria | 577 |
| 667 | Ga0496112_0022573 | 3300048915 | Bacteria | 5997 |
| 668 | Ga0496112_0151229 | 3300048915 | Bacteria | 2288 |
| 669 | Ga0496112_0163363 | 3300048915 | Bacteria | 2193 |
| 670 | Ga0496112_0269202 | 3300048915 | Bacteria | 1652 |
| 671 | Ga0496112_1372715 | 3300048915 | Bacteria | 621 |
| 672 | Ga0496112_1482616 | 3300048915 | Bacteria | 592 |
| 673 | Ga0496113_0456396 | 3300048916 | Bacteria | 1027 |
| 674 | Ga0496113_1231647 | 3300048916 | Bacteria | 584 |
| 675 | Ga0496126_0063848 | 3300048929 | Bacteria | 3300 |
| 676 | Ga0496126_0440165 | 3300048929 | Bacteria | 1051 |
| 677 | Ga0501307_023032 | 3300049162 | Bacteria | 823 |
| 678 | Ga0501034_0799023 | 3300049571 | Bacteria | 836 |
| 679 | Ga0501042_0308814 | 3300049578 | Bacteria | 1143 |
| 680 | Ga0501042_0567859 | 3300049578 | Bacteria | 825 |
| 681 | Ga0501043_0332078 | 3300049579 | Bacteria | 1158 |
| 682 | Ga0501047_0016507 | 3300049581 | Bacteria | 7049 |
| 683 | Ga0501047_0038223 | 3300049581 | Bacteria | 4643 |
| 684 | Ga0501048_0399693 | 3300049582 | Bacteria | 982 |
| 685 | Ga0501067_0322045 | 3300049583 | Bacteria | 861 |
| 686 | Ga0501070_0472811 | 3300049586 | Bacteria | 1009 |
| 687 | Ga0501070_0920343 | 3300049586 | Bacteria | 681 |
| 688 | Ga0501071_1265179 | 3300049587 | Bacteria | 570 |
| 689 | Ga0501072_0955182 | 3300049588 | Bacteria | 669 |
| 690 | Ga0501076_0430563 | 3300049592 | Bacteria | 1086 |
| 691 | Ga0501076_0968576 | 3300049592 | Bacteria | 701 |
| 692 | Ga0501044_0488760 | 3300049823 | Bacteria | 1133 |
| 693 | Ga0501045_0573826 | 3300049824 | Bacteria | 836 |
| 694 | nmdc:mga03n38_210510_c1 | 3300050490 | Bacteria | 1010 |
| 695 | nmdc:mga04h51_328745_c1 | 3300050495 | Bacteria | 628 |
| 696 | nmdc:mga05p37_153347_c1 | 3300050507 | Bacteria | 2817 |
| 697 | nmdc:mga05p37_1688_c1 | 3300050507 | Bacteria | 25686 |
| 698 | nmdc:mga05p37_1691_c1 | 3300050507 | Bacteria | 25680 |
| 699 | nmdc:mga05p37_25686_c1 | 3300050507 | Bacteria | 7165 |
| 700 | nmdc:mga05p37_40243_c1 | 3300050507 | Bacteria | 5740 |
| 701 | nmdc:mga05p37_411685_c1 | 3300050507 | Bacteria | 1576 |
| 702 | nmdc:mga05p37_623556_c1 | 3300050507 | Bacteria | 1213 |
| 703 | nmdc:mga05p37_6782_c1 | 3300050507 | Bacteria | 13496 |
| 704 | nmdc:mga09592_11758_c1 | 3300050508 | Bacteria | 7116 |
| 705 | nmdc:mga09592_1659749_c1 | 3300050508 | Bacteria | 516 |
| 706 | nmdc:mga09592_16_c1 | 3300050508 | Bacteria | 97518 |
| 707 | nmdc:mga09592_177379_c1 | 3300050508 | Bacteria | 1843 |
| 708 | nmdc:mga09592_373135_c1 | 3300050508 | Bacteria | 1234 |
| 709 | nmdc:mga09592_448529_c1 | 3300050508 | Bacteria | 1113 |
| 710 | nmdc:mga09592_48386_c1 | 3300050508 | Bacteria | 3584 |
| 711 | nmdc:mga09592_4861_c1 | 3300050508 | Bacteria | 10887 |
| 712 | nmdc:mga09592_708586_c1 | 3300050508 | Bacteria | 856 |
| 713 | nmdc:mga0qj67_100464_c1 | 3300050509 | Bacteria | 2332 |
| 714 | nmdc:mga0qj67_1336030_c1 | 3300050509 | Bacteria | 555 |
| 715 | nmdc:mga0qj67_16_c1 | 3300050509 | Bacteria | 124323 |
| 716 | nmdc:mga0qj67_284878_c1 | 3300050509 | Bacteria | 1339 |
| 717 | nmdc:mga0qj67_41028_c1 | 3300050509 | Bacteria | 3639 |
| 718 | nmdc:mga0qj67_418518_c1 | 3300050509 | Bacteria | 1080 |
| 719 | nmdc:mga0qj67_55356_c1 | 3300050509 | Bacteria | 3142 |
| 720 | nmdc:mga06r32_1729840_c1 | 3300050510 | Bacteria | 562 |
| 721 | nmdc:mga06r32_282398_c1 | 3300050510 | Bacteria | 1647 |
| 722 | nmdc:mga06r32_475605_c1 | 3300050510 | Bacteria | 1228 |
| 723 | nmdc:mga06r32_488104_c1 | 3300050510 | Bacteria | 1209 |
| 724 | nmdc:mga06r32_591359_c1 | 3300050510 | Bacteria | 1081 |
| 725 | nmdc:mga06r32_659315_c1 | 3300050510 | Bacteria | 1014 |
| 726 | nmdc:mga06r32_76305_c1 | 3300050510 | Bacteria | 3255 |
| 727 | nmdc:mga06r32_8377_c1 | 3300050510 | Bacteria | 9312 |
| 728 | nmdc:mga06r32_9713_c1 | 3300050510 | Bacteria | 8691 |
| 729 | nmdc:mga08y16_49925_c1 | 3300050511 | Bacteria | 4378 |
| 730 | nmdc:mga0n895_604776_c1 | 3300050512 | Bacteria | 1098 |
| 731 | nmdc:mga0a205_520500_c1 | 3300050515 | Bacteria | 1046 |
| 732 | nmdc:mga0a205_768639_c1 | 3300050515 | Bacteria | 811 |
| 733 | Ga0500578_0662702 | 3300053086 | Bacteria | 566 |
| 734 | Ga0500644_0004288 | 3300053088 | Bacteria | 3566 |
| 735 | Ga0500644_0091296 | 3300053088 | Bacteria | 1140 |
| 736 | Ga0500646_0220691 | 3300053090 | Bacteria | 657 |
| 737 | Ga0500583_0247677 | 3300053092 | Bacteria | 880 |
| 738 | Ga0500583_0354667 | 3300053092 | Bacteria | 710 |
| 739 | Ga0500651_0089163 | 3300053093 | Bacteria | 1901 |
| 740 | Ga0500651_0250974 | 3300053093 | Bacteria | 1029 |
| 741 | Ga0500641_0095528 | 3300053096 | Bacteria | 1271 |
| 742 | Ga0500650_0041339 | 3300053098 | Bacteria | 2128 |
| 743 | Ga0500660_126278 | 3300053100 | Bacteria | 1052 |
| 744 | Ga0500556_0240722 | 3300053104 | Bacteria | 713 |
| 745 | Ga0500556_0307904 | 3300053104 | Bacteria | 618 |
| 746 | Ga0500569_005632 | 3300053109 | Bacteria | 2701 |
| 747 | Ga0500572_202517 | 3300053111 | Bacteria | 650 |
| 748 | Ga0500652_024511 | 3300053131 | Bacteria | 2303 |
| 749 | Ga0500577_0108484 | 3300053142 | Bacteria | 1143 |
| 750 | Ga0500577_0230233 | 3300053142 | Bacteria | 803 |
| 751 | Ga0500600_0084237 | 3300053149 | Bacteria | 1711 |
| 752 | Ga0500604_0112228 | 3300053151 | Bacteria | 906 |
| 753 | Ga0500630_187723 | 3300053159 | Bacteria | 823 |
| 754 | Ga0500633_0086310 | 3300053160 | Bacteria | 1141 |
| 755 | Ga0500611_066714 | 3300053727 | Bacteria | 866 |
| 756 | Ga0501084_0506240 | 3300054114 | Bacteria | 1021 |
| 757 | Ga0501084_0567636 | 3300054114 | Bacteria | 959 |
| 758 | Ga0587084_050447 | 3300059477 | Bacteria | 735 |
| 759 | Ga0587066_030403 | 3300059490 | Bacteria | 959 |
| 760 | Ga0587066_067363 | 3300059490 | Bacteria | 746 |
| 761 | Ga0587070_051968 | 3300059491 | Bacteria | 821 |
| 762 | Ga0587070_081296 | 3300059491 | Bacteria | 711 |
| 763 | Ga0587073_0021409 | 3300059492 | Bacteria | 1244 |
| 764 | Ga0587073_0101606 | 3300059492 | Bacteria | 748 |
| 765 | Ga0587073_0144664 | 3300059492 | Bacteria | 666 |
| 766 | Ga0587077_020100 | 3300059493 | Bacteria | 1170 |
| 767 | Ga0587080_125620 | 3300059503 | Bacteria | 573 |
| 768 | Ga0587080_146411 | 3300059503 | Bacteria | 544 |
| 769 | Ga0587082_011845 | 3300059504 | Bacteria | 1284 |
| 770 | Ga0587085_075902 | 3300059506 | Bacteria | 667 |
| 771 | Ga0587088_180706 | 3300059508 | Bacteria | 528 |
| 772 | Ga0587090_025468 | 3300059510 | Bacteria | 956 |
| 773 | Ga0587091_042826 | 3300059511 | Bacteria | 900 |
| 774 | Ga0587091_043199 | 3300059511 | Bacteria | 897 |
| 775 | Ga0587091_067582 | 3300059511 | Bacteria | 774 |
| 776 | Ga0587092_016692 | 3300059512 | Bacteria | 1090 |
| 777 | Ga0587094_074948 | 3300059513 | Bacteria | 616 |
| 778 | Ga0587095_006376 | 3300059514 | Bacteria | 916 |
| 779 | Ga0587098_011221 | 3300059604 | Bacteria | 1005 |
| 780 | Ga0587106_117151 | 3300059605 | Bacteria | 561 |
| 781 | Ga0587099_031593 | 3300059622 | Bacteria | 646 |
| 782 | Ga0587101_072204 | 3300059623 | Bacteria | 638 |
| 783 | Ga0587101_105222 | 3300059623 | Bacteria | 566 |
| 784 | Ga0587109_030617 | 3300059624 | Bacteria | 1019 |
| 785 | Ga0587109_112954 | 3300059624 | Bacteria | 637 |
| 786 | Ga0587115_067144 | 3300059626 | Bacteria | 612 |
| 787 | Ga0587122_021766 | 3300059628 | Bacteria | 702 |
| 788 | Ga0587128_034035 | 3300059630 | Bacteria | 860 |
| 789 | Ga0587062_031890 | 3300059639 | Bacteria | 812 |
| 790 | Ga0587067_060627 | 3300059640 | Bacteria | 792 |
| 791 | Ga0587068_014219 | 3300059641 | Bacteria | 1238 |
| 792 | Ga0587068_070861 | 3300059641 | Bacteria | 687 |
| 793 | Ga0587068_104250 | 3300059641 | Bacteria | 599 |
| 794 | Ga0587069_034524 | 3300059642 | Bacteria | 835 |
| 795 | Ga0587075_055076 | 3300059644 | Bacteria | 704 |
| 796 | Ga0587076_085504 | 3300059645 | Bacteria | 681 |
| 797 | Ga0587076_102468 | 3300059645 | Bacteria | 641 |
| 798 | Ga0587076_207121 | 3300059645 | Bacteria | 507 |
| 799 | Ga0587078_005950 | 3300059646 | Bacteria | 1314 |
| 800 | Ga0587078_013535 | 3300059646 | Bacteria | 967 |
| 801 | Ga0587078_083471 | 3300059646 | Bacteria | 515 |
| 802 | Ga0587079_017185 | 3300059647 | Bacteria | 1252 |
| 803 | Ga0587079_028568 | 3300059647 | Bacteria | 1057 |
| 804 | Ga0587079_032566 | 3300059647 | Bacteria | 1010 |
| 805 | Ga0587079_075914 | 3300059647 | Bacteria | 759 |
| 806 | Ga0587102_032570 | 3300059649 | Bacteria | 643 |
| 807 | Ga0587107_108992 | 3300059652 | Bacteria | 557 |
| 808 | Ga0587114_063554 | 3300059655 | Bacteria | 653 |
| 809 | Ga0587119_014324 | 3300059658 | Bacteria | 950 |
| 810 | Ga0587120_015232 | 3300059659 | Bacteria | 693 |
| 811 | Ga0587071_070966 | 3300060344 | Bacteria | 758 |
| 812 | Ga0587071_085581 | 3300060344 | Bacteria | 709 |
| 813 | Ga0587071_221704 | 3300060344 | Bacteria | 503 |
| 814 | Ga0587111_0104753 | 3300060346 | Bacteria | 709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046616 | Ga0495668_0010448 | Ga0495668_0010448_4577_4879 | 88 |
| 2 | 3300046660 | Ga0495625_0011061 | Ga0495625_0011061_739_1041 | 88 |
| 3 | 3300047318 | Ga0495636_0208701 | Ga0495636_0208701_417_719 | 88 |
| 4 | 3300047323 | Ga0495683_0026250 | Ga0495683_0026250_641_943 | 88 |
| 5 | 3300048091 | Ga0495626_0002023 | Ga0495626_0002023_13879_14181 | 88 |
| 6 | 3300050509 | nmdc:mga0qj67_55356_c1 | nmdc:mga0qj67_55356_c1_423_725 | 89 |
