F485096

General Info

Members Datasets Scaffolds Average Seq Length
899 462 1798 88

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_101435914|Ga0068858_1014359142
Length 107
Sequence MAHKKGQGSSRNGRDSNPQYLGVKRYGGQTVTGGSIIVRQRGTRFFPGLNVGQGKDDTLFAKIGGVVKFQDRGRHGKYVHILPAEAAAASVAPDASTPSATASESAS

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
6 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
7 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
8 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
9 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
10 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
11 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
12 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
13 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
14 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
15 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
16 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
259 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
260 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
261 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
262 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
263 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
264 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
265 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
270 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
271 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
272 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
273 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
277 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
278 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
279 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
280 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
281 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
282 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
283 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
284 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
285 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
286 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
287 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
288 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
289 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
292 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
298 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
343 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
344 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
345 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
346 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
347 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
348 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
349 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
350 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
351 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
352 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
353 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
354 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
355 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
384 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
385 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
386 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
387 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
388 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
389 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
390 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
391 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
392 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
393 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
394 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
395 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
396 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
397 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
398 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
399 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
400 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
401 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
402 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
403 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
404 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
405 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
406 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
407 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
408 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
409 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
410 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
411 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
412 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
413 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
414 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
415 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
416 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
417 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
418 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
419 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
420 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
421 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
422 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
423 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
424 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
425 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
426 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
427 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
428 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
429 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
430 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
431 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
432 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
433 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
434 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
435 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
436 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
437 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
438 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
441 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
455 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
456 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
457 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
458 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
462 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_101435914 3300005842 Bacteria 680
2 SwRhRL2b_contig_1087855 2162886007 Bacteria 1484
3 2214806902 2209111006 Unclassified 694
4 JGI24742J22300_10077764 3300002244 Bacteria 625
5 JGI26128J50194_1005255 3300003347 Bacteria 851
6 JGI26129J50193_1011093 3300003349 Bacteria 658
7 JGI26145J50221_1000071 3300003371 Bacteria 7664
8 JGI26142J50222_102611 3300003379 Bacteria 529
9 JGI26140J50224_101891 3300003383 Bacteria 752
10 JGI26134J50242_101155 3300003392 Bacteria 862
11 JGI26133J50247_102041 3300003397 Bacteria 656
12 JGI26130J50248_102899 3300003398 Bacteria 529
13 JGI26132J50249_103969 3300003405 Bacteria 546
14 JGI26143J51219_1006949 3300003502 Bacteria 585
15 JGI26141J51220_1002671 3300003503 Bacteria 1089
16 JGI26138J51218_102793 3300003504 Bacteria 729
17 Ga0058860_11408664 3300004801 Bacteria 600
18 Ga0058860_11878411 3300004801 Unclassified 513
19 Ga0065704_10005524 3300005289 Bacteria 3904
20 Ga0065704_10287312 3300005289 Bacteria 910
21 Ga0065712_10202387 3300005290 Bacteria 1103
22 Ga0065715_10024978 3300005293 Bacteria 1494
23 Ga0065715_10466356 3300005293 Bacteria 811
24 Ga0065715_10703734 3300005293 Bacteria 651
25 Ga0065707_10083722 3300005295 Bacteria 8385
26 Ga0065707_10112291 3300005295 Bacteria 2366
27 Ga0065707_10499672 3300005295 Bacteria 758
28 Ga0070658_10025278 3300005327 Bacteria 4761
29 Ga0070658_10036820 3300005327 Bacteria 3944
30 Ga0070676_10002110 3300005328 Bacteria 10124
31 Ga0070676_10811513 3300005328 Bacteria 691
32 Ga0070683_101520820 3300005329 Bacteria 643
33 Ga0070690_100000128 3300005330 Bacteria 39293
34 Ga0070690_100006058 3300005330 Bacteria 6841
35 Ga0070690_100163496 3300005330 Bacteria 1527
36 Ga0070670_100073412 3300005331 Bacteria 2938
37 Ga0070670_100399030 3300005331 Bacteria 1214
38 Ga0070677_10010132 3300005333 Bacteria 3215
39 Ga0068869_100399586 3300005334 Bacteria 1130
40 Ga0068869_101641377 3300005334 Bacteria 573
41 Ga0070666_10018395 3300005335 Bacteria 4492
42 Ga0070666_10166291 3300005335 Bacteria 1543
43 Ga0070666_10529419 3300005335 Bacteria 856
44 Ga0070666_10665729 3300005335 Bacteria 762
45 Ga0070680_100031316 3300005336 Bacteria 4276
46 Ga0070680_100063420 3300005336 Bacteria 3027
47 Ga0070680_100063732 3300005336 Bacteria 3020
48 Ga0070680_100340015 3300005336 Bacteria 1275
49 Ga0070680_100995570 3300005336 Bacteria 724
50 Ga0070682_100225353 3300005337 Bacteria 1337
51 Ga0070682_100291316 3300005337 Bacteria 1194
52 Ga0070682_101474018 3300005337 Bacteria 584
53 Ga0068868_100077174 3300005338 Bacteria 2665
54 Ga0068868_100175469 3300005338 Bacteria 1776
55 Ga0068868_100439819 3300005338 Bacteria 1132
56 Ga0070660_100001287 3300005339 Bacteria 17103
57 Ga0070660_100085519 3300005339 Bacteria 2481
58 Ga0070660_100850866 3300005339 Bacteria 768
59 Ga0070689_100001472 3300005340 Bacteria 15018
60 Ga0070689_100024154 3300005340 Bacteria 4558
61 Ga0070689_100077278 3300005340 Bacteria 2609
62 Ga0070691_10001906 3300005341 Bacteria 9146
63 Ga0070691_10192469 3300005341 Bacteria 1068
64 Ga0070687_100000578 3300005343 Bacteria 12195
65 Ga0070687_100006792 3300005343 Bacteria 4719
66 Ga0070687_100154346 3300005343 Bacteria 1351
67 Ga0070687_100567546 3300005343 Bacteria 775
68 Ga0070661_100002446 3300005344 Bacteria 12743
69 Ga0070661_100031260 3300005344 Bacteria 3848
70 Ga0070692_10003356 3300005345 Bacteria 6481
71 Ga0070692_11090787 3300005345 Unclassified 563
72 Ga0070668_100012055 3300005347 Bacteria 6439
73 Ga0070669_100036233 3300005353 Bacteria 3574
74 Ga0070669_101072058 3300005353 Bacteria 693
75 Ga0070675_100233695 3300005354 Bacteria 1604
76 Ga0070675_100857891 3300005354 Bacteria 831
77 Ga0070675_101107484 3300005354 Bacteria 728
78 Ga0070671_100069717 3300005355 Bacteria 2933
79 Ga0070671_100402037 3300005355 Bacteria 1172
80 Ga0070674_100000651 3300005356 Bacteria 17493
81 Ga0070674_100013481 3300005356 Bacteria 5054
82 Ga0070674_100525895 3300005356 Bacteria 989
83 Ga0070673_100002548 3300005364 Bacteria 11116
84 Ga0070673_100086154 3300005364 Bacteria 2559
85 Ga0070673_100098879 3300005364 Bacteria 2399
86 Ga0070673_100882084 3300005364 Bacteria 829
87 Ga0070688_100000009 3300005365 Bacteria 85664
88 Ga0070688_100005771 3300005365 Bacteria 6544
89 Ga0070688_100023921 3300005365 Bacteria 3598
90 Ga0070659_100000429 3300005366 Bacteria 31798
91 Ga0070659_100991417 3300005366 Bacteria 737
92 Ga0070667_100032702 3300005367 Bacteria 4339
93 Ga0070667_100471054 3300005367 Bacteria 1149
94 Ga0070703_10115596 3300005406 Bacteria 966
95 Ga0070710_10468495 3300005437 Bacteria 857
96 Ga0070701_10001023 3300005438 Bacteria 10183
97 Ga0070701_10021474 3300005438 Bacteria 3082
98 Ga0070701_10101264 3300005438 Bacteria 1596
99 Ga0070701_10229959 3300005438 Bacteria 1110
100 Ga0070711_101507912 3300005439 Bacteria 587
101 Ga0070705_100003543 3300005440 Bacteria 7645
102 Ga0070705_100055568 3300005440 Bacteria 2327
103 Ga0070705_100260353 3300005440 Bacteria 1223
104 Ga0070705_100785023 3300005440 Bacteria 756
105 Ga0070700_100003185 3300005441 Bacteria 8430
106 Ga0070700_100012179 3300005441 Bacteria 4790
107 Ga0070700_100128047 3300005441 Bacteria 1710
108 Ga0070694_100050947 3300005444 Bacteria 2793
109 Ga0070694_100103928 3300005444 Bacteria 2013
110 Ga0070694_100354468 3300005444 Bacteria 1137
111 Ga0070694_100555906 3300005444 Bacteria 919
112 Ga0070694_100823890 3300005444 Bacteria 762
113 Ga0070708_100032477 3300005445 Bacteria 4529
114 Ga0070708_100150707 3300005445 Bacteria 2162
115 Ga0070708_100182048 3300005445 Bacteria 1964
116 Ga0070708_100189665 3300005445 Bacteria 1922
117 Ga0070708_100902761 3300005445 Bacteria 829
118 Ga0070708_101717164 3300005445 Bacteria 583
119 Ga0070663_100057877 3300005455 Bacteria 2782
120 Ga0070678_100227761 3300005456 Bacteria 1552
121 Ga0070678_101601551 3300005456 Bacteria 611
122 Ga0070662_100000333 3300005457 Bacteria 28293
123 Ga0070662_100869771 3300005457 Bacteria 768
124 Ga0070662_100937181 3300005457 Bacteria 740
125 Ga0070681_10014971 3300005458 Bacteria 7712
126 Ga0070681_10117118 3300005458 Bacteria 2600
127 Ga0068867_100000209 3300005459 Bacteria 39235
128 Ga0068867_100008954 3300005459 Bacteria 7062
129 Ga0068867_100084748 3300005459 Bacteria 2395
130 Ga0068867_102360266 3300005459 Bacteria 506
131 Ga0070685_10000197 3300005466 Bacteria 40603
132 Ga0070685_10024398 3300005466 Bacteria 3321
133 Ga0070706_100006062 3300005467 Bacteria 11427
134 Ga0070706_100022282 3300005467 Bacteria 5832
135 Ga0070706_100071009 3300005467 Bacteria 3220
136 Ga0070706_100160000 3300005467 Bacteria 2102
137 Ga0070706_100241449 3300005467 Bacteria 1687
138 Ga0070707_100000009 3300005468 Bacteria 166193
139 Ga0070707_100000546 3300005468 Bacteria 37594
140 Ga0070707_100013734 3300005468 Bacteria 7583
141 Ga0070707_100045910 3300005468 Bacteria 4180
142 Ga0070707_100160664 3300005468 Bacteria 2189
143 Ga0070698_100022782 3300005471 Bacteria 6550
144 Ga0070698_100065483 3300005471 Bacteria 3659
145 Ga0070698_100108921 3300005471 Bacteria 2737
146 Ga0070698_100321535 3300005471 Bacteria 1478
147 Ga0070698_100338737 3300005471 Bacteria 1435
148 Ga0070698_101297737 3300005471 Bacteria 678
149 Ga0070699_100012688 3300005518 Bacteria 7267
150 Ga0070699_100038839 3300005518 Bacteria 4121
151 Ga0070699_100046180 3300005518 Bacteria 3769
152 Ga0070699_100057826 3300005518 Bacteria 3358
153 Ga0070699_100060393 3300005518 Bacteria 3285
154 Ga0070699_100130500 3300005518 Bacteria 2215
155 Ga0070699_100297150 3300005518 Unclassified 1449
156 Ga0070679_100039709 3300005530 Bacteria 4678
157 Ga0070679_100238006 3300005530 Bacteria 1779
158 Ga0070684_100060682 3300005535 Bacteria 3309
159 Ga0070684_100172658 3300005535 Bacteria 1964
160 Ga0070684_101287682 3300005535 Bacteria 688
161 Ga0070697_100028140 3300005536 Bacteria 4499
162 Ga0070697_100039781 3300005536 Bacteria 3803
163 Ga0070697_100040563 3300005536 Bacteria 3767
164 Ga0070697_100052026 3300005536 Bacteria 3329
165 Ga0070697_100099320 3300005536 Bacteria 2416
166 Ga0070697_100321549 3300005536 Bacteria 1333
167 Ga0070697_100513173 3300005536 Bacteria 1049
168 Ga0068853_101220592 3300005539 Bacteria 726
169 Ga0068853_102461737 3300005539 Bacteria 504
170 Ga0070672_100004622 3300005543 Bacteria 9017
171 Ga0070672_100131393 3300005543 Bacteria 2058
172 Ga0070672_100154074 3300005543 Bacteria 1903
173 Ga0070686_100001153 3300005544 Bacteria 15105
174 Ga0070686_100001810 3300005544 Bacteria 11925
175 Ga0070686_100003735 3300005544 Bacteria 8366
176 Ga0070686_100021825 3300005544 Bacteria 3811
177 Ga0070686_100088889 3300005544 Bacteria 2063
178 Ga0070695_100054066 3300005545 Bacteria 2583
179 Ga0070695_100109564 3300005545 Bacteria 1872
180 Ga0070695_100153038 3300005545 Bacteria 1611
181 Ga0070696_100014740 3300005546 Bacteria 5244
182 Ga0070696_100039493 3300005546 Bacteria 3259
183 Ga0070696_100091065 3300005546 Bacteria 2171
184 Ga0070696_100378972 3300005546 Bacteria 1102
185 Ga0070693_100025178 3300005547 Bacteria 3200
186 Ga0070665_100155586 3300005548 Bacteria 2288
187 Ga0070665_100874118 3300005548 Bacteria 912
188 Ga0070665_101501812 3300005548 Bacteria 682
189 Ga0070704_100016656 3300005549 Bacteria 4650
190 Ga0070704_100167365 3300005549 Bacteria 1744
191 Ga0070704_100347908 3300005549 Bacteria 1250
192 Ga0070704_100964944 3300005549 Bacteria 770
193 Ga0068855_100121259 3300005563 Bacteria 2992
194 Ga0070664_100004699 3300005564 Bacteria 10954
195 Ga0070664_100017106 3300005564 Bacteria 5951
196 Ga0070664_100312780 3300005564 Bacteria 1422
197 Ga0070664_100539742 3300005564 Bacteria 1078
198 Ga0068857_100128798 3300005577 Bacteria 2282
199 Ga0068857_102009636 3300005577 Bacteria 567
200 Ga0068854_100190667 3300005578 Bacteria 1606
201 Ga0070702_100082706 3300005615 Bacteria 1927
202 Ga0070702_100901826 3300005615 Bacteria 692
203 Ga0068852_100141629 3300005616 Bacteria 2226
204 Ga0068852_100721648 3300005616 Bacteria 1008
205 Ga0068859_100001080 3300005617 Bacteria 27816
206 Ga0068859_100125401 3300005617 Bacteria 2637
207 Ga0068859_100309542 3300005617 Bacteria 1673
208 Ga0068864_100017267 3300005618 Bacteria 6017
209 Ga0068866_10028397 3300005718 Bacteria 2665
210 Ga0068866_10062640 3300005718 Bacteria 1936
211 Ga0068866_10129194 3300005718 Bacteria 1435
212 Ga0068861_100129149 3300005719 Bacteria 2049
213 Ga0068861_100189158 3300005719 Bacteria 1719
214 Ga0068861_101260593 3300005719 Bacteria 717
215 Ga0068861_101999900 3300005719 Bacteria 578
216 Ga0068870_10015488 3300005840 Bacteria 3619
217 Ga0068863_101939669 3300005841 Bacteria 599
218 Ga0068858_100124107 3300005842 Bacteria 2417
219 Ga0068858_101307008 3300005842 Bacteria 714
220 Ga0068860_100034338 3300005843 Bacteria 4864
221 Ga0068860_100072223 3300005843 Bacteria 3279
222 Ga0068860_100409080 3300005843 Bacteria 1343
223 Ga0068860_100438485 3300005843 Bacteria 1297
224 Ga0068862_100080379 3300005844 Bacteria 2827
225 Ga0081455_10000457 3300005937 Bacteria 53537
226 Ga0070717_10103093 3300006028 Bacteria 2425
227 Ga0075432_10002652 3300006058 Bacteria 5975
228 Ga0070715_10507423 3300006163 Unclassified 691
229 Ga0070715_10750485 3300006163 Bacteria 588
230 Ga0070716_100022519 3300006173 Bacteria 3331
231 Ga0070716_100114975 3300006173 Bacteria 1674
232 Ga0070716_100397840 3300006173 Bacteria 990
233 Ga0075427_10006876 3300006194 Unclassified 1661
234 Ga0097621_100003109 3300006237 Bacteria 11385
235 Ga0097621_100030403 3300006237 Bacteria 4275
