F485334

General Info

Members Datasets Scaffolds Average Seq Length
906 416 814 124

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100940233|Ga0307415_1009402331
Length 149
Sequence LIGRDESLTAVRPMRAGVEEVNGDMAERDEPTGALVRPYAVTRGRTRPKLEIAIEALIETTVRGRTAGSRPGGGHGQEQQYIATLCDGRLQSLAEIAARLHLPLGVARVLIADMAADGLVAIYEPTSLDDNEAVGTELLERVLSGLRRL

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
12 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
13 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
14 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
15 2855683550 Micromonospora sp. RP3T Isolate Unclassified
16 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
17 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
18 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
19 2858868258 Micromonospora sp. MH33 Isolate Unclassified
20 2858882152 Micromonospora noduli MED15 Isolate Nodule
21 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
22 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
23 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
24 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
25 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
26 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
27 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
28 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
29 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
30 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
31 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
32 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
33 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
34 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
35 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
36 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
37 2902582711 Micromonospora sp. AP08 Isolate Unclassified
38 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
39 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
40 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
47 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
48 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
49 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
52 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
55 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
145 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
146 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
168 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
235 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
238 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
239 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
261 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
264 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
265 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
266 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
267 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
268 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
269 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
270 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
283 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
284 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
285 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
286 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
287 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
288 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
289 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
290 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
291 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
292 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
293 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
294 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
295 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
296 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
297 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
298 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
301 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
305 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
306 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
353 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
354 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
355 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
356 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
357 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
358 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
359 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
360 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
361 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
362 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
363 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
364 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
365 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
366 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
367 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
368 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 649633069 Micromonospora sp. L5 Isolate Unclassified
408 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
409 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
410 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
411 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
412 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
413 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
414 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
415 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
416 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.16
Metatranscriptomes 13.69
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 1.32
Rhizoplane 3.64
Rhizosphere 80.79
Stem 0
Stem Tuber 0
Unclassified 11.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10012362 3300003203 Bacteria 3708
2 JGI25406J46586_10039243 3300003203 Bacteria 1689
3 JGI25406J46586_10043635 3300003203 Bacteria 1559
4 JGI25406J46586_10113656 3300003203 Bacteria 800
5 JGI25406J46586_10128039 3300003203 Bacteria 745
6 Ga0006770J48903_1026830 3300003305 Bacteria 674
7 rootH1_10044904 3300003316 Bacteria 2174
8 rootH2_10116321 3300003320 Bacteria 1028
9 rootH2_10187251 3300003320 Bacteria 1097
10 rootL2_10032490 3300003322 Bacteria 4318
11 Ga0007410J51695_1024025 3300003574 Bacteria 730
12 Ga0007410J51695_1063768 3300003574 Bacteria 803
13 Ga0007409J51694_1018812 3300003575 Bacteria 1399
14 Ga0007409J51694_1041147 3300003575 Bacteria 996
15 Ga0007429J51699_1034608 3300003579 Bacteria 816
16 JGI25404J52841_10051272 3300003659 Bacteria 867
17 Ga0032354_1071614 3300003693 Bacteria 861
18 Ga0058859_11596728 3300004798 Bacteria 564
19 Ga0058859_11644820 3300004798 Bacteria 589
20 Ga0058863_10043464 3300004799 Bacteria 1988
21 Ga0058861_11653156 3300004800 Bacteria 517
22 Ga0058861_12059710 3300004800 Bacteria 1245
23 Ga0058861_12062396 3300004800 Bacteria 1825
24 Ga0058861_12065553 3300004800 Bacteria 1083
25 Ga0058860_11858986 3300004801 Bacteria 740
26 Ga0058860_12019907 3300004801 Bacteria 1157
27 Ga0058860_12177233 3300004801 Bacteria 585
28 Ga0058860_12192533 3300004801 Bacteria 756
29 Ga0058862_10032891 3300004803 Bacteria 1201
30 Ga0058862_12802035 3300004803 Bacteria 1218
31 Ga0058862_12846367 3300004803 Bacteria 1536
32 Ga0070658_10057542 3300005327 Bacteria 3162
33 Ga0070658_10264029 3300005327 Bacteria 1463
34 Ga0070658_10359098 3300005327 Bacteria 1247
35 Ga0070658_10390122 3300005327 Bacteria 1195
36 Ga0070658_10818781 3300005327 Bacteria 809
37 Ga0070676_10247585 3300005328 Bacteria 1188
38 Ga0070683_100001644 3300005329 Bacteria 17313
39 Ga0070683_100003973 3300005329 Bacteria 12112
40 Ga0070683_100042177 3300005329 Bacteria 4201
41 Ga0070683_100049068 3300005329 Bacteria 3903
42 Ga0070683_100119646 3300005329 Bacteria 2487
43 Ga0070683_100289651 3300005329 Bacteria 1557
44 Ga0070670_100611799 3300005331 Bacteria 975
45 Ga0070670_100866441 3300005331 Bacteria 818
46 Ga0070677_10289611 3300005333 Bacteria 828
47 Ga0070677_10760558 3300005333 Bacteria 550
48 Ga0068869_100117816 3300005334 Bacteria 2028
49 Ga0068869_100178734 3300005334 Bacteria 1663
50 Ga0068869_100228360 3300005334 Bacteria 1478
51 Ga0068869_100354269 3300005334 Bacteria 1197
52 Ga0070680_100070645 3300005336 Bacteria 2868
53 Ga0070680_100294094 3300005336 Bacteria 1376
54 Ga0070682_100087308 3300005337 Bacteria 2033
55 Ga0070682_100865929 3300005337 Bacteria 739
56 Ga0068868_100010441 3300005338 Bacteria 6724
57 Ga0068868_100577292 3300005338 Bacteria 994
58 Ga0070660_100061410 3300005339 Bacteria 2918
59 Ga0070660_100404803 3300005339 Bacteria 1129
60 Ga0070660_100573757 3300005339 Bacteria 942
61 Ga0070660_100706809 3300005339 Bacteria 845
62 Ga0070689_101351714 3300005340 Bacteria 643
63 Ga0070687_100200866 3300005343 Bacteria 1208
64 Ga0070687_100361330 3300005343 Bacteria 940
65 Ga0070687_100534801 3300005343 Bacteria 795
66 Ga0070661_100030405 3300005344 Bacteria 3901
67 Ga0070661_100229387 3300005344 Bacteria 1427
68 Ga0070661_100280911 3300005344 Bacteria 1291
69 Ga0070661_100541372 3300005344 Bacteria 936
70 Ga0070692_10002983 3300005345 Bacteria 6735
71 Ga0070692_10358057 3300005345 Bacteria 909
72 Ga0070668_100000126 3300005347 Bacteria 47281
73 Ga0070668_100022741 3300005347 Bacteria 4740
74 Ga0070668_100159106 3300005347 Bacteria 1831
75 Ga0070668_101642979 3300005347 Bacteria 589
76 Ga0070668_102190034 3300005347 Bacteria 511
77 Ga0070669_100378824 3300005353 Bacteria 1154
78 Ga0070675_100000194 3300005354 Bacteria 38282
79 Ga0070675_100251209 3300005354 Bacteria 1548
80 Ga0070675_100614969 3300005354 Bacteria 986
81 Ga0070671_100320938 3300005355 Bacteria 1320
82 Ga0070671_100589219 3300005355 Bacteria 960
83 Ga0070674_100348052 3300005356 Bacteria 1196
84 Ga0070674_101075450 3300005356 Bacteria 709
85 Ga0070674_101921241 3300005356 Bacteria 538
86 Ga0070673_101161221 3300005364 Bacteria 723
87 Ga0070659_100009047 3300005366 Bacteria 7309
88 Ga0070659_100048390 3300005366 Bacteria 3340
89 Ga0070659_100391499 3300005366 Bacteria 1172
90 Ga0070659_100749949 3300005366 Bacteria 847
91 Ga0070667_100129491 3300005367 Bacteria 2201
92 Ga0070667_100389770 3300005367 Bacteria 1266
93 Ga0070714_100146372 3300005435 Bacteria 2125
94 Ga0070714_100911484 3300005435 Bacteria 854
95 Ga0070713_100266695 3300005436 Bacteria 1567
96 Ga0070713_100660855 3300005436 Bacteria 996
97 Ga0070710_10962731 3300005437 Bacteria 620
98 Ga0070701_11400369 3300005438 Bacteria 503
99 Ga0070700_100034264 3300005441 Bacteria 3065
100 Ga0070700_100205353 3300005441 Bacteria 1387
101 Ga0070663_100015500 3300005455 Bacteria 4923
102 Ga0070663_100818533 3300005455 Bacteria 800
103 Ga0070663_101263779 3300005455 Bacteria 650
104 Ga0070678_100450820 3300005456 Bacteria 1127
105 Ga0070678_100657221 3300005456 Bacteria 941
106 Ga0070678_101816675 3300005456 Bacteria 575
107 Ga0070662_101005278 3300005457 Bacteria 714
108 Ga0070681_10084464 3300005458 Bacteria 3127
109 Ga0070681_10381844 3300005458 Bacteria 1319
110 Ga0070681_10744943 3300005458 Bacteria 896
111 Ga0070681_11389505 3300005458 Bacteria 626
112 Ga0068867_100351501 3300005459 Bacteria 1230
113 Ga0070685_10160370 3300005466 Bacteria 1433
114 Ga0070685_10425769 3300005466 Bacteria 925
115 Ga0070707_101038696 3300005468 Bacteria 785
116 Ga0070679_100027945 3300005530 Bacteria 5558
117 Ga0070679_100231361 3300005530 Bacteria 1808
118 Ga0070679_100280689 3300005530 Bacteria 1618
119 Ga0070679_100701460 3300005530 Bacteria 955
120 Ga0070684_100028161 3300005535 Bacteria 4750
121 Ga0070684_100160975 3300005535 Bacteria 2036
122 Ga0070684_100188002 3300005535 Bacteria 1879
123 Ga0070684_100297880 3300005535 Bacteria 1479
124 Ga0070684_100436533 3300005535 Bacteria 1209
125 Ga0070684_102332171 3300005535 Bacteria 504
126 Ga0068853_100703932 3300005539 Bacteria 964
127 Ga0070672_100285363 3300005543 Bacteria 1397
128 Ga0070672_100971668 3300005543 Bacteria 752
129 Ga0070686_101007179 3300005544 Bacteria 683
130 Ga0070693_100259783 3300005547 Bacteria 1155
131 Ga0070665_100067482 3300005548 Bacteria 3586
132 Ga0070665_102562061 3300005548 Bacteria 511
133 Ga0068855_100088846 3300005563 Bacteria 3569
134 Ga0070664_100017966 3300005564 Bacteria 5806
135 Ga0070664_100088470 3300005564 Bacteria 2678
136 Ga0070664_100195172 3300005564 Bacteria 1805
137 Ga0070664_100373939 3300005564 Bacteria 1300
138 Ga0070664_100536600 3300005564 Bacteria 1081
139 Ga0068857_100016006 3300005577 Bacteria 6569
140 Ga0068857_100119203 3300005577 Bacteria 2375
141 Ga0068857_100306850 3300005577 Bacteria 1464
142 Ga0068857_100514229 3300005577 Bacteria 1125
143 Ga0068857_100552620 3300005577 Bacteria 1085
144 Ga0068857_101208539 3300005577 Bacteria 732
145 Ga0068857_102425929 3300005577 Bacteria 515
146 Ga0068854_100026591 3300005578 Bacteria 3979
147 Ga0068854_100619828 3300005578 Bacteria 926
148 Ga0068854_100964990 3300005578 Bacteria 753
149 Ga0068856_100490313 3300005614 Bacteria 1250
150 Ga0068856_100582038 3300005614 Bacteria 1141
151 Ga0068856_101569564 3300005614 Bacteria 671
152 Ga0070702_100662863 3300005615 Bacteria 791
153 Ga0068852_100442175 3300005616 Bacteria 1286
154 Ga0068852_100465942 3300005616 Bacteria 1253
155 Ga0068852_101259875 3300005616 Bacteria 761
156 Ga0068859_100014477 3300005617 Bacteria 7919
157 Ga0068859_102983866 3300005617 Unclassified 517
158 Ga0068864_100042591 3300005618 Bacteria 3885
159 Ga0068864_100362633 3300005618 Bacteria 1370
160 Ga0068864_100502654 3300005618 Bacteria 1166
161 Ga0068864_100656277 3300005618 Bacteria 1022
162 Ga0068864_100661645 3300005618 Bacteria 1018
163 Ga0068864_101253775 3300005618 Bacteria 741
164 Ga0068866_10295739 3300005718 Bacteria 1009
165 Ga0068866_10404499 3300005718 Bacteria 881
166 Ga0068861_100267902 3300005719 Bacteria 1465
167 Ga0068851_10092566 3300005834 Bacteria 1593
168 Ga0068851_10501590 3300005834 Bacteria 728
169 Ga0068870_10044752 3300005840 Bacteria 2314
170 Ga0068870_10661307 3300005840 Bacteria 717
171 Ga0068863_100000632 3300005841 Bacteria 35693
172 Ga0068863_100132089 3300005841 Bacteria 2384
173 Ga0068863_100143887 3300005841 Bacteria 2280
174 Ga0068863_100859999 3300005841 Bacteria 906
175 Ga0068858_100109760 3300005842 Bacteria 2576
176 Ga0068860_100593481 3300005843 Bacteria 1112
177 Ga0068862_100107057 3300005844 Bacteria 2452
178 Ga0068862_100258938 3300005844 Bacteria 1588
179 Ga0081455_10228212 3300005937 Bacteria 1376
180 Ga0081455_10240129 3300005937 Bacteria 1332
181 Ga0081455_10246158 3300005937 Bacteria 1311
182 Ga0081540_1004328 3300005983 Bacteria 10873
183 Ga0081540_1017361 3300005983 Bacteria 4459
184 Ga0081540_1025318 3300005983 Bacteria 3417
185 Ga0081540_1079648 3300005983 Bacteria 1480
186 Ga0081540_1098328 3300005983 Bacteria 1267
187 Ga0081540_1109584 3300005983 Bacteria 1170
188 Ga0081539_10000109 3300005985 Bacteria 193696
189 Ga0081539_10000320 3300005985 Bacteria 106935
190 Ga0081539_10000733 3300005985 Bacteria 65742
191 Ga0081539_10000837 3300005985 Bacteria 59104
192 Ga0081539_10007335 3300005985 Bacteria 10114
193 Ga0081539_10009471 3300005985 Bacteria 8130
194 Ga0081539_10037514 3300005985 Bacteria 2886
195 Ga0081539_10133643 3300005985 Bacteria 1215
196 Ga0081539_10393405 3300005985 Bacteria 577
197 Ga0070717_10155328 3300006028 Bacteria 1982
198 Ga0075368_10179885 3300006042 Bacteria 891
199 Ga0075363_101008540 3300006048 Unclassified 513
200 Ga0075364_10930321 3300006051 Bacteria 592
201 Ga0075432_10375371 3300006058 Bacteria 608
202 Ga0070716_100273420 3300006173 Bacteria 1162
203 Ga0070716_100505932 3300006173 Bacteria 892
204 Ga0070712_101089074 3300006175 Bacteria 693
205 Ga0070712_101396244 3300006175 Bacteria 611
206 Ga0097621_100500147 3300006237 Bacteria 1101
207 Ga0068871_100910378 3300006358 Bacteria 815
208 Ga0075428_100014457 3300006844 Bacteria 8766
209 Ga0075428_100086491 3300006844 Bacteria 3419
210 Ga0075428_100090825 3300006844 Bacteria 3332
211 Ga0075428_100103739 3300006844 Bacteria 3101
212 Ga0075428_100503717 3300006844 Bacteria 1295
213 Ga0075428_101124767 3300006844 Bacteria 829
214 Ga0075430_100010210 3300006846 Bacteria 7952
215 Ga0075430_100023905 3300006846 Bacteria 5203
216 Ga0075430_100165479 3300006846 Bacteria 1840
217 Ga0075430_100243280 3300006846 Bacteria 1491
218 Ga0075430_100247684 3300006846 Bacteria 1477
219 Ga0075430_100321619 3300006846 Bacteria 1279
220 Ga0075430_100573517 3300006846 Bacteria 931
221 Ga0075431_100002426 3300006847 Bacteria 17944
222 Ga0075431_100034622 3300006847 Bacteria 5203
223 Ga0075431_100045971 3300006847 Bacteria 4501
224 Ga0075431_100182905 3300006847 Bacteria 2151
225 Ga0075431_100339915 3300006847 Bacteria 1511
226 Ga0075431_100668531 3300006847 Bacteria 1018
227 Ga0075431_100965606 3300006847 Bacteria 820
228 Ga0075431_101009764 3300006847 Bacteria 799
229 Ga0075433_10501645 3300006852 Bacteria 1068
230 Ga0075433_10723782 3300006852 Bacteria 871
231 Ga0075434_100824137 3300006871 Bacteria 944
232 Ga0075429_100004467 3300006880 Bacteria 12035
233 Ga0075429_100007135 3300006880 Bacteria 9705
234 Ga0075429_100010682 3300006880 Bacteria 7944
235 Ga0075429_100014430 3300006880 Bacteria 6846
236 Ga0075429_100052579 3300006880 Bacteria 3544
237 Ga0075429_100115105 3300006880 Bacteria 2351
238 Ga0075429_100755267 3300006880 Bacteria 852
239 Ga0068865_100547816 3300006881 Bacteria 971
240 Ga0097620_100014477 3300006931 Bacteria 7919
241 Ga0097620_102983700 3300006931 Unclassified 517
242 Ga0111539_10000420 3300009094 Bacteria 53146
243 Ga0111539_10805438 3300009094 Bacteria 1093
244 Ga0111539_11374582 3300009094 Bacteria 819
245 Ga0105245_10001054 3300009098 Bacteria 24973
246 Ga0105245_10406434 3300009098 Bacteria 1362
247 Ga0105245_10743998 3300009098 Bacteria 1016
248 Ga0105247_10647567 3300009101 Bacteria 789
249 Ga0105247_11199179 3300009101 Bacteria 604
250 Ga0114129_10000001 3300009147 Bacteria 292978
251 Ga0114129_10000007 3300009147 Bacteria 156645
252 Ga0114129_10000011 3300009147 Bacteria 139000
253 Ga0114129_10005056 3300009147 Bacteria 18560
254 Ga0114129_10010562 3300009147 Bacteria 13168
255 Ga0114129_10011584 3300009147 Bacteria 12556
256 Ga0114129_10143303 3300009147 Bacteria 3274
257 Ga0114129_12004404 3300009147 Bacteria 700
258 Ga0105243_10132383 3300009148 Bacteria 2117
259 Ga0105243_10209725 3300009148 Bacteria 1715
260 Ga0105243_10398273 3300009148 Bacteria 1278
261 Ga0105241_10281781 3300009174 Bacteria 1420
262 Ga0105241_10950814 3300009174 Bacteria 801
263 Ga0105241_10963185 3300009174 Bacteria 796
264 Ga0105248_10059038 3300009177 Bacteria 4308
265 Ga0105248_10182532 3300009177 Bacteria 2364
266 Ga0105248_10544617 3300009177 Bacteria 1309
267 Ga0105248_11628617 3300009177 Bacteria 731
268 Ga0105237_10349594 3300009545 Bacteria 1483
269 Ga0105237_10363384 3300009545 Bacteria 1452
270 Ga0105237_10910313 3300009545 Bacteria 886
271 Ga0105237_10951776 3300009545 Bacteria 866
272 Ga0105238_10469442 3300009551 Bacteria 1257
273 Ga0105238_10590867 3300009551 Bacteria 1117
274 Ga0105238_10695772 3300009551 Bacteria 1028
275 Ga0105249_10064284 3300009553 Bacteria 3373
276 Ga0105249_10362331 3300009553 Bacteria 1471
277 Ga0105249_10408678 3300009553 Bacteria 1389
278 Ga0130087_1016194 3300009828 Bacteria 634
279 Ga0130086_1083337 3300009829 Bacteria 634
280 Ga0130084_1114510 3300009835 Bacteria 634
281 Ga0105239_10126206 3300010375 Bacteria 2844
282 Ga0105246_12046664 3300011119 Bacteria 553
283 Ga0154014_111627 3300013052 Bacteria 619
284 Ga0157371_10693643 3300013102 Bacteria 762
285 Ga0157371_11130049 3300013102 Bacteria 602
286 Ga0157370_10105609 3300013104 Bacteria 2636
287 Ga0157370_11541017 3300013104 Bacteria 597
288 Ga0157369_10019823 3300013105 Bacteria 7525
289 Ga0157369_10315884 3300013105 Bacteria 1624
290 Ga0157369_11411422 3300013105 Bacteria 709
291 Ga0157374_10482842 3300013296 Bacteria 1242
292 Ga0157374_10799193 3300013296 Bacteria 959
293 Ga0157378_10186509 3300013297 Bacteria 1954
294 Ga0157378_12247256 3300013297 Bacteria 597
295 Ga0163162_10222729 3300013306 Bacteria 2016
296 Ga0163162_10413803 3300013306 Bacteria 1480
297 Ga0157372_10180794 3300013307 Bacteria 2441
298 Ga0157372_10423042 3300013307 Bacteria 1552
299 Ga0157372_10699909 3300013307 Bacteria 1179
300 Ga0157375_10409705 3300013308 Bacteria 1522
301 Ga0157375_10500694 3300013308 Bacteria 1379
302 Ga0157375_13204886 3300013308 Bacteria 546
303 Ga0163163_10146872 3300014325 Bacteria 2402
304 Ga0163163_10167476 3300014325 Bacteria 2244
305 Ga0163163_10189475 3300014325 Bacteria 2105
306 Ga0163163_10790094 3300014325 Bacteria 1012
307 Ga0163163_11135515 3300014325 Bacteria 844
308 Ga0157380_10582896 3300014326 Bacteria 1103
309 Ga0182008_10165419 3300014497 Bacteria 1115
310 Ga0182008_10297557 3300014497 Bacteria 844
311 Ga0182008_10373499 3300014497 Bacteria 761
312 Ga0157377_10004597 3300014745 Bacteria 6378
313 Ga0157377_10500484 3300014745 Bacteria 849
314 Ga0157377_10713388 3300014745 Bacteria 730
315 Ga0157376_10178350 3300014969 Bacteria 1940
316 Ga0163161_10495591 3300017792 Bacteria 994
317 Ga0197907_10060655 3300020069 Bacteria 1813
318 Ga0197907_10379184 3300020069 Bacteria 982
319 Ga0197907_10658708 3300020069 Bacteria 1702
320 Ga0197907_10891682 3300020069 Bacteria 1918
321 Ga0206356_10184226 3300020070 Bacteria 591
322 Ga0206356_10193519 3300020070 Bacteria 6950
323 Ga0206356_10445206 3300020070 Bacteria 1443
324 Ga0206356_10842913 3300020070 Bacteria 1258
325 Ga0206356_11028553 3300020070 Bacteria 1688
326 Ga0206356_11645676 3300020070 Bacteria 1121
327 Ga0206349_1106262 3300020075 Bacteria 2340
328 Ga0206349_1890871 3300020075 Bacteria 1914
329 Ga0206355_1173917 3300020076 Bacteria 1009
330 Ga0206351_10395379 3300020077 Bacteria 894
331 Ga0206351_10442925 3300020077 Bacteria 1410
332 Ga0206352_10306061 3300020078 Bacteria 1307
333 Ga0206352_10317914 3300020078 Bacteria 2302
334 Ga0206352_10523430 3300020078 Bacteria 1520
335 Ga0206352_10681363 3300020078 Bacteria 1937
336 Ga0206352_11031132 3300020078 Bacteria 1603
337 Ga0206350_10138868 3300020080 Bacteria 2325
338 Ga0206350_10428956 3300020080 Bacteria 1691
339 Ga0206350_11582926 3300020080 Bacteria 831
340 Ga0206354_10309334 3300020081 Bacteria 591
341 Ga0206354_10790976 3300020081 Bacteria 2558
342 Ga0206354_11025538 3300020081 Bacteria 4111
343 Ga0206354_11540779 3300020081 Bacteria 1920
344 Ga0206353_10000897 3300020082 Bacteria 616
345 Ga0206353_10005794 3300020082 Bacteria 4115
346 Ga0206353_11941442 3300020082 Bacteria 3727
347 Ga0224712_10006660 3300022467 Bacteria 3312
348 Ga0224712_10009696 3300022467 Bacteria 2914
349 Ga0224712_10029395 3300022467 Bacteria 1973
350 Ga0224712_10083285 3300022467 Bacteria 1325
351 Ga0224712_10213763 3300022467 Bacteria 880
352 Ga0207656_10038352 3300025321 Bacteria 2021
353 Ga0207682_10135378 3300025893 Bacteria 1102
354 Ga0207642_10975051 3300025899 Bacteria 545
355 Ga0207710_10054824 3300025900 Bacteria 1796
356 Ga0207688_10406618 3300025901 Bacteria 845
357 Ga0207688_10641425 3300025901 Bacteria 670
358 Ga0207699_10263491 3300025906 Bacteria 1192
359 Ga0207699_10660478 3300025906 Bacteria 764
360 Ga0207643_10529355 3300025908 Bacteria 755
361 Ga0207705_10007873 3300025909 Bacteria 7823
362 Ga0207705_10096461 3300025909 Bacteria 2171
363 Ga0207705_10201781 3300025909 Bacteria 1507
364 Ga0207705_10819910 3300025909 Bacteria 722
365 Ga0207705_10863602 3300025909 Bacteria 701
366 Ga0207684_10324576 3300025910 Bacteria 1327
367 Ga0207654_10245715 3300025911 Bacteria 1197
368 Ga0207707_10211280 3300025912 Bacteria 1690
369 Ga0207707_10282952 3300025912 Bacteria 1436
370 Ga0207707_10575654 3300025912 Bacteria 955
371 Ga0207671_10208093 3300025914 Bacteria 1529
372 Ga0207671_11444621 3300025914 Bacteria 532
373 Ga0207693_10836526 3300025915 Bacteria 708
374 Ga0207660_10270825 3300025917 Bacteria 1345
375 Ga0207660_10377267 3300025917 Bacteria 1139
376 Ga0207660_10405620 3300025917 Bacteria 1098
377 Ga0207662_10156312 3300025918 Bacteria 1454
378 Ga0207662_10342361 3300025918 Bacteria 1002
379 Ga0207662_10679978 3300025918 Bacteria 720
380 Ga0207657_10043531 3300025919 Bacteria 3954
381 Ga0207657_10230689 3300025919 Bacteria 1480
382 Ga0207657_10373933 3300025919 Bacteria 1123
383 Ga0207657_10494880 3300025919 Bacteria 958
384 Ga0207649_10019283 3300025920 Bacteria 3896
385 Ga0207649_10090026 3300025920 Bacteria 2007
386 Ga0207652_10066451 3300025921 Bacteria 3125
387 Ga0207652_10215544 3300025921 Bacteria 1729
388 Ga0207652_10367554 3300025921 Bacteria 1298
389 Ga0207681_10109141 3300025923 Bacteria 2010
390 Ga0207694_10265261 3300025924 Bacteria 1408
391 Ga0207694_10489807 3300025924 Bacteria 1029
392 Ga0207694_10958766 3300025924 Bacteria 724
393 Ga0207650_10414713 3300025925 Bacteria 1116
394 Ga0207650_10556329 3300025925 Bacteria 962
395 Ga0207659_10071819 3300025926 Bacteria 2528