| 7 | 3300009147 | Ga0114129_10011584 | Ga0114129_100115845 | 91 |
| 8 | 3300050507 | nmdc:mga05p37_623556_c1 | nmdc:mga05p37_623556_c1_454_762 | 91 |
| 9 | 3300050508 | nmdc:mga09592_48386_c1 | nmdc:mga09592_48386_c1_1799_2107 | 91 |
| 10 | 3300059655 | Ga0587114_063554 | Ga0587114_063554_106_420 | 91 |
| 11 | 3300041492 | Ga0451835_0182726 | Ga0451835_0182726_179_505 | 96 |
| 12 | 3300048913 | Ga0496110_0710050 | Ga0496110_0710050_553_879 | 96 |
| 13 | 3300049162 | Ga0501307_023032 | Ga0501307_023032_476_802 | 96 |
| 14 | 3300031456 | Ga0307513_10006081 | Ga0307513_100060814 | 98 |
| 15 | 3300003316 | rootH1_10044904 | rootH1_100449043 | 100 |
| 16 | 3300031616 | Ga0307508_10073119 | Ga0307508_100731193 | 100 |
| 17 | 3300031730 | Ga0307516_10069749 | Ga0307516_100697492 | 100 |
| 18 | 3300053092 | Ga0500583_0247677 | Ga0500583_0247677_358_735 | 100 |
| 19 | 3300053149 | Ga0500600_0084237 | Ga0500600_0084237_863_1240 | 100 |
| 20 | 3300003203 | JGI25406J46586_10039243 | JGI25406J46586_100392433 | 101 |
| 21 | 3300005985 | Ga0081539_10000733 | Ga0081539_1000073325 | 101 |
| 22 | 3300031731 | Ga0307405_10031643 | Ga0307405_100316433 | 101 |
| 23 | 3300031852 | Ga0307410_10012558 | Ga0307410_100125581 | 101 |
| 24 | 3300031889 | Ga0326468_10000899 | Ga0326468_100008993 | 101 |
| 25 | 3300031901 | Ga0307406_10016567 | Ga0307406_100165673 | 101 |
| 26 | 3300031911 | Ga0307412_10487105 | Ga0307412_104871052 | 101 |
| 27 | 3300031995 | Ga0307409_100016211 | Ga0307409_1000162114 | 101 |
| 28 | 3300032002 | Ga0307416_100025289 | Ga0307416_1000252895 | 101 |
| 29 | 3300032004 | Ga0307414_10371006 | Ga0307414_103710063 | 101 |
| 30 | 3300032005 | Ga0307411_10391579 | Ga0307411_103915793 | 101 |
| 31 | 3300032126 | Ga0307415_100023474 | Ga0307415_1000234743 | 101 |
| 32 | 3300037418 | Ga0395900_0012064 | Ga0395900_0012064_6299_6682 | 101 |
| 33 | 3300037466 | Ga0395898_0050171 | Ga0395898_0050171_1212_1595 | 101 |
| 34 | 3300037471 | Ga0395905_0205827 | Ga0395905_0205827_518_901 | 101 |
| 35 | 3300038443 | Ga0395901_0053127 | Ga0395901_0053127_813_1196 | 101 |
| 36 | 3300042005 | Ga0439448_0128714 | Ga0439448_0128714_162_539 | 101 |
| 37 | 3300028786 | Ga0307517_10018569 | Ga0307517_100185694 | 102 |
| 38 | 3300028794 | Ga0307515_10018950 | Ga0307515_100189507 | 102 |
| 39 | 3300030522 | Ga0307512_10027644 | Ga0307512_100276443 | 102 |
| 40 | 3300031616 | Ga0307508_10084883 | Ga0307508_100848834 | 102 |
| 41 | 3300037312 | Ga0395899_0967143 | Ga0395899_0967143_14_397 | 102 |
| 42 | 3300046519 | Ga0495632_0021178 | Ga0495632_0021178_333_710 | 102 |
| 43 | 3300053088 | Ga0500644_0091296 | Ga0500644_0091296_206_583 | 102 |
| 44 | 3300053090 | Ga0500646_0220691 | Ga0500646_0220691_36_413 | 102 |
| 45 | 3300053093 | Ga0500651_0089163 | Ga0500651_0089163_621_998 | 102 |
| 46 | 3300053096 | Ga0500641_0095528 | Ga0500641_0095528_290_667 | 102 |
| 47 | 3300053098 | Ga0500650_0041339 | Ga0500650_0041339_959_1336 | 102 |
| 48 | 3300053104 | Ga0500556_0307904 | Ga0500556_0307904_22_399 | 102 |
| 49 | 3300053109 | Ga0500569_005632 | Ga0500569_005632_1452_1829 | 102 |
| 50 | 3300053131 | Ga0500652_024511 | Ga0500652_024511_658_1035 | 102 |
| 51 | 3300053142 | Ga0500577_0108484 | Ga0500577_0108484_285_662 | 102 |
| 52 | 3300053151 | Ga0500604_0112228 | Ga0500604_0112228_519_896 | 102 |
| 53 | 3300053160 | Ga0500633_0086310 | Ga0500633_0086310_709_1086 | 102 |
| 54 | 3300053727 | Ga0500611_066714 | Ga0500611_066714_386_763 | 102 |
| 55 | iso_pu_bacteria | 2862507626 | 2862510376 | 103 |
| 56 | iso_pu_bacteria | 2622736626 | 2623584993 | 104 |
| 57 | iso_pu_bacteria | 2855683550 | 2855684563 | 104 |
| 58 | iso_pu_bacteria | 2856858025 | 2856858820 | 104 |
| 59 | iso_pu_bacteria | 2867302475 | 2867307118 | 104 |
| 60 | iso_pu_bacteria | 2867312974 | 2867319472 | 104 |
| 61 | iso_pu_bacteria | 2867319477 | 2867321688 | 104 |
| 62 | iso_pu_bacteria | 2867507094 | 2867511970 | 104 |
| 63 | iso_pu_bacteria | 2902582711 | 2902583708 | 104 |
| 64 | iso_pu_bacteria | 2996221748 | 2996223752 | 104 |
| 65 | iso_pu_bacteria | 649633069 | 649810730 | 104 |
| 66 | 3300004803 | Ga0058862_12802035 | Ga0058862_128020352 | 105 |
| 67 | 3300035091 | Ga0373951_0000348 | Ga0373951_0000348_12857_13234 | 105 |
| 68 | 3300049592 | Ga0501076_0968576 | Ga0501076_0968576_122_520 | 105 |
| 69 | iso_pu_bacteria | 2515154088 | 2515496649 | 105 |
| 70 | iso_pu_bacteria | 2515154129 | 2515718349 | 105 |
| 71 | iso_pu_bacteria | 2515154137 | 2515756888 | 105 |
| 72 | iso_pu_bacteria | 2515154202 | 2516083491 | 105 |
| 73 | iso_pu_bacteria | 2515154203 | 2516089426 | 105 |
| 74 | iso_pu_bacteria | 2675903059 | 2676480774 | 105 |
| 75 | iso_pu_bacteria | 2772190715 | 2772644934 | 105 |
| 76 | iso_pu_bacteria | 2831935698 | 2831941071 | 105 |
| 77 | iso_pu_bacteria | 2832004796 | 2832006162 | 105 |
| 78 | iso_pu_bacteria | 2855670206 | 2855673747 | 105 |
| 79 | iso_pu_bacteria | 2855676851 | 2855682908 | 105 |
| 80 | iso_pu_bacteria | 2857288857 | 2857291278 | 105 |
| 81 | iso_pu_bacteria | 2858848962 | 2858849772 | 105 |
| 82 | iso_pu_bacteria | 2858882152 | 2858886284 | 105 |
| 83 | iso_pu_bacteria | 2858888857 | 2858890944 | 105 |
| 84 | iso_pu_bacteria | 2858895516 | 2858897676 | 105 |
| 85 | iso_pu_bacteria | 2858902515 | 2858902981 | 105 |
| 86 | iso_pu_bacteria | 2866065130 | 2866069288 | 105 |
| 87 | iso_pu_bacteria | 2869048445 | 2869054182 | 105 |
| 88 | iso_pu_bacteria | 2869061728 | 2869065992 | 105 |
| 89 | iso_pu_bacteria | 2869068681 | 2869071822 | 105 |
| 90 | iso_pu_bacteria | 2880489317 | 2880495272 | 105 |
| 91 | iso_pu_bacteria | 2880495981 | 2880497073 | 105 |
| 92 | iso_pu_bacteria | 2929219909 | 2929225672 | 105 |
| 93 | iso_pu_bacteria | 2929226422 | 2929231353 | 105 |
| 94 | iso_pu_bacteria | 8003830390 | 8003830970 | 105 |
| 95 | iso_pu_bacteria | 8003870546 | 8003874594 | 105 |
| 96 | iso_pu_bacteria | 8054704163 | 8054706663 | 105 |
| 97 | iso_pu_bacteria | 8054727385 | 8054733732 | 105 |
| 98 | iso_pu_bacteria | 8054734606 | 8054740708 | 105 |
| 99 | iso_pu_bacteria | 8055412473 | 8055417871 | 105 |
| 100 | 3300005327 | Ga0070658_10359098 | Ga0070658_103590981 | 106 |
| 101 | 3300005329 | Ga0070683_100042177 | Ga0070683_1000421773 | 106 |
| 102 | 3300005339 | Ga0070660_100573757 | Ga0070660_1005737572 | 106 |
| 103 | 3300005344 | Ga0070661_100280911 | Ga0070661_1002809111 | 106 |
| 104 | 3300005366 | Ga0070659_100048390 | Ga0070659_1000483903 | 106 |
| 105 | 3300005435 | Ga0070714_100911484 | Ga0070714_1009114841 | 106 |
| 106 | 3300005455 | Ga0070663_101263779 | Ga0070663_1012637791 | 106 |
| 107 | 3300005458 | Ga0070681_10381844 | Ga0070681_103818442 | 106 |
| 108 | 3300005530 | Ga0070679_100027945 | Ga0070679_1000279453 | 106 |
| 109 | 3300005535 | Ga0070684_100297880 | Ga0070684_1002978802 | 106 |
| 110 | 3300005535 | Ga0070684_102332171 | Ga0070684_1023321711 | 106 |
| 111 | 3300005563 | Ga0068855_100088846 | Ga0068855_1000888462 | 106 |
| 112 | 3300005564 | Ga0070664_100195172 | Ga0070664_1001951723 | 106 |
| 113 | 3300005614 | Ga0068856_101569564 | Ga0068856_1015695642 | 106 |
| 114 | 3300005616 | Ga0068852_100465942 | Ga0068852_1004659422 | 106 |
| 115 | 3300005618 | Ga0068864_100362633 | Ga0068864_1003626333 | 106 |
| 116 | 3300005841 | Ga0068863_100859999 | Ga0068863_1008599992 | 106 |
| 117 | 3300005983 | Ga0081540_1017361 | Ga0081540_10173613 | 106 |
| 118 | 3300006173 | Ga0070716_100273420 | Ga0070716_1002734203 | 106 |
| 119 | 3300009551 | Ga0105238_10590867 | Ga0105238_105908672 | 106 |
| 120 | 3300010375 | Ga0105239_10126206 | Ga0105239_101262063 | 106 |
| 121 | 3300013105 | Ga0157369_10019823 | Ga0157369_100198233 | 106 |
| 122 | 3300013307 | Ga0157372_10180794 | Ga0157372_101807943 | 106 |
| 123 | 3300014325 | Ga0163163_10790094 | Ga0163163_107900942 | 106 |
| 124 | 3300020069 | Ga0197907_10060655 | Ga0197907_100606553 | 106 |
| 125 | 3300020070 | Ga0206356_10842913 | Ga0206356_108429132 | 106 |
| 126 | 3300020075 | Ga0206349_1890871 | Ga0206349_18908712 | 106 |
| 127 | 3300020078 | Ga0206352_11031132 | Ga0206352_110311323 | 106 |
| 128 | 3300020080 | Ga0206350_10428956 | Ga0206350_104289562 | 106 |
| 129 | 3300020081 | Ga0206354_11025538 | Ga0206354_110255383 | 106 |
| 130 | 3300020082 | Ga0206353_10005794 | Ga0206353_100057943 | 106 |
| 131 | 3300022467 | Ga0224712_10006660 | Ga0224712_100066603 | 106 |
| 132 | 3300025909 | Ga0207705_10007873 | Ga0207705_100078732 | 106 |
| 133 | 3300025912 | Ga0207707_10211280 | Ga0207707_102112803 | 106 |
| 134 | 3300025917 | Ga0207660_10377267 | Ga0207660_103772672 | 106 |
| 135 | 3300025919 | Ga0207657_10494880 | Ga0207657_104948802 | 106 |
| 136 | 3300025921 | Ga0207652_10066451 | Ga0207652_100664512 | 106 |
| 137 | 3300025924 | Ga0207694_10958766 | Ga0207694_109587662 | 106 |
| 138 | 3300025928 | Ga0207700_11008099 | Ga0207700_110080992 | 106 |
| 139 | 3300025929 | Ga0207664_10082843 | Ga0207664_100828433 | 106 |
| 140 | 3300025939 | Ga0207665_10651685 | Ga0207665_106516852 | 106 |
| 141 | 3300025944 | Ga0207661_10011053 | Ga0207661_100110535 | 106 |
| 142 | 3300025945 | Ga0207679_10321274 | Ga0207679_103212742 | 106 |
| 143 | 3300025949 | Ga0207667_10158906 | Ga0207667_101589062 | 106 |
| 144 | 3300026078 | Ga0207702_10293338 | Ga0207702_102933382 | 106 |
| 145 | 3300026095 | Ga0207676_10144071 | Ga0207676_101440713 | 106 |