236 Ga0068871_100004722 3300006358 Bacteria 9531
237 Ga0068871_100010448 3300006358 Bacteria 6774
238 Ga0068871_100588775 3300006358 Bacteria 1011
239 Ga0068871_101054234 3300006358 Bacteria 759
240 Ga0075428_101316803 3300006844 Bacteria 759
241 Ga0075428_102240597 3300006844 Bacteria 563
242 Ga0075430_100000800 3300006846 Bacteria 24453
243 Ga0075430_100009708 3300006846 Bacteria 8132
244 Ga0075430_100011790 3300006846 Bacteria 7442
245 Ga0075430_100299651 3300006846 Bacteria 1330
246 Ga0075430_100341414 3300006846 Bacteria 1237
247 Ga0075431_100004808 3300006847 Bacteria 13295
248 Ga0075431_100019017 3300006847 Bacteria 6999
249 Ga0075431_100033801 3300006847 Bacteria 5268
250 Ga0075431_100104523 3300006847 Bacteria 2923
251 Ga0075433_10011787 3300006852 Bacteria 7041
252 Ga0075433_10153120 3300006852 Bacteria 2051
253 Ga0075433_10347961 3300006852 Bacteria 1310
254 Ga0075433_11601586 3300006852 Bacteria 562
255 Ga0075434_100038974 3300006871 Bacteria 4708
256 Ga0075434_100209843 3300006871 Bacteria 1968
257 Ga0075434_100907933 3300006871 Bacteria 896
258 Ga0075434_102619501 3300006871 Bacteria 505
259 Ga0075429_100000498 3300006880 Bacteria 29516
260 Ga0075429_100015569 3300006880 Bacteria 6590
261 Ga0075429_100052476 3300006880 Bacteria 3548
262 Ga0075429_100161294 3300006880 Bacteria 1964
263 Ga0075429_100697684 3300006880 Bacteria 889
264 Ga0075429_100970612 3300006880 Bacteria 743
265 Ga0068865_100001653 3300006881 Bacteria 13064
266 Ga0068865_100345777 3300006881 Bacteria 1203
267 Ga0075436_100208425 3300006914 Bacteria 1385
268 Ga0097620_100001080 3300006931 Bacteria 27816
269 Ga0097620_100125408 3300006931 Bacteria 2637
270 Ga0097620_100309513 3300006931 Bacteria 1673
271 Ga0075435_100007648 3300007076 Bacteria 7717
272 Ga0075435_100488466 3300007076 Bacteria 1064
273 Ga0075435_100489426 3300007076 Bacteria 1063
274 Ga0075435_101852796 3300007076 Bacteria 529
275 Ga0099794_10044108 3300007265 Bacteria 2130
276 Ga0111539_10072221 3300009094 Bacteria 4070
277 Ga0111539_13264804 3300009094 Unclassified 522
278 Ga0105245_10004374 3300009098 Bacteria 12503
279 Ga0105245_10484637 3300009098 Bacteria 1250
280 Ga0105245_11946933 3300009098 Bacteria 641
281 Ga0114129_10012324 3300009147 Bacteria 12166
282 Ga0114129_10105393 3300009147 Bacteria 3897
283 Ga0114129_10129962 3300009147 Bacteria 3460
284 Ga0114129_10322375 3300009147 Bacteria 2054
285 Ga0114129_11912634 3300009147 Bacteria 719
286 Ga0114129_12014761 3300009147 Bacteria 698
287 Ga0114129_12485541 3300009147 Unclassified 619
288 Ga0114129_12493535 3300009147 Unclassified 618
289 Ga0105243_10007248 3300009148 Bacteria 8524
290 Ga0105243_10107004 3300009148 Bacteria 2332
291 Ga0105243_11983231 3300009148 Bacteria 616
292 Ga0105241_10170657 3300009174 Bacteria 1796
293 Ga0105241_10368325 3300009174 Bacteria 1252
294 Ga0105242_10006995 3300009176 Bacteria 8710
295 Ga0105242_10021035 3300009176 Bacteria 5118
296 Ga0105242_11108292 3300009176 Bacteria 806
297 Ga0105248_10365102 3300009177 Bacteria 1625
298 Ga0105237_11952752 3300009545 Bacteria 595
299 Ga0105238_12111700 3300009551 Bacteria 598
300 Ga0105239_10025271 3300010375 Bacteria 6540
301 Ga0105246_10002042 3300011119 Bacteria 12188
302 Ga0157371_10844268 3300013102 Bacteria 692
303 Ga0157371_11493232 3300013102 Bacteria 527
304 Ga0157370_11057600 3300013104 Bacteria 734
305 Ga0157369_10143602 3300013105 Bacteria 2524
306 Ga0157374_10050010 3300013296 Bacteria 3884
307 Ga0157374_10073020 3300013296 Bacteria 3238
308 Ga0157374_11938514 3300013296 Bacteria 615
309 Ga0157374_12065493 3300013296 Bacteria 596
310 Ga0157378_10034081 3300013297 Bacteria 4503
311 Ga0157378_10054860 3300013297 Bacteria 3549
312 Ga0157378_10108765 3300013297 Bacteria 2539
313 Ga0157378_10158430 3300013297 Bacteria 2115
314 Ga0163162_10400230 3300013306 Bacteria 1506
315 Ga0157372_12805019 3300013307 Bacteria 559
316 Ga0157372_13001236 3300013307 Bacteria 539
317 Ga0157375_10028798 3300013308 Bacteria 5213
318 Ga0157375_11254923 3300013308 Bacteria 870
319 Ga0157375_11744568 3300013308 Bacteria 738
320 Ga0163163_10246746 3300014325 Bacteria 1836
321 Ga0163163_11273369 3300014325 Bacteria 798
322 Ga0157380_10003854 3300014326 Bacteria 10339
323 Ga0157380_10032243 3300014326 Bacteria 4029
324 Ga0157380_10242008 3300014326 Bacteria 1627
325 Ga0157380_10523612 3300014326 Bacteria 1157
326 Ga0157380_10830964 3300014326 Bacteria 944
327 Ga0157377_10026012 3300014745 Bacteria 3127
328 Ga0157377_10769502 3300014745 Bacteria 706
329 Ga0157379_10219236 3300014968 Bacteria 1724
330 Ga0157379_10614711 3300014968 Bacteria 1015
331 Ga0157379_10679873 3300014968 Unclassified 965
332 Ga0157376_10001862 3300014969 Bacteria 14060
333 Ga0157376_10002625 3300014969 Bacteria 12226
334 Ga0157376_10481382 3300014969 Bacteria 1216
335 Ga0163161_10082723 3300017792 Bacteria 2366
336 Ga0206356_11224672 3300020070 Bacteria 660
337 Ga0207697_10155248 3300025315 Bacteria 997
338 Ga0207653_10083849 3300025885 Bacteria 1107
339 Ga0207682_10034784 3300025893 Bacteria 2033
340 Ga0207642_10038684 3300025899 Bacteria 2067
341 Ga0207710_10659884 3300025900 Bacteria 548
342 Ga0207688_10028580 3300025901 Bacteria 3068
343 Ga0207680_10030317 3300025903 Bacteria 3049
344 Ga0207680_10042948 3300025903 Bacteria 2648
345 Ga0207680_10419713 3300025903 Bacteria 947
346 Ga0207680_11238509 3300025903 Bacteria 532
347 Ga0207647_10245966 3300025904 Bacteria 1027
348 Ga0207685_10106452 3300025905 Bacteria 1208
349 Ga0207685_10167245 3300025905 Bacteria 1009
350 Ga0207685_10461276 3300025905 Bacteria 662
351 Ga0207699_10637505 3300025906 Bacteria 778
352 Ga0207645_10000319 3300025907 Bacteria 40004
353 Ga0207643_10084365 3300025908 Bacteria 1844
354 Ga0207684_10000354 3300025910 Bacteria 62819
355 Ga0207684_10004998 3300025910 Bacteria 12354
356 Ga0207684_10011565 3300025910 Bacteria 7712
357 Ga0207684_10194665 3300025910 Bacteria 1749
358 Ga0207684_10239901 3300025910 Bacteria 1564
359 Ga0207684_10246606 3300025910 Bacteria 1541
360 Ga0207684_10305748 3300025910 Unclassified 1371
361 Ga0207684_10556385 3300025910 Bacteria 981
362 Ga0207654_10926235 3300025911 Bacteria 632
363 Ga0207707_10026688 3300025912 Bacteria 5048
364 Ga0207707_10128513 3300025912 Bacteria 2216
365 Ga0207707_10873013 3300025912 Bacteria 745
366 Ga0207671_10934643 3300025914 Bacteria 685
367 Ga0207663_10174053 3300025916 Bacteria 1531
368 Ga0207663_11740864 3300025916 Bacteria 501
369 Ga0207660_10006168 3300025917 Bacteria 7783
370 Ga0207660_10025604 3300025917 Bacteria 4007
371 Ga0207660_10118004 3300025917 Bacteria 2006
372 Ga0207662_10000281 3300025918 Bacteria 23576
373 Ga0207662_10010315 3300025918 Bacteria 5157
374 Ga0207662_10080299 3300025918 Bacteria 1989
375 Ga0207662_10624426 3300025918 Bacteria 751
376 Ga0207657_10001887 3300025919 Bacteria 22650
377 Ga0207649_10055832 3300025920 Bacteria 2464
378 Ga0207649_10184042 3300025920 Bacteria 1464
379 Ga0207652_10027975 3300025921 Bacteria 4701
380 Ga0207652_10115214 3300025921 Bacteria 2387
381 Ga0207646_10000011 3300025922 Bacteria 370246
382 Ga0207646_10000252 3300025922 Bacteria 72709
383 Ga0207646_10089293 3300025922 Bacteria 2758
384 Ga0207646_10233693 3300025922 Bacteria 1661
385 Ga0207681_10071862 3300025923 Bacteria 2414
386 Ga0207681_10718461 3300025923 Bacteria 831
387 Ga0207681_10969307 3300025923 Bacteria 713
388 Ga0207650_10069245 3300025925 Bacteria 2651
389 Ga0207659_10032437 3300025926 Bacteria 3585
390 Ga0207659_10069014 3300025926 Bacteria 2573
391 Ga0207687_10030538 3300025927 Bacteria 3634
392 Ga0207687_10181887 3300025927 Bacteria 1629
393 Ga0207644_10043162 3300025931 Bacteria 3199
394 Ga0207644_10374307 3300025931 Unclassified 1161
395 Ga0207690_10020246 3300025932 Bacteria 4107
396 Ga0207690_10816009 3300025932 Bacteria 771
397 Ga0207706_10000428 3300025933 Bacteria 45224
398 Ga0207706_10678054 3300025933 Bacteria 882
399 Ga0207686_10009930 3300025934 Bacteria 5174
400 Ga0207686_10035215 3300025934 Bacteria 3003
401 Ga0207686_10332146 3300025934 Bacteria 1139
402 Ga0207709_10152022 3300025935 Bacteria 1604
403 Ga0207670_10000024 3300025936 Bacteria 143058
404 Ga0207670_10016294 3300025936 Bacteria 4463
405 Ga0207670_10363737 3300025936 Bacteria 1148
406 Ga0207669_10002413 3300025937 Bacteria 7968
407 Ga0207669_10049674 3300025937 Bacteria 2502
408 Ga0207704_10039635 3300025938 Bacteria 2745
409 Ga0207704_10269240 3300025938 Bacteria 1289
410 Ga0207665_10032938 3300025939 Bacteria 3433
411 Ga0207665_10036430 3300025939 Bacteria 3272
412 Ga0207691_10000726 3300025940 Bacteria 32543
413 Ga0207691_10044629 3300025940 Bacteria 4079
414 Ga0207691_10063839 3300025940 Bacteria 3339
415 Ga0207711_10301706 3300025941 Bacteria 1477
416 Ga0207711_10340992 3300025941 Bacteria 1387
417 Ga0207711_11455700 3300025941 Bacteria 628
418 Ga0207689_10055849 3300025942 Bacteria 3249
419 Ga0207689_10613735 3300025942 Bacteria 915
420 Ga0207661_10126569 3300025944 Bacteria 2183
421 Ga0207661_11515563 3300025944 Bacteria 614
422 Ga0207679_10001492 3300025945 Bacteria 14665
423 Ga0207679_10007191 3300025945 Bacteria 7053