396 Ga0207659_10151986 3300025926 Bacteria 1809
397 Ga0207659_11479883 3300025926 Bacteria 581
398 Ga0207687_10005904 3300025927 Bacteria 8101
399 Ga0207687_10049584 3300025927 Bacteria 2920
400 Ga0207687_10498322 3300025927 Bacteria 1016
401 Ga0207700_10024274 3300025928 Bacteria 4194
402 Ga0207700_10238980 3300025928 Bacteria 1547
403 Ga0207700_11008099 3300025928 Bacteria 745
404 Ga0207664_10082843 3300025929 Bacteria 2613
405 Ga0207664_10121965 3300025929 Bacteria 2183
406 Ga0207690_10041486 3300025932 Bacteria 3016
407 Ga0207690_10246257 3300025932 Bacteria 1379
408 Ga0207706_10103463 3300025933 Bacteria 2505
409 Ga0207709_10140868 3300025935 Bacteria 1657
410 Ga0207709_11869913 3300025935 Bacteria 500
411 Ga0207669_10825359 3300025937 Bacteria 770
412 Ga0207665_10119443 3300025939 Bacteria 1861
413 Ga0207665_10518277 3300025939 Bacteria 923
414 Ga0207665_10651685 3300025939 Bacteria 825
415 Ga0207691_10139279 3300025940 Bacteria 2139
416 Ga0207691_10480228 3300025940 Bacteria 1056
417 Ga0207711_10079484 3300025941 Bacteria 2863
418 Ga0207711_10958595 3300025941 Bacteria 794
419 Ga0207689_10007698 3300025942 Bacteria 9429
420 Ga0207689_10107564 3300025942 Bacteria 2292
421 Ga0207689_10177263 3300025942 Bacteria 1758
422 Ga0207689_10282866 3300025942 Bacteria 1373
423 Ga0207661_10001034 3300025944 Bacteria 18464
424 Ga0207661_10002942 3300025944 Bacteria 11785
425 Ga0207661_10011053 3300025944 Bacteria 6525
426 Ga0207661_10066024 3300025944 Bacteria 2938
427 Ga0207661_10138752 3300025944 Bacteria 2090
428 Ga0207661_10440763 3300025944 Bacteria 1185
429 Ga0207661_10487345 3300025944 Bacteria 1126
430 Ga0207661_10664547 3300025944 Bacteria 958
431 Ga0207679_10027761 3300025945 Bacteria 3919
432 Ga0207679_10222785 3300025945 Bacteria 1588
433 Ga0207679_10321274 3300025945 Bacteria 1340
434 Ga0207679_10491558 3300025945 Bacteria 1094
435 Ga0207667_10158906 3300025949 Bacteria 2325
436 Ga0207667_10209048 3300025949 Bacteria 2000
437 Ga0207712_10062584 3300025961 Bacteria 2646
438 Ga0207712_10647591 3300025961 Bacteria 918
439 Ga0207668_10002695 3300025972 Bacteria 10388
440 Ga0207668_10133071 3300025972 Bacteria 1901
441 Ga0207668_11086926 3300025972 Bacteria 717
442 Ga0207640_10976507 3300025981 Bacteria 744
443 Ga0207658_10173886 3300025986 Bacteria 1777
444 Ga0207658_10361002 3300025986 Bacteria 1267
445 Ga0207677_10012422 3300026023 Bacteria 4895
446 Ga0207703_10332913 3300026035 Bacteria 1393
447 Ga0207639_10504187 3300026041 Bacteria 1106
448 Ga0207678_10031471 3300026067 Bacteria 4628
449 Ga0207678_10502440 3300026067 Bacteria 1057
450 Ga0207678_10939728 3300026067 Bacteria 765
451 Ga0207678_11674474 3300026067 Bacteria 559
452 Ga0207708_10028322 3300026075 Bacteria 4243
453 Ga0207708_10197130 3300026075 Bacteria 1605
454 Ga0207702_10293338 3300026078 Bacteria 1541
455 Ga0207702_10316852 3300026078 Bacteria 1484
456 Ga0207702_10692305 3300026078 Bacteria 1004
457 Ga0207641_10007184 3300026088 Bacteria 9286
458 Ga0207641_10177265 3300026088 Bacteria 1950
459 Ga0207641_11287326 3300026088 Bacteria 731
460 Ga0207641_12225018 3300026088 Bacteria 548
461 Ga0207648_10328976 3300026089 Bacteria 1374
462 Ga0207648_11010857 3300026089 Bacteria 779
463 Ga0207676_10130236 3300026095 Bacteria 2138
464 Ga0207676_10144071 3300026095 Bacteria 2044
465 Ga0207676_10192216 3300026095 Bacteria 1797
466 Ga0207676_10433084 3300026095 Bacteria 1236
467 Ga0207676_10530023 3300026095 Bacteria 1122
468 Ga0207676_11940952 3300026095 Bacteria 587
469 Ga0207674_10004069 3300026116 Bacteria 17718
470 Ga0207674_10082509 3300026116 Bacteria 3216
471 Ga0207674_10084146 3300026116 Bacteria 3180
472 Ga0207674_10313186 3300026116 Bacteria 1519
473 Ga0207674_10684865 3300026116 Bacteria 990
474 Ga0207674_11172099 3300026116 Bacteria 738
475 Ga0207674_12187768 3300026116 Bacteria 516
476 Ga0207675_100510410 3300026118 Bacteria 1198
477 Ga0207675_101268673 3300026118 Bacteria 757
478 Ga0207683_10074623 3300026121 Bacteria 3001
479 Ga0207683_10382122 3300026121 Bacteria 1294
480 Ga0207698_10455517 3300026142 Bacteria 1236
481 Ga0207698_10933798 3300026142 Bacteria 876
482 Ga0209813_10294289 3300027866 Bacteria 629
483 Ga0207428_10035191 3300027907 Bacteria 4096
484 Ga0268266_10238228 3300028379 Bacteria 1678
485 Ga0268266_10414557 3300028379 Bacteria 1276
486 Ga0268266_12002855 3300028379 Bacteria 552
487 Ga0268265_10094774 3300028380 Bacteria 2395
488 Ga0268265_11476194 3300028380 Bacteria 683
489 Ga0268264_10173608 3300028381 Bacteria 1951
490 Ga0307517_10018569 3300028786 Bacteria 8985
491 Ga0307515_10000088 3300028794 Bacteria 215810
492 Ga0307515_10013108 3300028794 Bacteria 15519
493 Ga0307515_10018950 3300028794 Bacteria 12421
494 Ga0307515_10039781 3300028794 Bacteria 7462
495 Ga0307512_10027644 3300030522 Bacteria 4987
496 Ga0307512_10071268 3300030522 Bacteria 2581
497 Ga0307512_10224937 3300030522 Bacteria 974
498 Ga0316176_1081199 3300030732 Bacteria 884
499 Ga0316178_1168392 3300030735 Bacteria 1140
500 Ga0316183_1108901 3300030742 Bacteria 908
501 Ga0316182_1249122 3300030745 Bacteria 2013
502 Ga0265328_10019234 3300031239 Bacteria 2626
503 Ga0307513_10000001 3300031456 Bacteria 1660464
504 Ga0307513_10006081 3300031456 Bacteria 15836
505 Ga0307513_10038166 3300031456 Bacteria 5336
506 Ga0307513_10039091 3300031456 Bacteria 5261
507 Ga0307509_10018036 3300031507 Bacteria 8104
508 Ga0307509_10485771 3300031507 Bacteria 922
509 Ga0307408_100268714 3300031548 Bacteria 1415
510 Ga0307508_10001033 3300031616 Bacteria 32282
511 Ga0307508_10073119 3300031616 Bacteria 3004
512 Ga0307508_10084883 3300031616 Bacteria 2749
513 Ga0307508_10149718 3300031616 Bacteria 1938
514 Ga0307508_10601568 3300031616 Bacteria 701
515 Ga0307514_10265715 3300031649 Bacteria 999
516 Ga0307516_10006674 3300031730 Bacteria 13487
517 Ga0307516_10011094 3300031730 Bacteria 9839
518 Ga0307516_10043491 3300031730 Bacteria 4451
519 Ga0307516_10069749 3300031730 Bacteria 3379
520 Ga0307516_10070013 3300031730 Bacteria 3373
521 Ga0307405_10028362 3300031731 Bacteria 3259
522 Ga0307405_10031643 3300031731 Bacteria 3117
523 Ga0307405_10170756 3300031731 Bacteria 1551
524 Ga0307405_10212786 3300031731 Bacteria 1413
525 Ga0316577_10833132 3300031733 Unclassified 523
526 Ga0307413_10095009 3300031824 Bacteria 1953
527 Ga0307413_10269399 3300031824 Bacteria 1274
528 Ga0307413_10340493 3300031824 Bacteria 1153
529 Ga0307413_11159118 3300031824 Bacteria 670
530 Ga0307413_11493271 3300031824 Bacteria 597
531 Ga0307410_10012558 3300031852 Bacteria 4905
532 Ga0307410_10237645 3300031852 Bacteria 1410
533 Ga0307410_10372017 3300031852 Bacteria 1147
534 Ga0307410_10585175 3300031852 Bacteria 929
535 Ga0326468_10000899 3300031889 Bacteria 2901
536 Ga0307406_10016567 3300031901 Bacteria 4286
537 Ga0307406_10156900 3300031901 Bacteria 1631
538 Ga0307406_10174835 3300031901 Bacteria 1558
539 Ga0307406_10180017 3300031901 Bacteria 1538
540 Ga0307406_10228031 3300031901 Bacteria 1389
541 Ga0307406_10327321 3300031901 Bacteria 1188
542 Ga0307406_10722871 3300031901 Bacteria 833
543 Ga0307406_10828271 3300031901 Bacteria 783
544 Ga0307406_11946697 3300031901 Bacteria 525
545 Ga0307407_10025296 3300031903 Bacteria 3127
546 Ga0307407_10371117 3300031903 Bacteria 1019
547 Ga0307407_10789307 3300031903 Bacteria 722
548 Ga0307412_10487105 3300031911 Bacteria 1024
549 Ga0307412_10488276 3300031911 Bacteria 1023
550 Ga0307409_100016211 3300031995 Bacteria 4922
551 Ga0307409_100042084 3300031995 Bacteria 3418
552 Ga0307409_100280632 3300031995 Bacteria 1539
553 Ga0307409_100587903 3300031995 Bacteria 1098
554 Ga0307409_101169721 3300031995 Bacteria 792
555 Ga0307409_101641228 3300031995 Bacteria 671
556 Ga0307416_100019576 3300032002 Bacteria 4804
557 Ga0307416_100025289 3300032002 Bacteria 4350
558 Ga0307416_100069430 3300032002 Bacteria 2916
559 Ga0307416_100110893 3300032002 Bacteria 2417
560 Ga0307416_100359102 3300032002 Bacteria 1478
561 Ga0307416_100462737 3300032002 Bacteria 1324
562 Ga0307416_101111190 3300032002 Bacteria 895
563 Ga0307416_103528277 3300032002 Bacteria 523
564 Ga0307414_10371006 3300032004 Bacteria 1234
565 Ga0307411_10391579 3300032005 Bacteria 1146
566 Ga0307411_10750411 3300032005 Bacteria 855
567 Ga0307411_11023821 3300032005 Bacteria 740
568 Ga0307415_100012069 3300032126 Bacteria 4980
569 Ga0307415_100023474 3300032126 Bacteria 3829
570 Ga0307415_100128838 3300032126 Bacteria 1912
571 Ga0307415_100170426 3300032126 Bacteria 1697
572 Ga0307415_100186987 3300032126 Bacteria 1631
573 Ga0307415_100729765 3300032126 Bacteria 897
574 Ga0307415_100865144 3300032126 Bacteria 830
575 Ga0307415_100940233 3300032126 Bacteria 799
576 Ga0316593_10023349 3300032168 Bacteria 1950
577 Ga0307507_10036964 3300033179 Bacteria 4977
578 Ga0373948_0020911 3300034817 Bacteria 1250
579 Ga0373938_0044520 3300034957 Bacteria 996
580 Ga0373928_0103906 3300035084 Bacteria 744
581 Ga0373940_0009036 3300035088 Bacteria 2305
582 Ga0373951_0000348 3300035091 Bacteria 14059
583 Ga0373932_0011494 3300035112 Bacteria 2164
584 Ga0373939_0197378 3300035114 Bacteria 759
585 Ga0373941_0059789 3300035115 Bacteria 1237
586 Ga0373954_0374955 3300035118 Bacteria 703
587 Ga0373942_0002690 3300035207 Bacteria 4258
588 Ga0373942_0047849 3300035207 Bacteria 1189
589 Ga0373962_0080915 3300035242 Bacteria 986
590 Ga0373931_0859209 3300035691 Bacteria 608
591 Ga0373935_0002590 3300035692 Bacteria 10386
592 Ga0373947_0339306 3300035725 Bacteria 1007
593 Ga0373937_1197649 3300036401 Bacteria 708
594 Ga0395899_0063911 3300037312 Bacteria 2707
595 Ga0395899_0967143 3300037312 Bacteria 515
596 Ga0395899_1011728 3300037312 Bacteria 501
597 Ga0395900_0012064 3300037418 Bacteria 8832
598 Ga0395900_0016074 3300037418 Bacteria 7626
599 Ga0395900_0268680 3300037418 Bacteria 1701
600 Ga0395898_0022252 3300037466 Bacteria 6423
601 Ga0395898_0050171 3300037466 Bacteria 4085
602 Ga0395905_0014625 3300037471 Bacteria 7486
603 Ga0395905_0205827 3300037471 Bacteria 1844
604 Ga0436364_0604116 3300037853 Bacteria 1655
605 Ga0395901_0016631 3300038443 Bacteria 7494
606 Ga0395901_0053127 3300038443 Bacteria 4210
607 Ga0395901_0076026 3300038443 Bacteria 3503
608 Ga0439436_0172020 3300041404 Bacteria 614
609 Ga0439438_037414 3300041405 Bacteria 1269
610 Ga0451787_658154 3300041441 Bacteria 748
611 Ga0451789_1288412 3300041443 Bacteria 1339
612 Ga0451794_30919 3300041446 Bacteria 588
613 Ga0451791_0746435 3300041451 Bacteria 2242
614 Ga0451793_1415064 3300041452 Bacteria 917
615 Ga0451801_32288 3300041455 Bacteria 814
616 Ga0451800_0112694 3300041459 Bacteria 671
617 Ga0451800_0243129 3300041459 Bacteria 512
618 Ga0451802_1455243 3300041460 Bacteria 732
619 Ga0451805_030692 3300041461 Bacteria 790
620 Ga0451805_084038 3300041461 Bacteria 546
621 Ga0451804_0532200 3300041463 Bacteria 957
622 Ga0451807_0946012 3300041486 Bacteria 579
623 Ga0451835_0182726 3300041492 Bacteria 516
624 Ga0451846_49640 3300041502 Bacteria 663
625 Ga0451849_0766240 3300041505 Bacteria 887
626 Ga0451853_2990416 3300041512 Bacteria 1090
627 Ga0451853_3286472 3300041512 Bacteria 1880
628 Ga0439448_0128714 3300042005 Bacteria 872
629 Ga0439449_0223832 3300042007 Bacteria 705
630 Ga0450908_099342 3300042184 Bacteria 532
631 Ga0466961_0183679 3300044693 Bacteria 1298
632 Ga0466963_1258665 3300044694 Bacteria 520
633 Ga0466971_0310346 3300044719 Bacteria 759
634 Ga0466957_0079358 3300044842 Bacteria 2042
635 Ga0466960_0412244 3300044901 Bacteria 780
636 Ga0466960_0584332 3300044901 Bacteria 662
637 Ga0466958_0817147 3300045836 Bacteria 608
638 Ga0466967_0061324 3300045976 Bacteria 3336
639 Ga0466967_0519673 3300045976 Bacteria 1170
640 Ga0495629_0030517 3300046459 Bacteria 3821
641 Ga0495629_0056195 3300046459 Bacteria 2753
642 Ga0495638_0455539 3300046460 Bacteria 652
643 Ga0495594_0096546 3300046499 Bacteria 1661
644 Ga0495594_0101277 3300046499 Bacteria 1620
645 Ga0495594_0117613 3300046499 Bacteria 1501
646 Ga0495632_0021178 3300046519 Bacteria 3507
647 Ga0495632_0145463 3300046519 Bacteria 1098
648 Ga0495622_0136589 3300046557 Bacteria 1115
649 Ga0495668_0010448 3300046616 Bacteria 5617
650 Ga0495625_0011061 3300046660 Bacteria 7394
651 Ga0495581_0492374 3300047315 Bacteria 713
652 Ga0495636_0208701 3300047318 Bacteria 894
653 Ga0495683_0026250 3300047323 Bacteria 2981
654 Ga0495626_0002023 3300048091 Bacteria 14913
655 Ga0496104_0070355 3300048907 Bacteria 3326
656 Ga0496105_0090253 3300048908 Bacteria 2531
657 Ga0496106_1470990 3300048909 Bacteria 525
658 Ga0496108_0000019 3300048911 Bacteria 234657
659 Ga0496108_1473386 3300048911 Bacteria 567
660 Ga0496109_0207436 3300048912 Bacteria 1843
661 Ga0496109_0317178 3300048912 Bacteria 1471
662 Ga0496109_1659842 3300048912 Bacteria 573
663 Ga0496110_0112143 3300048913 Bacteria 2452
664 Ga0496110_0710050 3300048913 Bacteria 907
665 Ga0496110_1175428 3300048913 Bacteria 676
666 Ga0496110_1531537 3300048913 Bacteria 577
667 Ga0496112_0022573 3300048915 Bacteria 5997
668 Ga0496112_0151229 3300048915 Bacteria 2288
669 Ga0496112_0163363 3300048915 Bacteria 2193
670 Ga0496112_0269202 3300048915 Bacteria 1652
671 Ga0496112_1372715 3300048915 Bacteria 621
672 Ga0496112_1482616 3300048915 Bacteria 592
673 Ga0496113_0456396 3300048916 Bacteria 1027
674 Ga0496113_1231647 3300048916 Bacteria 584
675 Ga0496126_0063848 3300048929 Bacteria 3300
676 Ga0496126_0440165 3300048929 Bacteria 1051
677 Ga0501307_023032 3300049162 Bacteria 823
678 Ga0501034_0799023 3300049571 Bacteria 836
679 Ga0501042_0308814 3300049578 Bacteria 1143
680 Ga0501042_0567859 3300049578 Bacteria 825
681 Ga0501043_0332078 3300049579 Bacteria 1158
682 Ga0501047_0016507 3300049581 Bacteria 7049
683 Ga0501047_0038223 3300049581 Bacteria 4643
684 Ga0501048_0399693 3300049582 Bacteria 982
685 Ga0501067_0322045 3300049583 Bacteria 861
686 Ga0501070_0472811 3300049586 Bacteria 1009
687 Ga0501070_0920343 3300049586 Bacteria 681
688 Ga0501071_1265179 3300049587 Bacteria 570
689 Ga0501072_0955182 3300049588 Bacteria 669
690 Ga0501076_0430563 3300049592 Bacteria 1086
691 Ga0501076_0968576 3300049592 Bacteria 701
692 Ga0501044_0488760 3300049823 Bacteria 1133
693 Ga0501045_0573826 3300049824 Bacteria 836
694 nmdc:mga03n38_210510_c1 3300050490 Bacteria 1010
695 nmdc:mga04h51_328745_c1 3300050495 Bacteria 628
696 nmdc:mga05p37_153347_c1 3300050507 Bacteria 2817
697 nmdc:mga05p37_1688_c1 3300050507 Bacteria 25686
698 nmdc:mga05p37_1691_c1 3300050507 Bacteria 25680
699 nmdc:mga05p37_25686_c1 3300050507 Bacteria 7165
700 nmdc:mga05p37_40243_c1 3300050507 Bacteria 5740
701 nmdc:mga05p37_411685_c1 3300050507 Bacteria 1576
702 nmdc:mga05p37_623556_c1 3300050507 Bacteria 1213
703 nmdc:mga05p37_6782_c1 3300050507 Bacteria 13496
704 nmdc:mga09592_11758_c1 3300050508 Bacteria 7116
705 nmdc:mga09592_1659749_c1 3300050508 Bacteria 516
706 nmdc:mga09592_16_c1 3300050508 Bacteria 97518
707 nmdc:mga09592_177379_c1 3300050508 Bacteria 1843
708 nmdc:mga09592_373135_c1 3300050508 Bacteria 1234
709 nmdc:mga09592_448529_c1 3300050508 Bacteria 1113
710 nmdc:mga09592_48386_c1 3300050508 Bacteria 3584
711 nmdc:mga09592_4861_c1 3300050508 Bacteria 10887
712 nmdc:mga09592_708586_c1 3300050508 Bacteria 856
713 nmdc:mga0qj67_100464_c1 3300050509 Bacteria 2332
714 nmdc:mga0qj67_1336030_c1 3300050509 Bacteria 555
715 nmdc:mga0qj67_16_c1 3300050509 Bacteria 124323
716 nmdc:mga0qj67_284878_c1 3300050509 Bacteria 1339
717 nmdc:mga0qj67_41028_c1 3300050509 Bacteria 3639
718 nmdc:mga0qj67_418518_c1 3300050509 Bacteria 1080
719 nmdc:mga0qj67_55356_c1 3300050509 Bacteria 3142
720 nmdc:mga06r32_1729840_c1 3300050510 Bacteria 562
721 nmdc:mga06r32_282398_c1 3300050510 Bacteria 1647
722 nmdc:mga06r32_475605_c1 3300050510 Bacteria 1228
723 nmdc:mga06r32_488104_c1 3300050510 Bacteria 1209
724 nmdc:mga06r32_591359_c1 3300050510 Bacteria 1081
725 nmdc:mga06r32_659315_c1 3300050510 Bacteria 1014
726 nmdc:mga06r32_76305_c1 3300050510 Bacteria 3255
727 nmdc:mga06r32_8377_c1 3300050510 Bacteria 9312
728 nmdc:mga06r32_9713_c1 3300050510 Bacteria 8691
729 nmdc:mga08y16_49925_c1 3300050511 Bacteria 4378
730 nmdc:mga0n895_604776_c1 3300050512 Bacteria 1098
731 nmdc:mga0a205_520500_c1 3300050515 Bacteria 1046
732 nmdc:mga0a205_768639_c1 3300050515 Bacteria 811
733 Ga0500578_0662702 3300053086 Bacteria 566
734 Ga0500644_0004288 3300053088 Bacteria 3566
735 Ga0500644_0091296 3300053088 Bacteria 1140
736 Ga0500646_0220691 3300053090 Bacteria 657
737 Ga0500583_0247677 3300053092 Bacteria 880
738 Ga0500583_0354667 3300053092 Bacteria 710
739 Ga0500651_0089163 3300053093 Bacteria 1901
740 Ga0500651_0250974 3300053093 Bacteria 1029
741 Ga0500641_0095528 3300053096 Bacteria 1271
742 Ga0500650_0041339 3300053098 Bacteria 2128
743 Ga0500660_126278 3300053100 Bacteria 1052
744 Ga0500556_0240722 3300053104 Bacteria 713
745 Ga0500556_0307904 3300053104 Bacteria 618
746 Ga0500569_005632 3300053109 Bacteria 2701
747 Ga0500572_202517 3300053111 Bacteria 650
748 Ga0500652_024511 3300053131 Bacteria 2303
749 Ga0500577_0108484 3300053142 Bacteria 1143
750 Ga0500577_0230233 3300053142 Bacteria 803
751 Ga0500600_0084237 3300053149 Bacteria 1711
752 Ga0500604_0112228 3300053151 Bacteria 906
753 Ga0500630_187723 3300053159 Bacteria 823
754 Ga0500633_0086310 3300053160 Bacteria 1141
755 Ga0500611_066714 3300053727 Bacteria 866
756 Ga0501084_0506240 3300054114 Bacteria 1021
757 Ga0501084_0567636 3300054114 Bacteria 959
758 Ga0587084_050447 3300059477 Bacteria 735
759 Ga0587066_030403 3300059490 Bacteria 959
760 Ga0587066_067363 3300059490 Bacteria 746
761 Ga0587070_051968 3300059491 Bacteria 821
762 Ga0587070_081296 3300059491 Bacteria 711
763 Ga0587073_0021409 3300059492 Bacteria 1244
764 Ga0587073_0101606 3300059492 Bacteria 748
765 Ga0587073_0144664 3300059492 Bacteria 666
766 Ga0587077_020100 3300059493 Bacteria 1170
767 Ga0587080_125620 3300059503 Bacteria 573
768 Ga0587080_146411 3300059503 Bacteria 544
769 Ga0587082_011845 3300059504 Bacteria 1284
770 Ga0587085_075902 3300059506 Bacteria 667
771 Ga0587088_180706 3300059508 Bacteria 528
772 Ga0587090_025468 3300059510 Bacteria 956
773 Ga0587091_042826 3300059511 Bacteria 900
774 Ga0587091_043199 3300059511 Bacteria 897
775 Ga0587091_067582 3300059511 Bacteria 774
776 Ga0587092_016692 3300059512 Bacteria 1090
777 Ga0587094_074948 3300059513 Bacteria 616
778 Ga0587095_006376 3300059514 Bacteria 916
779 Ga0587098_011221 3300059604 Bacteria 1005
780 Ga0587106_117151 3300059605 Bacteria 561
781 Ga0587099_031593 3300059622 Bacteria 646
782 Ga0587101_072204 3300059623 Bacteria 638
783 Ga0587101_105222 3300059623 Bacteria 566
784 Ga0587109_030617 3300059624 Bacteria 1019
785 Ga0587109_112954 3300059624 Bacteria 637
786 Ga0587115_067144 3300059626 Bacteria 612
787 Ga0587122_021766 3300059628 Bacteria 702
788 Ga0587128_034035 3300059630 Bacteria 860
789 Ga0587062_031890 3300059639 Bacteria 812
790 Ga0587067_060627 3300059640 Bacteria 792
791 Ga0587068_014219 3300059641 Bacteria 1238
792 Ga0587068_070861 3300059641 Bacteria 687
793 Ga0587068_104250 3300059641 Bacteria 599
794 Ga0587069_034524 3300059642 Bacteria 835
795 Ga0587075_055076 3300059644 Bacteria 704
796 Ga0587076_085504 3300059645 Bacteria 681
797 Ga0587076_102468 3300059645 Bacteria 641
798 Ga0587076_207121 3300059645 Bacteria 507
799 Ga0587078_005950 3300059646 Bacteria 1314
800 Ga0587078_013535 3300059646 Bacteria 967
801 Ga0587078_083471 3300059646 Bacteria 515
802 Ga0587079_017185 3300059647 Bacteria 1252
803 Ga0587079_028568 3300059647 Bacteria 1057
804 Ga0587079_032566 3300059647 Bacteria 1010
805 Ga0587079_075914 3300059647 Bacteria 759
806 Ga0587102_032570 3300059649 Bacteria 643
807 Ga0587107_108992 3300059652 Bacteria 557
808 Ga0587114_063554 3300059655 Bacteria 653
809 Ga0587119_014324 3300059658 Bacteria 950
810 Ga0587120_015232 3300059659 Bacteria 693
811 Ga0587071_070966 3300060344 Bacteria 758
812 Ga0587071_085581 3300060344 Bacteria 709
813 Ga0587071_221704 3300060344 Bacteria 503
814 Ga0587111_0104753 3300060346 Bacteria 709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0010448 Ga0495668_0010448_4577_4879 88
2 3300046660 Ga0495625_0011061 Ga0495625_0011061_739_1041 88
3 3300047318 Ga0495636_0208701 Ga0495636_0208701_417_719 88
4 3300047323 Ga0495683_0026250 Ga0495683_0026250_641_943 88
5 3300048091 Ga0495626_0002023 Ga0495626_0002023_13879_14181 88
6 3300050509 nmdc:mga0qj67_55356_c1 nmdc:mga0qj67_55356_c1_423_725 89
7 3300009147 Ga0114129_10011584 Ga0114129_100115845 91
8 3300050507 nmdc:mga05p37_623556_c1 nmdc:mga05p37_623556_c1_454_762 91
9 3300050508 nmdc:mga09592_48386_c1 nmdc:mga09592_48386_c1_1799_2107 91
10 3300059655 Ga0587114_063554 Ga0587114_063554_106_420 91
11 3300041492 Ga0451835_0182726 Ga0451835_0182726_179_505 96
12 3300048913 Ga0496110_0710050 Ga0496110_0710050_553_879 96
13 3300049162 Ga0501307_023032 Ga0501307_023032_476_802 96
14 3300031456 Ga0307513_10006081 Ga0307513_100060814 98
15 3300003316 rootH1_10044904 rootH1_100449043 100
16 3300031616 Ga0307508_10073119 Ga0307508_100731193 100
17 3300031730 Ga0307516_10069749 Ga0307516_100697492 100
18 3300053092 Ga0500583_0247677 Ga0500583_0247677_358_735 100
19 3300053149 Ga0500600_0084237 Ga0500600_0084237_863_1240 100
20 3300003203 JGI25406J46586_10039243 JGI25406J46586_100392433 101
21 3300005985 Ga0081539_10000733 Ga0081539_1000073325 101
22 3300031731 Ga0307405_10031643 Ga0307405_100316433 101
23 3300031852 Ga0307410_10012558 Ga0307410_100125581 101
24 3300031889 Ga0326468_10000899 Ga0326468_100008993 101
25 3300031901 Ga0307406_10016567 Ga0307406_100165673 101
26 3300031911 Ga0307412_10487105 Ga0307412_104871052 101
27 3300031995 Ga0307409_100016211 Ga0307409_1000162114 101
28 3300032002 Ga0307416_100025289 Ga0307416_1000252895 101
29 3300032004 Ga0307414_10371006 Ga0307414_103710063 101
30 3300032005 Ga0307411_10391579 Ga0307411_103915793 101
31 3300032126 Ga0307415_100023474 Ga0307415_1000234743 101
32 3300037418 Ga0395900_0012064 Ga0395900_0012064_6299_6682 101
33 3300037466 Ga0395898_0050171 Ga0395898_0050171_1212_1595 101
34 3300037471 Ga0395905_0205827 Ga0395905_0205827_518_901 101
35 3300038443 Ga0395901_0053127 Ga0395901_0053127_813_1196 101
36 3300042005 Ga0439448_0128714 Ga0439448_0128714_162_539 101
37 3300028786 Ga0307517_10018569 Ga0307517_100185694 102
38 3300028794 Ga0307515_10018950 Ga0307515_100189507 102
39 3300030522 Ga0307512_10027644 Ga0307512_100276443 102
40 3300031616 Ga0307508_10084883 Ga0307508_100848834 102
41 3300037312 Ga0395899_0967143 Ga0395899_0967143_14_397 102
42 3300046519 Ga0495632_0021178 Ga0495632_0021178_333_710 102
43 3300053088 Ga0500644_0091296 Ga0500644_0091296_206_583 102
44 3300053090 Ga0500646_0220691 Ga0500646_0220691_36_413 102
45 3300053093 Ga0500651_0089163 Ga0500651_0089163_621_998 102
46 3300053096 Ga0500641_0095528 Ga0500641_0095528_290_667 102
47 3300053098 Ga0500650_0041339 Ga0500650_0041339_959_1336 102
48 3300053104 Ga0500556_0307904 Ga0500556_0307904_22_399 102
49 3300053109 Ga0500569_005632 Ga0500569_005632_1452_1829 102
50 3300053131 Ga0500652_024511 Ga0500652_024511_658_1035 102
51 3300053142 Ga0500577_0108484 Ga0500577_0108484_285_662 102
52 3300053151 Ga0500604_0112228 Ga0500604_0112228_519_896 102
53 3300053160 Ga0500633_0086310 Ga0500633_0086310_709_1086 102
54 3300053727 Ga0500611_066714 Ga0500611_066714_386_763 102
55 iso_pu_bacteria 2862507626 2862510376 103
56 iso_pu_bacteria 2622736626 2623584993 104
57 iso_pu_bacteria 2855683550 2855684563 104
58 iso_pu_bacteria 2856858025 2856858820 104
59 iso_pu_bacteria 2867302475 2867307118 104
60 iso_pu_bacteria 2867312974 2867319472 104
61 iso_pu_bacteria 2867319477 2867321688 104
62 iso_pu_bacteria 2867507094 2867511970 104
63 iso_pu_bacteria 2902582711 2902583708 104
64 iso_pu_bacteria 2996221748 2996223752 104
65 iso_pu_bacteria 649633069 649810730 104
66 3300004803 Ga0058862_12802035 Ga0058862_128020352 105
67 3300035091 Ga0373951_0000348 Ga0373951_0000348_12857_13234 105
68 3300049592 Ga0501076_0968576 Ga0501076_0968576_122_520 105
69 iso_pu_bacteria 2515154088 2515496649 105
70 iso_pu_bacteria 2515154129 2515718349 105
71 iso_pu_bacteria 2515154137 2515756888 105
72 iso_pu_bacteria 2515154202 2516083491 105
73 iso_pu_bacteria 2515154203 2516089426 105
74 iso_pu_bacteria 2675903059 2676480774 105
75 iso_pu_bacteria 2772190715 2772644934 105
76 iso_pu_bacteria 2831935698 2831941071 105
77 iso_pu_bacteria 2832004796 2832006162 105
78 iso_pu_bacteria 2855670206 2855673747 105
79 iso_pu_bacteria 2855676851 2855682908 105
80 iso_pu_bacteria 2857288857 2857291278 105
81 iso_pu_bacteria 2858848962 2858849772 105
82 iso_pu_bacteria 2858882152 2858886284 105
83 iso_pu_bacteria 2858888857 2858890944 105
84 iso_pu_bacteria 2858895516 2858897676 105
85 iso_pu_bacteria 2858902515 2858902981 105
86 iso_pu_bacteria 2866065130 2866069288 105
87 iso_pu_bacteria 2869048445 2869054182 105
88 iso_pu_bacteria 2869061728 2869065992 105
89 iso_pu_bacteria 2869068681 2869071822 105
90 iso_pu_bacteria 2880489317 2880495272 105
91 iso_pu_bacteria 2880495981 2880497073 105
92 iso_pu_bacteria 2929219909 2929225672 105
93 iso_pu_bacteria 2929226422 2929231353 105
94 iso_pu_bacteria 8003830390 8003830970 105
95 iso_pu_bacteria 8003870546 8003874594 105
96 iso_pu_bacteria 8054704163 8054706663 105
97 iso_pu_bacteria 8054727385 8054733732 105
98 iso_pu_bacteria 8054734606 8054740708 105
99 iso_pu_bacteria 8055412473 8055417871 105
100 3300005327 Ga0070658_10359098 Ga0070658_103590981 106
101 3300005329 Ga0070683_100042177 Ga0070683_1000421773 106
102 3300005339 Ga0070660_100573757 Ga0070660_1005737572 106
103 3300005344 Ga0070661_100280911 Ga0070661_1002809111 106
104 3300005366 Ga0070659_100048390 Ga0070659_1000483903 106
105 3300005435 Ga0070714_100911484 Ga0070714_1009114841 106
106 3300005455 Ga0070663_101263779 Ga0070663_1012637791 106
107 3300005458 Ga0070681_10381844 Ga0070681_103818442 106
108 3300005530 Ga0070679_100027945 Ga0070679_1000279453 106
109 3300005535 Ga0070684_100297880 Ga0070684_1002978802 106
110 3300005535 Ga0070684_102332171 Ga0070684_1023321711 106
111 3300005563 Ga0068855_100088846 Ga0068855_1000888462 106
112 3300005564 Ga0070664_100195172 Ga0070664_1001951723 106
113 3300005614 Ga0068856_101569564 Ga0068856_1015695642 106
114 3300005616 Ga0068852_100465942 Ga0068852_1004659422 106
115 3300005618 Ga0068864_100362633 Ga0068864_1003626333 106
116 3300005841 Ga0068863_100859999 Ga0068863_1008599992 106
117 3300005983 Ga0081540_1017361 Ga0081540_10173613 106
118 3300006173 Ga0070716_100273420 Ga0070716_1002734203 106
119 3300009551 Ga0105238_10590867 Ga0105238_105908672 106
120 3300010375 Ga0105239_10126206 Ga0105239_101262063 106
121 3300013105 Ga0157369_10019823 Ga0157369_100198233 106
122 3300013307 Ga0157372_10180794 Ga0157372_101807943 106
123 3300014325 Ga0163163_10790094 Ga0163163_107900942 106
124 3300020069 Ga0197907_10060655 Ga0197907_100606553 106
125 3300020070 Ga0206356_10842913 Ga0206356_108429132 106
126 3300020075 Ga0206349_1890871 Ga0206349_18908712 106
127 3300020078 Ga0206352_11031132 Ga0206352_110311323 106
128 3300020080 Ga0206350_10428956 Ga0206350_104289562 106
129 3300020081 Ga0206354_11025538 Ga0206354_110255383 106
130 3300020082 Ga0206353_10005794 Ga0206353_100057943 106
131 3300022467 Ga0224712_10006660 Ga0224712_100066603 106
132 3300025909 Ga0207705_10007873 Ga0207705_100078732 106
133 3300025912 Ga0207707_10211280 Ga0207707_102112803 106
134 3300025917 Ga0207660_10377267 Ga0207660_103772672 106
135 3300025919 Ga0207657_10494880 Ga0207657_104948802 106
136 3300025921 Ga0207652_10066451 Ga0207652_100664512 106
137 3300025924 Ga0207694_10958766 Ga0207694_109587662 106
138 3300025928 Ga0207700_11008099 Ga0207700_110080992 106
139 3300025929 Ga0207664_10082843 Ga0207664_100828433 106
140 3300025939 Ga0207665_10651685 Ga0207665_106516852 106
141 3300025944 Ga0207661_10011053 Ga0207661_100110535 106
142 3300025945 Ga0207679_10321274 Ga0207679_103212742 106
143 3300025949 Ga0207667_10158906 Ga0207667_101589062 106
144 3300026078 Ga0207702_10293338 Ga0207702_102933382 106
145 3300026095 Ga0207676_10144071 Ga0207676_101440713 106
146 3300026116 Ga0207674_10313186 Ga0207674_103131863 106
147 3300026142 Ga0207698_10455517 Ga0207698_104555173 106
148 3300048915 Ga0496112_0163363 Ga0496112_0163363_1342_1704 106
149 3300048915 Ga0496112_0269202 Ga0496112_0269202_194_556 106
150 3300048916 Ga0496113_0456396 Ga0496113_0456396_133_495 106
151 3300049579 Ga0501043_0332078 Ga0501043_0332078_549_911 106
152 3300049581 Ga0501047_0038223 Ga0501047_0038223_2048_2410 106
153 3300049582 Ga0501048_0399693 Ga0501048_0399693_439_801 106
154 3300049824 Ga0501045_0573826 Ga0501045_0573826_320_682 106
155 iso_pu_bacteria 2861520306 2861521486 106
156 iso_pu_bacteria 8056054917 8056056863 106
157 3300005329 Ga0070683_100001644 Ga0070683_1000016443 107
158 3300005334 Ga0068869_100228360 Ga0068869_1002283602 107
159 3300005334 Ga0068869_100354269 Ga0068869_1003542692 107
160 3300005564 Ga0070664_100088470 Ga0070664_1000884703 107
161 3300005577 Ga0068857_101208539 Ga0068857_1012085392 107
162 3300005983 Ga0081540_1098328 Ga0081540_10983282 107
163 3300006844 Ga0075428_100086491 Ga0075428_1000864913 107
164 3300006844 Ga0075428_100103739 Ga0075428_1001037392 107
165 3300006846 Ga0075430_100321619 Ga0075430_1003216192 107
166 3300006847 Ga0075431_100182905 Ga0075431_1001829054 107
167 3300006880 Ga0075429_100052579 Ga0075429_1000525793 107
168 3300006880 Ga0075429_100115105 Ga0075429_1001151054 107
169 3300009147 Ga0114129_12004404 Ga0114129_120044042 107
170 3300013297 Ga0157378_12247256 Ga0157378_122472562 107
171 3300014497 Ga0182008_10165419 Ga0182008_101654192 107
172 3300025942 Ga0207689_10177263 Ga0207689_101772632 107
173 3300025942 Ga0207689_10282866 Ga0207689_102828662 107
174 3300025944 Ga0207661_10001034 Ga0207661_1000103420 107
175 3300026088 Ga0207641_12225018 Ga0207641_122250181 107
176 3300031239 Ga0265328_10019234 Ga0265328_100192342 107
177 3300031733 Ga0316577_10833132 Ga0316577_108331321 107
178 3300031901 Ga0307406_10722871 Ga0307406_107228712 107
179 3300032002 Ga0307416_100359102 Ga0307416_1003591022 107
180 3300032126 Ga0307415_100729765 Ga0307415_1007297652 107
181 3300049587 Ga0501071_1265179 Ga0501071_1265179_124_483 107
182 3300050508 nmdc:mga09592_373135_c1 nmdc:mga09592_373135_c1_504_863 107
183 3300050509 nmdc:mga0qj67_418518_c1 nmdc:mga0qj67_418518_c1_156_515 107
184 3300050510 nmdc:mga06r32_475605_c1 nmdc:mga06r32_475605_c1_490_849 107
185 3300054114 Ga0501084_0506240 Ga0501084_0506240_496_912 107
186 3300005347 Ga0070668_101642979 Ga0070668_1016429791 108
187 3300005617 Ga0068859_102983866 Ga0068859_1029838662 108
188 3300005718 Ga0068866_10404499 Ga0068866_104044992 108
189 3300006048 Ga0075363_101008540 Ga0075363_1010085402 108
190 3300006844 Ga0075428_100014457 Ga0075428_1000144576 108
191 3300006846 Ga0075430_100165479 Ga0075430_1001654793 108
192 3300006846 Ga0075430_100243280 Ga0075430_1002432803 108
193 3300006847 Ga0075431_100045971 Ga0075431_1000459713 108
194 3300006880 Ga0075429_100007135 Ga0075429_1000071356 108
195 3300006931 Ga0097620_102983700 Ga0097620_1029837002 108
196 3300009094 Ga0111539_10805438 Ga0111539_108054382 108
197 3300009147 Ga0114129_10005056 Ga0114129_100050566 108
198 3300009174 Ga0105241_10963185 Ga0105241_109631852 108
199 3300009177 Ga0105248_10182532 Ga0105248_101825322 108
200 3300014325 Ga0163163_10146872 Ga0163163_101468723 108
201 3300025972 Ga0207668_11086926 Ga0207668_110869262 108
202 3300031901 Ga0307406_10174835 Ga0307406_101748351 108
203 3300031901 Ga0307406_11946697 Ga0307406_119466971 108
204 3300032126 Ga0307415_100170426 Ga0307415_1001704262 108
205 3300035207 Ga0373942_0047849 Ga0373942_0047849_797_1159 108
206 3300037312 Ga0395899_1011728 Ga0395899_1011728_94_462 108
207 3300037418 Ga0395900_0268680 Ga0395900_0268680_216_584 108
208 3300038443 Ga0395901_0016631 Ga0395901_0016631_2742_3110 108
209 3300041460 Ga0451802_1455243 Ga0451802_1455243_232_600 108
210 3300041512 Ga0451853_2990416 Ga0451853_2990416_621_983 108
211 3300046460 Ga0495638_0455539 Ga0495638_0455539_200_562 108
212 3300046499 Ga0495594_0117613 Ga0495594_0117613_748_1116 108
213 3300046557 Ga0495622_0136589 Ga0495622_0136589_32_400 108
214 3300048929 Ga0496126_0063848 Ga0496126_0063848_767_1147 108
215 3300050490 nmdc:mga03n38_210510_c1 nmdc:mga03n38_210510_c1_434_796 108
216 3300050507 nmdc:mga05p37_153347_c1 nmdc:mga05p37_153347_c1_601_969 108
217 3300050508 nmdc:mga09592_11758_c1 nmdc:mga09592_11758_c1_5678_6046 108
218 3300050508 nmdc:mga09592_448529_c1 nmdc:mga09592_448529_c1_20_382 108
219 3300050509 nmdc:mga0qj67_100464_c1 nmdc:mga0qj67_100464_c1_892_1254 108
220 3300005577 Ga0068857_102425929 Ga0068857_1024259291 109
221 3300005985 Ga0081539_10000109 Ga0081539_1000010966 109
222 3300006051 Ga0075364_10930321 Ga0075364_109303212 109
223 3300006847 Ga0075431_100339915 Ga0075431_1003399152 109
224 3300006880 Ga0075429_100755267 Ga0075429_1007552672 109
225 3300009147 Ga0114129_10000007 Ga0114129_1000000761 109
226 3300026116 Ga0207674_11172099 Ga0207674_111720992 109
227 3300031901 Ga0307406_10228031 Ga0307406_102280312 109
228 3300049586 Ga0501070_0472811 Ga0501070_0472811_396_761 109
229 3300050507 nmdc:mga05p37_6782_c1 nmdc:mga05p37_6782_c1_3995_4387 109
230 3300050508 nmdc:mga09592_708586_c1 nmdc:mga09592_708586_c1_124_516 109
231 3300050510 nmdc:mga06r32_1729840_c1 nmdc:mga06r32_1729840_c1_142_507 109
232 3300050510 nmdc:mga06r32_591359_c1 nmdc:mga06r32_591359_c1_119_490 109
233 iso_pu_bacteria 2751185782 2753270630 109
234 iso_pu_bacteria 2880489317 2880493660 109
235 iso_pu_bacteria 2887478801 2887483793 109
236 iso_pu_bacteria 2902582711 2902586282 109
237 iso_pu_bacteria 2929226422 2929227244 109
238 iso_pu_bacteria 2996221748 2996227252 109
239 iso_pu_bacteria 8001781756 8001782422 109
240 iso_pu_bacteria 8003856774 8003859932 109
241 iso_pu_bacteria 8003856774 8003862568 109
242 iso_pu_bacteria 8054734606 8054735030 109
243 3300003320 rootH2_10187251 rootH2_101872512 110
244 3300006871 Ga0075434_100824137 Ga0075434_1008241372 110
245 3300009545 Ga0105237_10363384 Ga0105237_103633842 110
246 3300013104 Ga0157370_11541017 Ga0157370_115410171 110
247 3300022467 Ga0224712_10083285 Ga0224712_100832852 110
248 3300028794 Ga0307515_10013108 Ga0307515_100131085 110
249 3300030732 Ga0316176_1081199 Ga0316176_10811991 110
250 3300030735 Ga0316178_1168392 Ga0316178_11683922 110
251 3300030742 Ga0316183_1108901 Ga0316183_11089012 110
252 3300030745 Ga0316182_1249122 Ga0316182_12491223 110
253 3300031456 Ga0307513_10000001 Ga0307513_10000001348 110
254 3300031730 Ga0307516_10070013 Ga0307516_100700133 110
255 3300041404 Ga0439436_0172020 Ga0439436_0172020_116_493 110
256 3300041405 Ga0439438_037414 Ga0439438_037414_22_399 110
257 3300042007 Ga0439449_0223832 Ga0439449_0223832_60_437 110
258 3300042184 Ga0450908_099342 Ga0450908_099342_127_504 110
259 iso_pu_bacteria 2515154088 2515493817 110
260 iso_pu_bacteria 2515154137 2515755208 110
261 iso_pu_bacteria 2515154202 2516085556 110
262 iso_pu_bacteria 2515154203 2516087650 110
263 iso_pu_bacteria 2622736626 2623586535 110
264 iso_pu_bacteria 2675903059 2676481455 110
265 iso_pu_bacteria 2772190715 2772641759 110
266 iso_pu_bacteria 2856858025 2856860456 110
267 iso_pu_bacteria 2858882152 2858888626 110
268 iso_pu_bacteria 2858895516 2858898393 110
269 iso_pu_bacteria 2858902515 2858907482 110
270 iso_pu_bacteria 2867319477 2867324838 110
271 iso_pu_bacteria 2867507094 2867509417 110
272 iso_pu_bacteria 649633069 649811195 110
273 iso_pu_bacteria 8003830390 8003833488 110
274 iso_pu_bacteria 8055412473 8055416193 110
275 3300004800 Ga0058861_11653156 Ga0058861_116531561 111
276 3300005329 Ga0070683_100003973 Ga0070683_1000039735 111
277 3300005535 Ga0070684_100160975 Ga0070684_1001609752 111
278 3300005564 Ga0070664_100536600 Ga0070664_1005366002 111
279 3300005577 Ga0068857_100552620 Ga0068857_1005526202 111
280 3300025944 Ga0207661_10002942 Ga0207661_100029424 111
281 3300025945 Ga0207679_10491558 Ga0207679_104915582 111
282 3300026116 Ga0207674_10684865 Ga0207674_106848651 111
283 3300031616 Ga0307508_10149718 Ga0307508_101497181 111
284 3300003575 Ga0007409J51694_1041147 Ga0007409J51694_10411471 112
285 3300004798 Ga0058859_11644820 Ga0058859_116448201 112
286 3300004801 Ga0058860_12177233 Ga0058860_121772332 112
287 3300005333 Ga0070677_10289611 Ga0070677_102896112 112
288 3300005343 Ga0070687_100534801 Ga0070687_1005348011 112
289 3300005354 Ga0070675_100251209 Ga0070675_1002512092 112
290 3300005356 Ga0070674_100348052 Ga0070674_1003480521 112
291 3300005438 Ga0070701_11400369 Ga0070701_114003691 112
292 3300005441 Ga0070700_100205353 Ga0070700_1002053532 112
293 3300005456 Ga0070678_101816675 Ga0070678_1018166751 112
294 3300005466 Ga0070685_10425769 Ga0070685_104257692 112
295 3300005983 Ga0081540_1109584 Ga0081540_11095842 112
296 3300006237 Ga0097621_100500147 Ga0097621_1005001472 112
297 3300009148 Ga0105243_10398273 Ga0105243_103982732 112
298 3300013308 Ga0157375_10409705 Ga0157375_104097052 112
299 3300014326 Ga0157380_10582896 Ga0157380_105828962 112
300 3300014745 Ga0157377_10500484 Ga0157377_105004841 112
301 3300025926 Ga0207659_10151986 Ga0207659_101519862 112
302 3300025927 Ga0207687_10498322 Ga0207687_104983222 112
303 3300026075 Ga0207708_10197130 Ga0207708_101971302 112
304 3300026088 Ga0207641_10177265 Ga0207641_101772653 112
305 3300026095 Ga0207676_10130236 Ga0207676_101302362 112
306 3300028794 Ga0307515_10000088 Ga0307515_10000088119 112
307 3300028794 Ga0307515_10039781 Ga0307515_100397816 112
308 3300031456 Ga0307513_10039091 Ga0307513_100390915 112
309 3300031548 Ga0307408_100268714 Ga0307408_1002687143 112
310 3300031730 Ga0307516_10006674 Ga0307516_100066744 112
311 3300031730 Ga0307516_10043491 Ga0307516_100434913 112
312 3300031731 Ga0307405_10170756 Ga0307405_101707562 112
313 3300031824 Ga0307413_10095009 Ga0307413_100950093 112
314 3300031852 Ga0307410_10372017 Ga0307410_103720172 112
315 3300031903 Ga0307407_10025296 Ga0307407_100252963 112
316 3300031911 Ga0307412_10488276 Ga0307412_104882762 112
317 3300031995 Ga0307409_100042084 Ga0307409_1000420843 112
318 3300032002 Ga0307416_100069430 Ga0307416_1000694303 112
319 3300032002 Ga0307416_100110893 Ga0307416_1001108932 112
320 3300032005 Ga0307411_10750411 Ga0307411_107504112 112
321 3300032168 Ga0316593_10023349 Ga0316593_100233493 112
322 3300037853 Ga0436364_0604116 Ga0436364_0604116_348_722 112
323 3300041441 Ga0451787_658154 Ga0451787_658154_26_400 112
324 3300041443 Ga0451789_1288412 Ga0451789_1288412_444_818 112
325 3300041451 Ga0451791_0746435 Ga0451791_0746435_762_1136 112
326 3300041459 Ga0451800_0112694 Ga0451800_0112694_243_617 112
327 3300041461 Ga0451805_084038 Ga0451805_084038_21_395 112
328 3300041463 Ga0451804_0532200 Ga0451804_0532200_351_725 112
329 3300041512 Ga0451853_3286472 Ga0451853_3286472_686_1060 112
330 3300045976 Ga0466967_0061324 Ga0466967_0061324_767_1147 112
331 3300049583 Ga0501067_0322045 Ga0501067_0322045_188_565 112
332 3300053088 Ga0500644_0004288 Ga0500644_0004288_1281_1655 112
333 3300053100 Ga0500660_126278 Ga0500660_126278_517_888 112
334 iso_pu_bacteria 2929219909 2929220665 112
335 3300003203 JGI25406J46586_10043635 JGI25406J46586_100436353 113
336 3300003203 JGI25406J46586_10113656 JGI25406J46586_101136562 113
337 3300003203 JGI25406J46586_10128039 JGI25406J46586_101280391 113
338 3300003305 Ga0006770J48903_1026830 Ga0006770J48903_10268301 113
339 3300003320 rootH2_10116321 rootH2_101163212 113
340 3300003322 rootL2_10032490 rootL2_100324903 113
341 3300003574 Ga0007410J51695_1024025 Ga0007410J51695_10240251 113
342 3300003574 Ga0007410J51695_1063768 Ga0007410J51695_10637681 113
343 3300003575 Ga0007409J51694_1018812 Ga0007409J51694_10188122 113
344 3300003579 Ga0007429J51699_1034608 Ga0007429J51699_10346081 113
345 3300003693 Ga0032354_1071614 Ga0032354_10716141 113
346 3300004798 Ga0058859_11596728 Ga0058859_115967282 113
347 3300004800 Ga0058861_12059710 Ga0058861_120597102 113
348 3300004800 Ga0058861_12065553 Ga0058861_120655532 113
349 3300004801 Ga0058860_11858986 Ga0058860_118589862 113
350 3300004801 Ga0058860_12019907 Ga0058860_120199072 113
351 3300004801 Ga0058860_12192533 Ga0058860_121925331 113
352 3300004803 Ga0058862_12846367 Ga0058862_128463672 113
353 3300005327 Ga0070658_10264029 Ga0070658_102640293 113
354 3300005327 Ga0070658_10390122 Ga0070658_103901222 113
355 3300005327 Ga0070658_10818781 Ga0070658_108187811 113
356 3300005328 Ga0070676_10247585 Ga0070676_102475851 113
357 3300005329 Ga0070683_100049068 Ga0070683_1000490681 113
358 3300005329 Ga0070683_100289651 Ga0070683_1002896511 113
359 3300005331 Ga0070670_100611799 Ga0070670_1006117992 113
360 3300005331 Ga0070670_100866441 Ga0070670_1008664412 113
361 3300005333 Ga0070677_10760558 Ga0070677_107605581 113
362 3300005334 Ga0068869_100178734 Ga0068869_1001787343 113
363 3300005336 Ga0070680_100294094 Ga0070680_1002940943 113
364 3300005337 Ga0070682_100865929 Ga0070682_1008659292 113
365 3300005338 Ga0068868_100010441 Ga0068868_1000104414 113
366 3300005338 Ga0068868_100577292 Ga0068868_1005772922 113
367 3300005339 Ga0070660_100404803 Ga0070660_1004048032 113
368 3300005339 Ga0070660_100706809 Ga0070660_1007068091 113
369 3300005340 Ga0070689_101351714 Ga0070689_1013517141 113
370 3300005343 Ga0070687_100200866 Ga0070687_1002008661 113
371 3300005343 Ga0070687_100361330 Ga0070687_1003613302 113
372 3300005344 Ga0070661_100030405 Ga0070661_1000304053 113
373 3300005344 Ga0070661_100541372 Ga0070661_1005413722 113
374 3300005345 Ga0070692_10358057 Ga0070692_103580571 113
375 3300005347 Ga0070668_100000126 Ga0070668_10000012619 113
376 3300005347 Ga0070668_100159106 Ga0070668_1001591062 113
377 3300005347 Ga0070668_102190034 Ga0070668_1021900341 113
378 3300005353 Ga0070669_100378824 Ga0070669_1003788242 113
379 3300005354 Ga0070675_100000194 Ga0070675_10000019425 113
380 3300005354 Ga0070675_100614969 Ga0070675_1006149692 113
381 3300005355 Ga0070671_100320938 Ga0070671_1003209382 113
382 3300005355 Ga0070671_100589219 Ga0070671_1005892192 113
383 3300005356 Ga0070674_101075450 Ga0070674_1010754502 113
384 3300005356 Ga0070674_101921241 Ga0070674_1019212412 113
385 3300005364 Ga0070673_101161221 Ga0070673_1011612211 113
386 3300005366 Ga0070659_100009047 Ga0070659_1000090472 113
387 3300005366 Ga0070659_100749949 Ga0070659_1007499491 113
388 3300005367 Ga0070667_100129491 Ga0070667_1001294912 113
389 3300005367 Ga0070667_100389770 Ga0070667_1003897702 113
390 3300005436 Ga0070713_100660855 Ga0070713_1006608552 113
391 3300005437 Ga0070710_10962731 Ga0070710_109627312 113
392 3300005455 Ga0070663_100818533 Ga0070663_1008185332 113
393 3300005456 Ga0070678_100450820 Ga0070678_1004508202 113
394 3300005456 Ga0070678_100657221 Ga0070678_1006572212 113
395 3300005457 Ga0070662_101005278 Ga0070662_1010052781 113
396 3300005458 Ga0070681_11389505 Ga0070681_113895051 113
397 3300005459 Ga0068867_100351501 Ga0068867_1003515012 113
398 3300005466 Ga0070685_10160370 Ga0070685_101603703 113
399 3300005530 Ga0070679_100231361 Ga0070679_1002313611 113
400 3300005530 Ga0070679_100701460 Ga0070679_1007014602 113
401 3300005535 Ga0070684_100188002 Ga0070684_1001880022 113
402 3300005535 Ga0070684_100436533 Ga0070684_1004365332 113
403 3300005539 Ga0068853_100703932 Ga0068853_1007039322 113
404 3300005543 Ga0070672_100285363 Ga0070672_1002853633 113
405 3300005543 Ga0070672_100971668 Ga0070672_1009716681 113
406 3300005544 Ga0070686_101007179 Ga0070686_1010071791 113
407 3300005547 Ga0070693_100259783 Ga0070693_1002597831 113
408 3300005548 Ga0070665_100067482 Ga0070665_1000674822 113
409 3300005548 Ga0070665_102562061 Ga0070665_1025620612 113
410 3300005564 Ga0070664_100017966 Ga0070664_1000179663 113
411 3300005577 Ga0068857_100016006 Ga0068857_1000160062 113
412 3300005577 Ga0068857_100119203 Ga0068857_1001192033 113
413 3300005578 Ga0068854_100026591 Ga0068854_1000265912 113
414 3300005578 Ga0068854_100964990 Ga0068854_1009649901 113
415 3300005615 Ga0070702_100662863 Ga0070702_1006628631 113
416 3300005616 Ga0068852_100442175 Ga0068852_1004421752 113
417 3300005617 Ga0068859_100014477 Ga0068859_1000144776 113
418 3300005618 Ga0068864_100042591 Ga0068864_1000425913 113
419 3300005618 Ga0068864_100656277 Ga0068864_1006562772 113
420 3300005618 Ga0068864_100661645 Ga0068864_1006616452 113
421 3300005618 Ga0068864_101253775 Ga0068864_1012537752 113
422 3300005834 Ga0068851_10092566 Ga0068851_100925662 113
423 3300005834 Ga0068851_10501590 Ga0068851_105015902 113
424 3300005840 Ga0068870_10044752 Ga0068870_100447523 113
425 3300005840 Ga0068870_10661307 Ga0068870_106613072 113
426 3300005841 Ga0068863_100000632 Ga0068863_10000063212 113
427 3300005841 Ga0068863_100132089 Ga0068863_1001320893 113
428 3300005841 Ga0068863_100143887 Ga0068863_1001438873 113
429 3300005842 Ga0068858_100109760 Ga0068858_1001097603 113
430 3300005844 Ga0068862_100107057 Ga0068862_1001070572 113
431 3300005937 Ga0081455_10228212 Ga0081455_102282122 113
432 3300005937 Ga0081455_10240129 Ga0081455_102401292 113
433 3300005937 Ga0081455_10246158 Ga0081455_102461582 113
434 3300005983 Ga0081540_1025318 Ga0081540_10253184 113
435 3300005985 Ga0081539_10000837 Ga0081539_1000083746 113
436 3300005985 Ga0081539_10007335 Ga0081539_100073353 113
437 3300005985 Ga0081539_10009471 Ga0081539_100094715 113
438 3300005985 Ga0081539_10037514 Ga0081539_100375143 113
439 3300005985 Ga0081539_10133643 Ga0081539_101336433 113
440 3300005985 Ga0081539_10393405 Ga0081539_103934052 113
441 3300006028 Ga0070717_10155328 Ga0070717_101553283 113
442 3300006042 Ga0075368_10179885 Ga0075368_101798852 113
443 3300006058 Ga0075432_10375371 Ga0075432_103753712 113
444 3300006175 Ga0070712_101089074 Ga0070712_1010890742 113
445 3300006844 Ga0075428_100090825 Ga0075428_1000908253 113
446 3300006844 Ga0075428_100503717 Ga0075428_1005037172 113
447 3300006844 Ga0075428_101124767 Ga0075428_1011247672 113
448 3300006846 Ga0075430_100010210 Ga0075430_1000102102 113
449 3300006846 Ga0075430_100247684 Ga0075430_1002476842 113
450 3300006847 Ga0075431_100002426 Ga0075431_1000024266 113
451 3300006847 Ga0075431_100965606 Ga0075431_1009656062 113
452 3300006847 Ga0075431_101009764 Ga0075431_1010097641 113
453 3300006852 Ga0075433_10501645 Ga0075433_105016451 113
454 3300006852 Ga0075433_10723782 Ga0075433_107237822 113
455 3300006880 Ga0075429_100014430 Ga0075429_1000144306 113
456 3300006881 Ga0068865_100547816 Ga0068865_1005478161 113
457 3300006931 Ga0097620_100014477 Ga0097620_1000144773 113
458 3300009094 Ga0111539_11374582 Ga0111539_113745822 113
459 3300009098 Ga0105245_10406434 Ga0105245_104064342 113
460 3300009098 Ga0105245_10743998 Ga0105245_107439982 113
461 3300009101 Ga0105247_10647567 Ga0105247_106475672 113
462 3300009147 Ga0114129_10000011 Ga0114129_1000001161 113
463 3300009147 Ga0114129_10010562 Ga0114129_100105628 113
464 3300009148 Ga0105243_10132383 Ga0105243_101323832 113
465 3300009174 Ga0105241_10950814 Ga0105241_109508142 113
466 3300009177 Ga0105248_10059038 Ga0105248_100590382 113
467 3300009177 Ga0105248_10544617 Ga0105248_105446172 113
468 3300009177 Ga0105248_11628617 Ga0105248_116286171 113
469 3300009545 Ga0105237_10910313 Ga0105237_109103131 113
470 3300009545 Ga0105237_10951776 Ga0105237_109517762 113
471 3300009551 Ga0105238_10469442 Ga0105238_104694422 113
472 3300009551 Ga0105238_10695772 Ga0105238_106957722 113
473 3300009553 Ga0105249_10362331 Ga0105249_103623312 113
474 3300009553 Ga0105249_10408678 Ga0105249_104086782 113
475 3300009828 Ga0130087_1016194 Ga0130087_10161942 113
476 3300009829 Ga0130086_1083337 Ga0130086_10833372 113
477 3300009835 Ga0130084_1114510 Ga0130084_11145102 113
478 3300011119 Ga0105246_12046664 Ga0105246_120466642 113
479 3300013102 Ga0157371_11130049 Ga0157371_111300492 113
480 3300013105 Ga0157369_11411422 Ga0157369_114114221 113
481 3300013296 Ga0157374_10799193 Ga0157374_107991932 113
482 3300013297 Ga0157378_10186509 Ga0157378_101865091 113
483 3300013306 Ga0163162_10413803 Ga0163162_104138032 113
484 3300013307 Ga0157372_10699909 Ga0157372_106999092 113
485 3300013308 Ga0157375_10500694 Ga0157375_105006941 113
486 3300014325 Ga0163163_10189475 Ga0163163_101894753 113
487 3300014325 Ga0163163_11135515 Ga0163163_111355152 113
488 3300014497 Ga0182008_10297557 Ga0182008_102975571 113
489 3300014497 Ga0182008_10373499 Ga0182008_103734992 113
490 3300014745 Ga0157377_10713388 Ga0157377_107133881 113
491 3300014969 Ga0157376_10178350 Ga0157376_101783502 113
492 3300020069 Ga0197907_10891682 Ga0197907_108916823 113
493 3300020070 Ga0206356_10184226 Ga0206356_101842261 113
494 3300020070 Ga0206356_10445206 Ga0206356_104452063 113
495 3300020070 Ga0206356_11028553 Ga0206356_110285532 113
496 3300020070 Ga0206356_11645676 Ga0206356_116456762 113
497 3300020077 Ga0206351_10395379 Ga0206351_103953792 113
498 3300020078 Ga0206352_10306061 Ga0206352_103060612 113
499 3300020078 Ga0206352_10523430 Ga0206352_105234302 113
500 3300020078 Ga0206352_10681363 Ga0206352_106813632 113
501 3300020081 Ga0206354_11540779 Ga0206354_115407793 113
502 3300025321 Ga0207656_10038352 Ga0207656_100383523 113
503 3300025893 Ga0207682_10135378 Ga0207682_101353782 113
504 3300025900 Ga0207710_10054824 Ga0207710_100548243 113
505 3300025901 Ga0207688_10406618 Ga0207688_104066182 113
506 3300025909 Ga0207705_10201781 Ga0207705_102017812 113
507 3300025910 Ga0207684_10324576 Ga0207684_103245762 113
508 3300025911 Ga0207654_10245715 Ga0207654_102457153 113
509 3300025914 Ga0207671_10208093 Ga0207671_102080932 113
510 3300025914 Ga0207671_11444621 Ga0207671_114446212 113
511 3300025915 Ga0207693_10836526 Ga0207693_108365262 113
512 3300025917 Ga0207660_10405620 Ga0207660_104056203 113
513 3300025918 Ga0207662_10342361 Ga0207662_103423612 113
514 3300025918 Ga0207662_10679978 Ga0207662_106799782 113
515 3300025919 Ga0207657_10373933 Ga0207657_103739331 113
516 3300025920 Ga0207649_10019283 Ga0207649_100192833 113