| 146 | 3300026116 | Ga0207674_10313186 | Ga0207674_103131863 | 106 |
| 147 | 3300026142 | Ga0207698_10455517 | Ga0207698_104555173 | 106 |
| 148 | 3300048915 | Ga0496112_0163363 | Ga0496112_0163363_1342_1704 | 106 |
| 149 | 3300048915 | Ga0496112_0269202 | Ga0496112_0269202_194_556 | 106 |
| 150 | 3300048916 | Ga0496113_0456396 | Ga0496113_0456396_133_495 | 106 |
| 151 | 3300049579 | Ga0501043_0332078 | Ga0501043_0332078_549_911 | 106 |
| 152 | 3300049581 | Ga0501047_0038223 | Ga0501047_0038223_2048_2410 | 106 |
| 153 | 3300049582 | Ga0501048_0399693 | Ga0501048_0399693_439_801 | 106 |
| 154 | 3300049824 | Ga0501045_0573826 | Ga0501045_0573826_320_682 | 106 |
| 155 | iso_pu_bacteria | 2861520306 | 2861521486 | 106 |
| 156 | iso_pu_bacteria | 8056054917 | 8056056863 | 106 |
| 157 | 3300005329 | Ga0070683_100001644 | Ga0070683_1000016443 | 107 |
| 158 | 3300005334 | Ga0068869_100228360 | Ga0068869_1002283602 | 107 |
| 159 | 3300005334 | Ga0068869_100354269 | Ga0068869_1003542692 | 107 |
| 160 | 3300005564 | Ga0070664_100088470 | Ga0070664_1000884703 | 107 |
| 161 | 3300005577 | Ga0068857_101208539 | Ga0068857_1012085392 | 107 |
| 162 | 3300005983 | Ga0081540_1098328 | Ga0081540_10983282 | 107 |
| 163 | 3300006844 | Ga0075428_100086491 | Ga0075428_1000864913 | 107 |
| 164 | 3300006844 | Ga0075428_100103739 | Ga0075428_1001037392 | 107 |
| 165 | 3300006846 | Ga0075430_100321619 | Ga0075430_1003216192 | 107 |
| 166 | 3300006847 | Ga0075431_100182905 | Ga0075431_1001829054 | 107 |
| 167 | 3300006880 | Ga0075429_100052579 | Ga0075429_1000525793 | 107 |
| 168 | 3300006880 | Ga0075429_100115105 | Ga0075429_1001151054 | 107 |
| 169 | 3300009147 | Ga0114129_12004404 | Ga0114129_120044042 | 107 |
| 170 | 3300013297 | Ga0157378_12247256 | Ga0157378_122472562 | 107 |
| 171 | 3300014497 | Ga0182008_10165419 | Ga0182008_101654192 | 107 |
| 172 | 3300025942 | Ga0207689_10177263 | Ga0207689_101772632 | 107 |
| 173 | 3300025942 | Ga0207689_10282866 | Ga0207689_102828662 | 107 |
| 174 | 3300025944 | Ga0207661_10001034 | Ga0207661_1000103420 | 107 |
| 175 | 3300026088 | Ga0207641_12225018 | Ga0207641_122250181 | 107 |
| 176 | 3300031239 | Ga0265328_10019234 | Ga0265328_100192342 | 107 |
| 177 | 3300031733 | Ga0316577_10833132 | Ga0316577_108331321 | 107 |
| 178 | 3300031901 | Ga0307406_10722871 | Ga0307406_107228712 | 107 |
| 179 | 3300032002 | Ga0307416_100359102 | Ga0307416_1003591022 | 107 |
| 180 | 3300032126 | Ga0307415_100729765 | Ga0307415_1007297652 | 107 |
| 181 | 3300049587 | Ga0501071_1265179 | Ga0501071_1265179_124_483 | 107 |
| 182 | 3300050508 | nmdc:mga09592_373135_c1 | nmdc:mga09592_373135_c1_504_863 | 107 |
| 183 | 3300050509 | nmdc:mga0qj67_418518_c1 | nmdc:mga0qj67_418518_c1_156_515 | 107 |
| 184 | 3300050510 | nmdc:mga06r32_475605_c1 | nmdc:mga06r32_475605_c1_490_849 | 107 |
| 185 | 3300054114 | Ga0501084_0506240 | Ga0501084_0506240_496_912 | 107 |
| 186 | 3300005347 | Ga0070668_101642979 | Ga0070668_1016429791 | 108 |
| 187 | 3300005617 | Ga0068859_102983866 | Ga0068859_1029838662 | 108 |
| 188 | 3300005718 | Ga0068866_10404499 | Ga0068866_104044992 | 108 |
| 189 | 3300006048 | Ga0075363_101008540 | Ga0075363_1010085402 | 108 |
| 190 | 3300006844 | Ga0075428_100014457 | Ga0075428_1000144576 | 108 |
| 191 | 3300006846 | Ga0075430_100165479 | Ga0075430_1001654793 | 108 |
| 192 | 3300006846 | Ga0075430_100243280 | Ga0075430_1002432803 | 108 |
| 193 | 3300006847 | Ga0075431_100045971 | Ga0075431_1000459713 | 108 |
| 194 | 3300006880 | Ga0075429_100007135 | Ga0075429_1000071356 | 108 |
| 195 | 3300006931 | Ga0097620_102983700 | Ga0097620_1029837002 | 108 |
| 196 | 3300009094 | Ga0111539_10805438 | Ga0111539_108054382 | 108 |
| 197 | 3300009147 | Ga0114129_10005056 | Ga0114129_100050566 | 108 |
| 198 | 3300009174 | Ga0105241_10963185 | Ga0105241_109631852 | 108 |
| 199 | 3300009177 | Ga0105248_10182532 | Ga0105248_101825322 | 108 |
| 200 | 3300014325 | Ga0163163_10146872 | Ga0163163_101468723 | 108 |
| 201 | 3300025972 | Ga0207668_11086926 | Ga0207668_110869262 | 108 |
| 202 | 3300031901 | Ga0307406_10174835 | Ga0307406_101748351 | 108 |
| 203 | 3300031901 | Ga0307406_11946697 | Ga0307406_119466971 | 108 |
| 204 | 3300032126 | Ga0307415_100170426 | Ga0307415_1001704262 | 108 |
| 205 | 3300035207 | Ga0373942_0047849 | Ga0373942_0047849_797_1159 | 108 |
| 206 | 3300037312 | Ga0395899_1011728 | Ga0395899_1011728_94_462 | 108 |
| 207 | 3300037418 | Ga0395900_0268680 | Ga0395900_0268680_216_584 | 108 |
| 208 | 3300038443 | Ga0395901_0016631 | Ga0395901_0016631_2742_3110 | 108 |
| 209 | 3300041460 | Ga0451802_1455243 | Ga0451802_1455243_232_600 | 108 |
| 210 | 3300041512 | Ga0451853_2990416 | Ga0451853_2990416_621_983 | 108 |
| 211 | 3300046460 | Ga0495638_0455539 | Ga0495638_0455539_200_562 | 108 |
| 212 | 3300046499 | Ga0495594_0117613 | Ga0495594_0117613_748_1116 | 108 |
| 213 | 3300046557 | Ga0495622_0136589 | Ga0495622_0136589_32_400 | 108 |
| 214 | 3300048929 | Ga0496126_0063848 | Ga0496126_0063848_767_1147 | 108 |
| 215 | 3300050490 | nmdc:mga03n38_210510_c1 | nmdc:mga03n38_210510_c1_434_796 | 108 |
| 216 | 3300050507 | nmdc:mga05p37_153347_c1 | nmdc:mga05p37_153347_c1_601_969 | 108 |
| 217 | 3300050508 | nmdc:mga09592_11758_c1 | nmdc:mga09592_11758_c1_5678_6046 | 108 |
| 218 | 3300050508 | nmdc:mga09592_448529_c1 | nmdc:mga09592_448529_c1_20_382 | 108 |
| 219 | 3300050509 | nmdc:mga0qj67_100464_c1 | nmdc:mga0qj67_100464_c1_892_1254 | 108 |
| 220 | 3300005577 | Ga0068857_102425929 | Ga0068857_1024259291 | 109 |
| 221 | 3300005985 | Ga0081539_10000109 | Ga0081539_1000010966 | 109 |
| 222 | 3300006051 | Ga0075364_10930321 | Ga0075364_109303212 | 109 |
| 223 | 3300006847 | Ga0075431_100339915 | Ga0075431_1003399152 | 109 |
| 224 | 3300006880 | Ga0075429_100755267 | Ga0075429_1007552672 | 109 |
| 225 | 3300009147 | Ga0114129_10000007 | Ga0114129_1000000761 | 109 |
| 226 | 3300026116 | Ga0207674_11172099 | Ga0207674_111720992 | 109 |
| 227 | 3300031901 | Ga0307406_10228031 | Ga0307406_102280312 | 109 |
| 228 | 3300049586 | Ga0501070_0472811 | Ga0501070_0472811_396_761 | 109 |
| 229 | 3300050507 | nmdc:mga05p37_6782_c1 | nmdc:mga05p37_6782_c1_3995_4387 | 109 |
| 230 | 3300050508 | nmdc:mga09592_708586_c1 | nmdc:mga09592_708586_c1_124_516 | 109 |
| 231 | 3300050510 | nmdc:mga06r32_1729840_c1 | nmdc:mga06r32_1729840_c1_142_507 | 109 |
| 232 | 3300050510 | nmdc:mga06r32_591359_c1 | nmdc:mga06r32_591359_c1_119_490 | 109 |
| 233 | iso_pu_bacteria | 2751185782 | 2753270630 | 109 |
| 234 | iso_pu_bacteria | 2880489317 | 2880493660 | 109 |
| 235 | iso_pu_bacteria | 2887478801 | 2887483793 | 109 |
| 236 | iso_pu_bacteria | 2902582711 | 2902586282 | 109 |
| 237 | iso_pu_bacteria | 2929226422 | 2929227244 | 109 |
| 238 | iso_pu_bacteria | 2996221748 | 2996227252 | 109 |
| 239 | iso_pu_bacteria | 8001781756 | 8001782422 | 109 |
| 240 | iso_pu_bacteria | 8003856774 | 8003859932 | 109 |
| 241 | iso_pu_bacteria | 8003856774 | 8003862568 | 109 |
| 242 | iso_pu_bacteria | 8054734606 | 8054735030 | 109 |
| 243 | 3300003320 | rootH2_10187251 | rootH2_101872512 | 110 |
| 244 | 3300006871 | Ga0075434_100824137 | Ga0075434_1008241372 | 110 |
| 245 | 3300009545 | Ga0105237_10363384 | Ga0105237_103633842 | 110 |
| 246 | 3300013104 | Ga0157370_11541017 | Ga0157370_115410171 | 110 |
| 247 | 3300022467 | Ga0224712_10083285 | Ga0224712_100832852 | 110 |
| 248 | 3300028794 | Ga0307515_10013108 | Ga0307515_100131085 | 110 |
| 249 | 3300030732 | Ga0316176_1081199 | Ga0316176_10811991 | 110 |
| 250 | 3300030735 | Ga0316178_1168392 | Ga0316178_11683922 | 110 |
| 251 | 3300030742 | Ga0316183_1108901 | Ga0316183_11089012 | 110 |
| 252 | 3300030745 | Ga0316182_1249122 | Ga0316182_12491223 | 110 |
| 253 | 3300031456 | Ga0307513_10000001 | Ga0307513_10000001348 | 110 |
| 254 | 3300031730 | Ga0307516_10070013 | Ga0307516_100700133 | 110 |
| 255 | 3300041404 | Ga0439436_0172020 | Ga0439436_0172020_116_493 | 110 |
| 256 | 3300041405 | Ga0439438_037414 | Ga0439438_037414_22_399 | 110 |
| 257 | 3300042007 | Ga0439449_0223832 | Ga0439449_0223832_60_437 | 110 |
| 258 | 3300042184 | Ga0450908_099342 | Ga0450908_099342_127_504 | 110 |
| 259 | iso_pu_bacteria | 2515154088 | 2515493817 | 110 |
| 260 | iso_pu_bacteria | 2515154137 | 2515755208 | 110 |
| 261 | iso_pu_bacteria | 2515154202 | 2516085556 | 110 |
| 262 | iso_pu_bacteria | 2515154203 | 2516087650 | 110 |
| 263 | iso_pu_bacteria | 2622736626 | 2623586535 | 110 |
| 264 | iso_pu_bacteria | 2675903059 | 2676481455 | 110 |
| 265 | iso_pu_bacteria | 2772190715 | 2772641759 | 110 |
| 266 | iso_pu_bacteria | 2856858025 | 2856860456 | 110 |
| 267 | iso_pu_bacteria | 2858882152 | 2858888626 | 110 |
| 268 | iso_pu_bacteria | 2858895516 | 2858898393 | 110 |
| 269 | iso_pu_bacteria | 2858902515 | 2858907482 | 110 |
| 270 | iso_pu_bacteria | 2867319477 | 2867324838 | 110 |
| 271 | iso_pu_bacteria | 2867507094 | 2867509417 | 110 |
| 272 | iso_pu_bacteria | 649633069 | 649811195 | 110 |
| 273 | iso_pu_bacteria | 8003830390 | 8003833488 | 110 |
| 274 | iso_pu_bacteria | 8055412473 | 8055416193 | 110 |
| 275 | 3300004800 | Ga0058861_11653156 | Ga0058861_116531561 | 111 |
| 276 | 3300005329 | Ga0070683_100003973 | Ga0070683_1000039735 | 111 |
| 277 | 3300005535 | Ga0070684_100160975 | Ga0070684_1001609752 | 111 |
| 278 | 3300005564 | Ga0070664_100536600 | Ga0070664_1005366002 | 111 |