424 Ga0207679_10113288 3300025945 Bacteria 2145
425 Ga0207679_11546983 3300025945 Bacteria 608
426 Ga0207667_10131926 3300025949 Bacteria 2573
427 Ga0207651_10187581 3300025960 Bacteria 1646
428 Ga0207651_10334824 3300025960 Bacteria 1270
429 Ga0207651_10712446 3300025960 Bacteria 885
430 Ga0207712_10074085 3300025961 Bacteria 2457
431 Ga0207712_10219482 3300025961 Bacteria 1519
432 Ga0207668_10006294 3300025972 Bacteria 7018
433 Ga0207640_10075813 3300025981 Bacteria 2281
434 Ga0207658_10274977 3300025986 Bacteria 1441
435 Ga0207677_10073522 3300026023 Bacteria 2421
436 Ga0207677_10486840 3300026023 Bacteria 1064
437 Ga0207677_11036051 3300026023 Bacteria 745
438 Ga0207703_10364911 3300026035 Bacteria 1333
439 Ga0207639_12030666 3300026041 Bacteria 536
440 Ga0207639_12144677 3300026041 Bacteria 520
441 Ga0207678_10229241 3300026067 Bacteria 1590
442 Ga0207678_11489676 3300026067 Bacteria 597
443 Ga0207708_10000780 3300026075 Bacteria 24018
444 Ga0207708_10001713 3300026075 Bacteria 16231
445 Ga0207708_10139591 3300026075 Bacteria 1900
446 Ga0207702_11877462 3300026078 Bacteria 590
447 Ga0207648_10002186 3300026089 Bacteria 21222
448 Ga0207648_10013209 3300026089 Bacteria 7694
449 Ga0207648_10749583 3300026089 Bacteria 907
450 Ga0207676_10073748 3300026095 Bacteria 2748
451 Ga0207676_10714467 3300026095 Bacteria 972
452 Ga0207674_10025795 3300026116 Bacteria 6259
453 Ga0207674_10188878 3300026116 Bacteria 2010
454 Ga0207675_100162689 3300026118 Bacteria 2130
455 Ga0207675_100247114 3300026118 Bacteria 1726
456 Ga0207675_101565148 3300026118 Bacteria 680
457 Ga0207675_101954660 3300026118 Bacteria 605
458 Ga0207683_10000382 3300026121 Bacteria 40830
459 Ga0207683_10198912 3300026121 Bacteria 1821
460 Ga0207698_10579083 3300026142 Bacteria 1104
461 Ga0209973_1008178 3300027252 Bacteria 1186
462 Ga0209969_1000206 3300027360 Bacteria 7891
463 Ga0209967_1000013 3300027364 Bacteria 23510
464 Ga0209981_1000720 3300027378 Bacteria 4181
465 Ga0209981_1005981 3300027378 Bacteria 1624
466 Ga0209996_1000180 3300027395 Bacteria 8137
467 Ga0209984_1000021 3300027424 Bacteria 16233
468 Ga0210000_1000181 3300027462 Bacteria 9100
469 Ga0209995_1000006 3300027471 Bacteria 35957
470 Ga0209995_1018382 3300027471 Unclassified 1152
471 Ga0209968_1000042 3300027526 Bacteria 23178
472 Ga0209968_1016708 3300027526 Bacteria 1168
473 Ga0209968_1054211 3300027526 Bacteria 700
474 Ga0209999_1000492 3300027543 Bacteria 6148
475 Ga0209999_1063056 3300027543 Bacteria 707
476 Ga0209982_1079918 3300027552 Bacteria 539
477 Ga0209970_1000462 3300027614 Bacteria 6938
478 Ga0209970_1050183 3300027614 Bacteria 754
479 Ga0210002_1000005 3300027617 Bacteria 37981
480 Ga0209983_1001278 3300027665 Bacteria 5600
481 Ga0209983_1077018 3300027665 Bacteria 746
482 Ga0209971_1000482 3300027682 Bacteria 10560
483 Ga0209971_1019563 3300027682 Bacteria 1608
484 Ga0209971_1107834 3300027682 Bacteria 683
485 Ga0209966_1000092 3300027695 Bacteria 39143
486 Ga0209966_1001168 3300027695 Bacteria 4700
487 Ga0209998_10000049 3300027717 Bacteria 48633
488 Ga0209998_10015756 3300027717 Bacteria 1587
489 Ga0209974_10004159 3300027876 Bacteria 5175
490 Ga0209974_10005801 3300027876 Bacteria 4330
491 Ga0209974_10087637 3300027876 Bacteria 1077
492 Ga0209974_10150797 3300027876 Bacteria 839
493 Ga0207428_10001066 3300027907 Bacteria 30105
494 Ga0207428_10056972 3300027907 Bacteria 3104
495 Ga0268266_10308359 3300028379 Bacteria 1478
496 Ga0268266_11340318 3300028379 Bacteria 691
497 Ga0268265_10546336 3300028380 Bacteria 1099
498 Ga0268265_11376484 3300028380 Bacteria 707
499 Ga0268264_10024071 3300028381 Bacteria 4969
500 Ga0268264_10046757 3300028381 Bacteria 3596
501 Ga0268264_10374807 3300028381 Bacteria 1361
502 Ga0265338_10055975 3300028800 Bacteria 3503
503 Ga0307511_10000442 3300030521 Bacteria 44415
504 Ga0265327_10137169 3300031251 Bacteria 1146
505 Ga0265316_10913647 3300031344 Bacteria 613
506 Ga0265316_10962510 3300031344 Unclassified 595
507 Ga0307408_100031691 3300031548 Bacteria 3682
508 Ga0307408_100616472 3300031548 Bacteria 966
509 Ga0307405_10004671 3300031731 Bacteria 6508
510 Ga0307405_10830788 3300031731 Bacteria 776
511 Ga0307405_11467576 3300031731 Bacteria 598
512 Ga0307413_11044500 3300031824 Bacteria 703
513 Ga0307410_10026168 3300031852 Bacteria 3669
514 Ga0307410_10353701 3300031852 Bacteria 1174
515 Ga0307406_10146134 3300031901 Bacteria 1680
516 Ga0307407_10061421 3300031903 Bacteria 2196
517 Ga0307407_11087645 3300031903 Bacteria 621
518 Ga0307412_10012004 3300031911 Bacteria 5032
519 Ga0307412_10546556 3300031911 Bacteria 972
520 Ga0307409_100075929 3300031995 Bacteria 2693
521 Ga0307409_100136108 3300031995 Bacteria 2108
522 Ga0307416_100024445 3300032002 Bacteria 4410
523 Ga0307416_100782578 3300032002 Bacteria 1049
524 Ga0307416_102807870 3300032002 Bacteria 582
525 Ga0307414_10344425 3300032004 Bacteria 1277
526 Ga0307414_11658893 3300032004 Bacteria 596
527 Ga0307411_10003709 3300032005 Bacteria 7157
528 Ga0307411_10016375 3300032005 Bacteria 4194
529 Ga0307415_100038079 3300032126 Bacteria 3166
530 Ga0316593_10161025 3300032168 Bacteria 820
531 Ga0316593_10320698 3300032168 Unclassified 589
532 Ga0373958_0163399 3300034819 Bacteria 564
533 Ga0373926_0045995 3300035083 Bacteria 1565
534 Ga0373929_0193341 3300035085 Bacteria 567
535 Ga0373934_0061495 3300035086 Bacteria 1496
536 Ga0373923_0083806 3300035111 Bacteria 1386
537 Ga0373941_0127870 3300035115 Unclassified 912
538 Ga0373941_0240033 3300035115 Unclassified 704
539 Ga0373945_0110829 3300035116 Bacteria 1083
540 Ga0373945_0134495 3300035116 Bacteria 993
541 Ga0373956_0277813 3300035119 Bacteria 797
542 Ga0373957_0453771 3300035120 Bacteria 555
543 Ga0373960_0085052 3300035121 Bacteria 1003
544 Ga0373960_0103335 3300035121 Bacteria 926
545 Ga0373943_0026835 3300035170 Bacteria 2702
546 Ga0373946_0123635 3300035171 Bacteria 1184
547 Ga0373955_0134329 3300035172 Bacteria 1446
548 Ga0373942_0015789 3300035207 Bacteria 1845
549 Ga0373961_0369439 3300035241 Bacteria 544
550 Ga0373962_0083044 3300035242 Bacteria 976
551 Ga0373924_0368847 3300035410 Bacteria 640
552 Ga0373931_0185987 3300035691 Bacteria 1233
553 Ga0373931_0195960 3300035691 Bacteria 1204
554 Ga0373931_0908606 3300035691 Unclassified 592
555 Ga0373935_0044283 3300035692 Bacteria 2804
556 Ga0373935_0538420 3300035692 Bacteria 850
557 Ga0373927_0035547 3300035695 Bacteria 3240
558 Ga0373933_0032880 3300035724 Bacteria 3015
559 Ga0373947_0026956 3300035725 Bacteria 3361
560 Ga0373947_1063830 3300035725 Bacteria 552
561 Ga0373937_0569003 3300036401 Bacteria 1076
562 Ga0373925_0522369 3300037068 Bacteria 975
563 Ga0242420_049477 3300038996 Bacteria 819
564 Ga0400483_123123 3300039062 Bacteria 1180
565 Ga0400483_261336 3300039062 Bacteria 1514
566 Ga0439438_012686 3300041405 Bacteria 2573
567 Ga0439439_0009813 3300041406 Bacteria 2284
568 Ga0439447_045113 3300041407 Bacteria 1064
569 Ga0439453_0056649 3300041408 Bacteria 803
570 Ga0439461_0011958 3300041410 Bacteria 1618
571 Ga0439466_0027179 3300041411 Bacteria 1983
572 Ga0439465_0261708 3300041413 Bacteria 642
573 Ga0451802_1015304 3300041460 Bacteria 714
574 Ga0451807_1487812 3300041486 Bacteria 1160
575 Ga0451837_0058787 3300041494 Bacteria 2497
576 Ga0451849_0205384 3300041505 Bacteria 945
577 Ga0439431_0013413 3300041997 Bacteria 1891
578 Ga0439433_0081645 3300041999 Bacteria 787
579 Ga0439441_009512 3300042001 Bacteria 1611
580 Ga0439448_0185249 3300042005 Bacteria 728
581 Ga0439432_026350 3300042006 Bacteria 1903
582 Ga0439451_076935 3300042009 Unclassified 669
583 Ga0439452_027821 3300042010 Bacteria 1416
584 Ga0439454_121215 3300042011 Unclassified 506
585 Ga0439455_0081424 3300042012 Unclassified 880
586 Ga0439455_0202149 3300042012 Bacteria 575
587 Ga0439456_061353 3300042013 Bacteria 827
588 Ga0439457_138334 3300042014 Bacteria 582
589 Ga0439462_0051864 3300042015 Bacteria 1103
590 Ga0450914_030353 3300042118 Bacteria 648
591 Ga0450896_052909 3300042133 Bacteria 650
592 Ga0450905_036787 3300042142 Bacteria 769
593 Ga0439446_0031510 3300042156 Bacteria 1534
594 Ga0450909_012392 3300042185 Bacteria 1250
595 Ga0439435_0010610 3300042436 Bacteria 2192
596 Ga0439435_0034881 3300042436 Bacteria 1385
597 Ga0439444_0063208 3300042437 Bacteria 777
598 Ga0439464_0046380 3300042439 Bacteria 1249
599 Ga0439464_0077699 3300042439 Bacteria 988
600 Ga0439464_0274740 3300042439 Unclassified 547
601 Ga0439460_0019928 3300042461 Bacteria 1820
602 Ga0439460_0070169 3300042461 Bacteria 1084
603 Ga0450893_0106676 3300042532 Unclassified 575
604 Ga0451577_0264706 3300042876 Bacteria 1557
605 Ga0451577_0395796 3300042876 Bacteria 1254
606 Ga0451577_1799548 3300042876 Bacteria 537
607 Ga0439440_0256818 3300042993 Unclassified 534
608 Ga0439440_0280681 3300042993 Bacteria 514
609 Ga0453683_0069750 3300044673 Bacteria 2198
610 Ga0453683_0107305 3300044673 Unclassified 1755
611 Ga0453683_0292327 3300044673 Bacteria 1042
612 Ga0466963_0192463 3300044694 Bacteria 1425
613 Ga0453684_0255611 3300044712 Bacteria 2009
614 Ga0453684_0269147 3300044712 Bacteria 1948
615 Ga0453684_0388138 3300044712 Bacteria 1566
616 Ga0453684_0527403 3300044712 Bacteria 1304
617 Ga0453684_0632788 3300044712 Bacteria 1169
618 Ga0453684_0950237 3300044712 Bacteria 917
619 Ga0453684_1171214 3300044712 Bacteria 808
620 Ga0453684_1353995 3300044712 Bacteria 740
621 Ga0466971_0305184 3300044719 Bacteria 765
622 Ga0466957_0112615 3300044842 Bacteria 1727
623 Ga0451576_0010724 3300045051 Bacteria 10493
624 Ga0451576_0334658 3300045051 Bacteria 1585
625 Ga0451576_0585028 3300045051 Bacteria 1173
626 Ga0451576_0793871 3300045051 Bacteria 994
627 Ga0451576_1789170 3300045051 Bacteria 635
628 Ga0451576_1891564 3300045051 Bacteria 616
629 Ga0466958_0390972 3300045836 Bacteria 897
630 Ga0466967_0192171 3300045976 Bacteria 1930
631 Ga0495592_0228274 3300046454 Bacteria 1241
632 Ga0495629_0034132 3300046459 Bacteria 3597
633 Ga0495651_0360859 3300046462 Bacteria 958
634 Ga0495653_0146529 3300046463 Bacteria 1654
635 Ga0495582_0072667 3300046473 Bacteria 1904
636 Ga0495582_0416817 3300046473 Bacteria 775
637 Ga0495639_0455303 3300046475 Bacteria 650
638 Ga0495584_0616316 3300046491 Unclassified 553
639 Ga0495594_0011487 3300046499 Bacteria 4604
640 Ga0495594_0285376 3300046499 Bacteria 940
641 Ga0495594_0546203 3300046499 Bacteria 657
642 Ga0495596_0272862 3300046500 Unclassified 657
643 Ga0495607_0190683 3300046501 Unclassified 1021
644 Ga0495637_0050577 3300046520 Bacteria 1743
645 Ga0495666_0385049 3300046526 Bacteria 631
646 Ga0495609_0139077 3300046538 Unclassified 1037
647 Ga0495621_0153174 3300046539 Bacteria 908
648 Ga0495622_0188528 3300046557 Bacteria 923
649 Ga0495656_0327007 3300046615 Unclassified 791
650 Ga0495634_0411341 3300046642 Bacteria 802
651 Ga0495635_0268224 3300046663 Bacteria 1148
652 Ga0495635_0668671 3300046663 Bacteria 675
653 Ga0495659_0009361 3300046664 Bacteria 3126
654 Ga0495588_0203174 3300046674 Bacteria 1047
655 Ga0495657_0032657 3300046675 Bacteria 3631
656 Ga0495647_0013988 3300046681 Bacteria 2790
657 Ga0495658_0097137 3300046683 Bacteria 1753
658 Ga0495624_0195130 3300046690 Bacteria 1231
659 Ga0495670_0129089 3300046691 Bacteria 1317
660 Ga0495670_0311570 3300046691 Unclassified 844
661 Ga0495589_0174031 3300046794 Unclassified 1023
662 Ga0495600_0121010 3300046809 Bacteria 1702
663 Ga0495581_0030598 3300047315 Bacteria 3119
664 Ga0495604_0140888 3300047317 Bacteria 1723
665 Ga0495636_0530225 3300047318 Bacteria 571
666 Ga0495680_0096615 3300047322 Unclassified 2206
667 Ga0495614_0065681 3300048089 Bacteria 1561
668 Ga0496106_0382029 3300048909 Bacteria 1132
669 Ga0496109_1153059 3300048912 Bacteria 712
670 Ga0496111_0037047 3300048914 Bacteria 3490
671 Ga0496112_1794613 3300048915 Bacteria 525
672 Ga0501308_063994 3300049128 Bacteria 560
673 Ga0501309_040989 3300049129 Bacteria 708
674 Ga0501304_023346 3300049160 Bacteria 625
675 Ga0501290_001203 3300049513 Bacteria 3630
676 Ga0501291_000070 3300049514 Bacteria 12062
677 Ga0501292_000097 3300049515 Bacteria 15474
678 Ga0501293_001129 3300049516 Bacteria 2000
679 Ga0501294_000073 3300049517 Bacteria 10983
680 Ga0501295_000110 3300049518 Bacteria 8049
681 Ga0501296_000001 3300049519 Bacteria 31185
682 Ga0501297_000026 3300049520 Bacteria 14970
683 Ga0501298_005654 3300049521 Bacteria 2014
684 Ga0501298_052086 3300049521 Bacteria 851
685 Ga0501299_000081 3300049522 Bacteria 10639
686 Ga0501299_100089 3300049522 Bacteria 672
687 Ga0501300_000275 3300049523 Bacteria 7826
688 Ga0501301_000256 3300049524 Bacteria 3096
689 Ga0501303_001156 3300049526 Bacteria 1966
690 Ga0501311_102006 3300049527 Bacteria 509
691 Ga0501312_060276 3300049528 Bacteria 656
692 Ga0501317_106748 3300049533 Bacteria 511
693 Ga0501031_0003007 3300049568 Bacteria 10794
694 Ga0501031_0003309 3300049568 Bacteria 10343
695 Ga0501031_0013954 3300049568 Bacteria 5232
696 Ga0501031_0052700 3300049568 Bacteria 2651
697 Ga0501031_0221458 3300049568 Bacteria 1232
698 Ga0501031_0668675 3300049568 Bacteria 667
699 Ga0501032_0011486 3300049569 Bacteria 6362
700 Ga0501032_0022670 3300049569 Bacteria 4351
701 Ga0501032_0275407 3300049569 Bacteria 1090
702 Ga0501033_0189779 3300049570 Bacteria 1471
703 Ga0501033_0926442 3300049570 Bacteria 585
704 Ga0501034_0821894 3300049571 Bacteria 821
705 Ga0501034_1136513 3300049571 Bacteria 661
706 Ga0501036_0001418 3300049572 Bacteria 18422
707 Ga0501036_0072666 3300049572 Bacteria 2908
708 Ga0501036_0106647 3300049572 Bacteria 2369
709 Ga0501036_0177349 3300049572 Bacteria 1794
710 Ga0501036_1699334 3300049572 Bacteria 509
711 Ga0501037_0005978 3300049573 Bacteria 8889
712 Ga0501037_0019840 3300049573 Bacteria 4960
713 Ga0501037_0044493 3300049573 Bacteria 3260
714 Ga0501037_0186277 3300049573 Bacteria 1471
715 Ga0501037_0392312 3300049573 Bacteria 953
716 Ga0501038_0034759 3300049574 Bacteria 4429
717 Ga0501038_0043832 3300049574 Bacteria 3889
718 Ga0501038_0048896 3300049574 Bacteria 3659
719 Ga0501038_0396391 3300049574 Bacteria 1068
720 Ga0501038_1308771 3300049574 Bacteria 523
721 Ga0501039_0010478 3300049575 Bacteria 7063
722 Ga0501039_0020879 3300049575 Bacteria 5020
723 Ga0501039_0043557 3300049575 Bacteria 3467
724 Ga0501039_0220646 3300049575 Bacteria 1490
725 Ga0501039_0268065 3300049575 Bacteria 1342
726 Ga0501039_0558912 3300049575 Bacteria 898
727 Ga0501040_0019056 3300049576 Bacteria 4561
728 Ga0501040_0031341 3300049576 Bacteria 3593
729 Ga0501040_0053014 3300049576 Bacteria 2777
730 Ga0501040_0092978 3300049576 Bacteria 2097
731 Ga0501040_0937441 3300049576 Unclassified 627
732 Ga0501041_0000835 3300049577 Bacteria 16538
733 Ga0501041_0006703 3300049577 Bacteria 6747
734 Ga0501041_0009263 3300049577 Bacteria 5797
735 Ga0501041_0145921 3300049577 Bacteria 1476
736 Ga0501042_0024884 3300049578 Bacteria 4202
737 Ga0501042_0033761 3300049578 Bacteria 3628
738 Ga0501042_0045230 3300049578 Bacteria 3137
739 Ga0501042_0094916 3300049578 Bacteria 2142
740 Ga0501042_0136752 3300049578 Unclassified 1766
741 Ga0501043_0177162 3300049579 Unclassified 1662
742 Ga0501043_0220160 3300049579 Bacteria 1469
743 Ga0501046_0003559 3300049580 Bacteria 14273
744 Ga0501046_0004698 3300049580 Bacteria 12325
745 Ga0501046_0018359 3300049580 Bacteria 5821
746 Ga0501046_0031280 3300049580 Bacteria 4316
747 Ga0501046_0374776 3300049580 Bacteria 1031
748 Ga0501047_0777516 3300049581 Bacteria 773
749 Ga0501048_0000395 3300049582 Bacteria 30360
750 Ga0501048_0075391 3300049582 Bacteria 2379
751 Ga0501048_0127417 3300049582 Bacteria 1800
752 Ga0501048_0535514 3300049582 Bacteria 840
753 Ga0501048_0983013 3300049582 Unclassified 607
754 Ga0501067_0176473 3300049583 Bacteria 1190
755 Ga0501067_0378252 3300049583 Bacteria 790
756 Ga0501068_0240630 3300049584 Bacteria 1152
757 Ga0501068_0360137 3300049584 Bacteria 935
758 Ga0501069_0571397 3300049585 Bacteria 677
759 Ga0501069_0597665 3300049585 Bacteria 662
760 Ga0501069_0612584 3300049585 Bacteria 654
761 Ga0501070_0319362 3300049586 Bacteria 1263
762 Ga0501070_1197593 3300049586 Bacteria 583
763 Ga0501071_0002970 3300049587 Bacteria 10484
764 Ga0501071_0132578 3300049587 Bacteria 1852
765 Ga0501071_0397358 3300049587 Bacteria 1052
766 Ga0501072_0029542 3300049588 Bacteria 4283
767 Ga0501072_0432611 3300049588 Bacteria 1043
768 Ga0501072_0748481 3300049588 Bacteria 767
769 Ga0501073_0479957 3300049589 Bacteria 860
770 Ga0501074_0071057 3300049590 Bacteria 2502
771 Ga0501074_1289703 3300049590 Bacteria 512
772 Ga0501075_0008078 3300049591 Bacteria 7317
773 Ga0501075_0191046 3300049591 Bacteria 1562
774 Ga0501075_0338407 3300049591 Bacteria 1147
775 Ga0501075_0913966 3300049591 Unclassified 667
776 Ga0501075_1390903 3300049591 Bacteria 531
777 Ga0501076_0075708 3300049592 Bacteria 2698
778 Ga0501076_0210650 3300049592 Bacteria 1588
779 Ga0501076_0225491 3300049592 Bacteria 1531
780 Ga0501076_0561520 3300049592 Bacteria 941
781 Ga0501076_0644930 3300049592 Unclassified 874
782 Ga0501198_005747 3300049649 Bacteria 1752
783 Ga0501199_000588 3300049650 Bacteria 3207
784 Ga0501201_010914 3300049651 Bacteria 893
785 Ga0501202_001084 3300049652 Bacteria 4237
786 Ga0501206_000681 3300049653 Bacteria 4130
787 Ga0501208_000033 3300049655 Bacteria 8087
788 Ga0501214_082232 3300049659 Bacteria 543
789 Ga0501216_000248 3300049660 Bacteria 5996
790 Ga0501217_000657 3300049661 Bacteria 5855
791 Ga0501223_100251 3300049663 Bacteria 596
792 Ga0501224_050918 3300049664 Bacteria 635
793 Ga0501227_023381 3300049665 Bacteria 1436
794 Ga0501233_000389 3300049668 Bacteria 6946
795 Ga0501235_000044 3300049669 Bacteria 19898
796 Ga0501236_000030 3300049670 Bacteria 13822
797 Ga0501239_000789 3300049672 Bacteria 2552
798 Ga0501242_005697 3300049674 Bacteria 1408
799 Ga0501243_003599 3300049675 Bacteria 2305
800 Ga0501247_070289 3300049677 Bacteria 551
801 Ga0501248_000573 3300049678 Bacteria 2056
802 Ga0501249_001670 3300049679 Bacteria 4532
803 Ga0501251_003246 3300049681 Bacteria 1614
804 Ga0501253_002203 3300049683 Bacteria 2158
805 Ga0501255_001817 3300049684 Bacteria 1786
806 Ga0501256_000607 3300049685 Bacteria 2365
807 Ga0501257_001093 3300049686 Bacteria 5495
808 Ga0501259_036823 3300049688 Bacteria 947
809 Ga0501260_048832 3300049689 Bacteria 529
810 Ga0501261_000708 3300049690 Bacteria 4171
811 Ga0501219_001018 3300049703 Bacteria 3259
812 Ga0501225_0001524 3300049705 Bacteria 7272
813 Ga0501229_001207 3300049706 Bacteria 3004
814 Ga0501245_001430 3300049708 Bacteria 3092
815 Ga0501079_0193080 3300049741 Bacteria 1589
816 Ga0501080_0607402 3300049742 Bacteria 970
817 Ga0501080_1220989 3300049742 Unclassified 646
818 Ga0501081_0471811 3300049743 Bacteria 933
819 Ga0501081_0486350 3300049743 Bacteria 919
820 Ga0501083_0033924 3300049744 Bacteria 3492
821 Ga0501083_1148339 3300049744 Bacteria 505
822 Ga0501232_000579 3300049757 Bacteria 2508
823 Ga0501264_000260 3300049761 Bacteria 8360
824 Ga0501265_001370 3300049762 Bacteria 2756
825 Ga0501266_000269 3300049763 Bacteria 6816
826 Ga0501269_023202 3300049766 Bacteria 778
827 Ga0501270_002952 3300049767 Bacteria 1791
828 Ga0501271_001541 3300049768 Bacteria 1991
829 Ga0501272_000814 3300049769 Bacteria 2830
830 Ga0501273_000418 3300049770 Bacteria 3385
831 Ga0501274_000464 3300049771 Bacteria 2857
832 Ga0501275_019137 3300049772 Bacteria 824
833 Ga0501276_000272 3300049773 Bacteria 2993
834 Ga0501278_000701 3300049774 Bacteria 2537
835 Ga0501279_002409 3300049775 Bacteria 2456
836 Ga0501280_001221 3300049776 Bacteria 5015
837 Ga0501281_00480 3300049777 Bacteria 3763
838 Ga0501282_001620 3300049778 Bacteria 2486
839 Ga0501283_000031 3300049779 Bacteria 16683
840 Ga0501035_0004145 3300049822 Bacteria 13774
841 Ga0501035_0030679 3300049822 Bacteria 4900
842 Ga0501035_0048549 3300049822 Bacteria 3807
843 Ga0501035_0588486 3300049822 Bacteria 908
844 Ga0501044_0198050 3300049823 Bacteria 1968
845 Ga0501044_0666574 3300049823 Unclassified 928
846 Ga0501044_1444713 3300049823 Bacteria 553
847 Ga0501045_0071010 3300049824 Bacteria 2562
848 Ga0501045_1105664 3300049824 Unclassified 580
849 nmdc:mga05p37_21807_c1 3300050507 Bacteria 7760
850 nmdc:mga05p37_242672_c1 3300050507 Bacteria 2165
851 nmdc:mga05p37_539343_c1 3300050507 Bacteria 1330
852 nmdc:mga05p37_745742_c1 3300050507 Bacteria 1080
853 nmdc:mga05p37_83120_c1 3300050507 Bacteria 3944
854 nmdc:mga09592_141745_c1 3300050508 Bacteria 2072
855 nmdc:mga09592_27143_c1 3300050508 Bacteria 4751
856 nmdc:mga09592_275837_c1 3300050508 Bacteria 1458
857 nmdc:mga09592_71664_c1 3300050508 Bacteria 2941
858 nmdc:mga09592_7623_c1 3300050508 Bacteria 8802
859 nmdc:mga0qj67_10014_c1 3300050509 Bacteria 7071
860 nmdc:mga0qj67_1216_c1 3300050509 Bacteria 17913
861 nmdc:mga0qj67_18859_c1 3300050509 Bacteria 5263
862 nmdc:mga0qj67_73283_c1 3300050509 Bacteria 2735
863 nmdc:mga06r32_12279_c1 3300050510 Bacteria 7725
864 nmdc:mga06r32_31560_c1 3300050510 Bacteria 4977
865 nmdc:mga06r32_84525_c1 3300050510 Bacteria 3093
866 nmdc:mga06r32_9935_c1 3300050510 Bacteria 8588
867 nmdc:mga08y16_49455_c1 3300050511 Bacteria 4401
868 nmdc:mga0n895_157515_c1 3300050512 Bacteria 2302
869 nmdc:mga0n895_2194854_c1 3300050512 Bacteria 508
870 nmdc:mga0n895_2230970_c1 3300050512 Bacteria 503
871 nmdc:mga0rr50_1025642_c1 3300050513 Bacteria 703
872 nmdc:mga0rr50_1300338_c1 3300050513 Bacteria 617
873 nmdc:mga0rr50_195989_c1 3300050513 Bacteria 1658
874 nmdc:mga0rr50_734488_c1 3300050513 Bacteria 843
875 nmdc:mga08x19_219847_c1 3300050514 Bacteria 1305
876 nmdc:mga08x19_343142_c1 3300050514 Bacteria 1042
877 nmdc:mga08x19_85669_c1 3300050514 Bacteria 2074
878 nmdc:mga0a205_20209_c1 3300050515 Bacteria 6282
879 nmdc:mga0a205_479739_c1 3300050515 Bacteria 1102
880 Ga0495601_0008311 3300053077 Bacteria 6127
881 Ga0495612_0172330 3300053078 Bacteria 948
882 Ga0495595_0177233 3300053084 Bacteria 1056
883 Ga0495619_0146839 3300053085 Bacteria 1626
884 Ga0495619_0157571 3300053085 Bacteria 1567
885 Ga0501084_0185142 3300054114 Bacteria 1757
886 Ga0501084_0451151 3300054114 Bacteria 1087
887 Ga0501084_1592657 3300054114 Bacteria 546
888 Ga0590071_043061 3300059421 Bacteria 1088
889 Ga0590075_003561 3300059424 Bacteria 3694
890 Ga0590077_077776 3300059426 Bacteria 762
891 Ga0587070_093484 3300059491 Bacteria 680
892 Ga0587079_123978 3300059647 Bacteria 642
893 Ga0501082_0036974 3300060353 Bacteria 4206
894 Ga0501082_1024111 3300060353 Bacteria 722
895 Ga0466962_0304612 3300061719 Bacteria 789
896 Ga0530510_0024573 3300061734 Bacteria 4301
897 Ga0530510_0340977 3300061734 Bacteria 1125
898 Ga0530510_0423946 3300061734 Unclassified 1004
899 Ga0530510_0717799 3300061734 Bacteria 762
900 Ga0068858_101435914
901 SwRhRL2b_contig_1087855
902 2214806902
903 JGI24742J22300_10077764
904 JGI26128J50194_1005255
905 JGI26129J50193_1011093
906 JGI26145J50221_1000071
907 JGI26142J50222_102611
908 JGI26140J50224_101891
909 JGI26134J50242_101155
910 JGI26133J50247_102041
911 JGI26130J50248_102899
912 JGI26132J50249_103969
913 JGI26143J51219_1006949
914 JGI26141J51220_1002671
915 JGI26138J51218_102793
916 Ga0058860_11408664
917 Ga0058860_11878411
918 Ga0065704_10005524
919 Ga0065704_10287312
920 Ga0065712_10202387
921 Ga0065715_10024978
922 Ga0065715_10466356
923 Ga0065715_10703734
924 Ga0065707_10083722
925 Ga0065707_10112291
926 Ga0065707_10499672
927 Ga0070658_10025278
928 Ga0070658_10036820
929 Ga0070676_10002110
930 Ga0070676_10811513
931 Ga0070683_101520820
932 Ga0070690_100000128
933 Ga0070690_100006058
934 Ga0070690_100163496
935 Ga0070670_100073412
936 Ga0070670_100399030
937 Ga0070677_10010132
938 Ga0068869_100399586
939 Ga0068869_101641377
940 Ga0070666_10018395
941 Ga0070666_10166291
942 Ga0070666_10529419
943 Ga0070666_10665729
944 Ga0070680_100031316
945 Ga0070680_100063420
946 Ga0070680_100063732
947 Ga0070680_100340015
948 Ga0070680_100995570
949 Ga0070682_100225353
950 Ga0070682_100291316
951 Ga0070682_101474018
952 Ga0068868_100077174
953 Ga0068868_100175469
954 Ga0068868_100439819
955 Ga0070660_100001287
956 Ga0070660_100085519
957 Ga0070660_100850866
958 Ga0070689_100001472
959 Ga0070689_100024154
960 Ga0070689_100077278
961 Ga0070691_10001906
962 Ga0070691_10192469
963 Ga0070687_100000578
964 Ga0070687_100006792
965 Ga0070687_100154346
966 Ga0070687_100567546
967 Ga0070661_100002446
968 Ga0070661_100031260
969 Ga0070692_10003356
970 Ga0070692_11090787
971 Ga0070668_100012055
972 Ga0070669_100036233
973 Ga0070669_101072058
974 Ga0070675_100233695
975 Ga0070675_100857891
976 Ga0070675_101107484
977 Ga0070671_100069717
978 Ga0070671_100402037
979 Ga0070674_100000651
980 Ga0070674_100013481
981 Ga0070674_100525895
982 Ga0070673_100002548
983 Ga0070673_100086154
984 Ga0070673_100098879
985 Ga0070673_100882084
986 Ga0070688_100000009
987 Ga0070688_100005771
988 Ga0070688_100023921
989 Ga0070659_100000429
990 Ga0070659_100991417
991 Ga0070667_100032702
992 Ga0070667_100471054
993 Ga0070703_10115596
994 Ga0070710_10468495
995 Ga0070701_10001023
996 Ga0070701_10021474
997 Ga0070701_10101264
998 Ga0070701_10229959
999 Ga0070711_101507912
1000 Ga0070705_100003543
1001 Ga0070705_100055568
1002 Ga0070705_100260353
1003 Ga0070705_100785023
1004 Ga0070700_100003185
1005 Ga0070700_100012179
1006 Ga0070700_100128047
1007 Ga0070694_100050947
1008 Ga0070694_100103928
1009 Ga0070694_100354468
1010 Ga0070694_100555906
1011 Ga0070694_100823890
1012 Ga0070708_100032477
1013 Ga0070708_100150707
1014 Ga0070708_100182048
1015 Ga0070708_100189665
1016 Ga0070708_100902761
1017 Ga0070708_101717164
1018 Ga0070663_100057877
1019 Ga0070678_100227761
1020 Ga0070678_101601551
1021 Ga0070662_100000333
1022 Ga0070662_100869771
1023 Ga0070662_100937181
1024 Ga0070681_10014971
1025 Ga0070681_10117118
1026 Ga0068867_100000209
1027 Ga0068867_100008954
1028 Ga0068867_100084748
1029 Ga0068867_102360266
1030 Ga0070685_10000197
1031 Ga0070685_10024398
1032 Ga0070706_100006062
1033 Ga0070706_100022282
1034 Ga0070706_100071009
1035 Ga0070706_100160000
1036 Ga0070706_100241449
1037 Ga0070707_100000009
1038 Ga0070707_100000546
1039 Ga0070707_100013734
1040 Ga0070707_100045910
1041 Ga0070707_100160664
1042 Ga0070698_100022782
1043 Ga0070698_100065483
1044 Ga0070698_100108921
1045 Ga0070698_100321535
1046 Ga0070698_100338737
1047 Ga0070698_101297737
1048 Ga0070699_100012688
1049 Ga0070699_100038839
1050 Ga0070699_100046180
1051 Ga0070699_100057826
1052 Ga0070699_100060393
1053 Ga0070699_100130500
1054 Ga0070699_100297150
1055 Ga0070679_100039709
1056 Ga0070679_100238006
1057 Ga0070684_100060682
1058 Ga0070684_100172658
1059 Ga0070684_101287682
1060 Ga0070697_100028140
1061 Ga0070697_100039781
1062 Ga0070697_100040563
1063 Ga0070697_100052026
1064 Ga0070697_100099320
1065 Ga0070697_100321549
1066 Ga0070697_100513173
1067 Ga0068853_101220592
1068 Ga0068853_102461737
1069 Ga0070672_100004622
1070 Ga0070672_100131393
1071 Ga0070672_100154074
1072 Ga0070686_100001153
1073 Ga0070686_100001810
1074 Ga0070686_100003735
1075 Ga0070686_100021825
1076 Ga0070686_100088889
1077 Ga0070695_100054066
1078 Ga0070695_100109564
1079 Ga0070695_100153038
1080 Ga0070696_100014740
1081 Ga0070696_100039493
1082 Ga0070696_100091065
1083 Ga0070696_100378972
1084 Ga0070693_100025178
1085 Ga0070665_100155586
1086 Ga0070665_100874118
1087 Ga0070665_101501812
1088 Ga0070704_100016656
1089 Ga0070704_100167365
1090 Ga0070704_100347908
1091 Ga0070704_100964944
1092 Ga0068855_100121259
1093 Ga0070664_100004699
1094 Ga0070664_100017106
1095 Ga0070664_100312780
1096 Ga0070664_100539742
1097 Ga0068857_100128798
1098 Ga0068857_102009636
1099 Ga0068854_100190667
1100 Ga0070702_100082706
1101 Ga0070702_100901826
1102 Ga0068852_100141629
1103 Ga0068852_100721648
1104 Ga0068859_100001080
1105 Ga0068859_100125401
1106 Ga0068859_100309542
1107 Ga0068864_100017267
1108 Ga0068866_10028397
1109 Ga0068866_10062640
1110 Ga0068866_10129194
1111 Ga0068861_100129149
1112 Ga0068861_100189158
1113 Ga0068861_101260593
1114 Ga0068861_101999900
1115 Ga0068870_10015488
1116 Ga0068863_101939669
1117 Ga0068858_100124107
1118 Ga0068858_101307008
1119 Ga0068860_100034338
1120 Ga0068860_100072223
1121 Ga0068860_100409080
1122 Ga0068860_100438485
1123 Ga0068862_100080379
1124 Ga0081455_10000457
1125 Ga0070717_10103093
1126 Ga0075432_10002652
1127 Ga0070715_10507423
1128 Ga0070715_10750485
1129 Ga0070716_100022519
1130 Ga0070716_100114975
1131 Ga0070716_100397840
1132 Ga0075427_10006876
1133 Ga0097621_100003109
1134 Ga0097621_100030403
1135 Ga0068871_100004722
1136 Ga0068871_100010448
1137 Ga0068871_100588775
1138 Ga0068871_101054234
1139 Ga0075428_101316803
1140 Ga0075428_102240597
1141 Ga0075430_100000800
1142 Ga0075430_100009708
1143 Ga0075430_100011790
1144 Ga0075430_100299651
1145 Ga0075430_100341414
1146 Ga0075431_100004808
1147 Ga0075431_100019017
1148 Ga0075431_100033801
1149 Ga0075431_100104523
1150 Ga0075433_10011787
1151 Ga0075433_10153120
1152 Ga0075433_10347961
1153 Ga0075433_11601586
1154 Ga0075434_100038974
1155 Ga0075434_100209843
1156 Ga0075434_100907933
1157 Ga0075434_102619501
1158 Ga0075429_100000498
1159 Ga0075429_100015569
1160 Ga0075429_100052476
1161 Ga0075429_100161294
1162 Ga0075429_100697684
1163 Ga0075429_100970612
1164 Ga0068865_100001653
1165 Ga0068865_100345777
1166 Ga0075436_100208425
1167 Ga0097620_100001080
1168 Ga0097620_100125408
1169 Ga0097620_100309513
1170 Ga0075435_100007648
1171 Ga0075435_100488466
1172 Ga0075435_100489426
1173 Ga0075435_101852796
1174 Ga0099794_10044108
1175 Ga0111539_10072221
1176 Ga0111539_13264804
1177 Ga0105245_10004374
1178 Ga0105245_10484637
1179 Ga0105245_11946933
1180 Ga0114129_10012324
1181 Ga0114129_10105393
1182 Ga0114129_10129962
1183 Ga0114129_10322375
1184 Ga0114129_11912634
1185 Ga0114129_12014761
1186 Ga0114129_12485541
1187 Ga0114129_12493535
1188 Ga0105243_10007248
1189 Ga0105243_10107004
1190 Ga0105243_11983231
1191 Ga0105241_10170657
1192 Ga0105241_10368325
1193 Ga0105242_10006995
1194 Ga0105242_10021035
1195 Ga0105242_11108292
1196 Ga0105248_10365102
1197 Ga0105237_11952752
1198 Ga0105238_12111700
1199 Ga0105239_10025271
1200 Ga0105246_10002042
1201 Ga0157371_10844268
1202 Ga0157371_11493232
1203 Ga0157370_11057600
1204 Ga0157369_10143602
1205 Ga0157374_10050010
1206 Ga0157374_10073020
1207 Ga0157374_11938514
1208 Ga0157374_12065493
1209 Ga0157378_10034081
1210 Ga0157378_10054860
1211 Ga0157378_10108765
1212 Ga0157378_10158430
1213 Ga0163162_10400230
1214 Ga0157372_12805019
1215 Ga0157372_13001236
1216 Ga0157375_10028798
1217 Ga0157375_11254923
1218 Ga0157375_11744568
1219 Ga0163163_10246746
1220 Ga0163163_11273369
1221 Ga0157380_10003854
1222 Ga0157380_10032243
1223 Ga0157380_10242008
1224 Ga0157380_10523612
1225 Ga0157380_10830964
1226 Ga0157377_10026012
1227 Ga0157377_10769502
1228 Ga0157379_10219236
1229 Ga0157379_10614711
1230 Ga0157379_10679873
1231 Ga0157376_10001862
1232 Ga0157376_10002625
1233 Ga0157376_10481382
1234 Ga0163161_10082723
1235 Ga0206356_11224672
1236 Ga0207697_10155248
1237 Ga0207653_10083849
1238 Ga0207682_10034784
1239 Ga0207642_10038684
1240 Ga0207710_10659884
1241 Ga0207688_10028580
1242 Ga0207680_10030317
1243 Ga0207680_10042948
1244 Ga0207680_10419713
1245 Ga0207680_11238509
1246 Ga0207647_10245966
1247 Ga0207685_10106452
1248 Ga0207685_10167245
1249 Ga0207685_10461276
1250 Ga0207699_10637505
1251 Ga0207645_10000319
1252 Ga0207643_10084365
1253 Ga0207684_10000354
1254 Ga0207684_10004998
1255 Ga0207684_10011565
1256 Ga0207684_10194665
1257 Ga0207684_10239901
1258 Ga0207684_10246606
1259 Ga0207684_10305748
1260 Ga0207684_10556385
1261 Ga0207654_10926235
1262 Ga0207707_10026688
1263 Ga0207707_10128513
1264 Ga0207707_10873013
1265 Ga0207671_10934643
1266 Ga0207663_10174053
1267 Ga0207663_11740864
1268 Ga0207660_10006168
1269 Ga0207660_10025604
1270 Ga0207660_10118004
1271 Ga0207662_10000281
1272 Ga0207662_10010315
1273 Ga0207662_10080299
1274 Ga0207662_10624426
1275 Ga0207657_10001887
1276 Ga0207649_10055832
1277 Ga0207649_10184042
1278 Ga0207652_10027975
1279 Ga0207652_10115214
1280 Ga0207646_10000011
1281 Ga0207646_10000252
1282 Ga0207646_10089293
1283 Ga0207646_10233693
1284 Ga0207681_10071862
1285 Ga0207681_10718461
1286 Ga0207681_10969307
1287 Ga0207650_10069245
1288 Ga0207659_10032437
1289 Ga0207659_10069014
1290 Ga0207687_10030538
1291 Ga0207687_10181887
1292 Ga0207644_10043162
1293 Ga0207644_10374307
1294 Ga0207690_10020246
1295 Ga0207690_10816009
1296 Ga0207706_10000428
1297 Ga0207706_10678054
1298 Ga0207686_10009930
1299 Ga0207686_10035215
1300 Ga0207686_10332146
1301 Ga0207709_10152022
1302 Ga0207670_10000024
1303 Ga0207670_10016294
1304 Ga0207670_10363737
1305 Ga0207669_10002413
1306 Ga0207669_10049674
1307 Ga0207704_10039635
1308 Ga0207704_10269240
1309 Ga0207665_10032938
1310 Ga0207665_10036430
1311 Ga0207691_10000726
1312 Ga0207691_10044629
1313 Ga0207691_10063839
1314 Ga0207711_10301706
1315 Ga0207711_10340992
1316 Ga0207711_11455700
1317 Ga0207689_10055849
1318 Ga0207689_10613735
1319 Ga0207661_10126569
1320 Ga0207661_11515563
1321 Ga0207679_10001492
1322 Ga0207679_10007191
1323 Ga0207679_10113288
1324 Ga0207679_11546983
1325 Ga0207667_10131926
1326 Ga0207651_10187581
1327 Ga0207651_10334824
1328 Ga0207651_10712446
1329 Ga0207712_10074085
1330 Ga0207712_10219482
1331 Ga0207668_10006294
1332 Ga0207640_10075813
1333 Ga0207658_10274977
1334 Ga0207677_10073522
1335 Ga0207677_10486840
1336 Ga0207677_11036051
1337 Ga0207703_10364911
1338 Ga0207639_12030666
1339 Ga0207639_12144677
1340 Ga0207678_10229241
1341 Ga0207678_11489676
1342 Ga0207708_10000780
1343 Ga0207708_10001713
1344 Ga0207708_10139591
1345 Ga0207702_11877462
1346 Ga0207648_10002186
1347 Ga0207648_10013209
1348 Ga0207648_10749583
1349 Ga0207676_10073748
1350 Ga0207676_10714467
1351 Ga0207674_10025795
1352 Ga0207674_10188878
1353 Ga0207675_100162689
1354 Ga0207675_100247114
1355 Ga0207675_101565148
1356 Ga0207675_101954660
1357 Ga0207683_10000382
1358 Ga0207683_10198912
1359 Ga0207698_10579083
1360 Ga0209973_1008178
1361 Ga0209969_1000206
1362 Ga0209967_1000013
1363 Ga0209981_1000720
1364 Ga0209981_1005981
1365 Ga0209996_1000180
1366 Ga0209984_1000021
1367 Ga0210000_1000181
1368 Ga0209995_1000006
1369 Ga0209995_1018382
1370 Ga0209968_1000042
1371 Ga0209968_1016708
1372 Ga0209968_1054211
1373 Ga0209999_1000492
1374 Ga0209999_1063056
1375 Ga0209982_1079918
1376 Ga0209970_1000462
1377 Ga0209970_1050183
1378 Ga0210002_1000005
1379 Ga0209983_1001278
1380 Ga0209983_1077018
1381 Ga0209971_1000482
1382 Ga0209971_1019563
1383 Ga0209971_1107834
1384 Ga0209966_1000092
1385 Ga0209966_1001168
1386 Ga0209998_10000049
1387 Ga0209998_10015756
1388 Ga0209974_10004159
1389 Ga0209974_10005801
1390 Ga0209974_10087637
1391 Ga0209974_10150797
1392 Ga0207428_10001066
1393 Ga0207428_10056972
1394 Ga0268266_10308359
1395 Ga0268266_11340318
1396 Ga0268265_10546336
1397 Ga0268265_11376484
1398 Ga0268264_10024071
1399 Ga0268264_10046757
1400 Ga0268264_10374807
1401 Ga0265338_10055975
1402 Ga0307511_10000442
1403 Ga0265327_10137169
1404 Ga0265316_10913647
1405 Ga0265316_10962510
1406 Ga0307408_100031691
1407 Ga0307408_100616472
1408 Ga0307405_10004671
1409 Ga0307405_10830788
1410 Ga0307405_11467576
1411 Ga0307413_11044500
1412 Ga0307410_10026168
1413 Ga0307410_10353701
1414 Ga0307406_10146134
1415 Ga0307407_10061421
1416 Ga0307407_11087645
1417 Ga0307412_10012004
1418 Ga0307412_10546556
1419 Ga0307409_100075929
1420 Ga0307409_100136108
1421 Ga0307416_100024445
1422 Ga0307416_100782578
1423 Ga0307416_102807870
1424 Ga0307414_10344425
1425 Ga0307414_11658893
1426 Ga0307411_10003709
1427 Ga0307411_10016375
1428 Ga0307415_100038079
1429 Ga0316593_10161025
1430 Ga0316593_10320698
1431 Ga0373958_0163399
1432 Ga0373926_0045995
1433 Ga0373929_0193341
1434 Ga0373934_0061495
1435 Ga0373923_0083806
1436 Ga0373941_0127870
1437 Ga0373941_0240033
1438 Ga0373945_0110829
1439 Ga0373945_0134495
1440 Ga0373956_0277813
1441 Ga0373957_0453771
1442 Ga0373960_0085052
1443 Ga0373960_0103335
1444 Ga0373943_0026835
1445 Ga0373946_0123635
1446 Ga0373955_0134329
1447 Ga0373942_0015789
1448 Ga0373961_0369439
1449 Ga0373962_0083044
1450 Ga0373924_0368847
1451 Ga0373931_0185987
1452 Ga0373931_0195960
1453 Ga0373931_0908606
1454 Ga0373935_0044283
1455 Ga0373935_0538420
1456 Ga0373927_0035547
1457 Ga0373933_0032880
1458 Ga0373947_0026956
1459 Ga0373947_1063830
1460 Ga0373937_0569003
1461 Ga0373925_0522369
1462 Ga0242420_049477
1463 Ga0400483_123123
1464 Ga0400483_261336
1465 Ga0439438_012686
1466 Ga0439439_0009813
1467 Ga0439447_045113
1468 Ga0439453_0056649
1469 Ga0439461_0011958
1470 Ga0439466_0027179
1471 Ga0439465_0261708
1472 Ga0451802_1015304
1473 Ga0451807_1487812
1474 Ga0451837_0058787
1475 Ga0451849_0205384
1476 Ga0439431_0013413
1477 Ga0439433_0081645
1478 Ga0439441_009512
1479 Ga0439448_0185249
1480 Ga0439432_026350
1481 Ga0439451_076935
1482 Ga0439452_027821
1483 Ga0439454_121215
1484 Ga0439455_0081424
1485 Ga0439455_0202149
1486 Ga0439456_061353
1487 Ga0439457_138334
1488 Ga0439462_0051864
1489 Ga0450914_030353
1490 Ga0450896_052909
1491 Ga0450905_036787
1492 Ga0439446_0031510
1493 Ga0450909_012392
1494 Ga0439435_0010610
1495 Ga0439435_0034881
1496 Ga0439444_0063208
1497 Ga0439464_0046380
1498 Ga0439464_0077699
1499 Ga0439464_0274740
1500 Ga0439460_0019928
1501 Ga0439460_0070169
1502 Ga0450893_0106676
1503 Ga0451577_0264706
1504 Ga0451577_0395796
1505 Ga0451577_1799548
1506 Ga0439440_0256818
1507 Ga0439440_0280681
1508 Ga0453683_0069750
1509 Ga0453683_0107305
1510 Ga0453683_0292327
1511 Ga0466963_0192463
1512 Ga0453684_0255611
1513 Ga0453684_0269147
1514 Ga0453684_0388138
1515 Ga0453684_0527403
1516 Ga0453684_0632788
1517 Ga0453684_0950237
1518 Ga0453684_1171214
1519 Ga0453684_1353995
1520 Ga0466971_0305184
1521 Ga0466957_0112615
1522 Ga0451576_0010724
1523 Ga0451576_0334658
1524 Ga0451576_0585028
1525 Ga0451576_0793871
1526 Ga0451576_1789170
1527 Ga0451576_1891564
1528 Ga0466958_0390972
1529 Ga0466967_0192171
1530 Ga0495592_0228274
1531 Ga0495629_0034132
1532 Ga0495651_0360859
1533 Ga0495653_0146529
1534 Ga0495582_0072667
1535 Ga0495582_0416817
1536 Ga0495639_0455303
1537 Ga0495584_0616316
1538 Ga0495594_0011487
1539 Ga0495594_0285376
1540 Ga0495594_0546203
1541 Ga0495596_0272862
1542 Ga0495607_0190683
1543 Ga0495637_0050577
1544 Ga0495666_0385049
1545 Ga0495609_0139077
1546 Ga0495621_0153174
1547 Ga0495622_0188528
1548 Ga0495656_0327007
1549 Ga0495634_0411341
1550 Ga0495635_0268224
1551 Ga0495635_0668671
1552 Ga0495659_0009361
1553 Ga0495588_0203174
1554 Ga0495657_0032657
1555 Ga0495647_0013988
1556 Ga0495658_0097137
1557 Ga0495624_0195130
1558 Ga0495670_0129089
1559 Ga0495670_0311570
1560 Ga0495589_0174031
1561 Ga0495600_0121010
1562 Ga0495581_0030598
1563 Ga0495604_0140888
1564 Ga0495636_0530225
1565 Ga0495680_0096615
1566 Ga0495614_0065681
1567 Ga0496106_0382029
1568 Ga0496109_1153059
1569 Ga0496111_0037047
1570 Ga0496112_1794613
1571 Ga0501308_063994
1572 Ga0501309_040989
1573 Ga0501304_023346
1574 Ga0501290_001203
1575 Ga0501291_000070
1576 Ga0501292_000097
1577 Ga0501293_001129
1578 Ga0501294_000073
1579 Ga0501295_000110
1580 Ga0501296_000001
1581 Ga0501297_000026
1582 Ga0501298_005654
1583 Ga0501298_052086
1584 Ga0501299_000081
1585 Ga0501299_100089
1586 Ga0501300_000275
1587 Ga0501301_000256
1588 Ga0501303_001156
1589 Ga0501311_102006
1590 Ga0501312_060276
1591 Ga0501317_106748
1592 Ga0501031_0003007
1593 Ga0501031_0003309
1594 Ga0501031_0013954
1595 Ga0501031_0052700
1596 Ga0501031_0221458
1597 Ga0501031_0668675
1598 Ga0501032_0011486
1599 Ga0501032_0022670
1600 Ga0501032_0275407
1601 Ga0501033_0189779
1602 Ga0501033_0926442
1603 Ga0501034_0821894
1604 Ga0501034_1136513
1605 Ga0501036_0001418
1606 Ga0501036_0072666
1607 Ga0501036_0106647
1608 Ga0501036_0177349
1609 Ga0501036_1699334
1610 Ga0501037_0005978
1611 Ga0501037_0019840
1612 Ga0501037_0044493
1613 Ga0501037_0186277
1614 Ga0501037_0392312
1615 Ga0501038_0034759
1616 Ga0501038_0043832
1617 Ga0501038_0048896
1618 Ga0501038_0396391
1619 Ga0501038_1308771
1620 Ga0501039_0010478
1621 Ga0501039_0020879
1622 Ga0501039_0043557
1623 Ga0501039_0220646
1624 Ga0501039_0268065
1625 Ga0501039_0558912
1626 Ga0501040_0019056
1627 Ga0501040_0031341
1628 Ga0501040_0053014
1629 Ga0501040_0092978
1630 Ga0501040_0937441
1631 Ga0501041_0000835
1632 Ga0501041_0006703
1633 Ga0501041_0009263
1634 Ga0501041_0145921
1635 Ga0501042_0024884
1636 Ga0501042_0033761
1637 Ga0501042_0045230
1638 Ga0501042_0094916
1639 Ga0501042_0136752
1640 Ga0501043_0177162
1641 Ga0501043_0220160
1642 Ga0501046_0003559
1643 Ga0501046_0004698
1644 Ga0501046_0018359
1645 Ga0501046_0031280
1646 Ga0501046_0374776
1647 Ga0501047_0777516
1648 Ga0501048_0000395
1649 Ga0501048_0075391
1650 Ga0501048_0127417
1651 Ga0501048_0535514
1652 Ga0501048_0983013
1653 Ga0501067_0176473
1654 Ga0501067_0378252
1655 Ga0501068_0240630
1656 Ga0501068_0360137
1657 Ga0501069_0571397
1658 Ga0501069_0597665
1659 Ga0501069_0612584
1660 Ga0501070_0319362
1661 Ga0501070_1197593
1662 Ga0501071_0002970
1663 Ga0501071_0132578
1664 Ga0501071_0397358
1665 Ga0501072_0029542
1666 Ga0501072_0432611
1667 Ga0501072_0748481
1668 Ga0501073_0479957
1669 Ga0501074_0071057
1670 Ga0501074_1289703
1671 Ga0501075_0008078
1672 Ga0501075_0191046
1673 Ga0501075_0338407
1674 Ga0501075_0913966
1675 Ga0501075_1390903
1676 Ga0501076_0075708
1677 Ga0501076_0210650
1678 Ga0501076_0225491
1679 Ga0501076_0561520
1680 Ga0501076_0644930
1681 Ga0501198_005747
1682 Ga0501199_000588
1683 Ga0501201_010914
1684 Ga0501202_001084
1685 Ga0501206_000681
1686 Ga0501208_000033
1687 Ga0501214_082232
1688 Ga0501216_000248
1689 Ga0501217_000657
1690 Ga0501223_100251
1691 Ga0501224_050918
1692 Ga0501227_023381
1693 Ga0501233_000389
1694 Ga0501235_000044
1695 Ga0501236_000030
1696 Ga0501239_000789
1697 Ga0501242_005697
1698 Ga0501243_003599
1699 Ga0501247_070289
1700 Ga0501248_000573
1701 Ga0501249_001670
1702 Ga0501251_003246
1703 Ga0501253_002203
1704 Ga0501255_001817
1705 Ga0501256_000607
1706 Ga0501257_001093
1707 Ga0501259_036823
1708 Ga0501260_048832
1709 Ga0501261_000708
1710 Ga0501219_001018
1711 Ga0501225_0001524
1712 Ga0501229_001207
1713 Ga0501245_001430
1714 Ga0501079_0193080
1715 Ga0501080_0607402
1716 Ga0501080_1220989
1717 Ga0501081_0471811
1718 Ga0501081_0486350
1719 Ga0501083_0033924
1720 Ga0501083_1148339
1721 Ga0501232_000579
1722 Ga0501264_000260
1723 Ga0501265_001370
1724 Ga0501266_000269
1725 Ga0501269_023202
1726 Ga0501270_002952
1727 Ga0501271_001541
1728 Ga0501272_000814
1729 Ga0501273_000418
1730 Ga0501274_000464
1731 Ga0501275_019137
1732 Ga0501276_000272
1733 Ga0501278_000701
1734 Ga0501279_002409
1735 Ga0501280_001221
1736 Ga0501281_00480
1737 Ga0501282_001620
1738 Ga0501283_000031
1739 Ga0501035_0004145
1740 Ga0501035_0030679
1741 Ga0501035_0048549
1742 Ga0501035_0588486
1743 Ga0501044_0198050
1744 Ga0501044_0666574
1745 Ga0501044_1444713
1746 Ga0501045_0071010
1747 Ga0501045_1105664
1748 nmdc:mga05p37_21807_c1
1749 nmdc:mga05p37_242672_c1
1750 nmdc:mga05p37_539343_c1
1751 nmdc:mga05p37_745742_c1
1752 nmdc:mga05p37_83120_c1
1753 nmdc:mga09592_141745_c1
1754 nmdc:mga09592_27143_c1
1755 nmdc:mga09592_275837_c1
1756 nmdc:mga09592_71664_c1
1757 nmdc:mga09592_7623_c1
1758 nmdc:mga0qj67_10014_c1
1759 nmdc:mga0qj67_1216_c1
1760 nmdc:mga0qj67_18859_c1
1761 nmdc:mga0qj67_73283_c1
1762 nmdc:mga06r32_12279_c1
1763 nmdc:mga06r32_31560_c1
1764 nmdc:mga06r32_84525_c1
1765 nmdc:mga06r32_9935_c1
1766 nmdc:mga08y16_49455_c1
1767 nmdc:mga0n895_157515_c1
1768 nmdc:mga0n895_2194854_c1
1769 nmdc:mga0n895_2230970_c1
1770 nmdc:mga0rr50_1025642_c1
1771 nmdc:mga0rr50_1300338_c1
1772 nmdc:mga0rr50_195989_c1
1773 nmdc:mga0rr50_734488_c1
1774 nmdc:mga08x19_219847_c1
1775 nmdc:mga08x19_343142_c1
1776 nmdc:mga08x19_85669_c1
1777 nmdc:mga0a205_20209_c1
1778 nmdc:mga0a205_479739_c1
1779 Ga0495601_0008311
1780 Ga0495612_0172330
1781 Ga0495595_0177233
1782 Ga0495619_0146839
1783 Ga0495619_0157571
1784 Ga0501084_0185142
1785 Ga0501084_0451151
1786 Ga0501084_1592657
1787 Ga0590071_043061
1788 Ga0590075_003561
1789 Ga0590077_077776
1790 Ga0587070_093484
1791 Ga0587079_123978
1792 Ga0501082_0036974
1793 Ga0501082_1024111
1794 Ga0466962_0304612
1795 Ga0530510_0024573
1796 Ga0530510_0340977
1797 Ga0530510_0423946
1798 Ga0530510_0717799

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9336 21 84
3j6b-assembly1.cif.gz_R structure of the yeast mitochondrial large ribosomal subunit 0.9312 21 81
7sae-assembly1.cif.gz_V 44sr70p class1 ribosomal particle 0.9238 21 83
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9076 21 83
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9059 21 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9336 21 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8934 21 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8707 29 81 2.40.50.100
af_Q9Y3B2_6_56_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8692 29 81 2.40.50.100
af_Q9Y3B2_6_56_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.854 29 81 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A068NYA2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9587 21 87 GO:0003735
GO:0006412
GO:0022625
AF-A0A2S6T0A6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9483 21 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1V5VQS4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9391 21 81 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A420Z9C1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.939 21 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D3VUF3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9361 23 85 GO:0003735
GO:0006412
GO:0022625

Map