517 3300025921 Ga0207652_10367554 Ga0207652_103675542 113
518 3300025923 Ga0207681_10109141 Ga0207681_101091413 113
519 3300025924 Ga0207694_10489807 Ga0207694_104898072 113
520 3300025925 Ga0207650_10556329 Ga0207650_105563292 113
521 3300025926 Ga0207659_10071819 Ga0207659_100718193 113
522 3300025926 Ga0207659_11479883 Ga0207659_114798831 113
523 3300025927 Ga0207687_10005904 Ga0207687_100059042 113
524 3300025927 Ga0207687_10049584 Ga0207687_100495843 113
525 3300025928 Ga0207700_10238980 Ga0207700_102389802 113
526 3300025932 Ga0207690_10041486 Ga0207690_100414863 113
527 3300025933 Ga0207706_10103463 Ga0207706_101034632 113
528 3300025935 Ga0207709_10140868 Ga0207709_101408682 113
529 3300025937 Ga0207669_10825359 Ga0207669_108253592 113
530 3300025939 Ga0207665_10119443 Ga0207665_101194432 113
531 3300025940 Ga0207691_10139279 Ga0207691_101392791 113
532 3300025940 Ga0207691_10480228 Ga0207691_104802282 113
533 3300025941 Ga0207711_10079484 Ga0207711_100794843 113
534 3300025942 Ga0207689_10007698 Ga0207689_100076982 113
535 3300025942 Ga0207689_10107564 Ga0207689_101075642 113
536 3300025944 Ga0207661_10138752 Ga0207661_101387522 113
537 3300025944 Ga0207661_10487345 Ga0207661_104873453 113
538 3300025945 Ga0207679_10027761 Ga0207679_100277613 113
539 3300025961 Ga0207712_10062584 Ga0207712_100625843 113
540 3300025961 Ga0207712_10647591 Ga0207712_106475912 113
541 3300025972 Ga0207668_10002695 Ga0207668_1000269510 113
542 3300025972 Ga0207668_10133071 Ga0207668_101330711 113
543 3300025981 Ga0207640_10976507 Ga0207640_109765072 113
544 3300025986 Ga0207658_10361002 Ga0207658_103610022 113
545 3300026023 Ga0207677_10012422 Ga0207677_100124224 113
546 3300026035 Ga0207703_10332913 Ga0207703_103329132 113
547 3300026067 Ga0207678_10031471 Ga0207678_100314712 113
548 3300026067 Ga0207678_10939728 Ga0207678_109397281 113
549 3300026075 Ga0207708_10028322 Ga0207708_100283223 113
550 3300026088 Ga0207641_10007184 Ga0207641_100071846 113
551 3300026089 Ga0207648_10328976 Ga0207648_103289763 113
552 3300026095 Ga0207676_10192216 Ga0207676_101922162 113
553 3300026095 Ga0207676_10433084 Ga0207676_104330841 113
554 3300026095 Ga0207676_10530023 Ga0207676_105300232 113
555 3300026116 Ga0207674_10004069 Ga0207674_1000406910 113
556 3300026118 Ga0207675_101268673 Ga0207675_1012686732 113
557 3300026121 Ga0207683_10074623 Ga0207683_100746232 113
558 3300026121 Ga0207683_10382122 Ga0207683_103821222 113
559 3300027866 Ga0209813_10294289 Ga0209813_102942892 113
560 3300027907 Ga0207428_10035191 Ga0207428_100351913 113
561 3300028379 Ga0268266_10238228 Ga0268266_102382282 113
562 3300028379 Ga0268266_10414557 Ga0268266_104145572 113
563 3300028380 Ga0268265_10094774 Ga0268265_100947743 113
564 3300028381 Ga0268264_10173608 Ga0268264_101736081 113
565 3300030522 Ga0307512_10071268 Ga0307512_100712683 113
566 3300031507 Ga0307509_10018036 Ga0307509_100180368 113
567 3300031507 Ga0307509_10485771 Ga0307509_104857712 113
568 3300031616 Ga0307508_10001033 Ga0307508_1000103314 113
569 3300031616 Ga0307508_10601568 Ga0307508_106015682 113
570 3300031649 Ga0307514_10265715 Ga0307514_102657152 113
571 3300031731 Ga0307405_10028362 Ga0307405_100283623 113
572 3300031731 Ga0307405_10212786 Ga0307405_102127862 113
573 3300031824 Ga0307413_10269399 Ga0307413_102693993 113
574 3300031824 Ga0307413_10340493 Ga0307413_103404931 113
575 3300031824 Ga0307413_11159118 Ga0307413_111591182 113
576 3300031824 Ga0307413_11493271 Ga0307413_114932711 113
577 3300031852 Ga0307410_10585175 Ga0307410_105851751 113
578 3300031901 Ga0307406_10156900 Ga0307406_101569002 113
579 3300031901 Ga0307406_10327321 Ga0307406_103273212 113
580 3300031903 Ga0307407_10789307 Ga0307407_107893072 113
581 3300031995 Ga0307409_100280632 Ga0307409_1002806322 113
582 3300031995 Ga0307409_100587903 Ga0307409_1005879032 113
583 3300031995 Ga0307409_101169721 Ga0307409_1011697212 113
584 3300031995 Ga0307409_101641228 Ga0307409_1016412281 113
585 3300032002 Ga0307416_100462737 Ga0307416_1004627372 113
586 3300032002 Ga0307416_101111190 Ga0307416_1011111902 113
587 3300032002 Ga0307416_103528277 Ga0307416_1035282771 113
588 3300032005 Ga0307411_11023821 Ga0307411_110238211 113
589 3300032126 Ga0307415_100128838 Ga0307415_1001288383 113
590 3300032126 Ga0307415_100186987 Ga0307415_1001869871 113
591 3300032126 Ga0307415_100865144 Ga0307415_1008651442 113
592 3300033179 Ga0307507_10036964 Ga0307507_100369643 113
593 3300034817 Ga0373948_0020911 Ga0373948_0020911_383_763 113
594 3300034957 Ga0373938_0044520 Ga0373938_0044520_56_436 113
595 3300035084 Ga0373928_0103906 Ga0373928_0103906_113_493 113
596 3300035088 Ga0373940_0009036 Ga0373940_0009036_566_946 113
597 3300035112 Ga0373932_0011494 Ga0373932_0011494_913_1293 113
598 3300035114 Ga0373939_0197378 Ga0373939_0197378_214_594 113
599 3300035115 Ga0373941_0059789 Ga0373941_0059789_41_421 113
600 3300035207 Ga0373942_0002690 Ga0373942_0002690_2349_2729 113
601 3300035242 Ga0373962_0080915 Ga0373962_0080915_530_910 113
602 3300035691 Ga0373931_0859209 Ga0373931_0859209_62_442 113
603 3300035692 Ga0373935_0002590 Ga0373935_0002590_1982_2362 113
604 3300035725 Ga0373947_0339306 Ga0373947_0339306_576_956 113
605 3300036401 Ga0373937_1197649 Ga0373937_1197649_311_688 113
606 3300041446 Ga0451794_30919 Ga0451794_30919_19_399 113
607 3300041452 Ga0451793_1415064 Ga0451793_1415064_386_763 113
608 3300041455 Ga0451801_32288 Ga0451801_32288_167_556 113
609 3300041461 Ga0451805_030692 Ga0451805_030692_315_704 113
610 3300041486 Ga0451807_0946012 Ga0451807_0946012_181_561 113
611 3300041502 Ga0451846_49640 Ga0451846_49640_19_408 113
612 3300044693 Ga0466961_0183679 Ga0466961_0183679_238_618 113
613 3300044694 Ga0466963_1258665 Ga0466963_1258665_121_501 113
614 3300044719 Ga0466971_0310346 Ga0466971_0310346_186_566 113
615 3300044842 Ga0466957_0079358 Ga0466957_0079358_920_1297 113
616 3300044901 Ga0466960_0412244 Ga0466960_0412244_240_620 113
617 3300044901 Ga0466960_0584332 Ga0466960_0584332_89_469 113
618 3300045836 Ga0466958_0817147 Ga0466958_0817147_91_471 113
619 3300045976 Ga0466967_0519673 Ga0466967_0519673_275_655 113
620 3300046459 Ga0495629_0030517 Ga0495629_0030517_2565_2945 113
621 3300046459 Ga0495629_0056195 Ga0495629_0056195_619_999 113
622 3300046499 Ga0495594_0096546 Ga0495594_0096546_290_670 113
623 3300046499 Ga0495594_0101277 Ga0495594_0101277_664_1041 113
624 3300046519 Ga0495632_0145463 Ga0495632_0145463_611_991 113
625 3300047315 Ga0495581_0492374 Ga0495581_0492374_234_614 113
626 3300048907 Ga0496104_0070355 Ga0496104_0070355_971_1351 113
627 3300048908 Ga0496105_0090253 Ga0496105_0090253_1301_1681 113
628 3300048909 Ga0496106_1470990 Ga0496106_1470990_94_474 113
629 3300048911 Ga0496108_0000019 Ga0496108_0000019_165823_166203 113
630 3300048911 Ga0496108_1473386 Ga0496108_1473386_123_503 113
631 3300048912 Ga0496109_0317178 Ga0496109_0317178_194_574 113
632 3300048912 Ga0496109_1659842 Ga0496109_1659842_75_455 113
633 3300048913 Ga0496110_1175428 Ga0496110_1175428_178_558 113
634 3300048913 Ga0496110_1531537 Ga0496110_1531537_92_466 113
635 3300048915 Ga0496112_0022573 Ga0496112_0022573_1765_2145 113
636 3300048915 Ga0496112_1372715 Ga0496112_1372715_49_426 113
637 3300048916 Ga0496113_1231647 Ga0496113_1231647_65_445 113
638 3300048929 Ga0496126_0440165 Ga0496126_0440165_488_868 113
639 3300049578 Ga0501042_0308814 Ga0501042_0308814_556_936 113
640 3300050495 nmdc:mga04h51_328745_c1 nmdc:mga04h51_328745_c1_150_527 113
641 3300050507 nmdc:mga05p37_1691_c1 nmdc:mga05p37_1691_c1_21572_21946 113
642 3300050507 nmdc:mga05p37_40243_c1 nmdc:mga05p37_40243_c1_2288_2665 113
643 3300050507 nmdc:mga05p37_411685_c1 nmdc:mga05p37_411685_c1_871_1248 113
644 3300050508 nmdc:mga09592_4861_c1 nmdc:mga09592_4861_c1_6039_6416 113
645 3300050509 nmdc:mga0qj67_1336030_c1 nmdc:mga0qj67_1336030_c1_84_461 113
646 3300050509 nmdc:mga0qj67_41028_c1 nmdc:mga0qj67_41028_c1_2824_3201 113
647 3300050510 nmdc:mga06r32_488104_c1 nmdc:mga06r32_488104_c1_421_795 113
648 3300050510 nmdc:mga06r32_76305_c1 nmdc:mga06r32_76305_c1_1641_2018 113
649 3300050510 nmdc:mga06r32_9713_c1 nmdc:mga06r32_9713_c1_8022_8402 113
650 3300050512 nmdc:mga0n895_604776_c1 nmdc:mga0n895_604776_c1_496_873 113
651 3300050515 nmdc:mga0a205_520500_c1 nmdc:mga0a205_520500_c1_404_781 113
652 3300050515 nmdc:mga0a205_768639_c1 nmdc:mga0a205_768639_c1_83_460 113
653 3300053086 Ga0500578_0662702 Ga0500578_0662702_109_489 113
654 3300053092 Ga0500583_0354667 Ga0500583_0354667_313_693 113
655 3300053093 Ga0500651_0250974 Ga0500651_0250974_510_890 113
656 3300053104 Ga0500556_0240722 Ga0500556_0240722_22_402 113
657 3300053111 Ga0500572_202517 Ga0500572_202517_190_570 113
658 3300053142 Ga0500577_0230233 Ga0500577_0230233_94_474 113
659 3300053159 Ga0500630_187723 Ga0500630_187723_94_474 113
660 3300059490 Ga0587066_067363 Ga0587066_067363_142_522 113
661 3300059491 Ga0587070_051968 Ga0587070_051968_243_623 113
662 3300059504 Ga0587082_011845 Ga0587082_011845_686_1066 113
663 3300059623 Ga0587101_072204 Ga0587101_072204_13_393 113
664 3300059639 Ga0587062_031890 Ga0587062_031890_82_462 113
665 3300059646 Ga0587078_083471 Ga0587078_083471_13_393 113
666 3300059647 Ga0587079_017185 Ga0587079_017185_40_420 113
667 3300059647 Ga0587079_032566 Ga0587079_032566_18_401 113
668 3300059658 Ga0587119_014324 Ga0587119_014324_293_673 113
669 3300060344 Ga0587071_085581 Ga0587071_085581_46_429 113
670 iso_pu_bacteria 8054704163 8054708180 113
671 3300003659 JGI25404J52841_10051272 JGI25404J52841_100512722 114
672 3300004799 Ga0058863_10043464 Ga0058863_100434642 114
673 3300004800 Ga0058861_12062396 Ga0058861_120623963 114
674 3300004803 Ga0058862_10032891 Ga0058862_100328912 114
675 3300005327 Ga0070658_10057542 Ga0070658_100575423 114
676 3300005329 Ga0070683_100119646 Ga0070683_1001196463 114
677 3300005334 Ga0068869_100117816 Ga0068869_1001178162 114
678 3300005336 Ga0070680_100070645 Ga0070680_1000706453 114
679 3300005337 Ga0070682_100087308 Ga0070682_1000873083 114
680 3300005339 Ga0070660_100061410 Ga0070660_1000614103 114
681 3300005344 Ga0070661_100229387 Ga0070661_1002293872 114
682 3300005345 Ga0070692_10002983 Ga0070692_100029832 114
683 3300005347 Ga0070668_100022741 Ga0070668_1000227412 114
684 3300005366 Ga0070659_100391499 Ga0070659_1003914992 114
685 3300005435 Ga0070714_100146372 Ga0070714_1001463724 114
686 3300005436 Ga0070713_100266695 Ga0070713_1002666952 114
687 3300005441 Ga0070700_100034264 Ga0070700_1000342643 114
688 3300005455 Ga0070663_100015500 Ga0070663_1000155003 114
689 3300005458 Ga0070681_10084464 Ga0070681_100844643 114
690 3300005458 Ga0070681_10744943 Ga0070681_107449432 114
691 3300005468 Ga0070707_101038696 Ga0070707_1010386962 114
692 3300005530 Ga0070679_100280689 Ga0070679_1002806892 114
693 3300005535 Ga0070684_100028161 Ga0070684_1000281613 114
694 3300005564 Ga0070664_100373939 Ga0070664_1003739392 114
695 3300005577 Ga0068857_100306850 Ga0068857_1003068503 114
696 3300005577 Ga0068857_100514229 Ga0068857_1005142291 114
697 3300005578 Ga0068854_100619828 Ga0068854_1006198281 114
698 3300005614 Ga0068856_100490313 Ga0068856_1004903132 114
699 3300005614 Ga0068856_100582038 Ga0068856_1005820381 114
700 3300005616 Ga0068852_101259875 Ga0068852_1012598752 114
701 3300005618 Ga0068864_100502654 Ga0068864_1005026542 114
702 3300005718 Ga0068866_10295739 Ga0068866_102957392 114
703 3300005719 Ga0068861_100267902 Ga0068861_1002679022 114
704 3300005843 Ga0068860_100593481 Ga0068860_1005934812 114
705 3300005844 Ga0068862_100258938 Ga0068862_1002589382 114
706 3300005983 Ga0081540_1004328 Ga0081540_10043287 114
707 3300005983 Ga0081540_1079648 Ga0081540_10796483 114
708 3300006173 Ga0070716_100505932 Ga0070716_1005059322 114
709 3300006175 Ga0070712_101396244 Ga0070712_1013962441 114
710 3300006358 Ga0068871_100910378 Ga0068871_1009103782 114
711 3300006846 Ga0075430_100023905 Ga0075430_1000239055 114
712 3300006846 Ga0075430_100573517 Ga0075430_1005735171 114
713 3300006847 Ga0075431_100034622 Ga0075431_1000346225 114
714 3300006847 Ga0075431_100668531 Ga0075431_1006685312 114
715 3300006880 Ga0075429_100010682 Ga0075429_1000106823 114
716 3300009094 Ga0111539_10000420 Ga0111539_1000042046 114
717 3300009098 Ga0105245_10001054 Ga0105245_100010543 114
718 3300009101 Ga0105247_11199179 Ga0105247_111991791 114
719 3300009147 Ga0114129_10000001 Ga0114129_10000001213 114
720 3300009148 Ga0105243_10209725 Ga0105243_102097252 114
721 3300009174 Ga0105241_10281781 Ga0105241_102817813 114
722 3300009545 Ga0105237_10349594 Ga0105237_103495942 114
723 3300009553 Ga0105249_10064284 Ga0105249_100642843 114
724 3300013052 Ga0154014_111627 Ga0154014_1116271 114
725 3300013102 Ga0157371_10693643 Ga0157371_106936432 114
726 3300013104 Ga0157370_10105609 Ga0157370_101056092 114
727 3300013105 Ga0157369_10315884 Ga0157369_103158843 114
728 3300013296 Ga0157374_10482842 Ga0157374_104828422 114
729 3300013306 Ga0163162_10222729 Ga0163162_102227293 114
730 3300013307 Ga0157372_10423042 Ga0157372_104230423 114
731 3300013308 Ga0157375_13204886 Ga0157375_132048862 114
732 3300014325 Ga0163163_10167476 Ga0163163_101674764 114
733 3300014745 Ga0157377_10004597 Ga0157377_100045972 114
734 3300017792 Ga0163161_10495591 Ga0163161_104955911 114
735 3300020069 Ga0197907_10379184 Ga0197907_103791842 114
736 3300020069 Ga0197907_10658708 Ga0197907_106587083 114
737 3300020070 Ga0206356_10193519 Ga0206356_101935195 114
738 3300020075 Ga0206349_1106262 Ga0206349_11062623 114
739 3300020076 Ga0206355_1173917 Ga0206355_11739171 114
740 3300020077 Ga0206351_10442925 Ga0206351_104429253 114
741 3300020078 Ga0206352_10317914 Ga0206352_103179143 114
742 3300020080 Ga0206350_10138868 Ga0206350_101388683 114
743 3300020081 Ga0206354_10309334 Ga0206354_103093341 114
744 3300020081 Ga0206354_10790976 Ga0206354_107909762 114
745 3300020082 Ga0206353_10000897 Ga0206353_100008972 114
746 3300020082 Ga0206353_11941442 Ga0206353_119414423 114
747 3300022467 Ga0224712_10009696 Ga0224712_100096963 114
748 3300022467 Ga0224712_10029395 Ga0224712_100293952 114
749 3300022467 Ga0224712_10213763 Ga0224712_102137632 114
750 3300025899 Ga0207642_10975051 Ga0207642_109750512 114
751 3300025901 Ga0207688_10641425 Ga0207688_106414252 114
752 3300025906 Ga0207699_10263491 Ga0207699_102634912 114
753 3300025908 Ga0207643_10529355 Ga0207643_105293552 114
754 3300025909 Ga0207705_10096461 Ga0207705_100964612 114
755 3300025909 Ga0207705_10819910 Ga0207705_108199102 114
756 3300025909 Ga0207705_10863602 Ga0207705_108636021 114
757 3300025912 Ga0207707_10282952 Ga0207707_102829522 114
758 3300025912 Ga0207707_10575654 Ga0207707_105756541 114
759 3300025917 Ga0207660_10270825 Ga0207660_102708251 114
760 3300025918 Ga0207662_10156312 Ga0207662_101563122 114
761 3300025919 Ga0207657_10043531 Ga0207657_100435313 114
762 3300025919 Ga0207657_10230689 Ga0207657_102306892 114
763 3300025920 Ga0207649_10090026 Ga0207649_100900262 114
764 3300025921 Ga0207652_10215544 Ga0207652_102155443 114
765 3300025924 Ga0207694_10265261 Ga0207694_102652613 114
766 3300025925 Ga0207650_10414713 Ga0207650_104147132 114
767 3300025928 Ga0207700_10024274 Ga0207700_100242743 114
768 3300025929 Ga0207664_10121965 Ga0207664_101219652 114
769 3300025932 Ga0207690_10246257 Ga0207690_102462572 114
770 3300025935 Ga0207709_11869913 Ga0207709_118699131 114
771 3300025939 Ga0207665_10518277 Ga0207665_105182771 114
772 3300025941 Ga0207711_10958595 Ga0207711_109585951 114
773 3300025944 Ga0207661_10066024 Ga0207661_100660243 114
774 3300025944 Ga0207661_10440763 Ga0207661_104407633 114
775 3300025944 Ga0207661_10664547 Ga0207661_106645472 114
776 3300025945 Ga0207679_10222785 Ga0207679_102227852 114
777 3300025949 Ga0207667_10209048 Ga0207667_102090483 114
778 3300025986 Ga0207658_10173886 Ga0207658_101738862 114
779 3300026041 Ga0207639_10504187 Ga0207639_105041872 114
780 3300026067 Ga0207678_10502440 Ga0207678_105024402 114
781 3300026067 Ga0207678_11674474 Ga0207678_116744742 114
782 3300026078 Ga0207702_10316852 Ga0207702_103168522 114
783 3300026078 Ga0207702_10692305 Ga0207702_106923051 114
784 3300026088 Ga0207641_11287326 Ga0207641_112873262 114
785 3300026089 Ga0207648_11010857 Ga0207648_110108571 114
786 3300026095 Ga0207676_11940952 Ga0207676_119409521 114
787 3300026116 Ga0207674_10082509 Ga0207674_100825092 114
788 3300026116 Ga0207674_10084146 Ga0207674_100841463 114
789 3300026116 Ga0207674_12187768 Ga0207674_121877681 114
790 3300026118 Ga0207675_100510410 Ga0207675_1005104102 114
791 3300026142 Ga0207698_10933798 Ga0207698_109337982 114
792 3300028379 Ga0268266_12002855 Ga0268266_120028551 114
793 3300028380 Ga0268265_11476194 Ga0268265_114761941 114
794 3300030522 Ga0307512_10224937 Ga0307512_102249372 114
795 3300031730 Ga0307516_10011094 Ga0307516_100110945 114
796 3300031852 Ga0307410_10237645 Ga0307410_102376452 114
797 3300031901 Ga0307406_10180017 Ga0307406_101800173 114
798 3300031901 Ga0307406_10828271 Ga0307406_108282712 114
799 3300031903 Ga0307407_10371117 Ga0307407_103711171 114
800 3300032002 Ga0307416_100019576 Ga0307416_1000195763 114
801 3300032126 Ga0307415_100012069 Ga0307415_1000120693 114
802 3300032126 Ga0307415_100940233 Ga0307415_1009402331 114
803 3300035118 Ga0373954_0374955 Ga0373954_0374955_45_425 114
804 3300037312 Ga0395899_0063911 Ga0395899_0063911_429_806 114
805 3300037418 Ga0395900_0016074 Ga0395900_0016074_978_1355 114
806 3300037466 Ga0395898_0022252 Ga0395898_0022252_3965_4342 114
807 3300037471 Ga0395905_0014625 Ga0395905_0014625_714_1091 114
808 3300038443 Ga0395901_0076026 Ga0395901_0076026_2901_3278 114
809 3300041505 Ga0451849_0766240 Ga0451849_0766240_39_440 114
810 3300048912 Ga0496109_0207436 Ga0496109_0207436_799_1179 114
811 3300048913 Ga0496110_0112143 Ga0496110_0112143_528_908 114
812 3300048915 Ga0496112_0151229 Ga0496112_0151229_1732_2112 114
813 3300048915 Ga0496112_1482616 Ga0496112_1482616_121_498 114
814 3300049571 Ga0501034_0799023 Ga0501034_0799023_191_580 114
815 3300049578 Ga0501042_0567859 Ga0501042_0567859_310_687 114
816 3300049581 Ga0501047_0016507 Ga0501047_0016507_1642_2031 114
817 3300049586 Ga0501070_0920343 Ga0501070_0920343_128_532 114
818 3300049588 Ga0501072_0955182 Ga0501072_0955182_272_649 114
819 3300049823 Ga0501044_0488760 Ga0501044_0488760_449_838 114
820 3300050507 nmdc:mga05p37_1688_c1 nmdc:mga05p37_1688_c1_1754_2134 114
821 3300050508 nmdc:mga09592_1659749_c1 nmdc:mga09592_1659749_c1_110_499 114
822 3300050508 nmdc:mga09592_16_c1 nmdc:mga09592_16_c1_59609_59989 114
823 3300050509 nmdc:mga0qj67_16_c1 nmdc:mga0qj67_16_c1_37530_37910 114
824 3300050509 nmdc:mga0qj67_284878_c1 nmdc:mga0qj67_284878_c1_62_439 114
825 3300050510 nmdc:mga06r32_282398_c1 nmdc:mga06r32_282398_c1_227_640 114
826 3300050510 nmdc:mga06r32_8377_c1 nmdc:mga06r32_8377_c1_1754_2134 114
827 3300050511 nmdc:mga08y16_49925_c1 nmdc:mga08y16_49925_c1_2172_2561 114
828 3300054114 Ga0501084_0567636 Ga0501084_0567636_161_538 114
829 3300059477 Ga0587084_050447 Ga0587084_050447_96_482 114
830 3300059490 Ga0587066_030403 Ga0587066_030403_399_785 114
831 3300059491 Ga0587070_081296 Ga0587070_081296_310_693 114
832 3300059492 Ga0587073_0021409 Ga0587073_0021409_34_420 114
833 3300059492 Ga0587073_0101606 Ga0587073_0101606_239_625 114
834 3300059492 Ga0587073_0144664 Ga0587073_0144664_261_647 114
835 3300059493 Ga0587077_020100 Ga0587077_020100_54_440 114
836 3300059503 Ga0587080_125620 Ga0587080_125620_142_528 114
837 3300059503 Ga0587080_146411 Ga0587080_146411_113_499 114
838 3300059506 Ga0587085_075902 Ga0587085_075902_55_441 114
839 3300059508 Ga0587088_180706 Ga0587088_180706_127_513 114
840 3300059510 Ga0587090_025468 Ga0587090_025468_71_457 114
841 3300059511 Ga0587091_042826 Ga0587091_042826_224_610 114
842 3300059511 Ga0587091_043199 Ga0587091_043199_428_814 114
843 3300059511 Ga0587091_067582 Ga0587091_067582_117_503 114
844 3300059512 Ga0587092_016692 Ga0587092_016692_114_500 114
845 3300059513 Ga0587094_074948 Ga0587094_074948_65_451 114
846 3300059514 Ga0587095_006376 Ga0587095_006376_209_595 114
847 3300059604 Ga0587098_011221 Ga0587098_011221_589_975 114
848 3300059605 Ga0587106_117151 Ga0587106_117151_40_426 114
849 3300059622 Ga0587099_031593 Ga0587099_031593_11_397 114
850 3300059623 Ga0587101_105222 Ga0587101_105222_110_496 114
851 3300059624 Ga0587109_030617 Ga0587109_030617_41_427 114
852 3300059624 Ga0587109_112954 Ga0587109_112954_234_620 114
853 3300059626 Ga0587115_067144 Ga0587115_067144_19_405 114
854 3300059628 Ga0587122_021766 Ga0587122_021766_21_407 114
855 3300059630 Ga0587128_034035 Ga0587128_034035_390_773 114
856 3300059640 Ga0587067_060627 Ga0587067_060627_196_582 114
857 3300059641 Ga0587068_014219 Ga0587068_014219_644_1030 114
858 3300059641 Ga0587068_070861 Ga0587068_070861_60_446 114
859 3300059641 Ga0587068_104250 Ga0587068_104250_11_397 114
860 3300059642 Ga0587069_034524 Ga0587069_034524_211_597 114
861 3300059644 Ga0587075_055076 Ga0587075_055076_287_673 114
862 3300059645 Ga0587076_085504 Ga0587076_085504_142_525 114
863 3300059645 Ga0587076_102468 Ga0587076_102468_166_552 114
864 3300059645 Ga0587076_207121 Ga0587076_207121_106_492 114
865 3300059646 Ga0587078_005950 Ga0587078_005950_690_1076 114
866 3300059646 Ga0587078_013535 Ga0587078_013535_476_862 114
867 3300059647 Ga0587079_028568 Ga0587079_028568_438_824 114
868 3300059647 Ga0587079_075914 Ga0587079_075914_255_641 114
869 3300059649 Ga0587102_032570 Ga0587102_032570_189_575 114
870 3300059659 Ga0587120_015232 Ga0587120_015232_290_676 114
871 3300060344 Ga0587071_070966 Ga0587071_070966_343_729 114
872 3300060344 Ga0587071_221704 Ga0587071_221704_15_401 114
873 3300060346 Ga0587111_0104753 Ga0587111_0104753_274_660 114
874 iso_pu_bacteria 2831935698 2831940430 114
875 iso_pu_bacteria 2832004796 2832007796 114
876 iso_pu_bacteria 2855670206 2855672318 114
877 iso_pu_bacteria 2855676851 2855681302 114
878 iso_pu_bacteria 2855683550 2855684220 114
879 iso_pu_bacteria 2857288857 2857292678 114
880 iso_pu_bacteria 2858848962 2858849795 114
881 iso_pu_bacteria 2858868258 2858873354 114
882 iso_pu_bacteria 2858888857 2858890666 114
883 iso_pu_bacteria 2866065130 2866066973 114
884 iso_pu_bacteria 2867302475 2867303914 114
885 iso_pu_bacteria 2869048445 2869054796 114
886 iso_pu_bacteria 2869061728 2869064082 114
887 iso_pu_bacteria 2869068681 2869072897 114
888 iso_pu_bacteria 2880495981 2880498667 114
889 iso_pu_bacteria 8054727385 8054730899 114
890 3300003203 JGI25406J46586_10012362 JGI25406J46586_100123623 115
891 3300005985 Ga0081539_10000320 Ga0081539_100003208 115
892 3300006880 Ga0075429_100004467 Ga0075429_1000044674 115
893 3300009147 Ga0114129_10143303 Ga0114129_101433033 115
894 3300020080 Ga0206350_11582926 Ga0206350_115829261 115
895 3300025906 Ga0207699_10660478 Ga0207699_106604782 115
896 3300031456 Ga0307513_10038166 Ga0307513_100381663 115
897 3300041459 Ga0451800_0243129 Ga0451800_0243129_66_473 115
898 3300049592 Ga0501076_0430563 Ga0501076_0430563_356_739 115
899 3300050507 nmdc:mga05p37_25686_c1 nmdc:mga05p37_25686_c1_4892_5293 115
900 3300050508 nmdc:mga09592_177379_c1 nmdc:mga09592_177379_c1_192_593 115
901 3300050510 nmdc:mga06r32_659315_c1 nmdc:mga06r32_659315_c1_255_656 115
902 3300059652 Ga0587107_108992 Ga0587107_108992_143_526 115
903 iso_pu_bacteria 2501939600 2501942706 115
904 iso_pu_bacteria 2515154129 2515720701 115
905 iso_pu_bacteria 2867312974 2867313246 115
906 iso_pu_bacteria 8003870546 8003877872 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05331

DUF742

Protein of unknown function (DUF742)

30

149

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsu-assembly1.cif.gz_C c-terminal domain of elongation factor selb complexed with secis rna 0.8936 40 81
3gw2-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e. 0.8703 43 92
8p2k-assembly1.cif.gz_Ay ternary complex of translating ribosome, nac and metap1 0.8692 58 92
8t4s-assembly1.cif.gz_Z mers-cov nsp1 protein bound to the human 40s ribosomal subunit 0.8685 58 92
6ybs-assembly1.cif.gz_e structure of a human 48s translational initiation complex - head 0.866 58 92
ID Description Score Start End Superfamily
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9878 54 88 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9214 39 89 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9169 54 90 1.10.10.10
af_A0A0R4ITX8_1_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9059 47 91 1.10.10.10
af_Q4CSX0_1_108_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8959 40 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4U3B8G2-F1-model_v4 deleted 0.8844 43 92
AF-A0A662H0B2-F1-model_v4 Uncharacterized protein 0.8781 40 92
AF-A0A1Y6FX96-F1-model_v4 Regulatory protein, arsR family 0.8693 43 92 GO:0003677
GO:0003700
AF-A0A0P8A5Y4-F1-model_v4 Transcriptional regulator, ArsR family 0.864 43 89 GO:0003700
AF-A0A662QGB9-F1-model_v4 deleted 0.8557 43 91

Feature Viewer

pLDDT pTM Quality
73.75 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map