| 279 | 3300005577 | Ga0068857_100552620 | Ga0068857_1005526202 | 111 |
| 280 | 3300025944 | Ga0207661_10002942 | Ga0207661_100029424 | 111 |
| 281 | 3300025945 | Ga0207679_10491558 | Ga0207679_104915582 | 111 |
| 282 | 3300026116 | Ga0207674_10684865 | Ga0207674_106848651 | 111 |
| 283 | 3300031616 | Ga0307508_10149718 | Ga0307508_101497181 | 111 |
| 284 | 3300003575 | Ga0007409J51694_1041147 | Ga0007409J51694_10411471 | 112 |
| 285 | 3300004798 | Ga0058859_11644820 | Ga0058859_116448201 | 112 |
| 286 | 3300004801 | Ga0058860_12177233 | Ga0058860_121772332 | 112 |
| 287 | 3300005333 | Ga0070677_10289611 | Ga0070677_102896112 | 112 |
| 288 | 3300005343 | Ga0070687_100534801 | Ga0070687_1005348011 | 112 |
| 289 | 3300005354 | Ga0070675_100251209 | Ga0070675_1002512092 | 112 |
| 290 | 3300005356 | Ga0070674_100348052 | Ga0070674_1003480521 | 112 |
| 291 | 3300005438 | Ga0070701_11400369 | Ga0070701_114003691 | 112 |
| 292 | 3300005441 | Ga0070700_100205353 | Ga0070700_1002053532 | 112 |
| 293 | 3300005456 | Ga0070678_101816675 | Ga0070678_1018166751 | 112 |
| 294 | 3300005466 | Ga0070685_10425769 | Ga0070685_104257692 | 112 |
| 295 | 3300005983 | Ga0081540_1109584 | Ga0081540_11095842 | 112 |
| 296 | 3300006237 | Ga0097621_100500147 | Ga0097621_1005001472 | 112 |
| 297 | 3300009148 | Ga0105243_10398273 | Ga0105243_103982732 | 112 |
| 298 | 3300013308 | Ga0157375_10409705 | Ga0157375_104097052 | 112 |
| 299 | 3300014326 | Ga0157380_10582896 | Ga0157380_105828962 | 112 |
| 300 | 3300014745 | Ga0157377_10500484 | Ga0157377_105004841 | 112 |
| 301 | 3300025926 | Ga0207659_10151986 | Ga0207659_101519862 | 112 |
| 302 | 3300025927 | Ga0207687_10498322 | Ga0207687_104983222 | 112 |
| 303 | 3300026075 | Ga0207708_10197130 | Ga0207708_101971302 | 112 |
| 304 | 3300026088 | Ga0207641_10177265 | Ga0207641_101772653 | 112 |
| 305 | 3300026095 | Ga0207676_10130236 | Ga0207676_101302362 | 112 |
| 306 | 3300028794 | Ga0307515_10000088 | Ga0307515_10000088119 | 112 |
| 307 | 3300028794 | Ga0307515_10039781 | Ga0307515_100397816 | 112 |
| 308 | 3300031456 | Ga0307513_10039091 | Ga0307513_100390915 | 112 |
| 309 | 3300031548 | Ga0307408_100268714 | Ga0307408_1002687143 | 112 |
| 310 | 3300031730 | Ga0307516_10006674 | Ga0307516_100066744 | 112 |
| 311 | 3300031730 | Ga0307516_10043491 | Ga0307516_100434913 | 112 |
| 312 | 3300031731 | Ga0307405_10170756 | Ga0307405_101707562 | 112 |
| 313 | 3300031824 | Ga0307413_10095009 | Ga0307413_100950093 | 112 |
| 314 | 3300031852 | Ga0307410_10372017 | Ga0307410_103720172 | 112 |
| 315 | 3300031903 | Ga0307407_10025296 | Ga0307407_100252963 | 112 |
| 316 | 3300031911 | Ga0307412_10488276 | Ga0307412_104882762 | 112 |
| 317 | 3300031995 | Ga0307409_100042084 | Ga0307409_1000420843 | 112 |
| 318 | 3300032002 | Ga0307416_100069430 | Ga0307416_1000694303 | 112 |
| 319 | 3300032002 | Ga0307416_100110893 | Ga0307416_1001108932 | 112 |
| 320 | 3300032005 | Ga0307411_10750411 | Ga0307411_107504112 | 112 |
| 321 | 3300032168 | Ga0316593_10023349 | Ga0316593_100233493 | 112 |
| 322 | 3300037853 | Ga0436364_0604116 | Ga0436364_0604116_348_722 | 112 |
| 323 | 3300041441 | Ga0451787_658154 | Ga0451787_658154_26_400 | 112 |
| 324 | 3300041443 | Ga0451789_1288412 | Ga0451789_1288412_444_818 | 112 |
| 325 | 3300041451 | Ga0451791_0746435 | Ga0451791_0746435_762_1136 | 112 |
| 326 | 3300041459 | Ga0451800_0112694 | Ga0451800_0112694_243_617 | 112 |
| 327 | 3300041461 | Ga0451805_084038 | Ga0451805_084038_21_395 | 112 |
| 328 | 3300041463 | Ga0451804_0532200 | Ga0451804_0532200_351_725 | 112 |
| 329 | 3300041512 | Ga0451853_3286472 | Ga0451853_3286472_686_1060 | 112 |
| 330 | 3300045976 | Ga0466967_0061324 | Ga0466967_0061324_767_1147 | 112 |
| 331 | 3300049583 | Ga0501067_0322045 | Ga0501067_0322045_188_565 | 112 |
| 332 | 3300053088 | Ga0500644_0004288 | Ga0500644_0004288_1281_1655 | 112 |
| 333 | 3300053100 | Ga0500660_126278 | Ga0500660_126278_517_888 | 112 |
| 334 | iso_pu_bacteria | 2929219909 | 2929220665 | 112 |
| 335 | 3300003203 | JGI25406J46586_10043635 | JGI25406J46586_100436353 | 113 |
| 336 | 3300003203 | JGI25406J46586_10113656 | JGI25406J46586_101136562 | 113 |
| 337 | 3300003203 | JGI25406J46586_10128039 | JGI25406J46586_101280391 | 113 |
| 338 | 3300003305 | Ga0006770J48903_1026830 | Ga0006770J48903_10268301 | 113 |
| 339 | 3300003320 | rootH2_10116321 | rootH2_101163212 | 113 |
| 340 | 3300003322 | rootL2_10032490 | rootL2_100324903 | 113 |
| 341 | 3300003574 | Ga0007410J51695_1024025 | Ga0007410J51695_10240251 | 113 |
| 342 | 3300003574 | Ga0007410J51695_1063768 | Ga0007410J51695_10637681 | 113 |
| 343 | 3300003575 | Ga0007409J51694_1018812 | Ga0007409J51694_10188122 | 113 |
| 344 | 3300003579 | Ga0007429J51699_1034608 | Ga0007429J51699_10346081 | 113 |
| 345 | 3300003693 | Ga0032354_1071614 | Ga0032354_10716141 | 113 |
| 346 | 3300004798 | Ga0058859_11596728 | Ga0058859_115967282 | 113 |
| 347 | 3300004800 | Ga0058861_12059710 | Ga0058861_120597102 | 113 |
| 348 | 3300004800 | Ga0058861_12065553 | Ga0058861_120655532 | 113 |
| 349 | 3300004801 | Ga0058860_11858986 | Ga0058860_118589862 | 113 |
| 350 | 3300004801 | Ga0058860_12019907 | Ga0058860_120199072 | 113 |
| 351 | 3300004801 | Ga0058860_12192533 | Ga0058860_121925331 | 113 |
| 352 | 3300004803 | Ga0058862_12846367 | Ga0058862_128463672 | 113 |
| 353 | 3300005327 | Ga0070658_10264029 | Ga0070658_102640293 | 113 |
| 354 | 3300005327 | Ga0070658_10390122 | Ga0070658_103901222 | 113 |
| 355 | 3300005327 | Ga0070658_10818781 | Ga0070658_108187811 | 113 |
| 356 | 3300005328 | Ga0070676_10247585 | Ga0070676_102475851 | 113 |
| 357 | 3300005329 | Ga0070683_100049068 | Ga0070683_1000490681 | 113 |
| 358 | 3300005329 | Ga0070683_100289651 | Ga0070683_1002896511 | 113 |
| 359 | 3300005331 | Ga0070670_100611799 | Ga0070670_1006117992 | 113 |
| 360 | 3300005331 | Ga0070670_100866441 | Ga0070670_1008664412 | 113 |
| 361 | 3300005333 | Ga0070677_10760558 | Ga0070677_107605581 | 113 |
| 362 | 3300005334 | Ga0068869_100178734 | Ga0068869_1001787343 | 113 |
| 363 | 3300005336 | Ga0070680_100294094 | Ga0070680_1002940943 | 113 |
| 364 | 3300005337 | Ga0070682_100865929 | Ga0070682_1008659292 | 113 |
| 365 | 3300005338 | Ga0068868_100010441 | Ga0068868_1000104414 | 113 |
| 366 | 3300005338 | Ga0068868_100577292 | Ga0068868_1005772922 | 113 |
| 367 | 3300005339 | Ga0070660_100404803 | Ga0070660_1004048032 | 113 |
| 368 | 3300005339 | Ga0070660_100706809 | Ga0070660_1007068091 | 113 |
| 369 | 3300005340 | Ga0070689_101351714 | Ga0070689_1013517141 | 113 |
| 370 | 3300005343 | Ga0070687_100200866 | Ga0070687_1002008661 | 113 |
| 371 | 3300005343 | Ga0070687_100361330 | Ga0070687_1003613302 | 113 |
| 372 | 3300005344 | Ga0070661_100030405 | Ga0070661_1000304053 | 113 |
| 373 | 3300005344 | Ga0070661_100541372 | Ga0070661_1005413722 | 113 |
| 374 | 3300005345 | Ga0070692_10358057 | Ga0070692_103580571 | 113 |
| 375 | 3300005347 | Ga0070668_100000126 | Ga0070668_10000012619 | 113 |
| 376 | 3300005347 | Ga0070668_100159106 | Ga0070668_1001591062 | 113 |
| 377 | 3300005347 | Ga0070668_102190034 | Ga0070668_1021900341 | 113 |
| 378 | 3300005353 | Ga0070669_100378824 | Ga0070669_1003788242 | 113 |
| 379 | 3300005354 | Ga0070675_100000194 | Ga0070675_10000019425 | 113 |
| 380 | 3300005354 | Ga0070675_100614969 | Ga0070675_1006149692 | 113 |
| 381 | 3300005355 | Ga0070671_100320938 | Ga0070671_1003209382 | 113 |
| 382 | 3300005355 | Ga0070671_100589219 | Ga0070671_1005892192 | 113 |
| 383 | 3300005356 | Ga0070674_101075450 | Ga0070674_1010754502 | 113 |
| 384 | 3300005356 | Ga0070674_101921241 | Ga0070674_1019212412 | 113 |
| 385 | 3300005364 | Ga0070673_101161221 | Ga0070673_1011612211 | 113 |
| 386 | 3300005366 | Ga0070659_100009047 | Ga0070659_1000090472 | 113 |
| 387 | 3300005366 | Ga0070659_100749949 | Ga0070659_1007499491 | 113 |
| 388 | 3300005367 | Ga0070667_100129491 | Ga0070667_1001294912 | 113 |
| 389 | 3300005367 | Ga0070667_100389770 | Ga0070667_1003897702 | 113 |
| 390 | 3300005436 | Ga0070713_100660855 | Ga0070713_1006608552 | 113 |
| 391 | 3300005437 | Ga0070710_10962731 | Ga0070710_109627312 | 113 |
| 392 | 3300005455 | Ga0070663_100818533 | Ga0070663_1008185332 | 113 |
| 393 | 3300005456 | Ga0070678_100450820 | Ga0070678_1004508202 | 113 |
| 394 | 3300005456 | Ga0070678_100657221 | Ga0070678_1006572212 | 113 |
| 395 | 3300005457 | Ga0070662_101005278 | Ga0070662_1010052781 | 113 |
| 396 | 3300005458 | Ga0070681_11389505 | Ga0070681_113895051 | 113 |
| 397 | 3300005459 | Ga0068867_100351501 | Ga0068867_1003515012 | 113 |
| 398 | 3300005466 | Ga0070685_10160370 | Ga0070685_101603703 | 113 |
| 399 | 3300005530 | Ga0070679_100231361 | Ga0070679_1002313611 | 113 |
| 400 | 3300005530 | Ga0070679_100701460 | Ga0070679_1007014602 | 113 |
| 401 | 3300005535 | Ga0070684_100188002 | Ga0070684_1001880022 | 113 |
| 402 | 3300005535 | Ga0070684_100436533 | Ga0070684_1004365332 | 113 |
| 403 | 3300005539 | Ga0068853_100703932 | Ga0068853_1007039322 | 113 |
| 404 | 3300005543 | Ga0070672_100285363 | Ga0070672_1002853633 | 113 |
| 405 | 3300005543 | Ga0070672_100971668 | Ga0070672_1009716681 | 113 |
| 406 | 3300005544 | Ga0070686_101007179 | Ga0070686_1010071791 | 113 |
| 407 | 3300005547 | Ga0070693_100259783 | Ga0070693_1002597831 | 113 |
| 408 | 3300005548 | Ga0070665_100067482 | Ga0070665_1000674822 | 113 |
| 409 | 3300005548 | Ga0070665_102562061 | Ga0070665_1025620612 | 113 |
| 410 | 3300005564 | Ga0070664_100017966 | Ga0070664_1000179663 | 113 |
| 411 | 3300005577 | Ga0068857_100016006 | Ga0068857_1000160062 | 113 |
| 412 | 3300005577 | Ga0068857_100119203 | Ga0068857_1001192033 | 113 |
| 413 | 3300005578 | Ga0068854_100026591 | Ga0068854_1000265912 | 113 |
| 414 | 3300005578 | Ga0068854_100964990 | Ga0068854_1009649901 | 113 |
| 415 | 3300005615 | Ga0070702_100662863 | Ga0070702_1006628631 | 113 |
| 416 | 3300005616 | Ga0068852_100442175 | Ga0068852_1004421752 | 113 |
| 417 | 3300005617 | Ga0068859_100014477 | Ga0068859_1000144776 | 113 |
| 418 | 3300005618 | Ga0068864_100042591 | Ga0068864_1000425913 | 113 |
| 419 | 3300005618 | Ga0068864_100656277 | Ga0068864_1006562772 | 113 |
| 420 | 3300005618 | Ga0068864_100661645 | Ga0068864_1006616452 | 113 |
| 421 | 3300005618 | Ga0068864_101253775 | Ga0068864_1012537752 | 113 |
| 422 | 3300005834 | Ga0068851_10092566 | Ga0068851_100925662 | 113 |
| 423 | 3300005834 | Ga0068851_10501590 | Ga0068851_105015902 | 113 |
| 424 | 3300005840 | Ga0068870_10044752 | Ga0068870_100447523 | 113 |
| 425 | 3300005840 | Ga0068870_10661307 | Ga0068870_106613072 | 113 |
| 426 | 3300005841 | Ga0068863_100000632 | Ga0068863_10000063212 | 113 |
| 427 | 3300005841 | Ga0068863_100132089 | Ga0068863_1001320893 | 113 |
| 428 | 3300005841 | Ga0068863_100143887 | Ga0068863_1001438873 | 113 |
| 429 | 3300005842 | Ga0068858_100109760 | Ga0068858_1001097603 | 113 |
| 430 | 3300005844 | Ga0068862_100107057 | Ga0068862_1001070572 | 113 |
| 431 | 3300005937 | Ga0081455_10228212 | Ga0081455_102282122 | 113 |
| 432 | 3300005937 | Ga0081455_10240129 | Ga0081455_102401292 | 113 |
| 433 | 3300005937 | Ga0081455_10246158 | Ga0081455_102461582 | 113 |
| 434 | 3300005983 | Ga0081540_1025318 | Ga0081540_10253184 | 113 |
| 435 | 3300005985 | Ga0081539_10000837 | Ga0081539_1000083746 | 113 |
| 436 | 3300005985 | Ga0081539_10007335 | Ga0081539_100073353 | 113 |
| 437 | 3300005985 | Ga0081539_10009471 | Ga0081539_100094715 | 113 |
| 438 | 3300005985 | Ga0081539_10037514 | Ga0081539_100375143 | 113 |
| 439 | 3300005985 | Ga0081539_10133643 | Ga0081539_101336433 | 113 |
| 440 | 3300005985 | Ga0081539_10393405 | Ga0081539_103934052 | 113 |
| 441 | 3300006028 | Ga0070717_10155328 | Ga0070717_101553283 | 113 |
| 442 | 3300006042 | Ga0075368_10179885 | Ga0075368_101798852 | 113 |
| 443 | 3300006058 | Ga0075432_10375371 | Ga0075432_103753712 | 113 |
| 444 | 3300006175 | Ga0070712_101089074 | Ga0070712_1010890742 | 113 |
| 445 | 3300006844 | Ga0075428_100090825 | Ga0075428_1000908253 | 113 |
| 446 | 3300006844 | Ga0075428_100503717 | Ga0075428_1005037172 | 113 |
| 447 | 3300006844 | Ga0075428_101124767 | Ga0075428_1011247672 | 113 |
| 448 | 3300006846 | Ga0075430_100010210 | Ga0075430_1000102102 | 113 |
| 449 | 3300006846 | Ga0075430_100247684 | Ga0075430_1002476842 | 113 |
| 450 | 3300006847 | Ga0075431_100002426 | Ga0075431_1000024266 | 113 |
| 451 | 3300006847 | Ga0075431_100965606 | Ga0075431_1009656062 | 113 |
| 452 | 3300006847 | Ga0075431_101009764 | Ga0075431_1010097641 | 113 |
| 453 | 3300006852 | Ga0075433_10501645 | Ga0075433_105016451 | 113 |
| 454 | 3300006852 | Ga0075433_10723782 | Ga0075433_107237822 | 113 |
| 455 | 3300006880 | Ga0075429_100014430 | Ga0075429_1000144306 | 113 |
| 456 | 3300006881 | Ga0068865_100547816 | Ga0068865_1005478161 | 113 |
| 457 | 3300006931 | Ga0097620_100014477 | Ga0097620_1000144773 | 113 |
| 458 | 3300009094 | Ga0111539_11374582 | Ga0111539_113745822 | 113 |
| 459 | 3300009098 | Ga0105245_10406434 | Ga0105245_104064342 | 113 |
| 460 | 3300009098 | Ga0105245_10743998 | Ga0105245_107439982 | 113 |
| 461 | 3300009101 | Ga0105247_10647567 | Ga0105247_106475672 | 113 |
| 462 | 3300009147 | Ga0114129_10000011 | Ga0114129_1000001161 | 113 |
| 463 | 3300009147 | Ga0114129_10010562 | Ga0114129_100105628 | 113 |
| 464 | 3300009148 | Ga0105243_10132383 | Ga0105243_101323832 | 113 |
| 465 | 3300009174 | Ga0105241_10950814 | Ga0105241_109508142 | 113 |
| 466 | 3300009177 | Ga0105248_10059038 | Ga0105248_100590382 | 113 |
| 467 | 3300009177 | Ga0105248_10544617 | Ga0105248_105446172 | 113 |
| 468 | 3300009177 | Ga0105248_11628617 | Ga0105248_116286171 | 113 |
| 469 | 3300009545 | Ga0105237_10910313 | Ga0105237_109103131 | 113 |
| 470 | 3300009545 | Ga0105237_10951776 | Ga0105237_109517762 | 113 |
| 471 | 3300009551 | Ga0105238_10469442 | Ga0105238_104694422 | 113 |
| 472 | 3300009551 | Ga0105238_10695772 | Ga0105238_106957722 | 113 |
| 473 | 3300009553 | Ga0105249_10362331 | Ga0105249_103623312 | 113 |
| 474 | 3300009553 | Ga0105249_10408678 | Ga0105249_104086782 | 113 |
| 475 | 3300009828 | Ga0130087_1016194 | Ga0130087_10161942 | 113 |
| 476 | 3300009829 | Ga0130086_1083337 | Ga0130086_10833372 | 113 |
| 477 | 3300009835 | Ga0130084_1114510 | Ga0130084_11145102 | 113 |
| 478 | 3300011119 | Ga0105246_12046664 | Ga0105246_120466642 | 113 |
| 479 | 3300013102 | Ga0157371_11130049 | Ga0157371_111300492 | 113 |
| 480 | 3300013105 | Ga0157369_11411422 | Ga0157369_114114221 | 113 |
| 481 | 3300013296 | Ga0157374_10799193 | Ga0157374_107991932 | 113 |
| 482 | 3300013297 | Ga0157378_10186509 | Ga0157378_101865091 | 113 |
| 483 | 3300013306 | Ga0163162_10413803 | Ga0163162_104138032 | 113 |
| 484 | 3300013307 | Ga0157372_10699909 | Ga0157372_106999092 | 113 |
| 485 | 3300013308 | Ga0157375_10500694 | Ga0157375_105006941 | 113 |
| 486 | 3300014325 | Ga0163163_10189475 | Ga0163163_101894753 | 113 |
| 487 | 3300014325 | Ga0163163_11135515 | Ga0163163_111355152 | 113 |
| 488 | 3300014497 | Ga0182008_10297557 | Ga0182008_102975571 | 113 |
| 489 | 3300014497 | Ga0182008_10373499 | Ga0182008_103734992 | 113 |
| 490 | 3300014745 | Ga0157377_10713388 | Ga0157377_107133881 | 113 |
| 491 | 3300014969 | Ga0157376_10178350 | Ga0157376_101783502 | 113 |
| 492 | 3300020069 | Ga0197907_10891682 | Ga0197907_108916823 | 113 |
| 493 | 3300020070 | Ga0206356_10184226 | Ga0206356_101842261 | 113 |
| 494 | 3300020070 | Ga0206356_10445206 | Ga0206356_104452063 | 113 |
| 495 | 3300020070 | Ga0206356_11028553 | Ga0206356_110285532 | 113 |
| 496 | 3300020070 | Ga0206356_11645676 | Ga0206356_116456762 | 113 |
| 497 | 3300020077 | Ga0206351_10395379 | Ga0206351_103953792 | 113 |
| 498 | 3300020078 | Ga0206352_10306061 | Ga0206352_103060612 | 113 |
| 499 | 3300020078 | Ga0206352_10523430 | Ga0206352_105234302 | 113 |
| 500 | 3300020078 | Ga0206352_10681363 | Ga0206352_106813632 | 113 |
| 501 | 3300020081 | Ga0206354_11540779 | Ga0206354_115407793 | 113 |
| 502 | 3300025321 | Ga0207656_10038352 | Ga0207656_100383523 | 113 |
| 503 | 3300025893 | Ga0207682_10135378 | Ga0207682_101353782 | 113 |
| 504 | 3300025900 | Ga0207710_10054824 | Ga0207710_100548243 | 113 |
| 505 | 3300025901 | Ga0207688_10406618 | Ga0207688_104066182 | 113 |
| 506 | 3300025909 | Ga0207705_10201781 | Ga0207705_102017812 | 113 |
| 507 | 3300025910 | Ga0207684_10324576 | Ga0207684_103245762 | 113 |
| 508 | 3300025911 | Ga0207654_10245715 | Ga0207654_102457153 | 113 |
| 509 | 3300025914 | Ga0207671_10208093 | Ga0207671_102080932 | 113 |
| 510 | 3300025914 | Ga0207671_11444621 | Ga0207671_114446212 | 113 |
| 511 | 3300025915 | Ga0207693_10836526 | Ga0207693_108365262 | 113 |
| 512 | 3300025917 | Ga0207660_10405620 | Ga0207660_104056203 | 113 |
| 513 | 3300025918 | Ga0207662_10342361 | Ga0207662_103423612 | 113 |
| 514 | 3300025918 | Ga0207662_10679978 | Ga0207662_106799782 | 113 |
| 515 | 3300025919 | Ga0207657_10373933 | Ga0207657_103739331 | 113 |
| 516 | 3300025920 | Ga0207649_10019283 | Ga0207649_100192833 | 113 |
| 517 | 3300025921 | Ga0207652_10367554 | Ga0207652_103675542 | 113 |
| 518 | 3300025923 | Ga0207681_10109141 | Ga0207681_101091413 | 113 |
| 519 | 3300025924 | Ga0207694_10489807 | Ga0207694_104898072 | 113 |
| 520 | 3300025925 | Ga0207650_10556329 | Ga0207650_105563292 | 113 |
| 521 | 3300025926 | Ga0207659_10071819 | Ga0207659_100718193 | 113 |
| 522 | 3300025926 | Ga0207659_11479883 | Ga0207659_114798831 | 113 |
| 523 | 3300025927 | Ga0207687_10005904 | Ga0207687_100059042 | 113 |
| 524 | 3300025927 | Ga0207687_10049584 | Ga0207687_100495843 | 113 |
| 525 | 3300025928 | Ga0207700_10238980 | Ga0207700_102389802 | 113 |
| 526 | 3300025932 | Ga0207690_10041486 | Ga0207690_100414863 | 113 |
| 527 | 3300025933 | Ga0207706_10103463 | Ga0207706_101034632 | 113 |
| 528 | 3300025935 | Ga0207709_10140868 | Ga0207709_101408682 | 113 |
| 529 | 3300025937 | Ga0207669_10825359 | Ga0207669_108253592 | 113 |
| 530 | 3300025939 | Ga0207665_10119443 | Ga0207665_101194432 | 113 |
| 531 | 3300025940 | Ga0207691_10139279 | Ga0207691_101392791 | 113 |
| 532 | 3300025940 | Ga0207691_10480228 | Ga0207691_104802282 | 113 |
| 533 | 3300025941 | Ga0207711_10079484 | Ga0207711_100794843 | 113 |
| 534 | 3300025942 | Ga0207689_10007698 | Ga0207689_100076982 | 113 |
| 535 | 3300025942 | Ga0207689_10107564 | Ga0207689_101075642 | 113 |
| 536 | 3300025944 | Ga0207661_10138752 | Ga0207661_101387522 | 113 |
| 537 | 3300025944 | Ga0207661_10487345 | Ga0207661_104873453 | 113 |
| 538 | 3300025945 | Ga0207679_10027761 | Ga0207679_100277613 | 113 |
| 539 | 3300025961 | Ga0207712_10062584 | Ga0207712_100625843 | 113 |
| 540 | 3300025961 | Ga0207712_10647591 | Ga0207712_106475912 | 113 |
| 541 | 3300025972 | Ga0207668_10002695 | Ga0207668_1000269510 | 113 |
| 542 | 3300025972 | Ga0207668_10133071 | Ga0207668_101330711 | 113 |
| 543 | 3300025981 | Ga0207640_10976507 | Ga0207640_109765072 | 113 |
| 544 | 3300025986 | Ga0207658_10361002 | Ga0207658_103610022 | 113 |
| 545 | 3300026023 | Ga0207677_10012422 | Ga0207677_100124224 | 113 |
| 546 | 3300026035 | Ga0207703_10332913 | Ga0207703_103329132 | 113 |
| 547 | 3300026067 | Ga0207678_10031471 | Ga0207678_100314712 | 113 |
| 548 | 3300026067 | Ga0207678_10939728 | Ga0207678_109397281 | 113 |
| 549 | 3300026075 | Ga0207708_10028322 | Ga0207708_100283223 | 113 |
| 550 | 3300026088 | Ga0207641_10007184 | Ga0207641_100071846 | 113 |
| 551 | 3300026089 | Ga0207648_10328976 | Ga0207648_103289763 | 113 |
| 552 | 3300026095 | Ga0207676_10192216 | Ga0207676_101922162 | 113 |
| 553 | 3300026095 | Ga0207676_10433084 | Ga0207676_104330841 | 113 |
| 554 | 3300026095 | Ga0207676_10530023 | Ga0207676_105300232 | 113 |
| 555 | 3300026116 | Ga0207674_10004069 | Ga0207674_1000406910 | 113 |
| 556 | 3300026118 | Ga0207675_101268673 | Ga0207675_1012686732 | 113 |
| 557 | 3300026121 | Ga0207683_10074623 | Ga0207683_100746232 | 113 |
| 558 | 3300026121 | Ga0207683_10382122 | Ga0207683_103821222 | 113 |
| 559 | 3300027866 | Ga0209813_10294289 | Ga0209813_102942892 | 113 |
| 560 | 3300027907 | Ga0207428_10035191 | Ga0207428_100351913 | 113 |
| 561 | 3300028379 | Ga0268266_10238228 | Ga0268266_102382282 | 113 |
| 562 | 3300028379 | Ga0268266_10414557 | Ga0268266_104145572 | 113 |
| 563 | 3300028380 | Ga0268265_10094774 | Ga0268265_100947743 | 113 |
| 564 | 3300028381 | Ga0268264_10173608 | Ga0268264_101736081 | 113 |
| 565 | 3300030522 | Ga0307512_10071268 | Ga0307512_100712683 | 113 |
| 566 | 3300031507 | Ga0307509_10018036 | Ga0307509_100180368 | 113 |
| 567 | 3300031507 | Ga0307509_10485771 | Ga0307509_104857712 | 113 |
| 568 | 3300031616 | Ga0307508_10001033 | Ga0307508_1000103314 | 113 |
| 569 | 3300031616 | Ga0307508_10601568 | Ga0307508_106015682 | 113 |
| 570 | 3300031649 | Ga0307514_10265715 | Ga0307514_102657152 | 113 |
| 571 | 3300031731 | Ga0307405_10028362 | Ga0307405_100283623 | 113 |
| 572 | 3300031731 | Ga0307405_10212786 | Ga0307405_102127862 | 113 |
| 573 | 3300031824 | Ga0307413_10269399 | Ga0307413_102693993 | 113 |
| 574 | 3300031824 | Ga0307413_10340493 | Ga0307413_103404931 | 113 |
| 575 | 3300031824 | Ga0307413_11159118 | Ga0307413_111591182 | 113 |
| 576 | 3300031824 | Ga0307413_11493271 | Ga0307413_114932711 | 113 |
| 577 | 3300031852 | Ga0307410_10585175 | Ga0307410_105851751 | 113 |
| 578 | 3300031901 | Ga0307406_10156900 | Ga0307406_101569002 | 113 |
| 579 | 3300031901 | Ga0307406_10327321 | Ga0307406_103273212 | 113 |
| 580 | 3300031903 | Ga0307407_10789307 | Ga0307407_107893072 | 113 |
| 581 | 3300031995 | Ga0307409_100280632 | Ga0307409_1002806322 | 113 |
| 582 | 3300031995 | Ga0307409_100587903 | Ga0307409_1005879032 | 113 |
| 583 | 3300031995 | Ga0307409_101169721 | Ga0307409_1011697212 | 113 |
| 584 | 3300031995 | Ga0307409_101641228 | Ga0307409_1016412281 | 113 |
| 585 | 3300032002 | Ga0307416_100462737 | Ga0307416_1004627372 | 113 |
| 586 | 3300032002 | Ga0307416_101111190 | Ga0307416_1011111902 | 113 |
| 587 | 3300032002 | Ga0307416_103528277 | Ga0307416_1035282771 | 113 |
| 588 | 3300032005 | Ga0307411_11023821 | Ga0307411_110238211 | 113 |
| 589 | 3300032126 | Ga0307415_100128838 | Ga0307415_1001288383 | 113 |
| 590 | 3300032126 | Ga0307415_100186987 | Ga0307415_1001869871 | 113 |
| 591 | 3300032126 | Ga0307415_100865144 | Ga0307415_1008651442 | 113 |
| 592 | 3300033179 | Ga0307507_10036964 | Ga0307507_100369643 | 113 |
| 593 | 3300034817 | Ga0373948_0020911 | Ga0373948_0020911_383_763 | 113 |
| 594 | 3300034957 | Ga0373938_0044520 | Ga0373938_0044520_56_436 | 113 |
| 595 | 3300035084 | Ga0373928_0103906 | Ga0373928_0103906_113_493 | 113 |
| 596 | 3300035088 | Ga0373940_0009036 | Ga0373940_0009036_566_946 | 113 |
| 597 | 3300035112 | Ga0373932_0011494 | Ga0373932_0011494_913_1293 | 113 |
| 598 | 3300035114 | Ga0373939_0197378 | Ga0373939_0197378_214_594 | 113 |
| 599 | 3300035115 | Ga0373941_0059789 | Ga0373941_0059789_41_421 | 113 |
| 600 | 3300035207 | Ga0373942_0002690 | Ga0373942_0002690_2349_2729 | 113 |
| 601 | 3300035242 | Ga0373962_0080915 | Ga0373962_0080915_530_910 | 113 |
| 602 | 3300035691 | Ga0373931_0859209 | Ga0373931_0859209_62_442 | 113 |
| 603 | 3300035692 | Ga0373935_0002590 | Ga0373935_0002590_1982_2362 | 113 |
| 604 | 3300035725 | Ga0373947_0339306 | Ga0373947_0339306_576_956 | 113 |
| 605 | 3300036401 | Ga0373937_1197649 | Ga0373937_1197649_311_688 | 113 |
| 606 | 3300041446 | Ga0451794_30919 | Ga0451794_30919_19_399 | 113 |
| 607 | 3300041452 | Ga0451793_1415064 | Ga0451793_1415064_386_763 | 113 |
| 608 | 3300041455 | Ga0451801_32288 | Ga0451801_32288_167_556 | 113 |
| 609 | 3300041461 | Ga0451805_030692 | Ga0451805_030692_315_704 | 113 |
| 610 | 3300041486 | Ga0451807_0946012 | Ga0451807_0946012_181_561 | 113 |
| 611 | 3300041502 | Ga0451846_49640 | Ga0451846_49640_19_408 | 113 |
| 612 | 3300044693 | Ga0466961_0183679 | Ga0466961_0183679_238_618 | 113 |
| 613 | 3300044694 | Ga0466963_1258665 | Ga0466963_1258665_121_501 | 113 |
| 614 | 3300044719 | Ga0466971_0310346 | Ga0466971_0310346_186_566 | 113 |
| 615 | 3300044842 | Ga0466957_0079358 | Ga0466957_0079358_920_1297 | 113 |
| 616 | 3300044901 | Ga0466960_0412244 | Ga0466960_0412244_240_620 | 113 |
| 617 | 3300044901 | Ga0466960_0584332 | Ga0466960_0584332_89_469 | 113 |
| 618 | 3300045836 | Ga0466958_0817147 | Ga0466958_0817147_91_471 | 113 |
| 619 | 3300045976 | Ga0466967_0519673 | Ga0466967_0519673_275_655 | 113 |
| 620 | 3300046459 | Ga0495629_0030517 | Ga0495629_0030517_2565_2945 | 113 |
| 621 | 3300046459 | Ga0495629_0056195 | Ga0495629_0056195_619_999 | 113 |
| 622 | 3300046499 | Ga0495594_0096546 | Ga0495594_0096546_290_670 | 113 |
| 623 | 3300046499 | Ga0495594_0101277 | Ga0495594_0101277_664_1041 | 113 |
| 624 | 3300046519 | Ga0495632_0145463 | Ga0495632_0145463_611_991 | 113 |
| 625 | 3300047315 | Ga0495581_0492374 | Ga0495581_0492374_234_614 | 113 |
| 626 | 3300048907 | Ga0496104_0070355 | Ga0496104_0070355_971_1351 | 113 |
| 627 | 3300048908 | Ga0496105_0090253 | Ga0496105_0090253_1301_1681 | 113 |
| 628 | 3300048909 | Ga0496106_1470990 | Ga0496106_1470990_94_474 | 113 |
| 629 | 3300048911 | Ga0496108_0000019 | Ga0496108_0000019_165823_166203 | 113 |
| 630 | 3300048911 | Ga0496108_1473386 | Ga0496108_1473386_123_503 | 113 |
| 631 | 3300048912 | Ga0496109_0317178 | Ga0496109_0317178_194_574 | 113 |
| 632 | 3300048912 | Ga0496109_1659842 | Ga0496109_1659842_75_455 | 113 |
| 633 | 3300048913 | Ga0496110_1175428 | Ga0496110_1175428_178_558 | 113 |
| 634 | 3300048913 | Ga0496110_1531537 | Ga0496110_1531537_92_466 | 113 |
| 635 | 3300048915 | Ga0496112_0022573 | Ga0496112_0022573_1765_2145 | 113 |
| 636 | 3300048915 | Ga0496112_1372715 | Ga0496112_1372715_49_426 | 113 |
| 637 | 3300048916 | Ga0496113_1231647 | Ga0496113_1231647_65_445 | 113 |
| 638 | 3300048929 | Ga0496126_0440165 | Ga0496126_0440165_488_868 | 113 |
| 639 | 3300049578 | Ga0501042_0308814 | Ga0501042_0308814_556_936 | 113 |
| 640 | 3300050495 | nmdc:mga04h51_328745_c1 | nmdc:mga04h51_328745_c1_150_527 | 113 |
| 641 | 3300050507 | nmdc:mga05p37_1691_c1 | nmdc:mga05p37_1691_c1_21572_21946 | 113 |
| 642 | 3300050507 | nmdc:mga05p37_40243_c1 | nmdc:mga05p37_40243_c1_2288_2665 | 113 |
| 643 | 3300050507 | nmdc:mga05p37_411685_c1 | nmdc:mga05p37_411685_c1_871_1248 | 113 |
| 644 | 3300050508 | nmdc:mga09592_4861_c1 | nmdc:mga09592_4861_c1_6039_6416 | 113 |
| 645 | 3300050509 | nmdc:mga0qj67_1336030_c1 | nmdc:mga0qj67_1336030_c1_84_461 | 113 |
| 646 | 3300050509 | nmdc:mga0qj67_41028_c1 | nmdc:mga0qj67_41028_c1_2824_3201 | 113 |
| 647 | 3300050510 | nmdc:mga06r32_488104_c1 | nmdc:mga06r32_488104_c1_421_795 | 113 |
| 648 | 3300050510 | nmdc:mga06r32_76305_c1 | nmdc:mga06r32_76305_c1_1641_2018 | 113 |
| 649 | 3300050510 | nmdc:mga06r32_9713_c1 | nmdc:mga06r32_9713_c1_8022_8402 | 113 |
| 650 | 3300050512 | nmdc:mga0n895_604776_c1 | nmdc:mga0n895_604776_c1_496_873 | 113 |
| 651 | 3300050515 | nmdc:mga0a205_520500_c1 | nmdc:mga0a205_520500_c1_404_781 | 113 |
| 652 | 3300050515 | nmdc:mga0a205_768639_c1 | nmdc:mga0a205_768639_c1_83_460 | 113 |
| 653 | 3300053086 | Ga0500578_0662702 | Ga0500578_0662702_109_489 | 113 |
| 654 | 3300053092 | Ga0500583_0354667 | Ga0500583_0354667_313_693 | 113 |
| 655 | 3300053093 | Ga0500651_0250974 | Ga0500651_0250974_510_890 | 113 |
| 656 | 3300053104 | Ga0500556_0240722 | Ga0500556_0240722_22_402 | 113 |
| 657 | 3300053111 | Ga0500572_202517 | Ga0500572_202517_190_570 | 113 |
| 658 | 3300053142 | Ga0500577_0230233 | Ga0500577_0230233_94_474 | 113 |
| 659 | 3300053159 | Ga0500630_187723 | Ga0500630_187723_94_474 | 113 |
| 660 | 3300059490 | Ga0587066_067363 | Ga0587066_067363_142_522 | 113 |
| 661 | 3300059491 | Ga0587070_051968 | Ga0587070_051968_243_623 | 113 |
| 662 | 3300059504 | Ga0587082_011845 | Ga0587082_011845_686_1066 | 113 |
| 663 | 3300059623 | Ga0587101_072204 | Ga0587101_072204_13_393 | 113 |
| 664 | 3300059639 | Ga0587062_031890 | Ga0587062_031890_82_462 | 113 |
| 665 | 3300059646 | Ga0587078_083471 | Ga0587078_083471_13_393 | 113 |
| 666 | 3300059647 | Ga0587079_017185 | Ga0587079_017185_40_420 | 113 |
