F484550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 294 | 1764 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10062088|Ga0114129_100620885 |
| Length | 152 |
| Sequence | MAPRQNHKGAKMAKKFKAIVRLQLEAGKANPAPPVGPALAGHGINIMAFCKEYNARTSNRQGEVLPAEITVFTDGSFTFVLKTSPAAVLLRKAAKVEKGSGVPNKEKVGRVTRAQVKEIAEQKMKDLNAIDLDSAMKQIEGTARSMGITVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 97 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 144 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 153 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 156 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 168 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 169 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 195 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 196 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 197 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 217 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 218 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 219 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 220 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 256 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 257 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 271 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 274 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 286 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 287 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 288 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 289 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 290 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 291 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 292 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 293 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 294 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.31 |
| Metatranscriptomes | 5.67 |
| Isolates | 1.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.06 |
| Nodule | 0 |
| Rhizoplane | 0.23 |
| Rhizosphere | 94.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10062088 | 3300009147 | Bacteria | 5221 |
| 2 | JGI24034J26672_10111802 | 3300002239 | Bacteria | 522 |
| 3 | JGI24751J29686_10027219 | 3300002459 | Bacteria | 1187 |
| 4 | Ga0058858_1403602 | 3300004785 | Bacteria | 638 |
| 5 | Ga0065712_10477473 | 3300005290 | Bacteria | 665 |
| 6 | Ga0065707_10000587 | 3300005295 | Bacteria | 19505 |
| 7 | Ga0065707_10006372 | 3300005295 | Bacteria | 5046 |
| 8 | Ga0065707_10050454 | 3300005295 | Bacteria | 725 |
| 9 | Ga0065707_10092154 | 3300005295 | Bacteria | 3817 |
| 10 | Ga0065707_10115339 | 3300005295 | Bacteria | 2270 |
| 11 | Ga0065707_10170592 | 3300005295 | Bacteria | 1488 |
| 12 | Ga0065707_10340054 | 3300005295 | Bacteria | 927 |
| 13 | Ga0065707_10424300 | 3300005295 | Bacteria | 827 |
| 14 | Ga0065707_10555710 | 3300005295 | Unclassified | 718 |
| 15 | Ga0070658_10046451 | 3300005327 | Bacteria | 3513 |
| 16 | Ga0070670_100005811 | 3300005331 | Bacteria | 10430 |
| 17 | Ga0070666_10001479 | 3300005335 | Bacteria | 14268 |
| 18 | Ga0070680_100195578 | 3300005336 | Bacteria | 1705 |
| 19 | Ga0070680_101050704 | 3300005336 | Bacteria | 704 |
| 20 | Ga0070689_100260311 | 3300005340 | Bacteria | 1434 |
| 21 | Ga0070687_100054259 | 3300005343 | Bacteria | 2088 |
| 22 | Ga0070692_10421072 | 3300005345 | Unclassified | 848 |
| 23 | Ga0070668_100003599 | 3300005347 | Bacteria | 11434 |
| 24 | Ga0070669_100000113 | 3300005353 | Bacteria | 77341 |
| 25 | Ga0070671_100000038 | 3300005355 | Bacteria | 94972 |
| 26 | Ga0070674_100196525 | 3300005356 | Bacteria | 1555 |
| 27 | Ga0070667_101393565 | 3300005367 | Bacteria | 657 |
| 28 | Ga0070709_11289928 | 3300005434 | Bacteria | 589 |
| 29 | Ga0070713_100208085 | 3300005436 | Bacteria | 1770 |
| 30 | Ga0070713_100556082 | 3300005436 | Bacteria | 1087 |
| 31 | Ga0070705_100009106 | 3300005440 | Bacteria | 4927 |
| 32 | Ga0070705_100068415 | 3300005440 | Bacteria | 2137 |
| 33 | Ga0070705_100240918 | 3300005440 | Bacteria | 1264 |
| 34 | Ga0070705_100256481 | 3300005440 | Bacteria | 1231 |
| 35 | Ga0070705_100324597 | 3300005440 | Bacteria | 1113 |
| 36 | Ga0070700_100752885 | 3300005441 | Bacteria | 780 |
| 37 | Ga0070694_100055848 | 3300005444 | Bacteria | 2679 |
| 38 | Ga0070694_100070258 | 3300005444 | Unclassified | 2411 |
| 39 | Ga0070694_100145184 | 3300005444 | Bacteria | 1727 |
| 40 | Ga0070708_100099333 | 3300005445 | Bacteria | 2662 |
| 41 | Ga0070708_100178155 | 3300005445 | Bacteria | 1986 |
| 42 | Ga0070708_100319026 | 3300005445 | Bacteria | 1464 |
| 43 | Ga0070706_100001045 | 3300005467 | Bacteria | 30028 |
| 44 | Ga0070706_100026404 | 3300005467 | Bacteria | 5343 |
| 45 | Ga0070706_100122224 | 3300005467 | Bacteria | 2427 |
| 46 | Ga0070706_100414079 | 3300005467 | Bacteria | 1255 |
| 47 | Ga0070706_100622995 | 3300005467 | Bacteria | 1002 |
| 48 | Ga0070706_100786578 | 3300005467 | Bacteria | 881 |
| 49 | Ga0070707_100049061 | 3300005468 | Bacteria | 4046 |
| 50 | Ga0070707_100122242 | 3300005468 | Bacteria | 2527 |
| 51 | Ga0070707_100262622 | 3300005468 | Bacteria | 1679 |
| 52 | Ga0070707_100419285 | 3300005468 | Bacteria | 1299 |
| 53 | Ga0070698_100006184 | 3300005471 | Bacteria | 13040 |
| 54 | Ga0070698_100008324 | 3300005471 | Bacteria | 11209 |
| 55 | Ga0070698_100044974 | 3300005471 | Bacteria | 4519 |
| 56 | Ga0070698_100137731 | 3300005471 | Bacteria | 2394 |
| 57 | Ga0070698_100165246 | 3300005471 | Bacteria | 2156 |
| 58 | Ga0070698_100301028 | 3300005471 | Bacteria | 1534 |
| 59 | Ga0070698_101142738 | 3300005471 | Unclassified | 728 |
| 60 | Ga0070699_100000572 | 3300005518 | Bacteria | 34809 |
| 61 | Ga0070699_100003541 | 3300005518 | Bacteria | 13803 |
| 62 | Ga0070699_100035302 | 3300005518 | Bacteria | 4322 |
| 63 | Ga0070699_100120697 | 3300005518 | Bacteria | 2305 |
| 64 | Ga0070699_100127764 | 3300005518 | Bacteria | 2239 |
| 65 | Ga0070699_101089545 | 3300005518 | Bacteria | 733 |
| 66 | Ga0070699_101823367 | 3300005518 | Bacteria | 557 |
| 67 | Ga0070679_100563618 | 3300005530 | Bacteria | 1083 |
| 68 | Ga0070684_101497415 | 3300005535 | Bacteria | 636 |
| 69 | Ga0070697_100016412 | 3300005536 | Bacteria | 5823 |
| 70 | Ga0070697_100025069 | 3300005536 | Bacteria | 4754 |
| 71 | Ga0070697_100335985 | 3300005536 | Bacteria | 1303 |
| 72 | Ga0070697_100394786 | 3300005536 | Bacteria | 1200 |
| 73 | Ga0070686_100298953 | 3300005544 | Bacteria | 1193 |
| 74 | Ga0070695_100007042 | 3300005545 | Bacteria | 6664 |
| 75 | Ga0070695_100017089 | 3300005545 | Bacteria | 4400 |
| 76 | Ga0070695_100065547 | 3300005545 | Bacteria | 2365 |
| 77 | Ga0070695_100114297 | 3300005545 | Bacteria | 1837 |
| 78 | Ga0070695_100154749 | 3300005545 | Bacteria | 1603 |
| 79 | Ga0070695_100854077 | 3300005545 | Bacteria | 733 |
| 80 | Ga0070696_100041162 | 3300005546 | Bacteria | 3191 |
| 81 | Ga0070696_100278885 | 3300005546 | Bacteria | 1273 |
| 82 | Ga0070665_100018152 | 3300005548 | Bacteria | 7057 |
| 83 | Ga0070704_100168145 | 3300005549 | Bacteria | 1741 |
| 84 | Ga0070704_100428141 | 3300005549 | Bacteria | 1135 |
| 85 | Ga0070704_100625199 | 3300005549 | Bacteria | 949 |
| 86 | Ga0068857_100199871 | 3300005577 | Bacteria | 1822 |
| 87 | Ga0068857_100403110 | 3300005577 | Unclassified | 1273 |
| 88 | Ga0068854_101501230 | 3300005578 | Unclassified | 612 |
| 89 | Ga0068854_101525047 | 3300005578 | Bacteria | 607 |
| 90 | Ga0068856_100147198 | 3300005614 | Bacteria | 2363 |
| 91 | Ga0068859_100000085 | 3300005617 | Bacteria | 85748 |
| 92 | Ga0068859_100300106 | 3300005617 | Bacteria | 1700 |
| 93 | Ga0068864_100000774 | 3300005618 | Bacteria | 26845 |
| 94 | Ga0068864_100046272 | 3300005618 | Bacteria | 3733 |
| 95 | Ga0068866_10815849 | 3300005718 | Bacteria | 650 |
| 96 | Ga0068861_100003294 | 3300005719 | Bacteria | 10692 |
| 97 | Ga0068861_100036368 | 3300005719 | Bacteria | 3654 |
| 98 | Ga0068861_100103177 | 3300005719 | Bacteria | 2272 |
| 99 | Ga0068861_100511266 | 3300005719 | Bacteria | 1088 |
| 100 | Ga0068861_101170129 | 3300005719 | Bacteria | 742 |
| 101 | Ga0068870_10632578 | 3300005840 | Bacteria | 731 |
| 102 | Ga0068863_100043591 | 3300005841 | Bacteria | 4258 |
| 103 | Ga0068858_100001589 | 3300005842 | Bacteria | 23176 |
| 104 | Ga0068860_100017147 | 3300005843 | Bacteria | 7060 |
| 105 | Ga0068860_100076778 | 3300005843 | Bacteria | 3177 |
| 106 | Ga0068860_100301438 | 3300005843 | Bacteria | 1570 |
| 107 | Ga0068862_100001040 | 3300005844 | Bacteria | 26611 |
| 108 | Ga0068862_100004463 | 3300005844 | Bacteria | 11802 |
| 109 | Ga0068862_100030047 | 3300005844 | Bacteria | 4579 |
| 110 | Ga0068862_100067977 | 3300005844 | Unclassified | 3073 |
| 111 | Ga0068862_100127802 | 3300005844 | Bacteria | 2245 |
| 112 | Ga0068862_100575944 | 3300005844 | Bacteria | 1078 |
| 113 | Ga0081455_10164677 | 3300005937 | Bacteria | 1695 |
| 114 | Ga0081455_10623787 | 3300005937 | Bacteria | 699 |
| 115 | Ga0081539_10001957 | 3300005985 | Bacteria | 31406 |
| 116 | Ga0081539_10184672 | 3300005985 | Unclassified | 975 |
| 117 | Ga0070717_10000098 | 3300006028 | Bacteria | 67146 |
| 118 | Ga0070717_10094351 | 3300006028 | Bacteria | 2531 |
| 119 | Ga0075368_10077154 | 3300006042 | Bacteria | 1352 |
| 120 | Ga0075368_10179707 | 3300006042 | Bacteria | 892 |
| 121 | Ga0075368_10491003 | 3300006042 | Bacteria | 547 |
| 122 | Ga0075363_100069917 | 3300006048 | Bacteria | 1905 |
| 123 | Ga0075364_10043992 | 3300006051 | Bacteria | 2903 |
| 124 | Ga0075364_10411738 | 3300006051 | Bacteria | 923 |
| 125 | Ga0075364_10416663 | 3300006051 | Bacteria | 917 |
| 126 | Ga0070716_100179443 | 3300006173 | Bacteria | 1389 |
| 127 | Ga0070712_100441704 | 3300006175 | Bacteria | 1082 |
| 128 | Ga0075362_10182741 | 3300006177 | Bacteria | 1016 |
| 129 | Ga0075367_10172354 | 3300006178 | Bacteria | 1348 |
| 130 | Ga0075367_10520862 | 3300006178 | Bacteria | 755 |
| 131 | Ga0075427_10004500 | 3300006194 | Bacteria | 1957 |
| 132 | Ga0075427_10007147 | 3300006194 | Bacteria | 1636 |
| 133 | Ga0075366_10019611 | 3300006195 | Bacteria | 3916 |
| 134 | Ga0075370_10061129 | 3300006353 | Bacteria | 2146 |
| 135 | Ga0075428_100004514 | 3300006844 | Bacteria | 15372 |
| 136 | Ga0075428_100079686 | 3300006844 | Bacteria | 3574 |
| 137 | Ga0075428_100165332 | 3300006844 | Bacteria | 2400 |
| 138 | Ga0075428_100590207 | 3300006844 | Bacteria | 1187 |
| 139 | Ga0075428_101573631 | 3300006844 | Bacteria | 688 |
| 140 | Ga0075428_101753941 | 3300006844 | Bacteria | 647 |
| 141 | Ga0075428_102195189 | 3300006844 | Bacteria | 570 |
| 142 | Ga0075428_102398873 | 3300006844 | Bacteria | 542 |
| 143 | Ga0075430_100043161 | 3300006846 | Bacteria | 3811 |
| 144 | Ga0075430_100552790 | 3300006846 | Bacteria | 949 |
| 145 | Ga0075430_100564293 | 3300006846 | Bacteria | 939 |
| 146 | Ga0075431_100026658 | 3300006847 | Bacteria | 5928 |
| 147 | Ga0075431_100057206 | 3300006847 | Bacteria | 4022 |
| 148 | Ga0075431_100085999 | 3300006847 | Bacteria | 3245 |
| 149 | Ga0075431_101298981 | 3300006847 | Bacteria | 689 |
| 150 | