F484694

General Info

Members Datasets Scaffolds Average Seq Length
886 430 856 423

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10030302|Ga0157371_100303024
Length 498
Sequence MHDIRAIRENPQVYVAGWSSRGVDEADGLVADILRLDGELRHAQTTGQDALAKRNAASKLIGAAMGRKDMAEADRLKAEVEALXGXIAAAAEIEARVGKELRDLLAGLKNLAAEDVPDGEDEAGNVEVSTWGEPRRAGPAKDHADLGEALGMLDFEAAAKMSGARFAVLKGQLARLERAVGQFMLDMQTDQHGYMEVNPPLLVRDDAMFGTGQLPKFKDDLFASFAMAPLSLESLVHSGLYAEDDPDWEAVRKEIENFFSNNAVDDGTYADYDHYLNHFRSVVLKSMRAQDVRSRWWMIPTAEVSLTNLVRQQILSEDELATPMRMTALTPCFRAEAGSAGRDTRGLIRQHQFSKVEMVSITRPEDSDAEHERMTACAEAVLKALELPFRRMLLCKGDMGFSAQKTFDLEVWLPSQGTYREISSCSNCGDFQARRMEARFKRAGEKKTEFVHTLNGSGLAVGRTLVAIMENYQQEDGRIAVPAVLQPYMGGLQFVGGQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
7 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
8 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
12 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
15 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
16 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
19 2851153111 Caulobacter radicis 736 Isolate Unclassified
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
22 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
23 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
24 2909042592 Labrys sp. LIt4 Isolate Nodule
25 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
26 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
27 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
28 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
29 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
30 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
31 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
35 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
36 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
223 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
238 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
254 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
259 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
265 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
275 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
276 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
277 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
278 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
279 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
284 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
285 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
286 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
287 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
288 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
289 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
290 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
291 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
292 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
300 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
301 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
316 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
317 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
374 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
390 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
397 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
398 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
399 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
400 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
401 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
402 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
403 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
404 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
405 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
406 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
407 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
408 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
409 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
410 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
411 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
412 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
413 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
414 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
417 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
418 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
419 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
423 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
426 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
429 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
430 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.72
Nodule 0.34
Rhizoplane 1.47
Rhizosphere 80.7
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1045895 2162886007 Bacteria 2280
2 ARcpr5oldR_c001570 3300000041 Bacteria 2260
3 JGI24034J14986_100228 3300001432 Bacteria 3043
4 JGI24736J21556_1000120 3300001904 Bacteria 13372
5 JGI24740J21852_10010503 3300001979 Bacteria 3559
6 JGI24735J21928_10010617 3300002067 Bacteria 2932
7 JGI24748J21848_1000010 3300002074 Bacteria 166979
8 JGI24748J21848_1000029 3300002074 Bacteria 90134
9 JGI24034J26672_10000001 3300002239 Bacteria 1118280
10 JGI24034J26672_10000006 3300002239 Bacteria 294495
11 JGI24742J22300_10001915 3300002244 Bacteria 3311
12 JGI25165J46597_1000053 3300003214 Bacteria 235857
13 JGI25153J46596_10000138 3300003215 Bacteria 75653
14 rootL2_10042889 3300003322 Bacteria 2689
15 Ga0055537_1002278 3300003773 Bacteria 6593
16 Ga0055537_1006509 3300003773 Bacteria 2950
17 Ga0055524_1000169 3300003775 Bacteria 74567
18 Ga0055536_1010658 3300003781 Bacteria 3616
19 Ga0055536_1010718 3300003781 Bacteria 3599
20 Ga0055528_1014590 3300003790 Bacteria 2897
21 Ga0055530_10000423 3300003791 Bacteria 37624
22 Ga0055530_10009835 3300003791 Bacteria 3612
23 Ga0055530_10014691 3300003791 Bacteria 2593
24 Ga0055531_10000589 3300003794 Bacteria 31724
25 Ga0055531_10004369 3300003794 Bacteria 8645
26 Ga0055531_10017852 3300003794 Bacteria 2966
27 Ga0065704_10003860 3300005289 Bacteria 7478
28 Ga0065704_10083135 3300005289 Bacteria 3504
29 Ga0065712_10009500 3300005290 Bacteria 3214
30 Ga0065715_10002131 3300005293 Bacteria 7154
31 Ga0065715_10009882 3300005293 Bacteria 4098
32 Ga0065715_10013095 3300005293 Bacteria 1915
33 Ga0065707_10003307 3300005295 Bacteria 5295
34 Ga0065707_10009757 3300005295 Bacteria 4154
35 Ga0065707_10088542 3300005295 Bacteria 4622
36 Ga0065707_10152081 3300005295 Bacteria 1647
37 Ga0070658_10077335 3300005327 Bacteria 2729
38 Ga0070676_10000056 3300005328 Bacteria 36724
39 Ga0070676_10000801 3300005328 Bacteria 15534
40 Ga0070676_10017192 3300005328 Bacteria 4001
41 Ga0070683_100129573 3300005329 Bacteria 2387
42 Ga0070690_100039665 3300005330 Bacteria 2976
43 Ga0070670_100000001 3300005331 Bacteria 728788
44 Ga0070670_100027274 3300005331 Bacteria 4913
45 Ga0070670_100247982 3300005331 Bacteria 1551
46 Ga0068869_100012546 3300005334 Bacteria 5604
47 Ga0068869_100065272 3300005334 Bacteria 2679
48 Ga0068869_100066087 3300005334 Bacteria 2664
49 Ga0070666_10009203 3300005335 Bacteria 6158
50 Ga0070666_10031921 3300005335 Bacteria 3478
51 Ga0070666_10047659 3300005335 Bacteria 2877
52 Ga0070680_100051738 3300005336 Bacteria 3352
53 Ga0070687_100040250 3300005343 Bacteria 2354
54 Ga0070668_100013918 3300005347 Bacteria 6016
55 Ga0070668_100038290 3300005347 Bacteria 3664
56 Ga0070669_100013074 3300005353 Bacteria 5896
57 Ga0070669_100020394 3300005353 Bacteria 4734
58 Ga0070669_100071214 3300005353 Bacteria 2572
59 Ga0070675_100005347 3300005354 Bacteria 9818
60 Ga0070671_100000008 3300005355 Bacteria 207831
61 Ga0070671_100003230 3300005355 Bacteria 12709
62 Ga0070671_100084259 3300005355 Bacteria 2658
63 Ga0070674_100001556 3300005356 Bacteria 12291
64 Ga0070674_100001596 3300005356 Bacteria 12156
65 Ga0070674_100057727 3300005356 Bacteria 2695
66 Ga0070673_100017315 3300005364 Bacteria 5120
67 Ga0070673_100122996 3300005364 Bacteria 2168
68 Ga0070688_100000972 3300005365 Bacteria 14354
69 Ga0070659_100079147 3300005366 Bacteria 2623
70 Ga0070659_100151922 3300005366 Bacteria 1889
71 Ga0070667_100000023 3300005367 Bacteria 199687
72 Ga0070667_100031234 3300005367 Bacteria 4441
73 Ga0070667_100037573 3300005367 Bacteria 4059
74 Ga0070667_100125038 3300005367 Bacteria 2240
75 Ga0070703_10000544 3300005406 Bacteria 13973
76 Ga0070714_100011352 3300005435 Bacteria 7065
77 Ga0070713_100180411 3300005436 Bacteria 1897
78 Ga0070705_100000469 3300005440 Bacteria 23189
79 Ga0070700_100001016 3300005441 Bacteria 13876
80 Ga0070694_100009240 3300005444 Bacteria 6048
81 Ga0070694_100167847 3300005444 Bacteria 1615
82 Ga0070663_100002136 3300005455 Bacteria 11066
83 Ga0070678_100038089 3300005456 Bacteria 3382
84 Ga0070678_100086075 3300005456 Bacteria 2396
85 Ga0070678_100291229 3300005456 Bacteria 1384
86 Ga0070662_100002362 3300005457 Bacteria 11602
87 Ga0070662_100004008 3300005457 Bacteria 9232
88 Ga0070662_100088844 3300005457 Bacteria 2317
89 Ga0070662_100127965 3300005457 Bacteria 1954
90 Ga0070681_10056714 3300005458 Bacteria 3898
91 Ga0070681_10135085 3300005458 Bacteria 2397
92 Ga0070685_10000008 3300005466 Bacteria 166350
93 Ga0070706_100052417 3300005467 Bacteria 3765
94 Ga0070706_100266999 3300005467 Bacteria 1597
95 Ga0070698_100004114 3300005471 Bacteria 15989
96 Ga0070698_100292900 3300005471 Bacteria 1559
97 Ga0070699_100001512 3300005518 Bacteria 21269
98 Ga0070699_100244128 3300005518 Bacteria 1604
99 Ga0070679_100006337 3300005530 Bacteria 11018
100 Ga0070679_100014606 3300005530 Bacteria 7545
101 Ga0070679_100076250 3300005530 Bacteria 3343
102 Ga0070679_100169270 3300005530 Bacteria 2158
103 Ga0070684_100056278 3300005535 Bacteria 3432
104 Ga0070697_100007219 3300005536 Bacteria 8642
105 Ga0070672_100005200 3300005543 Bacteria 8609
106 Ga0070672_100024040 3300005543 Bacteria 4495
107 Ga0070672_100147992 3300005543 Bacteria 1941
108 Ga0070686_100063669 3300005544 Bacteria 2389
109 Ga0070695_100003955 3300005545 Bacteria 8651
110 Ga0070695_100104380 3300005545 Bacteria 1913
111 Ga0070696_100000758 3300005546 Bacteria 20714
112 Ga0070696_100051322 3300005546 Bacteria 2868
113 Ga0070693_100006856 3300005547 Bacteria 5536
114 Ga0070693_100007155 3300005547 Bacteria 5443
115 Ga0070693_100053609 3300005547 Bacteria 2316
116 Ga0070665_100004189 3300005548 Bacteria 15172
117 Ga0070665_100012413 3300005548 Bacteria 8587
118 Ga0070665_100059944 3300005548 Bacteria 3815
119 Ga0070704_100037698 3300005549 Bacteria 3305
120 Ga0070704_100056420 3300005549 Bacteria 2789
121 Ga0068855_100001436 3300005563 Bacteria 29649
122 Ga0068855_100049432 3300005563 Bacteria 4959
123 Ga0068855_100072552 3300005563 Bacteria 4001
124 Ga0068855_100104045 3300005563 Bacteria 3266
125 Ga0068857_100125695 3300005577 Bacteria 2310
126 Ga0068857_100126791 3300005577 Bacteria 2300
127 Ga0068856_100015873 3300005614 Bacteria 7281
128 Ga0070702_100096167 3300005615 Bacteria 1807
129 Ga0068859_100000177 3300005617 Bacteria 62179
130 Ga0068859_100004727 3300005617 Bacteria 13833
131 Ga0068859_100159049 3300005617 Bacteria 2338
132 Ga0068859_100170192 3300005617 Bacteria 2259
133 Ga0068864_100000006 3300005618 Bacteria 393838
134 Ga0068864_100001081 3300005618 Bacteria 22832
135 Ga0068864_100199607 3300005618 Bacteria 1837
136 Ga0068866_10001731 3300005718 Bacteria 9162
137 Ga0068861_100003245 3300005719 Bacteria 10767
138 Ga0068861_100014323 3300005719 Bacteria 5562
139 Ga0068861_100060136 3300005719 Bacteria 2911
140 Ga0068861_100104002 3300005719 Bacteria 2265
141 Ga0068851_10010933 3300005834 Bacteria 4245
142 Ga0068870_10010685 3300005840 Bacteria 4226
143 Ga0068870_10042545 3300005840 Bacteria 2366
144 Ga0068870_10073120 3300005840 Bacteria 1875
145 Ga0068863_100001323 3300005841 Bacteria 24691
146 Ga0068863_100016359 3300005841 Bacteria 7116
147 Ga0068863_100024017 3300005841 Bacteria 5818
148 Ga0068863_100026142 3300005841 Bacteria 5570
149 Ga0068858_100000005 3300005842 Bacteria 305830
150 Ga0068858_100000098 3300005842 Bacteria 90747
151 Ga0068858_100061852 3300005842 Bacteria 3462
152 Ga0068860_100001556 3300005843 Bacteria 24714
153 Ga0068860_100002721 3300005843 Bacteria 18394
154 Ga0068860_100040551 3300005843 Bacteria 4449
155 Ga0068860_100167494 3300005843 Bacteria 2121
156 Ga0068862_100001815 3300005844 Bacteria 19329
157 Ga0068862_100005737 3300005844 Bacteria 10362
158 Ga0068862_100015047 3300005844 Bacteria 6425
159 Ga0068862_100034160 3300005844 Bacteria 4302
160 Ga0068862_100089800 3300005844 Bacteria 2674
161 Ga0081455_10001641 3300005937 Bacteria 27241
162 Ga0081538_10005495 3300005981 Bacteria 11382
163 Ga0081538_10025694 3300005981 Bacteria 4143
164 Ga0081540_1028352 3300005983 Bacteria 3146
165 Ga0075365_10026434 3300006038 Bacteria 3685
166 Ga0070715_10000002 3300006163 Bacteria 389554
167 Ga0075362_10051556 3300006177 Bacteria 1842
168 Ga0075369_10011160 3300006186 Bacteria 3527
169 Ga0097621_100000004 3300006237 Bacteria 144414
170 Ga0068871_100000159 3300006358 Bacteria 44727
171 Ga0068871_100122455 3300006358 Bacteria 2198
172 Ga0075428_100005210 3300006844 Bacteria 14452
173 Ga0075428_100007089 3300006844 Bacteria 12417
174 Ga0075428_100011232 3300006844 Bacteria 9966
175 Ga0075428_100020288 3300006844 Bacteria 7361
176 Ga0075428_100024773 3300006844 Bacteria 6638
177 Ga0075428_100059278 3300006844 Bacteria 4192
178 Ga0075428_100303110 3300006844 Bacteria 1717
179 Ga0075430_100002163 3300006846 Bacteria 16263
180 Ga0075430_100006567 3300006846 Bacteria 9810
181 Ga0075430_100089544 3300006846 Bacteria 2574
182 Ga0075430_100093362 3300006846 Bacteria 2516
183 Ga0075431_100000033 3300006847 Bacteria 72175
184 Ga0075431_100008475 3300006847 Bacteria 10295
185 Ga0075431_100094967 3300006847 Bacteria 3078
186 Ga0075434_100027108 3300006871 Bacteria 5623
187 Ga0075434_100053378 3300006871 Bacteria 4017
188 Ga0075434_100057762 3300006871 Bacteria 3856
189 Ga0075434_100097939 3300006871 Bacteria 2937
190 Ga0075429_100002783 3300006880 Bacteria 14783
191 Ga0075429_100118588 3300006880 Bacteria 2313
192 Ga0075429_100277327 3300006880 Bacteria 1468
193 Ga0068865_100013432 3300006881 Bacteria 5173
194 Ga0068865_100025917 3300006881 Bacteria 3862
195 Ga0068865_100051796 3300006881 Bacteria 2843
196 Ga0068865_100155385 3300006881 Bacteria 1739
197 Ga0075436_100000020 3300006914 Bacteria 124822
198 Ga0075436_100038240 3300006914 Bacteria 3312
199 Ga0075436_100151500 3300006914 Bacteria 1632
200 Ga0097620_100000177 3300006931 Bacteria 62179
201 Ga0097620_100004727 3300006931 Bacteria 13833
202 Ga0097620_100159036 3300006931 Bacteria 2338
203 Ga0097620_100170204 3300006931 Bacteria 2259
204 Ga0097620_100397225 3300006931 Bacteria 1475
205 Ga0075435_100000717 3300007076 Bacteria 20581
206 Ga0075435_100002396 3300007076 Bacteria 12432
207 Ga0075435_100045786 3300007076 Bacteria 3508
208 Ga0075435_100081116 3300007076 Bacteria 2664
209 Ga0105240_10018744 3300009093 Bacteria 9272
210 Ga0111539_10000042 3300009094 Bacteria 129513
211 Ga0111539_10000926 3300009094 Bacteria 38374
212 Ga0111539_10003260 3300009094 Bacteria 21453
213 Ga0111539_10016091 3300009094 Bacteria 9282
214 Ga0111539_10023154 3300009094 Bacteria 7628
215 Ga0111539_10024213 3300009094 Bacteria 7454
216 Ga0111539_10045327 3300009094 Bacteria 5265
217 Ga0111539_10168096 3300009094 Bacteria 2563
218 Ga0111539_10203259 3300009094 Bacteria 2310
219 Ga0111539_10283688 3300009094 Bacteria 1927
220 Ga0111539_10329831 3300009094 Bacteria 1776
221 Ga0105245_10000079 3300009098 Bacteria 100009
222 Ga0105245_10063119 3300009098 Bacteria 3344
223 Ga0105247_10000002 3300009101 Bacteria 724587
224 Ga0114129_10001565 3300009147 Bacteria 31048
225 Ga0114129_10016967 3300009147 Bacteria 10366
226 Ga0114129_10023279 3300009147 Bacteria 8785
227 Ga0114129_10090821 3300009147 Bacteria 4233
228 Ga0114129_10273744 3300009147 Bacteria 2258
229 Ga0114129_10340341 3300009147 Bacteria 1990
230 Ga0105243_10009752 3300009148 Bacteria 7309
231 Ga0105243_10042291 3300009148 Bacteria 3567
232 Ga0105243_10216589 3300009148 Bacteria 1690
233 Ga0105241_10014087 3300009174 Bacteria 5860
234 Ga0105242_10074724 3300009176 Bacteria 2820
235 Ga0105248_10003238 3300009177 Bacteria 18062
236 Ga0105248_10020707 3300009177 Bacteria 7289
237 Ga0105238_10047750 3300009551 Bacteria 4316
238 Ga0105249_10007251 3300009553 Bacteria 9671
239 Ga0105249_10283548 3300009553 Bacteria 1655
240 Ga0105239_10003937 3300010375 Bacteria 17989
241 Ga0105239_10014595 3300010375 Bacteria 8714
242 Ga0105239_10232135 3300010375 Bacteria 2070
243 Ga0157373_10023760 3300013100 Bacteria 4441
244 Ga0157373_10028230 3300013100 Bacteria 4048
245 Ga0157371_10030302 3300013102 Bacteria 3903
246 Ga0157370_10017787 3300013104 Bacteria 7164
247 Ga0157369_10009868 3300013105 Bacteria 10909
248 Ga0157369_10249999 3300013105 Bacteria 1850
249 Ga0157374_10000713 3300013296 Bacteria 29128
250 Ga0157374_10054598 3300013296 Bacteria 3727
251 Ga0157378_10073458 3300013297 Bacteria 3075
252 Ga0157378_10084084 3300013297 Bacteria 2881
253 Ga0163162_10032135 3300013306 Bacteria 5211
254 Ga0163162_10102175 3300013306 Bacteria 2960
255 Ga0157375_10014981 3300013308 Bacteria 6934
256 Ga0163163_10017137 3300014325 Bacteria 6748
257 Ga0157380_10009037 3300014326 Bacteria 7120
258 Ga0157380_10011499 3300014326 Bacteria 6395
259 Ga0157380_10129032 3300014326 Bacteria 2154
260 Ga0157379_10193810 3300014968 Bacteria 1836
261 Ga0157376_10003895 3300014969 Bacteria 10321
262 Ga0213872_10000267 3300021361 Bacteria 45184
263 Ga0213872_10003797 3300021361 Bacteria 8236
264 Ga0213872_10004985 3300021361 Bacteria 6903
265 Ga0213872_10012874 3300021361 Bacteria 3924
266 Ga0213872_10024910 3300021361 Bacteria 2751
267 Ga0213872_10031026 3300021361 Bacteria 2449
268 Ga0213872_10038966 3300021361 Bacteria 2169
269 Ga0213876_10000125 3300021384 Bacteria 83238
270 Ga0213876_10025628 3300021384 Bacteria 3110
271 Ga0209129_1015754 3300025258 Bacteria 1542
272 Ga0209565_1000012 3300025263 Bacteria 606500
273 Ga0209565_1000268 3300025263 Bacteria 53879
274 Ga0209673_1000600 3300025273 Bacteria 55820
275 Ga0209673_1001822 3300025273 Bacteria 17442
276 Ga0209676_1000099 3300025292 Bacteria 230048
277 Ga0209676_1000180 3300025292 Bacteria 148369
278 Ga0209025_1000384 3300025294 Bacteria 91722
279 Ga0209564_1018524 3300025295 Bacteria 2648
280 Ga0209758_1000028 3300025297 Bacteria 530102
281 Ga0209758_1003490 3300025297 Bacteria 14226
282 Ga0209758_1019213 3300025297 Bacteria 3308
283 Ga0209050_1000010 3300025298 Bacteria 980454
284 Ga0209050_1000319 3300025298 Bacteria 96837
285 Ga0209050_1003235 3300025298 Bacteria 12275
286 Ga0209050_1008434 3300025298 Bacteria 5511
287 Ga0209050_1010978 3300025298 Bacteria 4373
288 Ga0209256_1000012 3300025299 Bacteria 790371
289 Ga0209256_1001870 3300025299 Bacteria 19435
290 Ga0209051_1002009 3300025303 Bacteria 15523
291 Ga0209257_1000009 3300025304 Bacteria 1205047
292 Ga0209257_1000114 3300025304 Bacteria 233013
293 Ga0209257_1000614 3300025304 Bacteria 58019
294 Ga0209257_1000934 3300025304 Bacteria 40351
295 Ga0209257_1002674 3300025304 Bacteria 17096
296 Ga0207697_10011907 3300025315 Bacteria 3664
297 Ga0207653_10002711 3300025885 Bacteria 5631
298 Ga0207682_10012374 3300025893 Bacteria 3331
299 Ga0207642_10002096 3300025899 Bacteria 6166
300 Ga0207642_10065016 3300025899 Bacteria 1712
301 Ga0207710_10000002 3300025900 Bacteria 1251998
302 Ga0207710_10002477 3300025900 Bacteria 8549
303 Ga0207688_10037005 3300025901 Bacteria 2706
304 Ga0207647_10000069 3300025904 Bacteria 80952
305 Ga0207685_10000002 3300025905 Bacteria 438088
306 Ga0207645_10007912 3300025907 Bacteria 7469
307 Ga0207645_10014174 3300025907 Bacteria 5339
308 Ga0207645_10016971 3300025907 Bacteria 4810
309 Ga0207643_10027214 3300025908 Bacteria 3169
310 Ga0207643_10048666 3300025908 Bacteria 2402
311 Ga0207705_10085236 3300025909 Bacteria 2308
312 Ga0207654_10006681 3300025911 Bacteria 5805
313 Ga0207707_10010516 3300025912 Bacteria 8031
314 Ga0207707_10088468 3300025912 Bacteria 2706
315 Ga0207695_10006284 3300025913 Bacteria 15460
316 Ga0207695_10012923 3300025913 Bacteria 9992
317 Ga0207671_10002421 3300025914 Bacteria 19972
318 Ga0207663_10043357 3300025916 Bacteria 2754
319 Ga0207663_10166369 3300025916 Bacteria 1562
320 Ga0207662_10067368 3300025918 Bacteria 2159
321 Ga0207657_10005842 3300025919 Bacteria 12823
322 Ga0207649_10098484 3300025920 Bacteria 1930
323 Ga0207652_10121877 3300025921 Bacteria 2320
324 Ga0207652_10168580 3300025921 Bacteria 1964
325 Ga0207681_10007853 3300025923 Bacteria 6530
326 Ga0207681_10030359 3300025923 Bacteria 3523
327 Ga0207681_10056288 3300025923 Bacteria 2682
328 Ga0207694_10003033 3300025924 Bacteria 13465
329 Ga0207650_10000002 3300025925 Bacteria 1439222
330 Ga0207650_10007766 3300025925 Bacteria 7311
331 Ga0207650_10019990 3300025925 Bacteria 4715
332 Ga0207650_10143944 3300025925 Bacteria 1876
333 Ga0207687_10000603 3300025927 Bacteria 24269
334 Ga0207700_10199101 3300025928 Bacteria 1687
335 Ga0207664_10008296 3300025929 Bacteria 7237
336 Ga0207644_10000019 3300025931 Bacteria 170919
337 Ga0207644_10000210 3300025931 Bacteria 40409
338 Ga0207644_10002172 3300025931 Bacteria 12720
339 Ga0207690_10021855 3300025932 Bacteria 3973
340 Ga0207706_10001828 3300025933 Bacteria 20899
341 Ga0207706_10003256 3300025933 Bacteria 15558
342 Ga0207706_10065816 3300025933 Bacteria 3190
343 Ga0207709_10003138 3300025935 Bacteria 9940
344 Ga0207670_10007351 3300025936 Bacteria 6140
345 Ga0207669_10001357 3300025937 Bacteria 10422
346 Ga0207669_10061491 3300025937 Bacteria 2308
347 Ga0207704_10015697 3300025938 Bacteria 3868
348 Ga0207691_10006490 3300025940 Bacteria 11293
349 Ga0207691_10017589 3300025940 Bacteria 6776
350 Ga0207691_10050470 3300025940 Bacteria 3808
351 Ga0207711_10000156 3300025941 Bacteria 73391
352 Ga0207711_10003188 3300025941 Bacteria 14300
353 Ga0207711_10010997 3300025941 Bacteria 7519
354 Ga0207711_10020671 3300025941 Bacteria 5492
355 Ga0207711_10039375 3300025941 Bacteria 4021
356 Ga0207711_10054444 3300025941 Bacteria 3433
357 Ga0207689_10014108 3300025942 Bacteria 6801
358 Ga0207689_10076726 3300025942 Bacteria 2747
359 Ga0207689_10289186 3300025942 Bacteria 1357
360 Ga0207667_10000735 3300025949 Bacteria 42634
361 Ga0207667_10116859 3300025949 Bacteria 2749
362 Ga0207651_10125557 3300025960 Bacteria 1954
363 Ga0207712_10000922 3300025961 Bacteria 21290
364 Ga0207712_10022518 3300025961 Bacteria 4150
365 Ga0207712_10221557 3300025961 Bacteria 1513
366 Ga0207668_10090960 3300025972 Bacteria 2241
367 Ga0207640_10031574 3300025981 Bacteria 3274
368 Ga0207658_10000001 3300025986 Bacteria 1439333
369 Ga0207658_10113305 3300025986 Bacteria 2148
370 Ga0207703_10000086 3300026035 Bacteria 107307
371 Ga0207703_10000158 3300026035 Bacteria 78397
372 Ga0207703_10033515 3300026035 Bacteria 4072
373 Ga0207639_10108039 3300026041 Bacteria 2261
374 Ga0207678_10030183 3300026067 Bacteria 4733
375 Ga0207678_10255594 3300026067 Bacteria 1501
376 Ga0207708_10003376 3300026075 Bacteria 11772
377 Ga0207702_10007759 3300026078 Bacteria 9110
378 Ga0207702_10087049 3300026078 Bacteria 2726
379 Ga0207641_10000012 3300026088 Bacteria 375486
380 Ga0207641_10005717 3300026088 Bacteria 10568
381 Ga0207641_10020165 3300026088 Bacteria 5473
382 Ga0207641_10037909 3300026088 Bacteria 4027
383 Ga0207641_10187110 3300026088 Bacteria 1900
384 Ga0207648_10001100 3300026089 Bacteria 30324
385 Ga0207648_10073931 3300026089 Bacteria 2970
386 Ga0207676_10000001 3300026095 Bacteria 1439222
387 Ga0207676_10002359 3300026095 Bacteria 13494
388 Ga0207676_10161356 3300026095 Bacteria 1942
389 Ga0207674_10010079 3300026116 Bacteria 10746
390 Ga0207674_10122225 3300026116 Bacteria 2570
391 Ga0207674_10143827 3300026116 Bacteria 2344
392 Ga0207675_100004034 3300026118 Bacteria 14233
393 Ga0207675_100043976 3300026118 Bacteria 4171
394 Ga0207675_100074454 3300026118 Bacteria 3177
395 Ga0207675_100097050 3300026118 Bacteria 2775
396 Ga0207675_100181472 3300026118 Bacteria 2016
397 Ga0207683_10000698 3300026121 Bacteria 30636
398 Ga0207683_10000825 3300026121 Bacteria 28372
399 Ga0207698_10075126 3300026142 Bacteria 2699
400 Ga0209983_1006458 3300027665 Bacteria 2408
401 Ga0209588_1033453 3300027671 Bacteria 1648
402 Ga0209971_1000386 3300027682 Bacteria 12051
403 Ga0207428_10001035 3300027907 Bacteria 30658
404 Ga0207428_10003754 3300027907 Bacteria 14582
405 Ga0207428_10063991 3300027907 Bacteria 2904
406 Ga0207428_10064691 3300027907 Bacteria 2887
407 Ga0268266_10003314 3300028379 Bacteria 16169
408 Ga0268266_10026752 3300028379 Bacteria 4908
409 Ga0268266_10179954 3300028379 Bacteria 1924
410 Ga0268265_10000288 3300028380 Bacteria 56817
411 Ga0268265_10000750 3300028380 Bacteria 31594
412 Ga0268265_10088736 3300028380 Bacteria 2464
413 Ga0268264_10000419 3300028381 Bacteria 59940
414 Ga0268264_10001691 3300028381 Bacteria 20334
415 Ga0268264_10193978 3300028381 Bacteria 1853
416 Ga0265334_10000017 3300028573 Bacteria 147461
417 Ga0265318_10000018 3300028577 Bacteria 173038
418 Ga0307517_10018255 3300028786 Bacteria 9086
419 Ga0307515_10061623 3300028794 Bacteria 5316
420 Ga0307515_10164957 3300028794 Bacteria 2238
421 Ga0265338_10061169 3300028800 Bacteria 3302
422 Ga0265338_10102528 3300028800 Bacteria 2327
423 Ga0307511_10011792 3300030521 Bacteria 8603
424 Ga0265332_10002592 3300031238 Bacteria 9146
425 Ga0265339_10004112 3300031249 Bacteria 10030
426 Ga0265331_10000337 3300031250 Bacteria 50233
427 Ga0265327_10000008 3300031251 Bacteria 658870
428 Ga0265327_10000696 3300031251 Bacteria 53491
429 Ga0265327_10001626 3300031251 Bacteria 27106
430 Ga0265316_10001097 3300031344 Bacteria 29331
431 Ga0307513_10005329 3300031456 Bacteria 17015
432 Ga0307513_10107698 3300031456 Bacteria 2790
433 Ga0307509_10061048 3300031507 Bacteria 3982
434 Ga0265313_10000022 3300031595 Bacteria 144838
435 Ga0307508_10000537 3300031616 Bacteria 45080
436 Ga0307508_10054128 3300031616 Bacteria 3559
437 Ga0307508_10115385 3300031616 Bacteria 2287
438 Ga0316575_10028428 3300031665 Bacteria 2181
439 Ga0316575_10046820 3300031665 Bacteria 1718
440 Ga0316579_10066768 3300031691 Bacteria 1699
441 Ga0265314_10035513 3300031711 Bacteria 3632
442 Ga0265314_10049811 3300031711 Bacteria 2930
443 Ga0265342_10000150 3300031712 Bacteria 78890
444 Ga0265342_10009942 3300031712 Bacteria 6651
445 Ga0316576_10000840 3300031727 Bacteria 15545
446 Ga0316576_10003350 3300031727 Bacteria 9372
447 Ga0316576_10008620 3300031727 Bacteria 6520
448 Ga0316576_10018774 3300031727 Bacteria 4729
449 Ga0316576_10019577 3300031727 Bacteria 4639
450 Ga0316576_10033505 3300031727 Bacteria 3657
451 Ga0316576_10033527 3300031727 Bacteria 3656
452 Ga0316576_10034042 3300031727 Bacteria 3630
453 Ga0316576_10093617 3300031727 Bacteria 2240
454 Ga0316578_10000632 3300031728 Bacteria 12443
455 Ga0316578_10006285 3300031728 Bacteria 5848
456 Ga0316578_10019684 3300031728 Bacteria 3720
457 Ga0316578_10030651 3300031728 Bacteria 3058
458 Ga0316578_10049391 3300031728 Bacteria 2458
459 Ga0316578_10083196 3300031728 Bacteria 1906
460 Ga0316577_10006744 3300031733 Bacteria 6091
461 Ga0316577_10033917 3300031733 Bacteria 2852
462 Ga0316577_10042326 3300031733 Bacteria 2548
463 Ga0316577_10050538 3300031733 Bacteria 2321
464 Ga0316577_10081354 3300031733 Bacteria 1811
465 Ga0307413_10027626 3300031824 Bacteria 3147
466 Ga0307413_10071455 3300031824 Bacteria 2187
467 Ga0307413_10079811 3300031824 Bacteria 2093
468 Ga0307410_10027562 3300031852 Bacteria 3592
469 Ga0307406_10053094 3300031901 Bacteria 2581
470 Ga0307406_10060203 3300031901 Bacteria 2447
471 Ga0307407_10039628 3300031903 Bacteria 2621
472 Ga0307407_10039691 3300031903 Bacteria 2619
473 Ga0307409_100024830 3300031995 Bacteria 4189
474 Ga0307416_100017882 3300032002 Bacteria 4976
475 Ga0307416_100081616 3300032002 Bacteria 2735
476 Ga0307416_100122574 3300032002 Bacteria 2321
477 Ga0307414_10001865 3300032004 Bacteria 10895
478 Ga0307414_10053051 3300032004 Bacteria 2826
479 Ga0307411_10000376 3300032005 Bacteria 15191
480 Ga0307411_10062865 3300032005 Bacteria 2478
481 Ga0307411_10117716 3300032005 Bacteria 1915
482 Ga0307415_100013273 3300032126 Bacteria 4803
483 Ga0307415_100196960 3300032126 Bacteria 1595
484 Ga0316583_10010214 3300032133 Bacteria 3383
485 Ga0316583_10018886 3300032133 Bacteria 2476
486 Ga0316580_10030790 3300032139 Bacteria 1662
487 Ga0373940_0034671 3300035088 Bacteria 1363
488 Ga0373949_0000951 3300035090 Bacteria 8980
489 Ga0373955_0049692 3300035172 Bacteria 2278
490 Ga0373942_0007594 3300035207 Bacteria 2518
491 Ga0316574_0002485 3300035398 Bacteria 9261
492 Ga0316574_0009334 3300035398 Bacteria 5493
493 Ga0316574_0054924 3300035398 Bacteria 2488
494 Ga0373935_0007615 3300035692 Bacteria 6487
495 Ga0373927_0000003 3300035695 Bacteria 480348
496 Ga0373947_0084854 3300035725 Bacteria 1966
497 Ga0373937_0001072 3300036401 Bacteria 23084
498 Ga0373937_0053691 3300036401 Bacteria 3696
499 Ga0373937_0205345 3300036401 Bacteria 1853
500 Ga0316582_0007070 3300036647 Bacteria 5958
501 Ga0316582_0102397 3300036647 Bacteria 1898
502 Ga0316584_0000420 3300036712 Bacteria 22076
503 Ga0316584_0032212 3300036712 Bacteria 3879
504 Ga0316584_0036815 3300036712 Bacteria 3632
505 Ga0316584_0096468 3300036712 Bacteria 2213
506 Ga0316584_0098186 3300036712 Bacteria 2193
507 Ga0316584_0128624 3300036712 Bacteria 1892
508 Ga0373925_0031321 3300037068 Bacteria 3908
509 Ga0373925_0081095 3300037068 Bacteria 2467
510 Ga0395899_0004071 3300037312 Bacteria 11522
511 Ga0395900_0003648 3300037418 Bacteria 16550
512 Ga0395900_0052210 3300037418 Bacteria 4208
513 Ga0395900_0104362 3300037418 Bacteria 2912
514 Ga0395900_0160786 3300037418 Bacteria 2291
515 Ga0395898_0002144 3300037466 Bacteria 24310
516 Ga0395898_0013402 3300037466 Bacteria 8444
517 Ga0395898_0031995 3300037466 Bacteria 5251
518 Ga0395905_0000145 3300037471 Bacteria 116795
519 Ga0395905_0001178 3300037471 Bacteria 32675
520 Ga0395905_0121103 3300037471 Bacteria 2459
521 Ga0395905_0137615 3300037471 Unclassified 2298
522 Ga0316581_0009548 3300037588 Bacteria 2670
523 Ga0436364_0158752 3300037853 Bacteria 1866
524 Ga0436364_0432318 3300037853 Bacteria 56122
525 Ga0395901_0001254 3300038443 Bacteria 26979
526 Ga0395901_0093201 3300038443 Bacteria 3153
527 Ga0395901_0094882 3300038443 Bacteria 3126
528 Ga0395901_0113641 3300038443 Bacteria 2844
529 Ga0395901_0179431 3300038443 Bacteria 2221
530 Ga0400490_46219 3300038726 Bacteria 20743
531 Ga0400485_13208 3300038735 Bacteria 6790
532 Ga0400485_16317 3300038735 Bacteria 1460
533 Ga0400488_17591 3300038741 Bacteria 1508
534 Ga0400486_11253 3300038742 Unclassified 1910
535 Ga0400486_23182 3300038742 Bacteria 11956
536 Ga0400483_001761 3300039062 Bacteria 3404
537 Ga0400483_204516 3300039062 Bacteria 1586
538 Ga0400483_212392 3300039062 Bacteria 8447
539 Ga0400483_280760 3300039062 Bacteria 5718
540 Ga0400487_05423 3300039110 Bacteria 5710
541 Ga0400487_59306 3300039110 Bacteria 2535
542 Ga0436365_0749742 3300039437 Bacteria 107056
543 Ga0436361_0015804 3300039447 Bacteria 7667
544 Ga0436361_0046882 3300039447 Bacteria 5171
545 Ga0436361_0049245 3300039447 Bacteria 3528
546 Ga0436361_0271669 3300039447 Bacteria 15881
547 Ga0436361_0298070 3300039447 Bacteria 21162
548 Ga0436361_0446120 3300039447 Bacteria 25100
549 Ga0436361_0464290 3300039447 Bacteria 2648
550 Ga0436361_0585829 3300039447 Bacteria 9342
551 Ga0436361_0589265 3300039447 Bacteria 45710
552 Ga0436361_0629359 3300039447 Bacteria 14562
553 Ga0436361_0735177 3300039447 Bacteria 29126
554 Ga0436361_0778877 3300039447 Bacteria 10989
555 Ga0436361_0860856 3300039447 Bacteria 3196
556 Ga0436361_0946815 3300039447 Bacteria 1534
557 Ga0436361_1123843 3300039447 Bacteria 3604
558 Ga0436363_1440181 3300039450 Bacteria 1329
559 Ga0436362_0157410 3300039453 Bacteria 11708
560 Ga0439461_0000037 3300041410 Bacteria 16309
561 Ga0439465_0005600 3300041413 Bacteria 4001
562 Ga0439465_0025870 3300041413 Bacteria 1854
563 Ga0439431_0000035 3300041997 Bacteria 20455
564 Ga0439431_0025194 3300041997 Bacteria 1451
565 Ga0439442_004776 3300042002 Bacteria 2695
566 Ga0439445_0002180 3300042004 Bacteria 4343
567 Ga0439432_000347 3300042006 Bacteria 16905
568 Ga0439452_016834 3300042010 Bacteria 1978
569 Ga0439462_0004168 3300042015 Bacteria 3517
570 Ga0439462_0012344 3300042015 Bacteria 2181
571 Ga0439434_0001167 3300042435 Bacteria 7599
572 Ga0451577_0033328 3300042876 Bacteria 4643
573 Ga0451577_0058703 3300042876 Bacteria 3430
574 Ga0453683_0120161 3300044673 Bacteria 1654
575 Ga0466963_0010075 3300044694 Bacteria 5715
576 Ga0453684_0000681 3300044712 Bacteria 121111
577 Ga0453684_0003515 3300044712 Bacteria 35112
578 Ga0453684_0005989 3300044712 Bacteria 23556
579 Ga0453684_0034569 3300044712 Bacteria 7012
580 Ga0466957_0010995 3300044842 Bacteria 5206
581 Ga0466957_0086706 3300044842 Bacteria 1956
582 Ga0451576_0008922 3300045051 Bacteria 11698
583 Ga0451576_0011409 3300045051 Bacteria 10098
584 Ga0451576_0015073 3300045051 Bacteria 8584
585 Ga0451576_0109584 3300045051 Bacteria 2873
586 Ga0451576_0115872 3300045051 Bacteria 2790
587 Ga0466958_0031993 3300045836 Bacteria 3128
588 Ga0466967_0003375 3300045976 Bacteria 10398
589 Ga0495627_000120 3300046453 Bacteria 97375
590 Ga0495603_0003297 3300046455 Bacteria 9608
591 Ga0495590_0001850 3300046457 Bacteria 8950
592 Ga0495629_0057403 3300046459 Bacteria 2722
593 Ga0495638_0000920 3300046460 Bacteria 29986
594 Ga0495650_0000020 3300046471 Bacteria 533839
595 Ga0495580_0108750 3300046472 Bacteria 1925
596 Ga0495580_0131810 3300046472 Bacteria 1734
597 Ga0495582_0021989 3300046473 Bacteria 3489
598 Ga0495585_0037859 3300046492 Bacteria 2716
599 Ga0495594_0089251 3300046499 Bacteria 1726
600 Ga0495583_0000069 3300046506 Bacteria 186863
601 Ga0495610_0007069 3300046512 Bacteria 7579
602 Ga0495610_0007751 3300046512 Bacteria 7086
603 Ga0495620_0015363 3300046515 Bacteria 3869
604 Ga0495630_0212835 3300046517 Bacteria 1475
605 Ga0495632_0049547 3300046519 Bacteria 2075
606 Ga0495643_0010185 3300046522 Bacteria 5795
607 Ga0495648_0027842 3300046524 Bacteria 3776
608 Ga0495597_0008164 3300046542 Bacteria 5265
609 Ga0495622_0005156 3300046557 Bacteria 6060
610 Ga0495633_0065119 3300046558 Bacteria 1704
611 Ga0495668_0000186 3300046616 Bacteria 92604
612 Ga0495668_0025388 3300046616 Bacteria 3367
613 Ga0495625_0158580 3300046660 Bacteria 1517
614 Ga0495669_0000001 3300046684 Bacteria 291866
615 Ga0495669_0016596 3300046684 Bacteria 3154
616 Ga0495669_0042831 3300046684 Bacteria 2014
617 Ga0495624_0035188 3300046690 Bacteria 3234
618 Ga0495670_0000007 3300046691 Bacteria 247088
619 Ga0495672_0004324 3300047320 Bacteria 11699
620 Ga0495672_0015997 3300047320 Bacteria 5076
621 Ga0495672_0033183 3300047320 Bacteria 3201
622 Ga0495672_0053807 3300047320 Bacteria 2356
623 Ga0495676_0000334 3300047321 Bacteria 38217
624 Ga0495673_0000403 3300047469 Bacteria 50650
625 Ga0495686_0000765 3300047472 Bacteria 42391
626 Ga0495686_0001049 3300047472 Bacteria 33132
627 Ga0495686_0010359 3300047472 Bacteria 6636
628 Ga0495686_0043009 3300047472 Bacteria 2868
629 Ga0495593_0037701 3300047673 Bacteria 2613
630 Ga0496102_0011343 3300048905 Bacteria 7677
631 Ga0496102_0048500 3300048905 Bacteria 3861
632 Ga0496103_0005222 3300048906 Bacteria 7803
633 Ga0496106_0004061 3300048909 Bacteria 10921
634 Ga0496106_0065136 3300048909 Bacteria 2774
635 Ga0496106_0145614 3300048909 Bacteria 1866
636 Ga0496107_0015512 3300048910 Bacteria 5343
637 Ga0496110_0138219 3300048913 Bacteria 2203
638 Ga0496112_0053926 3300048915 Bacteria 3950
639 Ga0496112_0079875 3300048915 Bacteria 3235
640 Ga0496112_0164576 3300048915 Bacteria 2184
641 Ga0496115_0002266 3300048918 Bacteria 13774
642 Ga0496116_0033178 3300048919 Bacteria 3667
643 Ga0496117_0032808 3300048920 Bacteria 3938
644 Ga0496118_0030172 3300048921 Bacteria 4531
645 Ga0496118_0075207 3300048921 Bacteria 2410
646 Ga0496119_0024037 3300048922 Bacteria 4301
647 Ga0496121_0000009 3300048924 Bacteria 836971
648 Ga0496121_0000631 3300048924 Bacteria 65738
649 Ga0496122_0023547 3300048925 Bacteria 5423
650 Ga0496123_0006810 3300048926 Bacteria 10969
651 Ga0496125_0001837 3300048928 Bacteria 29288
652 Ga0496125_0037060 3300048928 Bacteria 4245
653 Ga0496125_0070035 3300048928 Bacteria 2748
654 Ga0496126_0148069 3300048929 Bacteria 2014
655 Ga0495678_000738 3300049459 Bacteria 29701
656 Ga0501031_0023554 3300049568 Bacteria 4013
657 Ga0501032_0002952 3300049569 Bacteria 13214
658 Ga0501032_0026073 3300049569 Bacteria 4026
659 Ga0501032_0054951 3300049569 Bacteria 2679
660 Ga0501033_0003092 3300049570 Bacteria 13826
661 Ga0501033_0007825 3300049570 Bacteria 8282
662 Ga0501033_0068432 3300049570 Bacteria 2610
663 Ga0501033_0074238 3300049570 Bacteria 2497
664 Ga0501033_0134506 3300049570 Bacteria 1789
665 Ga0501033_0196739 3300049570 Bacteria 1441
666 Ga0501034_0000013 3300049571 Bacteria 297898
667 Ga0501034_0000280 3300049571 Bacteria 91814
668 Ga0501034_0000415 3300049571 Bacteria 71688
669 Ga0501034_0002434 3300049571 Bacteria 22482
670 Ga0501034_0038952 3300049571 Bacteria 4814
671 Ga0501034_0126795 3300049571 Bacteria 2537
672 Ga0501034_0171074 3300049571 Bacteria 2140
673 Ga0501036_0002006 3300049572 Bacteria 15824
674 Ga0501036_0198380 3300049572 Bacteria 1688
675 Ga0501037_0000487 3300049573 Bacteria 32144
676 Ga0501037_0009708 3300049573 Bacteria 7064
677 Ga0501037_0014451 3300049573 Bacteria 5810
678 Ga0501037_0068411 3300049573 Bacteria 2585
679 Ga0501038_0000308 3300049574 Bacteria 41640
680 Ga0501038_0016356 3300049574 Bacteria 6725
681 Ga0501038_0056902 3300049574 Bacteria 3358
682 Ga0501039_0000249 3300049575 Bacteria 39312
683 Ga0501039_0019968 3300049575 Bacteria 5136
684 Ga0501040_0108460 3300049576 Bacteria 1941
685 Ga0501041_0037142 3300049577 Bacteria 2951
686 Ga0501041_0067686 3300049577 Bacteria 2189
687 Ga0501043_0002326 3300049579 Bacteria 16096
688 Ga0501043_0167113 3300049579 Bacteria 1717
689 Ga0501046_0004392 3300049580 Bacteria 12813
690 Ga0501046_0041049 3300049580 Bacteria 3693
691 Ga0501046_0068682 3300049580 Bacteria 2758
692 Ga0501046_0154565 3300049580 Bacteria 1729
693 Ga0501047_0000469 3300049581 Bacteria 43881
694 Ga0501047_0001112 3300049581 Bacteria 26731
695 Ga0501047_0024082 3300049581 Bacteria 5846
696 Ga0501047_0050924 3300049581 Bacteria 3999
697 Ga0501047_0169676 3300049581 Bacteria 2051
698 Ga0501047_0187158 3300049581 Bacteria 1935
699 Ga0501048_0032975 3300049582 Bacteria 3743
700 Ga0501048_0121820 3300049582 Bacteria 1843
701 Ga0501067_0001487 3300049583 Bacteria 12752
702 Ga0501067_0008213 3300049583 Bacteria 5796
703 Ga0501067_0031419 3300049583 Bacteria 2946
704 Ga0501067_0082488 3300049583 Bacteria 1783
705 Ga0501068_0017699 3300049584 Bacteria 4123
706 Ga0501068_0117881 3300049584 Bacteria 1654
707 Ga0501069_0000411 3300049585 Bacteria 19421
708 Ga0501069_0011302 3300049585 Bacteria 4734
709 Ga0501070_0004769 3300049586 Bacteria 11606
710 Ga0501070_0006021 3300049586 Bacteria 10331
711 Ga0501070_0066390 3300049586 Bacteria 2987
712 Ga0501070_0095433 3300049586 Bacteria 2460
713 Ga0501070_0207224 3300049586 Bacteria 1610
714 Ga0501071_0019726 3300049587 Bacteria 4680
715 Ga0501072_0005781 3300049588 Bacteria 9419
716 Ga0501072_0036829 3300049588 Bacteria 3836
717 Ga0501072_0138994 3300049588 Bacteria 1937
718 Ga0501073_0001711 3300049589 Bacteria 16281
719 Ga0501073_0002016 3300049589 Bacteria 15167
720 Ga0501073_0007841 3300049589 Bacteria 7928
721 Ga0501073_0017023 3300049589 Bacteria 5267
722 Ga0501073_0029602 3300049589 Bacteria 3912
723 Ga0501074_0007384 3300049590 Bacteria 7949
724 Ga0501074_0015001 3300049590 Bacteria 5639
725 Ga0501075_0024615 3300049591 Bacteria 4418
726 Ga0501075_0071806 3300049591 Bacteria 2616
727 Ga0501075_0076710 3300049591 Bacteria 2528
728 Ga0501076_0021969 3300049592 Bacteria 4901
729 Ga0501076_0044295 3300049592 Bacteria 3509
730 Ga0501077_0040685 3300049593 Bacteria 2961
731 Ga0501202_013954 3300049652 Bacteria 1534
732 Ga0501209_031992 3300049656 Bacteria 1340
733 Ga0501079_0045657 3300049741 Bacteria 3381
734 Ga0501079_0046828 3300049741 Bacteria 3337
735 Ga0501079_0060684 3300049741 Bacteria 2917
736 Ga0501080_0000003 3300049742 Bacteria 214890
737 Ga0501080_0000644 3300049742 Bacteria 27691
738 Ga0501080_0001724 3300049742 Bacteria 18686
739 Ga0501080_0010976 3300049742 Bacteria 8292
740 Ga0501080_0026308 3300049742 Bacteria 5406
741 Ga0501080_0109696 3300049742 Bacteria 2558
742 Ga0501080_0300274 3300049742 Bacteria 1457
743 Ga0501081_0015052 3300049743 Bacteria 5103
744 Ga0501081_0024684 3300049743 Bacteria 4039
745 Ga0501083_0021974 3300049744 Bacteria 4430
746 Ga0501083_0030932 3300049744 Bacteria 3674
747 Ga0501035_0000058 3300049822 Bacteria 135089
748 Ga0501035_0072898 3300049822 Bacteria 3038
749 Ga0501035_0087628 3300049822 Bacteria 2743
750 Ga0501035_0179705 3300049822 Bacteria 1823
751 Ga0501044_0000023 3300049823 Bacteria 196555
752 Ga0501044_0001009 3300049823 Bacteria 33822
753 Ga0501044_0004049 3300049823 Bacteria 16444
754 Ga0501044_0005168 3300049823 Bacteria 14535
755 Ga0501044_0033646 3300049823 Bacteria 5384
756 Ga0501044_0055196 3300049823 Bacteria 4081
757 Ga0501044_0086360 3300049823 Bacteria 3169
758 Ga0501044_0286709 3300049823 Bacteria 1579
759 Ga0501045_0034360 3300049824 Bacteria 3681
760 nmdc:mga05p37_102615_c1 3300050507 Bacteria 3522
761 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
762 nmdc:mga05p37_171826_c1 3300050507 Bacteria 2643
763 nmdc:mga05p37_3462_c1 3300050507 Bacteria 18433
764 nmdc:mga05p37_99101_c1 3300050507 Bacteria 3590
765 nmdc:mga09592_13954_c1 3300050508 Bacteria 6562
766 nmdc:mga09592_21823_c1 3300050508 Bacteria 5280
767 nmdc:mga09592_25243_c1 3300050508 Bacteria 4917
768 nmdc:mga09592_77530_c1 3300050508 Bacteria 2827
769 nmdc:mga0qj67_145886_c1 3300050509 Bacteria 1919
770 nmdc:mga0qj67_226381_c1 3300050509 Bacteria 1518
771 nmdc:mga0qj67_2734_c1 3300050509 Bacteria 12645
772 nmdc:mga0qj67_29305_c1 3300050509 Bacteria 4276
773 nmdc:mga06r32_1042_c1 3300050510 Bacteria 25028
774 nmdc:mga06r32_143618_c1 3300050510 Bacteria 2364
775 nmdc:mga06r32_219628_c1 3300050510 Bacteria 1889
776 nmdc:mga06r32_3549_c1 3300050510 Bacteria 13927
777 nmdc:mga06r32_55420_c1 3300050510 Bacteria 3803
778 nmdc:mga06r32_86749_c1 3300050510 Bacteria 3053
779 nmdc:mga08y16_120640_c1 3300050511 Bacteria 2728
780 nmdc:mga08y16_146126_c1 3300050511 Bacteria 2458
781 nmdc:mga08y16_155884_c1 3300050511 Bacteria 2373
782 nmdc:mga08y16_1630_c3 3300050511 Bacteria 9162
783 nmdc:mga08y16_412_c1 3300050511 Bacteria 39249
784 nmdc:mga08y16_47_c1 3300050511 Bacteria 111829
785 nmdc:mga08y16_5453_c1 3300050511 Bacteria 13298
786 nmdc:mga08y16_61415_c1 3300050511 Bacteria 3924
787 nmdc:mga0n895_107089_c1 3300050512 Bacteria 2809
788 nmdc:mga0n895_166685_c1 3300050512 Bacteria 2235
789 nmdc:mga0rr50_47905_c1 3300050513 Bacteria 3156
790 nmdc:mga0rr50_98_c1 3300050513 Bacteria 48790
791 nmdc:mga0rr50_9938_c1 3300050513 Bacteria 6015
792 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
793 nmdc:mga08x19_744_c1 3300050514 Bacteria 20777
794 nmdc:mga0a205_226255_c1 3300050515 Bacteria 1755
795 nmdc:mga0sz30_10065_c1 3300050516 Bacteria 3615
796 Ga0500635_0000341 3300053080 Bacteria 15509
797 Ga0495619_0013355 3300053085 Bacteria 5175
798 Ga0500578_0070210 3300053086 Bacteria 2233
799 Ga0500643_007932 3300053087 Bacteria 4224
800 Ga0500643_011262 3300053087 Bacteria 3272
801 Ga0500644_0000417 3300053088 Bacteria 20038
802 Ga0500651_0026285 3300053093 Bacteria 3657
803 Ga0500566_0000395 3300053094 Bacteria 24231
804 Ga0500566_0014059 3300053094 Bacteria 4705
805 Ga0500566_0040118 3300053094 Bacteria 2706
806 Ga0500641_0021637 3300053096 Bacteria 2455
807 Ga0500641_0024141 3300053096 Bacteria 2342
808 Ga0500650_0000012 3300053098 Bacteria 81170
809 Ga0500554_009814 3300053102 Bacteria 2306
810 Ga0500555_002402 3300053103 Bacteria 5443
811 Ga0500555_010087 3300053103 Bacteria 2704
812 Ga0500556_0003170 3300053104 Bacteria 4898
813 Ga0500562_000746 3300053108 Bacteria 7911
814 Ga0500569_003491 3300053109 Bacteria 3221
815 Ga0500594_0000383 3300053118 Bacteria 9907
816 Ga0500594_0001236 3300053118 Bacteria 5529
817 Ga0500595_001105 3300053119 Bacteria 14963
818 Ga0500595_002031 3300053119 Bacteria 10344
819 Ga0500595_002725 3300053119 Bacteria 8557
820 Ga0500608_000062 3300053122 Bacteria 46850
821 Ga0500608_000926 3300053122 Bacteria 10538
822 Ga0500608_001411 3300053122 Bacteria 8596
823 Ga0500614_000989 3300053123 Bacteria 7062
824 Ga0500618_000533 3300053125 Bacteria 23792
825 Ga0500642_0000312 3300053130 Bacteria 17022
826 Ga0500642_0004595 3300053130 Bacteria 4346
827 Ga0500642_0073457 3300053130 Bacteria 1559
828 Ga0500658_0000344 3300053134 Bacteria 20695
829 Ga0500658_0030889 3300053134 Bacteria 2093
830 Ga0500658_0032817 3300053134 Bacteria 2038
831 Ga0500559_0009681 3300053136 Bacteria 4161
832 Ga0500559_0043839 3300053136 Bacteria 1955
833 Ga0500564_000244 3300053138 Bacteria 15171
834 Ga0500564_011844 3300053138 Bacteria 3859
835 Ga0500568_0002926 3300053139 Bacteria 9788
836 Ga0500568_0012589 3300053139 Bacteria 3883
837 Ga0500568_0026297 3300053139 Bacteria 2444
838 Ga0500573_0023904 3300053140 Bacteria 3511
839 Ga0500588_0001206 3300053146 Bacteria 4785
840 Ga0500590_008548 3300053148 Bacteria 5113
841 Ga0500604_0001150 3300053151 Bacteria 7350
842 Ga0500616_0000388 3300053153 Bacteria 61251
843 Ga0500616_0021719 3300053153 Bacteria 3594
844 Ga0500622_0019273 3300053156 Bacteria 3624
845 Ga0500636_0029081 3300053177 Bacteria 3263
846 Ga0500637_0023041 3300053178 Bacteria 3399
847 Ga0500637_0023688 3300053178 Bacteria 3360
848 Ga0500645_010755 3300053730 Bacteria 3010
849 Ga0501084_0000713 3300054114 Bacteria 25334
850 Ga0501084_0044062 3300054114 Bacteria 3734
851 Ga0501084_0116577 3300054114 Bacteria 2245
852 Ga0590077_007197 3300059426 Bacteria 2277
853 Ga0501082_0002642 3300060353 Bacteria 15680
854 Ga0501082_0003016 3300060353 Bacteria 14713
855 Ga0501082_0003390 3300060353 Bacteria 13908
856 Ga0530510_0002688 3300061734 Bacteria 12216

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0108750 Ga0495580_0108750_11_1096 351
2 3300045051 Ga0451576_0109584 Ga0451576_0109584_1797_2855 352
3 3300049583 Ga0501067_0082488 Ga0501067_0082488_298_1449 352
4 3300047472 Ga0495686_0010359 Ga0495686_0010359_4153_5457 357
5 3300046684 Ga0495669_0016596 Ga0495669_0016596_1613_2893 358
6 3300047472 Ga0495686_0043009 Ga0495686_0043009_490_1809 359
7 3300005617 Ga0068859_100000177 Ga0068859_10000017735 361
8 3300006931 Ga0097620_100000177 Ga0097620_10000017735 361
9 3300025941 Ga0207711_10020671 Ga0207711_100206714 361
10 3300042876 Ga0451577_0033328 Ga0451577_0033328_2008_3300 362
11 3300044712 Ga0453684_0005989 Ga0453684_0005989_1460_2752 362
12 3300037471 Ga0395905_0000145 Ga0395905_0000145_98202_99548 365
13 3300037471 Ga0395905_0121103 Ga0395905_0121103_774_2120 365
14 3300006177 Ga0075362_10051556 Ga0075362_100515561 366
15 3300049579 Ga0501043_0167113 Ga0501043_0167113_132_1406 366
16 3300049823 Ga0501044_0033646 Ga0501044_0033646_1352_2626 366
17 3300027671 Ga0209588_1033453 Ga0209588_10334531 367
18 3300028800 Ga0265338_10061169 Ga0265338_100611692 367
19 3300038443 Ga0395901_0179431 Ga0395901_0179431_510_1856 367
20 3300039447 Ga0436361_1123843 Ga0436361_1123843_1205_2476 367
21 3300005548 Ga0070665_100059944 Ga0070665_1000599442 368
22 3300053086 Ga0500578_0070210 Ga0500578_0070210_271_1545 369
23 3300053096 Ga0500641_0024141 Ga0500641_0024141_872_2146 369
24 3300046691 Ga0495670_0000007 Ga0495670_0000007_216189_217460 370
25 3300049571 Ga0501034_0171074 Ga0501034_0171074_503_1777 370
26 3300049742 Ga0501080_0109696 Ga0501080_0109696_368_1642 370
27 3300031456 Ga0307513_10107698 Ga0307513_101076981 371
28 3300038443 Ga0395901_0113641 Ga0395901_0113641_1033_2301 371
29 3300053104 Ga0500556_0003170 Ga0500556_0003170_230_1792 371
30 3300041410 Ga0439461_0000037 Ga0439461_0000037_14975_16255 372
31 3300041413 Ga0439465_0025870 Ga0439465_0025870_17_1297 372
32 3300041997 Ga0439431_0000035 Ga0439431_0000035_17075_18355 372
33 3300042002 Ga0439442_004776 Ga0439442_004776_343_1623 372
34 3300042004 Ga0439445_0002180 Ga0439445_0002180_686_1966 372
35 3300042006 Ga0439432_000347 Ga0439432_000347_2671_3951 372
36 3300042015 Ga0439462_0004168 Ga0439462_0004168_1227_2507 372
37 3300042435 Ga0439434_0001167 Ga0439434_0001167_686_1966 372
38 3300046512 Ga0495610_0007751 Ga0495610_0007751_1281_2555 372
39 3300053103 Ga0500555_002402 Ga0500555_002402_1066_2340 372
40 3300053119 Ga0500595_001105 Ga0500595_001105_13534_14808 372
41 3300000041 ARcpr5oldR_c001570 ARcpr5oldR_0015702 374
42 3300041413 Ga0439465_0005600 Ga0439465_0005600_2176_3447 374
43 3300041997 Ga0439431_0025194 Ga0439431_0025194_126_1400 374
44 3300042010 Ga0439452_016834 Ga0439452_016834_467_1738 374
45 3300042015 Ga0439462_0012344 Ga0439462_0012344_75_1346 374
46 3300003215 JGI25153J46596_10000138 JGI25153J46596_1000013837 375
47 3300005844 Ga0068862_100015047 Ga0068862_1000150472 375
48 3300025297 Ga0209758_1000028 Ga0209758_1000028166 375
49 3300053139 Ga0500568_0002926 Ga0500568_0002926_1001_2275 375
50 3300053134 Ga0500658_0000344 Ga0500658_0000344_33_1304 376
51 3300005334 Ga0068869_100065272 Ga0068869_1000652722 377
52 3300025942 Ga0207689_10076726 Ga0207689_100767262 377
53 3300039447 Ga0436361_0778877 Ga0436361_0778877_6418_7698 377
54 3300053153 Ga0500616_0000388 Ga0500616_0000388_20092_21366 377
55 3300003322 rootL2_10042889 rootL2_100428892 378
56 3300049569 Ga0501032_0026073 Ga0501032_0026073_1398_2672 378
57 3300049581 Ga0501047_0001112 Ga0501047_0001112_8875_10149 378
58 3300049583 Ga0501067_0031419 Ga0501067_0031419_747_2021 378
59 3300049742 Ga0501080_0010976 Ga0501080_0010976_258_1532 378
60 3300049744 Ga0501083_0021974 Ga0501083_0021974_1768_3042 378
61 3300049823 Ga0501044_0005168 Ga0501044_0005168_6934_8208 378
62 3300054114 Ga0501084_0116577 Ga0501084_0116577_330_1604 378
63 3300060353 Ga0501082_0002642 Ga0501082_0002642_7516_8790 378
64 3300028577 Ga0265318_10000018 Ga0265318_1000001884 379
65 3300053093 Ga0500651_0026285 Ga0500651_0026285_282_1556 379
66 3300005471 Ga0070698_100004114 Ga0070698_10000411416 381
67 3300026118 Ga0207675_100004034 Ga0207675_1000040343 381
68 3300049586 Ga0501070_0095433 Ga0501070_0095433_509_1795 381
69 3300053130 Ga0500642_0000312 Ga0500642_0000312_13572_14846 381
70 3300002074 JGI24748J21848_1000029 JGI24748J21848_100002948 382
71 3300002239 JGI24034J26672_10000006 JGI24034J26672_10000006195 382
72 3300002244 JGI24742J22300_10001915 JGI24742J22300_100019154 382
73 3300037471 Ga0395905_0001178 Ga0395905_0001178_30936_32282 382
74 3300014325 Ga0163163_10017137 Ga0163163_100171373 383
75 3300044712 Ga0453684_0000681 Ga0453684_0000681_60814_62103 383
76 3300048909 Ga0496106_0145614 Ga0496106_0145614_73_1464 383
77 3300053087 Ga0500643_011262 Ga0500643_011262_1694_2995 383
78 3300053139 Ga0500568_0026297 Ga0500568_0026297_1046_2347 383
79 3300025258 Ga0209129_1015754 Ga0209129_10157541 384
80 3300049571 Ga0501034_0000280 Ga0501034_0000280_21700_23037 384
81 3300053151 Ga0500604_0001150 Ga0500604_0001150_622_1896 384
82 3300013296 Ga0157374_10000713 Ga0157374_1000071324 385
83 3300025294 Ga0209025_1000384 Ga0209025_100038468 385
84 3300005983 Ga0081540_1028352 Ga0081540_10283524 386
85 3300010375 Ga0105239_10232135 Ga0105239_102321351 386
86 3300006186 Ga0075369_10011160 Ga0075369_100111602 387
87 3300013100 Ga0157373_10028230 Ga0157373_100282304 387
88 3300025933 Ga0207706_10065816 Ga0207706_100658164 387
89 3300026067 Ga0207678_10255594 Ga0207678_102555942 387
90 3300050516 nmdc:mga0sz30_10065_c1 nmdc:mga0sz30_10065_c1_494_1777 387
91 3300047472 Ga0495686_0001049 Ga0495686_0001049_17891_19168 388
92 3300005366 Ga0070659_100079147 Ga0070659_1000791473 390
93 3300009177 Ga0105248_10003238 Ga0105248_100032387 390
94 3300021384 Ga0213876_10025628 Ga0213876_100256283 390
95 3300025941 Ga0207711_10039375 Ga0207711_100393752 390
96 3300053130 Ga0500642_0073457 Ga0500642_0073457_327_1517 390
97 3300037418 Ga0395900_0104362 Ga0395900_0104362_733_2043 392
98 3300037471 Ga0395905_0137615 Ga0395905_0137615_606_1916 392
99 3300005842 Ga0068858_100000098 Ga0068858_10000009854 393
100 3300014968 Ga0157379_10193810 Ga0157379_101938101 393
101 3300025925 Ga0207650_10143944 Ga0207650_101439442 393
102 3300025941 Ga0207711_10054444 Ga0207711_100544444 393
103 3300026035 Ga0207703_10000086 Ga0207703_1000008669 393
104 3300044712 Ga0453684_0003515 Ga0453684_0003515_13601_14926 393
105 3300053119 Ga0500595_002725 Ga0500595_002725_2695_3981 393
106 3300038735 Ga0400485_16317 Ga0400485_16317_15_1256 394
107 3300045051 Ga0451576_0015073 Ga0451576_0015073_1939_3228 394
108 3300031727 Ga0316576_10093617 Ga0316576_100936172 395
109 3300031728 Ga0316578_10006285 Ga0316578_100062853 395
110 3300036647 Ga0316582_0007070 Ga0316582_0007070_1259_2623 395
111 3300049570 Ga0501033_0074238 Ga0501033_0074238_1229_2437 395
112 iso_pu_bacteria 2821443989 2821445350 395
113 3300005841 Ga0068863_100026142 Ga0068863_1000261424 396
114 3300026088 Ga0207641_10020165 Ga0207641_100201655 396
115 3300005458 Ga0070681_10056714 Ga0070681_100567145 397
116 3300005530 Ga0070679_100076250 Ga0070679_1000762505 397
117 3300005841 Ga0068863_100016359 Ga0068863_1000163594 397
118 3300025912 Ga0207707_10010516 Ga0207707_100105164 397
119 3300025921 Ga0207652_10121877 Ga0207652_101218773 397
120 3300026088 Ga0207641_10005717 Ga0207641_100057176 397
121 3300031616 Ga0307508_10000537 Ga0307508_100005379 397
122 3300031616 Ga0307508_10054128 Ga0307508_100541282 397
123 3300036401 Ga0373937_0053691 Ga0373937_0053691_892_2256 397
124 3300053136 Ga0500559_0043839 Ga0500559_0043839_55_1329 397
125 3300005563 Ga0068855_100001436 Ga0068855_10000143620 399
126 3300025949 Ga0207667_10000735 Ga0207667_1000073531 399
127 3300031733 Ga0316577_10081354 Ga0316577_100813541 399
128 3300046453 Ga0495627_000120 Ga0495627_000120_89309_90589 399
129 3300046519 Ga0495632_0049547 Ga0495632_0049547_271_1551 399
130 3300046660 Ga0495625_0158580 Ga0495625_0158580_190_1464 399
131 3300046684 Ga0495669_0000001 Ga0495669_0000001_263735_265009 399
132 3300047320 Ga0495672_0004324 Ga0495672_0004324_3974_5254 399
133 3300049823 Ga0501044_0286709 Ga0501044_0286709_167_1456 399
134 3300053140 Ga0500573_0023904 Ga0500573_0023904_1369_2655 399
135 3300035207 Ga0373942_0007594 Ga0373942_0007594_780_2057 400
136 3300045976 Ga0466967_0003375 Ga0466967_0003375_252_1544 400
137 3300046492 Ga0495585_0037859 Ga0495585_0037859_416_1690 400
138 3300005843 Ga0068860_100167494 Ga0068860_1001674942 401
139 3300009553 Ga0105249_10007251 Ga0105249_100072513 401
140 3300025972 Ga0207668_10090960 Ga0207668_100909601 401
141 3300025986 Ga0207658_10113305 Ga0207658_101133051 401
142 3300028381 Ga0268264_10193978 Ga0268264_101939781 401
143 3300030521 Ga0307511_10011792 Ga0307511_100117927 401
144 3300031691 Ga0316579_10066768 Ga0316579_100667681 401
145 3300031727 Ga0316576_10033527 Ga0316576_100335274 401
146 3300031728 Ga0316578_10030651 Ga0316578_100306512 401
147 3300031733 Ga0316577_10033917 Ga0316577_100339172 401
148 3300032002 Ga0307416_100122574 Ga0307416_1001225742 401
149 3300032139 Ga0316580_10030790 Ga0316580_100307901 401
150 3300035172 Ga0373955_0049692 Ga0373955_0049692_141_1427 401
151 3300036401 Ga0373937_0001072 Ga0373937_0001072_1678_2964 401
152 3300037068 Ga0373925_0081095 Ga0373925_0081095_296_1582 401
153 3300037418 Ga0395900_0052210 Ga0395900_0052210_1412_2701 401
154 3300037466 Ga0395898_0013402 Ga0395898_0013402_4485_5774 401
155 3300038443 Ga0395901_0093201 Ga0395901_0093201_1827_3116 401
156 3300047320 Ga0495672_0053807 Ga0495672_0053807_756_2036 401
157 3300053134 Ga0500658_0032817 Ga0500658_0032817_174_1475 401
158 3300053085 Ga0495619_0013355 Ga0495619_0013355_1717_2994 402
159 3300053087 Ga0500643_007932 Ga0500643_007932_11_1291 402
160 3300053108 Ga0500562_000746 Ga0500562_000746_4832_6220 402
161 3300053122 Ga0500608_000926 Ga0500608_000926_476_1753 402
162 3300053153 Ga0500616_0021719 Ga0500616_0021719_2254_3534 402
163 3300005343 Ga0070687_100040250 Ga0070687_1000402501 403
164 3300005406 Ga0070703_10000544 Ga0070703_100005444 403
165 3300005440 Ga0070705_100000469 Ga0070705_10000046915 403
166 3300005441 Ga0070700_100001016 Ga0070700_1000010167 403
167 3300005444 Ga0070694_100009240 Ga0070694_1000092405 403
168 3300005455 Ga0070663_100002136 Ga0070663_1000021369 403
169 3300005467 Ga0070706_100052417 Ga0070706_1000524172 403
170 3300005518 Ga0070699_100001512 Ga0070699_10000151218 403
171 3300005536 Ga0070697_100007219 Ga0070697_1000072197 403
172 3300005545 Ga0070695_100003955 Ga0070695_1000039553 403
173 3300005546 Ga0070696_100000758 Ga0070696_10000075811 403
174 3300005547 Ga0070693_100006856 Ga0070693_1000068562 403
175 3300005549 Ga0070704_100037698 Ga0070704_1000376981 403
176 3300005617 Ga0068859_100004727 Ga0068859_10000472711 403
177 3300005719 Ga0068861_100104002 Ga0068861_1001040022 403
178 3300005843 Ga0068860_100002721 Ga0068860_10000272113 403
179 3300005844 Ga0068862_100005737 Ga0068862_1000057379 403
180 3300006844 Ga0075428_100011232 Ga0075428_1000112326 403
181 3300006846 Ga0075430_100006567 Ga0075430_1000065676 403
182 3300006931 Ga0097620_100004727 Ga0097620_10000472711 403
183 3300025885 Ga0207653_10002711 Ga0207653_100027113 403
184 3300025918 Ga0207662_10067368 Ga0207662_100673682 403
185 3300025942 Ga0207689_10014108 Ga0207689_100141087 403
186 3300025961 Ga0207712_10000922 Ga0207712_1000092225 403
187 3300026067 Ga0207678_10030183 Ga0207678_100301832 403
188 3300026075 Ga0207708_10003376 Ga0207708_1000337610 403
189 3300026095 Ga0207676_10161356 Ga0207676_101613561 403
190 3300026116 Ga0207674_10010079 Ga0207674_1001007911 403
191 3300026118 Ga0207675_100074454 Ga0207675_1000744543 403
192 3300028380 Ga0268265_10000750 Ga0268265_1000075026 403
193 3300028381 Ga0268264_10001691 Ga0268264_1000169114 403
194 3300035725 Ga0373947_0084854 Ga0373947_0084854_274_1566 403
195 3300036712 Ga0316584_0128624 Ga0316584_0128624_105_1391 403
196 3300039450 Ga0436363_1440181 Ga0436363_1440181_15_1304 403
197 3300046557 Ga0495622_0005156 Ga0495622_0005156_2025_3302 403
198 3300046558 Ga0495633_0065119 Ga0495633_0065119_227_1504 403
199 3300047320 Ga0495672_0033183 Ga0495672_0033183_1606_2883 403
200 3300048905 Ga0496102_0011343 Ga0496102_0011343_2097_3539 403
201 3300048906 Ga0496103_0005222 Ga0496103_0005222_700_2142 403
202 3300048909 Ga0496106_0004061 Ga0496106_0004061_6070_7512 403
203 3300048910 Ga0496107_0015512 Ga0496107_0015512_2768_4210 403
204 3300048928 Ga0496125_0001837 Ga0496125_0001837_7318_8613 403
205 3300049592 Ga0501076_0021969 Ga0501076_0021969_2679_3965 403
206 3300050508 nmdc:mga09592_21823_c1 nmdc:mga09592_21823_c1_264_1547 403
207 3300050509 nmdc:mga0qj67_29305_c1 nmdc:mga0qj67_29305_c1_1469_2752 403
208 3300050510 nmdc:mga06r32_55420_c1 nmdc:mga06r32_55420_c1_1331_2614 403
209 3300053178 Ga0500637_0023041 Ga0500637_0023041_1376_2653 403
210 3300053730 Ga0500645_010755 Ga0500645_010755_146_1426 403
211 3300001904 JGI24736J21556_1000120 JGI24736J21556_10001204 404
212 3300001979 JGI24740J21852_10010503 JGI24740J21852_100105032 404
213 3300002067 JGI24735J21928_10010617 JGI24735J21928_100106172 404
214 3300005329 Ga0070683_100129573 Ga0070683_1001295731 404
215 3300005457 Ga0070662_100127965 Ga0070662_1001279652 404
216 3300005535 Ga0070684_100056278 Ga0070684_1000562784 404
217 3300005577 Ga0068857_100126791 Ga0068857_1001267912 404
218 3300005834 Ga0068851_10010933 Ga0068851_100109334 404
219 3300013105 Ga0157369_10009868 Ga0157369_100098684 404
220 3300025904 Ga0207647_10000069 Ga0207647_1000006949 404
221 3300025911 Ga0207654_10006681 Ga0207654_100066814 404
222 3300025913 Ga0207695_10012923 Ga0207695_100129233 404
223 3300025914 Ga0207671_10002421 Ga0207671_100024218 404
224 3300025924 Ga0207694_10003033 Ga0207694_1000303312 404
225 3300025981 Ga0207640_10031574 Ga0207640_100315744 404
226 3300026041 Ga0207639_10108039 Ga0207639_101080392 404
227 3300026078 Ga0207702_10007759 Ga0207702_100077598 404
228 3300026116 Ga0207674_10122225 Ga0207674_101222252 404
229 3300026142 Ga0207698_10075126 Ga0207698_100751262 404
230 3300046471 Ga0495650_0000020 Ga0495650_0000020_161304_162599 404
231 3300046684 Ga0495669_0042831 Ga0495669_0042831_498_1829 404
232 3300048919 Ga0496116_0033178 Ga0496116_0033178_680_1975 404
233 3300005327 Ga0070658_10077335 Ga0070658_100773353 405
234 3300006844 Ga0075428_100005210 Ga0075428_1000052103 405
235 3300006846 Ga0075430_100002163 Ga0075430_10000216311 405
236 3300006847 Ga0075431_100000033 Ga0075431_10000003371 405
237 3300006880 Ga0075429_100118588 Ga0075429_1001185882 405
238 3300009094 Ga0111539_10003260 Ga0111539_1000326017 405
239 3300009147 Ga0114129_10001565 Ga0114129_100015653 405
240 3300025909 Ga0207705_10085236 Ga0207705_100852363 405
241 3300027907 Ga0207428_10003754 Ga0207428_1000375413 405
242 3300046473 Ga0495582_0021989 Ga0495582_0021989_1554_2828 405
243 3300048920 Ga0496117_0032808 Ga0496117_0032808_1158_2438 405
244 3300048921 Ga0496118_0030172 Ga0496118_0030172_858_2138 405
245 3300048922 Ga0496119_0024037 Ga0496119_0024037_206_1486 405
246 3300048924 Ga0496121_0000009 Ga0496121_0000009_772629_773909 405
247 3300048925 Ga0496122_0023547 Ga0496122_0023547_1840_3240 405
248 3300048926 Ga0496123_0006810 Ga0496123_0006810_3109_4509 405
249 3300049656 Ga0501209_031992 Ga0501209_031992_44_1261 405
250 3300050507 nmdc:mga05p37_14_c1 nmdc:mga05p37_14_c1_76940_78286 405
251 3300050508 nmdc:mga09592_25243_c1 nmdc:mga09592_25243_c1_458_1804 405
252 3300050510 nmdc:mga06r32_1042_c1 nmdc:mga06r32_1042_c1_10938_12284 405
253 3300050511 nmdc:mga08y16_412_c1 nmdc:mga08y16_412_c1_22364_23710 405
254 3300005618 Ga0068864_100001081 Ga0068864_1000010811 406
255 3300005841 Ga0068863_100001323 Ga0068863_10000132322 406
256 3300026088 Ga0207641_10000012 Ga0207641_1000001214 406
257 3300026095 Ga0207676_10002359 Ga0207676_100023591 406
258 3300037466 Ga0395898_0002144 Ga0395898_0002144_21720_23012 406
259 3300049577 Ga0501041_0067686 Ga0501041_0067686_403_1680 406
260 3300013100 Ga0157373_10023760 Ga0157373_100237603 407
261 3300031712 Ga0265342_10009942 Ga0265342_100099423 407
262 3300037312 Ga0395899_0004071 Ga0395899_0004071_9916_11193 407
263 3300037418 Ga0395900_0003648 Ga0395900_0003648_7873_9150 407
264 3300037466 Ga0395898_0031995 Ga0395898_0031995_2828_4105 407
265 3300038443 Ga0395901_0001254 Ga0395901_0001254_25249_26526 407
266 3300039110 Ga0400487_05423 Ga0400487_05423_2042_3322 407
267 3300046472 Ga0495580_0131810 Ga0495580_0131810_298_1590 407
268 3300053118 Ga0500594_0001236 Ga0500594_0001236_3757_5034 407
269 3300005467 Ga0070706_100266999 Ga0070706_1002669991 408
270 3300005518 Ga0070699_100244128 Ga0070699_1002441281 408
271 3300009176 Ga0105242_10074724 Ga0105242_100747242 408
272 3300045051 Ga0451576_0115872 Ga0451576_0115872_1208_2479 408
273 3300046524 Ga0495648_0027842 Ga0495648_0027842_1527_2822 408
274 3300013105 Ga0157369_10249999 Ga0157369_102499991 409
275 3300038726 Ga0400490_46219 Ga0400490_46219_1667_2941 409
276 3300047469 Ga0495673_0000403 Ga0495673_0000403_40626_41921 409
277 3300053098 Ga0500650_0000012 Ga0500650_0000012_42025_43320 409
278 3300053138 Ga0500564_000244 Ga0500564_000244_11988_13283 409
279 3300003773 Ga0055537_1002278 Ga0055537_10022784 410
280 3300003773 Ga0055537_1006509 Ga0055537_10065093 410
281 3300003775 Ga0055524_1000169 Ga0055524_100016943 410
282 3300003790 Ga0055528_1014590 Ga0055528_10145903 410
283 3300003791 Ga0055530_10014691 Ga0055530_100146913 410
284 3300003794 Ga0055531_10017852 Ga0055531_100178522 410
285 3300005563 Ga0068855_100104045 Ga0068855_1001040455 410
286 3300009098 Ga0105245_10000079 Ga0105245_1000007986 410
287 3300013296 Ga0157374_10054598 Ga0157374_100545982 410
288 3300025263 Ga0209565_1000012 Ga0209565_100001267 410
289 3300025263 Ga0209565_1000268 Ga0209565_100026819 410
290 3300025273 Ga0209673_1000600 Ga0209673_100060037 410
291 3300025273 Ga0209673_1001822 Ga0209673_100182211 410
292 3300025295 Ga0209564_1018524 Ga0209564_10185243 410
293 3300025297 Ga0209758_1003490 Ga0209758_10034909 410
294 3300025297 Ga0209758_1019213 Ga0209758_10192133 410
295 3300025298 Ga0209050_1008434 Ga0209050_10084343 410
296 3300025299 Ga0209256_1000012 Ga0209256_1000012258 410
297 3300025299 Ga0209256_1001870 Ga0209256_100187015 410
298 3300025304 Ga0209257_1000934 Ga0209257_100093416 410
299 3300025949 Ga0207667_10116859 Ga0207667_101168594 410
300 3300031616 Ga0307508_10115385 Ga0307508_101153852 410
301 3300039062 Ga0400483_001761 Ga0400483_001761_1252_2526 410
302 3300039062 Ga0400483_280760 Ga0400483_280760_2902_4176 410
303 3300046616 Ga0495668_0000186 Ga0495668_0000186_8563_9858 410
304 3300048918 Ga0496115_0002266 Ga0496115_0002266_6715_8010 410
305 3300025899 Ga0207642_10065016 Ga0207642_100650162 411
306 3300046460 Ga0495638_0000920 Ga0495638_0000920_13826_15121 411
307 3300049570 Ga0501033_0068432 Ga0501033_0068432_981_2252 411
308 3300049580 Ga0501046_0041049 Ga0501046_0041049_2338_3609 411
309 3300049585 Ga0501069_0011302 Ga0501069_0011302_500_1771 411
310 3300049586 Ga0501070_0066390 Ga0501070_0066390_1305_2576 411
311 3300049744 Ga0501083_0030932 Ga0501083_0030932_560_1831 411
312 3300053122 Ga0500608_000062 Ga0500608_000062_23387_24682 411
313 3300053136 Ga0500559_0009681 Ga0500559_0009681_2047_3342 411
314 3300053156 Ga0500622_0019273 Ga0500622_0019273_942_2237 411
315 iso_pu_bacteria 2643221574 2643883655 411
316 iso_pu_bacteria 2643221699 2644551658 411
317 3300005563 Ga0068855_100072552 Ga0068855_1000725522 412
318 3300031665 Ga0316575_10046820 Ga0316575_100468202 412
319 3300032133 Ga0316583_10018886 Ga0316583_100188863 412
320 3300038742 Ga0400486_11253 Ga0400486_11253_71_1315 412
321 3300053125 Ga0500618_000533 Ga0500618_000533_17212_18507 412
322 iso_pu_bacteria 2643221622 2644126847 412
323 iso_pu_bacteria 2643221663 2644351822 412
324 iso_pu_bacteria 2643221699 2644551811 412
325 iso_pu_bacteria 2844533157 2844540174 412
326 iso_pu_bacteria 2895880812 2895884798 412
327 3300010375 Ga0105239_10003937 Ga0105239_1000393711 413
328 3300014326 Ga0157380_10009037 Ga0157380_100090375 413
329 3300046455 Ga0495603_0003297 Ga0495603_0003297_6936_8228 413
330 3300046506 Ga0495583_0000069 Ga0495583_0000069_141248_142543 413
331 3300047321 Ga0495676_0000334 Ga0495676_0000334_21072_22364 413
332 3300059426 Ga0590077_007197 Ga0590077_007197_904_2178 413
333 3300005618 Ga0068864_100199607 Ga0068864_1001996072 414
334 3300039447 Ga0436361_0735177 Ga0436361_0735177_2662_3945 414
335 iso_pu_bacteria 2510917020 2511124487 414
336 iso_pu_bacteria 2599185359 2600226469 414
337 iso_pu_bacteria 2643221640 2644224211 414
338 iso_pu_bacteria 2643221642 2644234853 414
339 iso_pu_bacteria 2791355048 2792458898 414
340 iso_pu_bacteria 2843744320 2843749054 414
341 iso_pu_bacteria 2849560528 2849564378 414
342 iso_pu_bacteria 2849573788 2849573951 414
343 iso_pu_bacteria 2857504554 2857509426 414
344 iso_pu_bacteria 2898329390 2898330895 414
345 iso_pu_bacteria 2928531327 2928532461 414
346 iso_pu_bacteria 2928972540 2928974788 414
347 iso_pu_bacteria 2941485952 2941488568 414
348 iso_pu_bacteria 2977240413 2977242168 414
349 iso_pu_bacteria 8054563764 8054565065 414
350 3300005367 Ga0070667_100031234 Ga0070667_1000312343 415
351 3300005719 Ga0068861_100060136 Ga0068861_1000601362 415
352 3300005841 Ga0068863_100024017 Ga0068863_1000240175 415
353 3300005842 Ga0068858_100061852 Ga0068858_1000618522 415
354 3300021361 Ga0213872_10038966 Ga0213872_100389662 415
355 3300025941 Ga0207711_10003188 Ga0207711_1000318816 415
356 3300025961 Ga0207712_10022518 Ga0207712_100225184 415
357 3300026118 Ga0207675_100181472 Ga0207675_1001814721 415
358 3300028379 Ga0268266_10179954 Ga0268266_101799542 415
359 3300031238 Ga0265332_10002592 Ga0265332_100025924 415
360 3300031249 Ga0265339_10004112 Ga0265339_100041122 415
361 3300031344 Ga0265316_10001097 Ga0265316_1000109723 415
362 3300031712 Ga0265342_10000150 Ga0265342_1000015015 415
363 3300031727 Ga0316576_10000840 Ga0316576_100008406 415
364 3300031728 Ga0316578_10000632 Ga0316578_100006329 415
365 3300031733 Ga0316577_10006744 Ga0316577_100067444 415
366 3300032133 Ga0316583_10010214 Ga0316583_100102143 415
367 3300035090 Ga0373949_0000951 Ga0373949_0000951_7035_8321 415
368 3300036712 Ga0316584_0000420 Ga0316584_0000420_12295_13569 415
369 3300039447 Ga0436361_0298070 Ga0436361_0298070_4814_6100 415
370 3300039453 Ga0436362_0157410 Ga0436362_0157410_332_1624 415
371 3300053094 Ga0500566_0014059 Ga0500566_0014059_3371_4651 415
372 iso_pu_bacteria 2909042592 2909045898 415
373 3300001432 JGI24034J14986_100228 JGI24034J14986_1002282 416
374 3300002074 JGI24748J21848_1000010 JGI24748J21848_100001012 416
375 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001670 416
376 3300003791 Ga0055530_10000423 Ga0055530_100004238 416
377 3300003794 Ga0055531_10004369 Ga0055531_100043693 416
378 3300005331 Ga0070670_100247982 Ga0070670_1002479821 416
379 3300005364 Ga0070673_100122996 Ga0070673_1001229962 416
380 3300005456 Ga0070678_100086075 Ga0070678_1000860754 416
381 3300005530 Ga0070679_100014606 Ga0070679_1000146069 416
382 3300005548 Ga0070665_100004189 Ga0070665_1000041895 416
383 3300005615 Ga0070702_100096167 Ga0070702_1000961672 416
384 3300005842 Ga0068858_100000005 Ga0068858_10000000569 416
385 3300005937 Ga0081455_10001641 Ga0081455_1000164114 416
386 3300005981 Ga0081538_10025694 Ga0081538_100256943 416
387 3300006931 Ga0097620_100397225 Ga0097620_1003972252 416
388 3300007076 Ga0075435_100045786 Ga0075435_1000457866 416
389 3300009101 Ga0105247_10000002 Ga0105247_10000002326 416
390 3300013104 Ga0157370_10017787 Ga0157370_100177876 416
391 3300021361 Ga0213872_10004985 Ga0213872_100049853 416
392 3300021361 Ga0213872_10012874 Ga0213872_100128742 416
393 3300025298 Ga0209050_1000010 Ga0209050_1000010454 416
394 3300025304 Ga0209257_1000009 Ga0209257_1000009661 416
395 3300025900 Ga0207710_10000002 Ga0207710_10000002326 416
396 3300025927 Ga0207687_10000603 Ga0207687_1000060315 416
397 3300025931 Ga0207644_10000210 Ga0207644_100002105 416
398 3300025936 Ga0207670_10007351 Ga0207670_100073519 416
399 3300025937 Ga0207669_10061491 Ga0207669_100614913 416
400 3300026035 Ga0207703_10000158 Ga0207703_1000015865 416
401 3300026078 Ga0207702_10087049 Ga0207702_100870493 416
402 3300026121 Ga0207683_10000698 Ga0207683_1000069812 416
403 3300028379 Ga0268266_10026752 Ga0268266_100267526 416
404 3300031507 Ga0307509_10061048 Ga0307509_100610485 416
405 3300031824 Ga0307413_10079811 Ga0307413_100798112 416
406 3300036401 Ga0373937_0205345 Ga0373937_0205345_369_1649 416
407 3300037853 Ga0436364_0158752 Ga0436364_0158752_15_1310 416
408 3300037853 Ga0436364_0432318 Ga0436364_0432318_37989_39302 416
409 3300038443 Ga0395901_0094882 Ga0395901_0094882_1518_2795 416
410 3300039447 Ga0436361_0046882 Ga0436361_0046882_3264_4535 416
411 3300039447 Ga0436361_0446120 Ga0436361_0446120_16780_18048 416
412 3300039447 Ga0436361_0589265 Ga0436361_0589265_37893_39182 416
413 3300044694 Ga0466963_0010075 Ga0466963_0010075_2721_4007 416
414 3300044842 Ga0466957_0086706 Ga0466957_0086706_413_1699 416
415 3300045836 Ga0466958_0031993 Ga0466958_0031993_1446_2735 416
416 3300047320 Ga0495672_0015997 Ga0495672_0015997_828_2300 416
417 3300049570 Ga0501033_0134506 Ga0501033_0134506_385_1683 416
418 3300049581 Ga0501047_0187158 Ga0501047_0187158_556_1854 416
419 3300049584 Ga0501068_0017699 Ga0501068_0017699_2765_4051 416
420 3300053094 Ga0500566_0000395 Ga0500566_0000395_3913_5184 416
421 3300053139 Ga0500568_0012589 Ga0500568_0012589_1791_3098 416
422 3300005353 Ga0070669_100071214 Ga0070669_1000712142 417
423 3300005356 Ga0070674_100001596 Ga0070674_1000015963 417
424 3300005530 Ga0070679_100006337 Ga0070679_1000063374 417
425 3300005719 Ga0068861_100014323 Ga0068861_1000143234 417
426 3300005981 Ga0081538_10005495 Ga0081538_1000549512 417
427 3300006038 Ga0075365_10026434 Ga0075365_100264344 417
428 3300006881 Ga0068865_100025917 Ga0068865_1000259175 417
429 3300009094 Ga0111539_10000042 Ga0111539_1000004269 417
430 3300009094 Ga0111539_10168096 Ga0111539_101680962 417
431 3300009147 Ga0114129_10090821 Ga0114129_100908212 417
432 3300021361 Ga0213872_10000267 Ga0213872_1000026733 417
433 3300021361 Ga0213872_10003797 Ga0213872_100037975 417
434 3300021361 Ga0213872_10024910 Ga0213872_100249101 417
435 3300021361 Ga0213872_10031026 Ga0213872_100310262 417
436 3300025298 Ga0209050_1010978 Ga0209050_10109782 417
437 3300025304 Ga0209257_1000114 Ga0209257_10001146 417
438 3300025921 Ga0207652_10168580 Ga0207652_101685802 417
439 3300025923 Ga0207681_10056288 Ga0207681_100562882 417
440 3300025938 Ga0207704_10015697 Ga0207704_100156972 417
441 3300026118 Ga0207675_100043976 Ga0207675_1000439763 417
442 3300027907 Ga0207428_10001035 Ga0207428_100010355 417
443 3300028380 Ga0268265_10088736 Ga0268265_100887362 417
444 3300028786 Ga0307517_10018255 Ga0307517_100182552 417
445 3300028794 Ga0307515_10061623 Ga0307515_100616235 417
446 3300031250 Ga0265331_10000337 Ga0265331_1000033721 417
447 3300031251 Ga0265327_10001626 Ga0265327_100016264 417
448 3300031456 Ga0307513_10005329 Ga0307513_100053293 417
449 3300031824 Ga0307413_10027626 Ga0307413_100276263 417
450 3300031852 Ga0307410_10027562 Ga0307410_100275624 417
451 3300031901 Ga0307406_10053094 Ga0307406_100530942 417
452 3300032002 Ga0307416_100081616 Ga0307416_1000816163 417
453 3300032005 Ga0307411_10062865 Ga0307411_100628653 417
454 3300032126 Ga0307415_100196960 Ga0307415_1001969602 417
455 3300039447 Ga0436361_0015804 Ga0436361_0015804_4066_5343 417
456 3300039447 Ga0436361_0049245 Ga0436361_0049245_1821_3098 417
457 3300039447 Ga0436361_0271669 Ga0436361_0271669_1100_2377 417
458 3300039447 Ga0436361_0464290 Ga0436361_0464290_641_1918 417
459 3300039447 Ga0436361_0585829 Ga0436361_0585829_643_1914 417
460 3300039447 Ga0436361_0629359 Ga0436361_0629359_2537_3814 417
461 3300039447 Ga0436361_0860856 Ga0436361_0860856_888_2165 417
462 3300039447 Ga0436361_0946815 Ga0436361_0946815_240_1514 417
463 3300044842 Ga0466957_0010995 Ga0466957_0010995_1800_3077 417
464 3300048909 Ga0496106_0065136 Ga0496106_0065136_90_1373 417
465 3300048913 Ga0496110_0138219 Ga0496110_0138219_441_1724 417
466 3300048915 Ga0496112_0079875 Ga0496112_0079875_1798_3081 417
467 3300049569 Ga0501032_0002952 Ga0501032_0002952_11219_12508 417
468 3300049570 Ga0501033_0003092 Ga0501033_0003092_7408_8697 417
469 3300049571 Ga0501034_0038952 Ga0501034_0038952_2536_3825 417
470 3300049572 Ga0501036_0002006 Ga0501036_0002006_9095_10384 417
471 3300049573 Ga0501037_0014451 Ga0501037_0014451_3770_5059 417
472 3300049574 Ga0501038_0000308 Ga0501038_0000308_5132_6421 417
473 3300049580 Ga0501046_0004392 Ga0501046_0004392_10998_12287 417
474 3300049581 Ga0501047_0024082 Ga0501047_0024082_3857_5146 417
475 3300049584 Ga0501068_0117881 Ga0501068_0117881_198_1487 417
476 3300049585 Ga0501069_0000411 Ga0501069_0000411_17329_18618 417
477 3300049586 Ga0501070_0006021 Ga0501070_0006021_7271_8560 417
478 3300049589 Ga0501073_0002016 Ga0501073_0002016_10895_12184 417
479 3300049589 Ga0501073_0017023 Ga0501073_0017023_2513_3802 417
480 3300049590 Ga0501074_0007384 Ga0501074_0007384_76_1365 417
481 3300049741 Ga0501079_0046828 Ga0501079_0046828_1017_2306 417
482 3300049742 Ga0501080_0000644 Ga0501080_0000644_18315_19604 417
483 3300049742 Ga0501080_0026308 Ga0501080_0026308_1434_2723 417
484 3300049742 Ga0501080_0300274 Ga0501080_0300274_80_1354 417
485 3300049823 Ga0501044_0004049 Ga0501044_0004049_11797_13086 417
486 3300050507 nmdc:mga05p37_102615_c1 nmdc:mga05p37_102615_c1_2001_3281 417
487 3300050511 nmdc:mga08y16_146126_c1 nmdc:mga08y16_146126_c1_497_1777 417
488 3300050511 nmdc:mga08y16_47_c1 nmdc:mga08y16_47_c1_95683_96963 417
489 3300053146 Ga0500588_0001206 Ga0500588_0001206_2805_4079 417
490 3300054114 Ga0501084_0044062 Ga0501084_0044062_189_1478 417
491 3300060353 Ga0501082_0003390 Ga0501082_0003390_8666_9955 417
492 iso_pu_bacteria 2585428106 2587915929 417
493 3300003214 JGI25165J46597_1000053 JGI25165J46597_100005364 418
494 3300003781 Ga0055536_1010658 Ga0055536_10106583 418
495 3300003781 Ga0055536_1010718 Ga0055536_10107183 418
496 3300003791 Ga0055530_10009835 Ga0055530_100098353 418
497 3300003794 Ga0055531_10000589 Ga0055531_100005893 418
498 3300005328 Ga0070676_10000056 Ga0070676_1000005631 418
499 3300006237 Ga0097621_100000004 Ga0097621_10000000421 418
500 3300006358 Ga0068871_100000159 Ga0068871_10000015921 418
501 3300006914 Ga0075436_100038240 Ga0075436_1000382403 418
502 3300009093 Ga0105240_10018744 Ga0105240_100187448 418
503 3300009177 Ga0105248_10020707 Ga0105248_100207072 418
504 3300013102 Ga0157371_10030302 Ga0157371_100303024 418
505 3300021384 Ga0213876_10000125 Ga0213876_1000012558 418
506 3300025292 Ga0209676_1000099 Ga0209676_100009958 418
507 3300025292 Ga0209676_1000180 Ga0209676_100018073 418
508 3300025298 Ga0209050_1000319 Ga0209050_100031949 418
509 3300025298 Ga0209050_1003235 Ga0209050_100323515 418
510 3300025303 Ga0209051_1002009 Ga0209051_100200916 418
511 3300025304 Ga0209257_1000614 Ga0209257_100061414 418
512 3300025304 Ga0209257_1002674 Ga0209257_100267411 418
513 3300025913 Ga0207695_10006284 Ga0207695_1000628414 418
514 3300025941 Ga0207711_10010997 Ga0207711_100109977 418
515 3300031711 Ga0265314_10035513 Ga0265314_100355132 418
516 3300039437 Ga0436365_0749742 Ga0436365_0749742_90200_91480 418
517 3300046457 Ga0495590_0001850 Ga0495590_0001850_7389_8684 418
518 3300046459 Ga0495629_0057403 Ga0495629_0057403_32_1312 418
519 3300046512 Ga0495610_0007069 Ga0495610_0007069_1623_2918 418
520 3300046515 Ga0495620_0015363 Ga0495620_0015363_1327_2607 418
521 3300046522 Ga0495643_0010185 Ga0495643_0010185_3898_5178 418
522 3300046542 Ga0495597_0008164 Ga0495597_0008164_2851_4131 418
523 3300046616 Ga0495668_0025388 Ga0495668_0025388_549_1844 418
524 3300046690 Ga0495624_0035188 Ga0495624_0035188_950_2230 418
525 3300047673 Ga0495593_0037701 Ga0495593_0037701_1138_2418 418
526 3300048905 Ga0496102_0048500 Ga0496102_0048500_981_2261 418
527 3300048928 Ga0496125_0037060 Ga0496125_0037060_901_2196 418
528 3300048929 Ga0496126_0148069 Ga0496126_0148069_672_1967 418
529 3300049459 Ga0495678_000738 Ga0495678_000738_9270_10565 418
530 3300053080 Ga0500635_0000341 Ga0500635_0000341_4990_6270 418
531 3300053088 Ga0500644_0000417 Ga0500644_0000417_7316_8611 418
532 3300053094 Ga0500566_0040118 Ga0500566_0040118_1395_2675 418
533 3300053096 Ga0500641_0021637 Ga0500641_0021637_864_2159 418
534 3300053103 Ga0500555_010087 Ga0500555_010087_541_1821 418
535 3300053109 Ga0500569_003491 Ga0500569_003491_1083_2363 418
536 3300053118 Ga0500594_0000383 Ga0500594_0000383_3931_5226 418
537 3300053119 Ga0500595_002031 Ga0500595_002031_1815_3095 418
538 3300053122 Ga0500608_001411 Ga0500608_001411_2328_3608 418
539 3300053123 Ga0500614_000989 Ga0500614_000989_3174_4454 418
540 3300053130 Ga0500642_0004595 Ga0500642_0004595_1740_3020 418
541 3300053134 Ga0500658_0030889 Ga0500658_0030889_585_1865 418
542 3300053148 Ga0500590_008548 Ga0500590_008548_1515_2795 418
543 3300053177 Ga0500636_0029081 Ga0500636_0029081_835_2115 418
544 3300053178 Ga0500637_0023688 Ga0500637_0023688_370_1650 418
545 3300054114 Ga0501084_0000713 Ga0501084_0000713_21923_23287 418
546 iso_pu_bacteria 2851153111 2851155507 418
547 3300031711 Ga0265314_10049811 Ga0265314_100498111 419
548 3300047472 Ga0495686_0000765 Ga0495686_0000765_19646_21055 419
549 3300048921 Ga0496118_0075207 Ga0496118_0075207_77_1360 419
550 3300049570 Ga0501033_0196739 Ga0501033_0196739_71_1375 419
551 3300049571 Ga0501034_0000013 Ga0501034_0000013_171107_172387 419
552 3300049573 Ga0501037_0000487 Ga0501037_0000487_9172_10452 419
553 3300049575 Ga0501039_0000249 Ga0501039_0000249_26445_27725 419
554 3300049576 Ga0501040_0108460 Ga0501040_0108460_288_1577 419
555 3300049580 Ga0501046_0154565 Ga0501046_0154565_300_1580 419
556 3300049581 Ga0501047_0000469 Ga0501047_0000469_10167_11447 419
557 3300049581 Ga0501047_0169676 Ga0501047_0169676_311_1600 419
558 3300049583 Ga0501067_0001487 Ga0501067_0001487_8678_9958 419
559 3300049583 Ga0501067_0008213 Ga0501067_0008213_4125_5414 419
560 3300049586 Ga0501070_0004769 Ga0501070_0004769_10143_11423 419
561 3300049589 Ga0501073_0007841 Ga0501073_0007841_2729_4009 419
562 3300049742 Ga0501080_0000003 Ga0501080_0000003_163637_164917 419
563 3300049822 Ga0501035_0000058 Ga0501035_0000058_6960_8240 419
564 3300049823 Ga0501044_0000023 Ga0501044_0000023_68375_69655 419
565 3300053102 Ga0500554_009814 Ga0500554_009814_56_1438 419
566 3300060353 Ga0501082_0003016 Ga0501082_0003016_11673_12953 419
567 iso_pu_bacteria 2513237165 2514042203 420
568 iso_pu_bacteria 2523533628 2524001672 420
569 iso_pu_bacteria 644736347 644747069 420
570 3300005289 Ga0065704_10003860 Ga0065704_100038603 422
571 3300005295 Ga0065707_10003307 Ga0065707_100033072 422
572 3300005330 Ga0070690_100039665 Ga0070690_1000396652 422
573 3300005334 Ga0068869_100012546 Ga0068869_1000125464 422
574 3300005355 Ga0070671_100003230 Ga0070671_1000032308 422
575 3300005436 Ga0070713_100180411 Ga0070713_1001804112 422
576 3300005545 Ga0070695_100104380 Ga0070695_1001043802 422
577 3300009094 Ga0111539_10024213 Ga0111539_100242134 422
578 3300014326 Ga0157380_10129032 Ga0157380_101290322 422
579 3300025928 Ga0207700_10199101 Ga0207700_101991012 422
580 3300025931 Ga0207644_10002172 Ga0207644_100021725 422
581 3300025942 Ga0207689_10289186 Ga0207689_102891861 422
582 3300025961 Ga0207712_10221557 Ga0207712_102215571 422
583 3300028794 Ga0307515_10164957 Ga0307515_101649572 422
584 3300028800 Ga0265338_10102528 Ga0265338_101025282 422
585 3300032004 Ga0307414_10001865 Ga0307414_100018654 422
586 3300035088 Ga0373940_0034671 Ga0373940_0034671_73_1353 422
587 3300037068 Ga0373925_0031321 Ga0373925_0031321_610_1905 422
588 3300044712 Ga0453684_0034569 Ga0453684_0034569_2929_4209 422
589 3300045051 Ga0451576_0008922 Ga0451576_0008922_6101_7381 422
590 3300049652 Ga0501202_013954 Ga0501202_013954_19_1287 422
591 3300050511 nmdc:mga08y16_5453_c1 nmdc:mga08y16_5453_c1_4426_5706 422
592 iso_pu_bacteria 2887630918 2887631039 422
593 3300005293 Ga0065715_10002131 Ga0065715_100021311 423
594 3300005293 Ga0065715_10013095 Ga0065715_100130952 423
595 3300005295 Ga0065707_10088542 Ga0065707_100885425 423
596 3300005328 Ga0070676_10017192 Ga0070676_100171925 423
597 3300005335 Ga0070666_10031921 Ga0070666_100319214 423
598 3300005336 Ga0070680_100051738 Ga0070680_1000517381 423
599 3300005355 Ga0070671_100084259 Ga0070671_1000842593 423
600 3300005366 Ga0070659_100151922 Ga0070659_1001519221 423
601 3300005367 Ga0070667_100037573 Ga0070667_1000375731 423
602 3300005435 Ga0070714_100011352 Ga0070714_1000113523 423
603 3300005456 Ga0070678_100038089 Ga0070678_1000380895 423
604 3300005457 Ga0070662_100002362 Ga0070662_10000236210 423
605 3300005457 Ga0070662_100088844 Ga0070662_1000888442 423
606 3300005458 Ga0070681_10135085 Ga0070681_101350851 423
607 3300005530 Ga0070679_100169270 Ga0070679_1001692701 423
608 3300005543 Ga0070672_100024040 Ga0070672_1000240405 423
609 3300005544 Ga0070686_100063669 Ga0070686_1000636692 423
610 3300005546 Ga0070696_100051322 Ga0070696_1000513224 423
611 3300005547 Ga0070693_100007155 Ga0070693_1000071554 423
612 3300005547 Ga0070693_100053609 Ga0070693_1000536092 423
613 3300005549 Ga0070704_100056420 Ga0070704_1000564202 423
614 3300005563 Ga0068855_100049432 Ga0068855_1000494321 423
615 3300005614 Ga0068856_100015873 Ga0068856_1000158739 423
616 3300005617 Ga0068859_100159049 Ga0068859_1001590492 423
617 3300005843 Ga0068860_100040551 Ga0068860_1000405511 423
618 3300006163 Ga0070715_10000002 Ga0070715_10000002277 423
619 3300006358 Ga0068871_100122455 Ga0068871_1001224552 423
620 3300006847 Ga0075431_100094967 Ga0075431_1000949674 423
621 3300006871 Ga0075434_100053378 Ga0075434_1000533781 423
622 3300006871 Ga0075434_100057762 Ga0075434_1000577622 423
623 3300006871 Ga0075434_100097939 Ga0075434_1000979393 423
624 3300006881 Ga0068865_100051796 Ga0068865_1000517964 423
625 3300006914 Ga0075436_100151500 Ga0075436_1001515002 423
626 3300006931 Ga0097620_100159036 Ga0097620_1001590362 423
627 3300007076 Ga0075435_100002396 Ga0075435_10000239613 423
628 3300007076 Ga0075435_100081116 Ga0075435_1000811164 423
629 3300009094 Ga0111539_10023154 Ga0111539_100231548 423
630 3300009094 Ga0111539_10203259 Ga0111539_102032592 423
631 3300009098 Ga0105245_10063119 Ga0105245_100631193 423
632 3300009147 Ga0114129_10016967 Ga0114129_100169675 423
633 3300009147 Ga0114129_10273744 Ga0114129_102737442 423
634 3300009148 Ga0105243_10009752 Ga0105243_100097522 423
635 3300009148 Ga0105243_10216589 Ga0105243_102165892 423
636 3300009174 Ga0105241_10014087 Ga0105241_100140878 423
637 3300009551 Ga0105238_10047750 Ga0105238_100477501 423
638 3300009553 Ga0105249_10283548 Ga0105249_102835481 423
639 3300010375 Ga0105239_10014595 Ga0105239_1001459510 423
640 3300013297 Ga0157378_10073458 Ga0157378_100734583 423
641 3300013297 Ga0157378_10084084 Ga0157378_100840842 423
642 3300013306 Ga0163162_10032135 Ga0163162_100321355 423
643 3300014969 Ga0157376_10003895 Ga0157376_1000389511 423
644 3300025315 Ga0207697_10011907 Ga0207697_100119074 423
645 3300025905 Ga0207685_10000002 Ga0207685_10000002171 423
646 3300025907 Ga0207645_10007912 Ga0207645_100079121 423
647 3300025908 Ga0207643_10027214 Ga0207643_100272142 423
648 3300025912 Ga0207707_10088468 Ga0207707_100884681 423
649 3300025916 Ga0207663_10043357 Ga0207663_100433574 423
650 3300025916 Ga0207663_10166369 Ga0207663_101663691 423
651 3300025919 Ga0207657_10005842 Ga0207657_1000584212 423
652 3300025920 Ga0207649_10098484 Ga0207649_100984841 423
653 3300025925 Ga0207650_10019990 Ga0207650_100199905 423
654 3300025929 Ga0207664_10008296 Ga0207664_100082966 423
655 3300025932 Ga0207690_10021855 Ga0207690_100218551 423
656 3300025933 Ga0207706_10003256 Ga0207706_100032567 423
657 3300025935 Ga0207709_10003138 Ga0207709_100031383 423
658 3300025940 Ga0207691_10050470 Ga0207691_100504705 423
659 3300025960 Ga0207651_10125557 Ga0207651_101255572 423
660 3300026121 Ga0207683_10000825 Ga0207683_1000082511 423
661 3300027907 Ga0207428_10064691 Ga0207428_100646912 423
662 3300028573 Ga0265334_10000017 Ga0265334_1000001774 423
663 3300031595 Ga0265313_10000022 Ga0265313_10000022100 423
664 3300035692 Ga0373935_0007615 Ga0373935_0007615_538_1809 423
665 3300035695 Ga0373927_0000003 Ga0373927_0000003_145813_147084 423
666 3300038741 Ga0400488_17591 Ga0400488_17591_97_1374 423
667 3300039110 Ga0400487_59306 Ga0400487_59306_96_1373 423
668 3300044673 Ga0453683_0120161 Ga0453683_0120161_82_1398 423
669 3300046517 Ga0495630_0212835 Ga0495630_0212835_57_1328 423
670 3300048915 Ga0496112_0053926 Ga0496112_0053926_203_1474 423
671 3300048915 Ga0496112_0164576 Ga0496112_0164576_476_1747 423
672 3300049568 Ga0501031_0023554 Ga0501031_0023554_2099_3370 423
673 3300049569 Ga0501032_0054951 Ga0501032_0054951_988_2259 423
674 3300049571 Ga0501034_0126795 Ga0501034_0126795_101_1372 423
675 3300049573 Ga0501037_0068411 Ga0501037_0068411_957_2228 423
676 3300049574 Ga0501038_0056902 Ga0501038_0056902_1875_3146 423
677 3300049577 Ga0501041_0037142 Ga0501041_0037142_480_1751 423
678 3300049586 Ga0501070_0207224 Ga0501070_0207224_64_1335 423
679 3300049588 Ga0501072_0138994 Ga0501072_0138994_542_1813 423
680 3300049589 Ga0501073_0029602 Ga0501073_0029602_1665_2936 423
681 3300049590 Ga0501074_0015001 Ga0501074_0015001_2116_3387 423
682 3300049591 Ga0501075_0076710 Ga0501075_0076710_1031_2302 423
683 3300049741 Ga0501079_0045657 Ga0501079_0045657_925_2196 423
684 3300049743 Ga0501081_0015052 Ga0501081_0015052_1315_2586 423
685 3300049822 Ga0501035_0072898 Ga0501035_0072898_1124_2395 423
686 3300049823 Ga0501044_0055196 Ga0501044_0055196_2599_3870 423
687 3300050507 nmdc:mga05p37_3462_c1 nmdc:mga05p37_3462_c1_1033_2349 423
688 3300050507 nmdc:mga05p37_99101_c1 nmdc:mga05p37_99101_c1_1577_2848 423
689 3300050510 nmdc:mga06r32_219628_c1 nmdc:mga06r32_219628_c1_141_1412 423
690 3300050510 nmdc:mga06r32_86749_c1 nmdc:mga06r32_86749_c1_547_1818 423
691 3300050511 nmdc:mga08y16_120640_c1 nmdc:mga08y16_120640_c1_859_2130 423
692 3300050512 nmdc:mga0n895_107089_c1 nmdc:mga0n895_107089_c1_10_1281 423
693 3300050512 nmdc:mga0n895_166685_c1 nmdc:mga0n895_166685_c1_395_1666 423
694 3300050513 nmdc:mga0rr50_47905_c1 nmdc:mga0rr50_47905_c1_892_2163 423
695 3300050513 nmdc:mga0rr50_9938_c1 nmdc:mga0rr50_9938_c1_798_2069 423
696 3300050514 nmdc:mga08x19_744_c1 nmdc:mga08x19_744_c1_1332_2618 423
697 3300050515 nmdc:mga0a205_226255_c1 nmdc:mga0a205_226255_c1_268_1539 423
698 3300005290 Ga0065712_10009500 Ga0065712_100095003 424
699 3300005293 Ga0065715_10009882 Ga0065715_100098824 424
700 3300005295 Ga0065707_10009757 Ga0065707_100097572 424
701 3300005331 Ga0070670_100000001 Ga0070670_100000001347 424
702 3300005331 Ga0070670_100027274 Ga0070670_1000272744 424
703 3300005334 Ga0068869_100066087 Ga0068869_1000660872 424
704 3300005335 Ga0070666_10009203 Ga0070666_100092033 424
705 3300005335 Ga0070666_10047659 Ga0070666_100476593 424
706 3300005353 Ga0070669_100013074 Ga0070669_1000130742 424
707 3300005353 Ga0070669_100020394 Ga0070669_1000203944 424
708 3300005355 Ga0070671_100000008 Ga0070671_10000000869 424
709 3300005356 Ga0070674_100001556 Ga0070674_1000015565 424
710 3300005356 Ga0070674_100057727 Ga0070674_1000577273 424
711 3300005364 Ga0070673_100017315 Ga0070673_1000173154 424
712 3300005365 Ga0070688_100000972 Ga0070688_1000009724 424
713 3300005367 Ga0070667_100000023 Ga0070667_100000023102 424
714 3300005367 Ga0070667_100125038 Ga0070667_1001250383 424
715 3300005466 Ga0070685_10000008 Ga0070685_1000000817 424
716 3300005543 Ga0070672_100005200 Ga0070672_10000520010 424
717 3300005548 Ga0070665_100012413 Ga0070665_1000124132 424
718 3300005577 Ga0068857_100125695 Ga0068857_1001256953 424
719 3300005617 Ga0068859_100170192 Ga0068859_1001701922 424
720 3300005618 Ga0068864_100000006 Ga0068864_100000006352 424
721 3300005718 Ga0068866_10001731 Ga0068866_100017317 424
722 3300005840 Ga0068870_10010685 Ga0068870_100106853 424
723 3300005840 Ga0068870_10073120 Ga0068870_100731202 424
724 3300005843 Ga0068860_100001556 Ga0068860_10000155617 424
725 3300005844 Ga0068862_100001815 Ga0068862_1000018159 424
726 3300005844 Ga0068862_100089800 Ga0068862_1000898002 424
727 3300006844 Ga0075428_100007089 Ga0075428_1000070897 424
728 3300006844 Ga0075428_100024773 Ga0075428_1000247732 424
729 3300006844 Ga0075428_100303110 Ga0075428_1003031102 424
730 3300006846 Ga0075430_100093362 Ga0075430_1000933623 424
731 3300006847 Ga0075431_100008475 Ga0075431_1000084756 424
732 3300006880 Ga0075429_100002783 Ga0075429_1000027839 424
733 3300006881 Ga0068865_100155385 Ga0068865_1001553852 424
734 3300006914 Ga0075436_100000020 Ga0075436_10000002031 424
735 3300006931 Ga0097620_100170204 Ga0097620_1001702042 424
736 3300007076 Ga0075435_100000717 Ga0075435_1000007179 424
737 3300009094 Ga0111539_10283688 Ga0111539_102836883 424
738 3300009094 Ga0111539_10329831 Ga0111539_103298311 424
739 3300009147 Ga0114129_10023279 Ga0114129_100232797 424
740 3300009148 Ga0105243_10042291 Ga0105243_100422914 424
741 3300013306 Ga0163162_10102175 Ga0163162_101021754 424
742 3300013308 Ga0157375_10014981 Ga0157375_100149815 424
743 3300014326 Ga0157380_10011499 Ga0157380_100114995 424
744 3300025893 Ga0207682_10012374 Ga0207682_100123744 424
745 3300025899 Ga0207642_10002096 Ga0207642_100020964 424
746 3300025900 Ga0207710_10002477 Ga0207710_100024774 424
747 3300025901 Ga0207688_10037005 Ga0207688_100370053 424
748 3300025907 Ga0207645_10016971 Ga0207645_100169712 424
749 3300025923 Ga0207681_10030359 Ga0207681_100303592 424
750 3300025925 Ga0207650_10000002 Ga0207650_100000021024 424
751 3300025925 Ga0207650_10007766 Ga0207650_100077665 424
752 3300025931 Ga0207644_10000019 Ga0207644_1000001971 424
753 3300025937 Ga0207669_10001357 Ga0207669_100013577 424
754 3300025940 Ga0207691_10006490 Ga0207691_100064907 424
755 3300025941 Ga0207711_10000156 Ga0207711_1000015649 424
756 3300025986 Ga0207658_10000001 Ga0207658_10000001331 424
757 3300026035 Ga0207703_10033515 Ga0207703_100335154 424
758 3300026088 Ga0207641_10037909 Ga0207641_100379094 424
759 3300026088 Ga0207641_10187110 Ga0207641_101871102 424
760 3300026089 Ga0207648_10073931 Ga0207648_100739312 424
761 3300026095 Ga0207676_10000001 Ga0207676_100000011024 424
762 3300026116 Ga0207674_10143827 Ga0207674_101438272 424
763 3300026118 Ga0207675_100097050 Ga0207675_1000970503 424
764 3300028379 Ga0268266_10003314 Ga0268266_1000331412 424
765 3300028380 Ga0268265_10000288 Ga0268265_1000028841 424
766 3300028381 Ga0268264_10000419 Ga0268264_1000041914 424
767 3300031251 Ga0265327_10000008 Ga0265327_10000008319 424
768 3300031251 Ga0265327_10000696 Ga0265327_1000069617 424
769 3300031665 Ga0316575_10028428 Ga0316575_100284282 424
770 3300031727 Ga0316576_10008620 Ga0316576_100086204 424
771 3300031727 Ga0316576_10019577 Ga0316576_100195772 424
772 3300031727 Ga0316576_10033505 Ga0316576_100335053 424
773 3300031727 Ga0316576_10034042 Ga0316576_100340423 424
774 3300031728 Ga0316578_10019684 Ga0316578_100196842 424
775 3300031733 Ga0316577_10042326 Ga0316577_100423262 424
776 3300031733 Ga0316577_10050538 Ga0316577_100505382 424
777 3300035398 Ga0316574_0009334 Ga0316574_0009334_1457_2740 424
778 3300036647 Ga0316582_0102397 Ga0316582_0102397_264_1541 424
779 3300036712 Ga0316584_0032212 Ga0316584_0032212_1362_2636 424
780 3300036712 Ga0316584_0098186 Ga0316584_0098186_151_1428 424
781 3300037418 Ga0395900_0160786 Ga0395900_0160786_492_1787 424
782 3300038735 Ga0400485_13208 Ga0400485_13208_4303_5577 424
783 3300038742 Ga0400486_23182 Ga0400486_23182_9459_10733 424
784 3300039062 Ga0400483_204516 Ga0400483_204516_114_1388 424
785 3300039062 Ga0400483_212392 Ga0400483_212392_1019_2293 424
786 3300048928 Ga0496125_0070035 Ga0496125_0070035_1130_2425 424
787 3300050507 nmdc:mga05p37_171826_c1 nmdc:mga05p37_171826_c1_133_1416 424
788 3300050508 nmdc:mga09592_13954_c1 nmdc:mga09592_13954_c1_5021_6304 424
789 3300050509 nmdc:mga0qj67_2734_c1 nmdc:mga0qj67_2734_c1_3038_4321 424
790 3300050510 nmdc:mga06r32_3549_c1 nmdc:mga06r32_3549_c1_8706_9989 424
791 3300050511 nmdc:mga08y16_155884_c1 nmdc:mga08y16_155884_c1_176_1459 424
792 3300050513 nmdc:mga0rr50_98_c1 nmdc:mga0rr50_98_c1_36897_38186 424
793 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_455820_457109 424
794 3300053138 Ga0500564_011844 Ga0500564_011844_1145_2440 424
795 3300005347 Ga0070668_100013918 Ga0070668_1000139184 425
796 3300005354 Ga0070675_100005347 Ga0070675_1000053472 425
797 3300005444 Ga0070694_100167847 Ga0070694_1001678471 425
798 3300005471 Ga0070698_100292900 Ga0070698_1002929001 425
799 3300006871 Ga0075434_100027108 Ga0075434_1000271082 425
800 3300006880 Ga0075429_100277327 Ga0075429_1002773271 425
801 3300009094 Ga0111539_10000926 Ga0111539_1000092616 425
802 3300009094 Ga0111539_10016091 Ga0111539_100160913 425
803 3300009094 Ga0111539_10045327 Ga0111539_100453272 425
804 3300009147 Ga0114129_10340341 Ga0114129_103403412 425
805 3300027907 Ga0207428_10063991 Ga0207428_100639913 425
806 3300031727 Ga0316576_10018774 Ga0316576_100187744 425
807 3300031728 Ga0316578_10049391 Ga0316578_100493911 425
808 3300031728 Ga0316578_10083196 Ga0316578_100831962 425
809 3300031824 Ga0307413_10071455 Ga0307413_100714552 425
810 3300031901 Ga0307406_10060203 Ga0307406_100602032 425
811 3300031903 Ga0307407_10039628 Ga0307407_100396282 425
812 3300031903 Ga0307407_10039691 Ga0307407_100396912 425
813 3300031995 Ga0307409_100024830 Ga0307409_1000248302 425
814 3300032002 Ga0307416_100017882 Ga0307416_1000178825 425
815 3300032004 Ga0307414_10053051 Ga0307414_100530512 425
816 3300032005 Ga0307411_10000376 Ga0307411_1000037610 425
817 3300032005 Ga0307411_10117716 Ga0307411_101177162 425
818 3300032126 Ga0307415_100013273 Ga0307415_1000132734 425
819 3300035398 Ga0316574_0002485 Ga0316574_0002485_4701_5981 425
820 3300035398 Ga0316574_0054924 Ga0316574_0054924_461_1741 425
821 3300036712 Ga0316584_0036815 Ga0316584_0036815_1671_2954 425
822 3300036712 Ga0316584_0096468 Ga0316584_0096468_790_2067 425
823 3300037588 Ga0316581_0009548 Ga0316581_0009548_1132_2412 425
824 3300045051 Ga0451576_0011409 Ga0451576_0011409_7092_8378 425
825 3300046499 Ga0495594_0089251 Ga0495594_0089251_115_1407 425
826 3300048924 Ga0496121_0000631 Ga0496121_0000631_42540_43967 425
827 3300049570 Ga0501033_0007825 Ga0501033_0007825_283_1593 425
828 3300049571 Ga0501034_0000415 Ga0501034_0000415_5070_6362 425
829 3300049571 Ga0501034_0002434 Ga0501034_0002434_5795_7105 425
830 3300049572 Ga0501036_0198380 Ga0501036_0198380_68_1354 425
831 3300049573 Ga0501037_0009708 Ga0501037_0009708_3223_4533 425
832 3300049574 Ga0501038_0016356 Ga0501038_0016356_2149_3459 425
833 3300049575 Ga0501039_0019968 Ga0501039_0019968_2188_3474 425
834 3300049579 Ga0501043_0002326 Ga0501043_0002326_4740_6050 425
835 3300049580 Ga0501046_0068682 Ga0501046_0068682_660_1970 425
836 3300049581 Ga0501047_0050924 Ga0501047_0050924_1239_2549 425
837 3300049582 Ga0501048_0032975 Ga0501048_0032975_795_2081 425
838 3300049582 Ga0501048_0121820 Ga0501048_0121820_155_1444 425
839 3300049587 Ga0501071_0019726 Ga0501071_0019726_852_2141 425
840 3300049588 Ga0501072_0005781 Ga0501072_0005781_13_1302 425
841 3300049588 Ga0501072_0036829 Ga0501072_0036829_1795_3081 425
842 3300049589 Ga0501073_0001711 Ga0501073_0001711_12690_14000 425
843 3300049591 Ga0501075_0024615 Ga0501075_0024615_778_2067 425
844 3300049591 Ga0501075_0071806 Ga0501075_0071806_905_2191 425
845 3300049592 Ga0501076_0044295 Ga0501076_0044295_1263_2552 425
846 3300049593 Ga0501077_0040685 Ga0501077_0040685_630_1916 425
847 3300049741 Ga0501079_0060684 Ga0501079_0060684_1110_2396 425
848 3300049742 Ga0501080_0001724 Ga0501080_0001724_11839_13149 425
849 3300049743 Ga0501081_0024684 Ga0501081_0024684_1183_2469 425
850 3300049822 Ga0501035_0087628 Ga0501035_0087628_742_2022 425
851 3300049822 Ga0501035_0179705 Ga0501035_0179705_48_1358 425
852 3300049823 Ga0501044_0001009 Ga0501044_0001009_31401_32711 425
853 3300049823 Ga0501044_0086360 Ga0501044_0086360_1166_2446 425
854 3300049824 Ga0501045_0034360 Ga0501045_0034360_1636_2925 425
855 3300050511 nmdc:mga08y16_1630_c3 nmdc:mga08y16_1630_c3_1198_2487 425
856 3300050511 nmdc:mga08y16_61415_c1 nmdc:mga08y16_61415_c1_564_1850 425
857 3300061734 Ga0530510_0002688 Ga0530510_0002688_5483_6769 425
858 3300005295 Ga0065707_10152081 Ga0065707_101520812 426
859 3300005328 Ga0070676_10000801 Ga0070676_100008015 426
860 3300005347 Ga0070668_100038290 Ga0070668_1000382902 426
861 3300005456 Ga0070678_100291229 Ga0070678_1002912291 426
862 3300005457 Ga0070662_100004008 Ga0070662_1000040082 426
863 3300005543 Ga0070672_100147992 Ga0070672_1001479921 426
864 3300005719 Ga0068861_100003245 Ga0068861_1000032452 426
865 3300005840 Ga0068870_10042545 Ga0068870_100425451 426
866 3300005844 Ga0068862_100034160 Ga0068862_1000341601 426
867 3300006844 Ga0075428_100020288 Ga0075428_1000202883 426
868 3300006844 Ga0075428_100059278 Ga0075428_1000592782 426
869 3300006846 Ga0075430_100089544 Ga0075430_1000895442 426
870 3300006881 Ga0068865_100013432 Ga0068865_1000134322 426
871 3300025907 Ga0207645_10014174 Ga0207645_100141742 426
872 3300025908 Ga0207643_10048666 Ga0207643_100486661 426
873 3300025923 Ga0207681_10007853 Ga0207681_100078535 426
874 3300025933 Ga0207706_10001828 Ga0207706_1000182812 426
875 3300025940 Ga0207691_10017589 Ga0207691_100175895 426
876 3300026089 Ga0207648_10001100 Ga0207648_1000110017 426
877 3300027665 Ga0209983_1006458 Ga0209983_10064582 426
878 3300027682 Ga0209971_1000386 Ga0209971_10003861 426
879 3300031727 Ga0316576_10003350 Ga0316576_100033506 426
880 3300050508 nmdc:mga09592_77530_c1 nmdc:mga09592_77530_c1_1420_2709 426
881 3300050509 nmdc:mga0qj67_145886_c1 nmdc:mga0qj67_145886_c1_77_1366 426
882 3300050509 nmdc:mga0qj67_226381_c1 nmdc:mga0qj67_226381_c1_192_1481 426
883 3300050510 nmdc:mga06r32_143618_c1 nmdc:mga06r32_143618_c1_916_2205 426
884 2162886007 SwRhRL2b_contig_1045895 SwRhRL2b_0914.00001930 428
885 3300005289 Ga0065704_10083135 Ga0065704_100831353 428
886 3300042876 Ga0451577_0058703 Ga0451577_0058703_1215_2501 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02403

Seryl_tRNA_N

Seryl-tRNA synthetase N-terminal domain

1

112

0.96

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

286

472

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6he3-assembly1.cif.gz_B pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)cytidine 0.9884 1 426
6hdz-assembly1.cif.gz_B pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)uridine 0.9864 1 426
6he3-assembly1.cif.gz_B pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)cytidine 0.9832 1 426
1skv-assembly1.cif.gz_B crystal structure of d-63 from sulfolobus spindle virus 1 0.9821 37 95
6hdz-assembly1.cif.gz_B pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)uridine 0.9812 1 426
ID Description Score Start End Superfamily
2dq3B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9874 105 427 3.30.930.10
2dq3B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9781 105 427 3.30.930.10
af_O94387_1197_1582_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9707 34 98 3.40.50.300
af_P9WFT7_105_418_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9677 106 427 3.30.930.10
af_K7MCG3_207_510_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9613 27 100 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A656H7G4-F1-model_v4 deleted 1.001 314 426
AF-A0A656H516-F1-model_v4 deleted 0.9999 328 426
AF-A0A257NUA9-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9948 290 427 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A353Y9I4-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9936 283 423 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A2S5LPB4-F1-model_v4 Serine--tRNA ligase (EC 6.1.1.11) 0.9921 184 428 GO:0004828
GO:0005524
GO:0005737
GO:0006434

Feature Viewer

pLDDT pTM Quality
94.2 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map