| 667 | 3300059647 | Ga0587079_032566 | Ga0587079_032566_18_401 | 113 |
| 668 | 3300059658 | Ga0587119_014324 | Ga0587119_014324_293_673 | 113 |
| 669 | 3300060344 | Ga0587071_085581 | Ga0587071_085581_46_429 | 113 |
| 670 | iso_pu_bacteria | 8054704163 | 8054708180 | 113 |
| 671 | 3300003659 | JGI25404J52841_10051272 | JGI25404J52841_100512722 | 114 |
| 672 | 3300004799 | Ga0058863_10043464 | Ga0058863_100434642 | 114 |
| 673 | 3300004800 | Ga0058861_12062396 | Ga0058861_120623963 | 114 |
| 674 | 3300004803 | Ga0058862_10032891 | Ga0058862_100328912 | 114 |
| 675 | 3300005327 | Ga0070658_10057542 | Ga0070658_100575423 | 114 |
| 676 | 3300005329 | Ga0070683_100119646 | Ga0070683_1001196463 | 114 |
| 677 | 3300005334 | Ga0068869_100117816 | Ga0068869_1001178162 | 114 |
| 678 | 3300005336 | Ga0070680_100070645 | Ga0070680_1000706453 | 114 |
| 679 | 3300005337 | Ga0070682_100087308 | Ga0070682_1000873083 | 114 |
| 680 | 3300005339 | Ga0070660_100061410 | Ga0070660_1000614103 | 114 |
| 681 | 3300005344 | Ga0070661_100229387 | Ga0070661_1002293872 | 114 |
| 682 | 3300005345 | Ga0070692_10002983 | Ga0070692_100029832 | 114 |
| 683 | 3300005347 | Ga0070668_100022741 | Ga0070668_1000227412 | 114 |
| 684 | 3300005366 | Ga0070659_100391499 | Ga0070659_1003914992 | 114 |
| 685 | 3300005435 | Ga0070714_100146372 | Ga0070714_1001463724 | 114 |
| 686 | 3300005436 | Ga0070713_100266695 | Ga0070713_1002666952 | 114 |
| 687 | 3300005441 | Ga0070700_100034264 | Ga0070700_1000342643 | 114 |
| 688 | 3300005455 | Ga0070663_100015500 | Ga0070663_1000155003 | 114 |
| 689 | 3300005458 | Ga0070681_10084464 | Ga0070681_100844643 | 114 |
| 690 | 3300005458 | Ga0070681_10744943 | Ga0070681_107449432 | 114 |
| 691 | 3300005468 | Ga0070707_101038696 | Ga0070707_1010386962 | 114 |
| 692 | 3300005530 | Ga0070679_100280689 | Ga0070679_1002806892 | 114 |
| 693 | 3300005535 | Ga0070684_100028161 | Ga0070684_1000281613 | 114 |
| 694 | 3300005564 | Ga0070664_100373939 | Ga0070664_1003739392 | 114 |
| 695 | 3300005577 | Ga0068857_100306850 | Ga0068857_1003068503 | 114 |
| 696 | 3300005577 | Ga0068857_100514229 | Ga0068857_1005142291 | 114 |
| 697 | 3300005578 | Ga0068854_100619828 | Ga0068854_1006198281 | 114 |
| 698 | 3300005614 | Ga0068856_100490313 | Ga0068856_1004903132 | 114 |
| 699 | 3300005614 | Ga0068856_100582038 | Ga0068856_1005820381 | 114 |
| 700 | 3300005616 | Ga0068852_101259875 | Ga0068852_1012598752 | 114 |
| 701 | 3300005618 | Ga0068864_100502654 | Ga0068864_1005026542 | 114 |
| 702 | 3300005718 | Ga0068866_10295739 | Ga0068866_102957392 | 114 |
| 703 | 3300005719 | Ga0068861_100267902 | Ga0068861_1002679022 | 114 |
| 704 | 3300005843 | Ga0068860_100593481 | Ga0068860_1005934812 | 114 |
| 705 | 3300005844 | Ga0068862_100258938 | Ga0068862_1002589382 | 114 |
| 706 | 3300005983 | Ga0081540_1004328 | Ga0081540_10043287 | 114 |
| 707 | 3300005983 | Ga0081540_1079648 | Ga0081540_10796483 | 114 |
| 708 | 3300006173 | Ga0070716_100505932 | Ga0070716_1005059322 | 114 |
| 709 | 3300006175 | Ga0070712_101396244 | Ga0070712_1013962441 | 114 |
| 710 | 3300006358 | Ga0068871_100910378 | Ga0068871_1009103782 | 114 |
| 711 | 3300006846 | Ga0075430_100023905 | Ga0075430_1000239055 | 114 |
| 712 | 3300006846 | Ga0075430_100573517 | Ga0075430_1005735171 | 114 |
| 713 | 3300006847 | Ga0075431_100034622 | Ga0075431_1000346225 | 114 |
| 714 | 3300006847 | Ga0075431_100668531 | Ga0075431_1006685312 | 114 |
| 715 | 3300006880 | Ga0075429_100010682 | Ga0075429_1000106823 | 114 |
| 716 | 3300009094 | Ga0111539_10000420 | Ga0111539_1000042046 | 114 |
| 717 | 3300009098 | Ga0105245_10001054 | Ga0105245_100010543 | 114 |
| 718 | 3300009101 | Ga0105247_11199179 | Ga0105247_111991791 | 114 |
| 719 | 3300009147 | Ga0114129_10000001 | Ga0114129_10000001213 | 114 |
| 720 | 3300009148 | Ga0105243_10209725 | Ga0105243_102097252 | 114 |
| 721 | 3300009174 | Ga0105241_10281781 | Ga0105241_102817813 | 114 |
| 722 | 3300009545 | Ga0105237_10349594 | Ga0105237_103495942 | 114 |
| 723 | 3300009553 | Ga0105249_10064284 | Ga0105249_100642843 | 114 |
| 724 | 3300013052 | Ga0154014_111627 | Ga0154014_1116271 | 114 |
| 725 | 3300013102 | Ga0157371_10693643 | Ga0157371_106936432 | 114 |
| 726 | 3300013104 | Ga0157370_10105609 | Ga0157370_101056092 | 114 |
| 727 | 3300013105 | Ga0157369_10315884 | Ga0157369_103158843 | 114 |
| 728 | 3300013296 | Ga0157374_10482842 | Ga0157374_104828422 | 114 |
| 729 | 3300013306 | Ga0163162_10222729 | Ga0163162_102227293 | 114 |
| 730 | 3300013307 | Ga0157372_10423042 | Ga0157372_104230423 | 114 |
| 731 | 3300013308 | Ga0157375_13204886 | Ga0157375_132048862 | 114 |
| 732 | 3300014325 | Ga0163163_10167476 | Ga0163163_101674764 | 114 |
| 733 | 3300014745 | Ga0157377_10004597 | Ga0157377_100045972 | 114 |
| 734 | 3300017792 | Ga0163161_10495591 | Ga0163161_104955911 | 114 |
| 735 | 3300020069 | Ga0197907_10379184 | Ga0197907_103791842 | 114 |
| 736 | 3300020069 | Ga0197907_10658708 | Ga0197907_106587083 | 114 |
| 737 | 3300020070 | Ga0206356_10193519 | Ga0206356_101935195 | 114 |
| 738 | 3300020075 | Ga0206349_1106262 | Ga0206349_11062623 | 114 |
| 739 | 3300020076 | Ga0206355_1173917 | Ga0206355_11739171 | 114 |
| 740 | 3300020077 | Ga0206351_10442925 | Ga0206351_104429253 | 114 |
| 741 | 3300020078 | Ga0206352_10317914 | Ga0206352_103179143 | 114 |
| 742 | 3300020080 | Ga0206350_10138868 | Ga0206350_101388683 | 114 |
| 743 | 3300020081 | Ga0206354_10309334 | Ga0206354_103093341 | 114 |
| 744 | 3300020081 | Ga0206354_10790976 | Ga0206354_107909762 | 114 |
| 745 | 3300020082 | Ga0206353_10000897 | Ga0206353_100008972 | 114 |
| 746 | 3300020082 | Ga0206353_11941442 | Ga0206353_119414423 | 114 |
| 747 | 3300022467 | Ga0224712_10009696 | Ga0224712_100096963 | 114 |
| 748 | 3300022467 | Ga0224712_10029395 | Ga0224712_100293952 | 114 |
| 749 | 3300022467 | Ga0224712_10213763 | Ga0224712_102137632 | 114 |
| 750 | 3300025899 | Ga0207642_10975051 | Ga0207642_109750512 | 114 |
| 751 | 3300025901 | Ga0207688_10641425 | Ga0207688_106414252 | 114 |
| 752 | 3300025906 | Ga0207699_10263491 | Ga0207699_102634912 | 114 |
| 753 | 3300025908 | Ga0207643_10529355 | Ga0207643_105293552 | 114 |
| 754 | 3300025909 | Ga0207705_10096461 | Ga0207705_100964612 | 114 |
| 755 | 3300025909 | Ga0207705_10819910 | Ga0207705_108199102 | 114 |
| 756 | 3300025909 | Ga0207705_10863602 | Ga0207705_108636021 | 114 |
| 757 | 3300025912 | Ga0207707_10282952 | Ga0207707_102829522 | 114 |
| 758 | 3300025912 | Ga0207707_10575654 | Ga0207707_105756541 | 114 |
| 759 | 3300025917 | Ga0207660_10270825 | Ga0207660_102708251 | 114 |
| 760 | 3300025918 | Ga0207662_10156312 | Ga0207662_101563122 | 114 |
| 761 | 3300025919 | Ga0207657_10043531 | Ga0207657_100435313 | 114 |
| 762 | 3300025919 | Ga0207657_10230689 | Ga0207657_102306892 | 114 |
| 763 | 3300025920 | Ga0207649_10090026 | Ga0207649_100900262 | 114 |
| 764 | 3300025921 | Ga0207652_10215544 | Ga0207652_102155443 | 114 |
| 765 | 3300025924 | Ga0207694_10265261 | Ga0207694_102652613 | 114 |
| 766 | 3300025925 | Ga0207650_10414713 | Ga0207650_104147132 | 114 |
| 767 | 3300025928 | Ga0207700_10024274 | Ga0207700_100242743 | 114 |
| 768 | 3300025929 | Ga0207664_10121965 | Ga0207664_101219652 | 114 |
| 769 | 3300025932 | Ga0207690_10246257 | Ga0207690_102462572 | 114 |
| 770 | 3300025935 | Ga0207709_11869913 | Ga0207709_118699131 | 114 |
| 771 | 3300025939 | Ga0207665_10518277 | Ga0207665_105182771 | 114 |
| 772 | 3300025941 | Ga0207711_10958595 | Ga0207711_109585951 | 114 |
| 773 | 3300025944 | Ga0207661_10066024 | Ga0207661_100660243 | 114 |
| 774 | 3300025944 | Ga0207661_10440763 | Ga0207661_104407633 | 114 |
| 775 | 3300025944 | Ga0207661_10664547 | Ga0207661_106645472 | 114 |
| 776 | 3300025945 | Ga0207679_10222785 | Ga0207679_102227852 | 114 |
| 777 | 3300025949 | Ga0207667_10209048 | Ga0207667_102090483 | 114 |
| 778 | 3300025986 | Ga0207658_10173886 | Ga0207658_101738862 | 114 |
| 779 | 3300026041 | Ga0207639_10504187 | Ga0207639_105041872 | 114 |
| 780 | 3300026067 | Ga0207678_10502440 | Ga0207678_105024402 | 114 |
| 781 | 3300026067 | Ga0207678_11674474 | Ga0207678_116744742 | 114 |
| 782 | 3300026078 | Ga0207702_10316852 | Ga0207702_103168522 | 114 |
| 783 | 3300026078 | Ga0207702_10692305 | Ga0207702_106923051 | 114 |
| 784 | 3300026088 | Ga0207641_11287326 | Ga0207641_112873262 | 114 |
| 785 | 3300026089 | Ga0207648_11010857 | Ga0207648_110108571 | 114 |
| 786 | 3300026095 | Ga0207676_11940952 | Ga0207676_119409521 | 114 |
| 787 | 3300026116 | Ga0207674_10082509 | Ga0207674_100825092 | 114 |
| 788 | 3300026116 | Ga0207674_10084146 | Ga0207674_100841463 | 114 |
| 789 | 3300026116 | Ga0207674_12187768 | Ga0207674_121877681 | 114 |
| 790 | 3300026118 | Ga0207675_100510410 | Ga0207675_1005104102 | 114 |
| 791 | 3300026142 | Ga0207698_10933798 | Ga0207698_109337982 | 114 |
| 792 | 3300028379 | Ga0268266_12002855 | Ga0268266_120028551 | 114 |
| 793 | 3300028380 | Ga0268265_11476194 | Ga0268265_114761941 | 114 |
| 794 | 3300030522 | Ga0307512_10224937 | Ga0307512_102249372 | 114 |
| 795 | 3300031730 | Ga0307516_10011094 | Ga0307516_100110945 | 114 |
| 796 | 3300031852 | Ga0307410_10237645 | Ga0307410_102376452 | 114 |
| 797 | 3300031901 | Ga0307406_10180017 | Ga0307406_101800173 | 114 |
| 798 | 3300031901 | Ga0307406_10828271 | Ga0307406_108282712 | 114 |
| 799 | 3300031903 | Ga0307407_10371117 | Ga0307407_103711171 | 114 |
| 800 | 3300032002 | Ga0307416_100019576 | Ga0307416_1000195763 | 114 |
| 801 | 3300032126 | Ga0307415_100012069 | Ga0307415_1000120693 | 114 |
| 802 | 3300032126 | Ga0307415_100940233 | Ga0307415_1009402331 | 114 |
| 803 | 3300035118 | Ga0373954_0374955 | Ga0373954_0374955_45_425 | 114 |
| 804 | 3300037312 | Ga0395899_0063911 | Ga0395899_0063911_429_806 | 114 |
| 805 | 3300037418 | Ga0395900_0016074 | Ga0395900_0016074_978_1355 | 114 |
| 806 | 3300037466 | Ga0395898_0022252 | Ga0395898_0022252_3965_4342 | 114 |
| 807 | 3300037471 | Ga0395905_0014625 | Ga0395905_0014625_714_1091 | 114 |
| 808 | 3300038443 | Ga0395901_0076026 | Ga0395901_0076026_2901_3278 | 114 |
| 809 | 3300041505 | Ga0451849_0766240 | Ga0451849_0766240_39_440 | 114 |
| 810 | 3300048912 | Ga0496109_0207436 | Ga0496109_0207436_799_1179 | 114 |
| 811 | 3300048913 | Ga0496110_0112143 | Ga0496110_0112143_528_908 | 114 |
| 812 | 3300048915 | Ga0496112_0151229 | Ga0496112_0151229_1732_2112 | 114 |
| 813 | 3300048915 | Ga0496112_1482616 | Ga0496112_1482616_121_498 | 114 |
| 814 | 3300049571 | Ga0501034_0799023 | Ga0501034_0799023_191_580 | 114 |
| 815 | 3300049578 | Ga0501042_0567859 | Ga0501042_0567859_310_687 | 114 |
| 816 | 3300049581 | Ga0501047_0016507 | Ga0501047_0016507_1642_2031 | 114 |
| 817 | 3300049586 | Ga0501070_0920343 | Ga0501070_0920343_128_532 | 114 |
| 818 | 3300049588 | Ga0501072_0955182 | Ga0501072_0955182_272_649 | 114 |
| 819 | 3300049823 | Ga0501044_0488760 | Ga0501044_0488760_449_838 | 114 |
| 820 | 3300050507 | nmdc:mga05p37_1688_c1 | nmdc:mga05p37_1688_c1_1754_2134 | 114 |
| 821 | 3300050508 | nmdc:mga09592_1659749_c1 | nmdc:mga09592_1659749_c1_110_499 | 114 |
| 822 | 3300050508 | nmdc:mga09592_16_c1 | nmdc:mga09592_16_c1_59609_59989 | 114 |
| 823 | 3300050509 | nmdc:mga0qj67_16_c1 | nmdc:mga0qj67_16_c1_37530_37910 | 114 |
| 824 | 3300050509 | nmdc:mga0qj67_284878_c1 | nmdc:mga0qj67_284878_c1_62_439 | 114 |
| 825 | 3300050510 | nmdc:mga06r32_282398_c1 | nmdc:mga06r32_282398_c1_227_640 | 114 |
| 826 | 3300050510 | nmdc:mga06r32_8377_c1 | nmdc:mga06r32_8377_c1_1754_2134 | 114 |
| 827 | 3300050511 | nmdc:mga08y16_49925_c1 | nmdc:mga08y16_49925_c1_2172_2561 | 114 |
| 828 | 3300054114 | Ga0501084_0567636 | Ga0501084_0567636_161_538 | 114 |
| 829 | 3300059477 | Ga0587084_050447 | Ga0587084_050447_96_482 | 114 |
| 830 | 3300059490 | Ga0587066_030403 | Ga0587066_030403_399_785 | 114 |
| 831 | 3300059491 | Ga0587070_081296 | Ga0587070_081296_310_693 | 114 |
| 832 | 3300059492 | Ga0587073_0021409 | Ga0587073_0021409_34_420 | 114 |
| 833 | 3300059492 | Ga0587073_0101606 | Ga0587073_0101606_239_625 | 114 |
| 834 | 3300059492 | Ga0587073_0144664 | Ga0587073_0144664_261_647 | 114 |
| 835 | 3300059493 | Ga0587077_020100 | Ga0587077_020100_54_440 | 114 |
| 836 | 3300059503 | Ga0587080_125620 | Ga0587080_125620_142_528 | 114 |
| 837 | 3300059503 | Ga0587080_146411 | Ga0587080_146411_113_499 | 114 |
| 838 | 3300059506 | Ga0587085_075902 | Ga0587085_075902_55_441 | 114 |
| 839 | 3300059508 | Ga0587088_180706 | Ga0587088_180706_127_513 | 114 |
| 840 | 3300059510 | Ga0587090_025468 | Ga0587090_025468_71_457 | 114 |
| 841 | 3300059511 | Ga0587091_042826 | Ga0587091_042826_224_610 | 114 |
| 842 | 3300059511 | Ga0587091_043199 | Ga0587091_043199_428_814 | 114 |
| 843 | 3300059511 | Ga0587091_067582 | Ga0587091_067582_117_503 | 114 |
| 844 | 3300059512 | Ga0587092_016692 | Ga0587092_016692_114_500 | 114 |
| 845 | 3300059513 | Ga0587094_074948 | Ga0587094_074948_65_451 | 114 |
| 846 | 3300059514 | Ga0587095_006376 | Ga0587095_006376_209_595 | 114 |
| 847 | 3300059604 | Ga0587098_011221 | Ga0587098_011221_589_975 | 114 |
| 848 | 3300059605 | Ga0587106_117151 | Ga0587106_117151_40_426 | 114 |
| 849 | 3300059622 | Ga0587099_031593 | Ga0587099_031593_11_397 | 114 |
| 850 | 3300059623 | Ga0587101_105222 | Ga0587101_105222_110_496 | 114 |
| 851 | 3300059624 | Ga0587109_030617 | Ga0587109_030617_41_427 | 114 |
| 852 | 3300059624 | Ga0587109_112954 | Ga0587109_112954_234_620 | 114 |
| 853 | 3300059626 | Ga0587115_067144 | Ga0587115_067144_19_405 | 114 |
| 854 | 3300059628 | Ga0587122_021766 | Ga0587122_021766_21_407 | 114 |
| 855 | 3300059630 | Ga0587128_034035 | Ga0587128_034035_390_773 | 114 |
| 856 | 3300059640 | Ga0587067_060627 | Ga0587067_060627_196_582 | 114 |
| 857 | 3300059641 | Ga0587068_014219 | Ga0587068_014219_644_1030 | 114 |
| 858 | 3300059641 | Ga0587068_070861 | Ga0587068_070861_60_446 | 114 |
| 859 | 3300059641 | Ga0587068_104250 | Ga0587068_104250_11_397 | 114 |
| 860 | 3300059642 | Ga0587069_034524 | Ga0587069_034524_211_597 | 114 |
| 861 | 3300059644 | Ga0587075_055076 | Ga0587075_055076_287_673 | 114 |
| 862 | 3300059645 | Ga0587076_085504 | Ga0587076_085504_142_525 | 114 |
| 863 | 3300059645 | Ga0587076_102468 | Ga0587076_102468_166_552 | 114 |
| 864 | 3300059645 | Ga0587076_207121 | Ga0587076_207121_106_492 | 114 |
| 865 | 3300059646 | Ga0587078_005950 | Ga0587078_005950_690_1076 | 114 |
| 866 | 3300059646 | Ga0587078_013535 | Ga0587078_013535_476_862 | 114 |
| 867 | 3300059647 | Ga0587079_028568 | Ga0587079_028568_438_824 | 114 |
| 868 | 3300059647 | Ga0587079_075914 | Ga0587079_075914_255_641 | 114 |
| 869 | 3300059649 | Ga0587102_032570 | Ga0587102_032570_189_575 | 114 |
| 870 | 3300059659 | Ga0587120_015232 | Ga0587120_015232_290_676 | 114 |
| 871 | 3300060344 | Ga0587071_070966 | Ga0587071_070966_343_729 | 114 |
| 872 | 3300060344 | Ga0587071_221704 | Ga0587071_221704_15_401 | 114 |
| 873 | 3300060346 | Ga0587111_0104753 | Ga0587111_0104753_274_660 | 114 |
| 874 | iso_pu_bacteria | 2831935698 | 2831940430 | 114 |
| 875 | iso_pu_bacteria | 2832004796 | 2832007796 | 114 |
| 876 | iso_pu_bacteria | 2855670206 | 2855672318 | 114 |
| 877 | iso_pu_bacteria | 2855676851 | 2855681302 | 114 |
| 878 | iso_pu_bacteria | 2855683550 | 2855684220 | 114 |
| 879 | iso_pu_bacteria | 2857288857 | 2857292678 | 114 |
| 880 | iso_pu_bacteria | 2858848962 | 2858849795 | 114 |
| 881 | iso_pu_bacteria | 2858868258 | 2858873354 | 114 |
| 882 | iso_pu_bacteria | 2858888857 | 2858890666 | 114 |
| 883 | iso_pu_bacteria | 2866065130 | 2866066973 | 114 |
| 884 | iso_pu_bacteria | 2867302475 | 2867303914 | 114 |
| 885 | iso_pu_bacteria | 2869048445 | 2869054796 | 114 |
| 886 | iso_pu_bacteria | 2869061728 | 2869064082 | 114 |
| 887 | iso_pu_bacteria | 2869068681 | 2869072897 | 114 |
| 888 | iso_pu_bacteria | 2880495981 | 2880498667 | 114 |
| 889 | iso_pu_bacteria | 8054727385 | 8054730899 | 114 |
| 890 | 3300003203 | JGI25406J46586_10012362 | JGI25406J46586_100123623 | 115 |
| 891 | 3300005985 | Ga0081539_10000320 | Ga0081539_100003208 | 115 |
| 892 | 3300006880 | Ga0075429_100004467 | Ga0075429_1000044674 | 115 |
| 893 | 3300009147 | Ga0114129_10143303 | Ga0114129_101433033 | 115 |
| 894 | 3300020080 | Ga0206350_11582926 | Ga0206350_115829261 | 115 |
| 895 | 3300025906 | Ga0207699_10660478 | Ga0207699_106604782 | 115 |
| 896 | 3300031456 | Ga0307513_10038166 | Ga0307513_100381663 | 115 |
| 897 | 3300041459 | Ga0451800_0243129 | Ga0451800_0243129_66_473 | 115 |
| 898 | 3300049592 | Ga0501076_0430563 | Ga0501076_0430563_356_739 | 115 |
| 899 | 3300050507 | nmdc:mga05p37_25686_c1 | nmdc:mga05p37_25686_c1_4892_5293 | 115 |
| 900 | 3300050508 | nmdc:mga09592_177379_c1 | nmdc:mga09592_177379_c1_192_593 | 115 |
| 901 | 3300050510 | nmdc:mga06r32_659315_c1 | nmdc:mga06r32_659315_c1_255_656 | 115 |
| 902 | 3300059652 | Ga0587107_108992 | Ga0587107_108992_143_526 | 115 |
| 903 | iso_pu_bacteria | 2501939600 | 2501942706 | 115 |
| 904 | iso_pu_bacteria | 2515154129 | 2515720701 | 115 |
| 905 | iso_pu_bacteria | 2867312974 | 2867313246 | 115 |
| 906 | iso_pu_bacteria | 8003870546 | 8003877872 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wsu-assembly1.cif.gz_C | c-terminal domain of elongation factor selb complexed with secis rna | 0.8936 | 40 | 81 |
| 3gw2-assembly1.cif.gz_A-2 | crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e. | 0.8703 | 43 | 92 |
| 8p2k-assembly1.cif.gz_Ay | ternary complex of translating ribosome, nac and metap1 | 0.8692 | 58 | 92 |
| 8t4s-assembly1.cif.gz_Z | mers-cov nsp1 protein bound to the human 40s ribosomal subunit | 0.8685 | 58 | 92 |
| 6ybs-assembly1.cif.gz_e | structure of a human 48s translational initiation complex - head | 0.866 | 58 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30852_292_361_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9878 | 54 | 88 | 1.10.10.10 |
| af_Q5NE14_88_145_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9214 | 39 | 89 | 1.10.10.10 |
| af_Q57693_7_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9169 | 54 | 90 | 1.10.10.10 |
| af_A0A0R4ITX8_1_93_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9059 | 47 | 91 | 1.10.10.10 |
| af_Q4CSX0_1_108_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8959 | 40 | 86 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U3B8G2-F1-model_v4 | deleted | 0.8844 | 43 | 92 |
|
| AF-A0A662H0B2-F1-model_v4 | Uncharacterized protein | 0.8781 | 40 | 92 |
|
| AF-A0A1Y6FX96-F1-model_v4 | Regulatory protein, arsR family | 0.8693 | 43 | 92 |
GO:0003677
GO:0003700 |
| AF-A0A0P8A5Y4-F1-model_v4 | Transcriptional regulator, ArsR family | 0.864 | 43 | 89 |
GO:0003700
|
| AF-A0A662QGB9-F1-model_v4 | deleted | 0.8557 | 43 | 91 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar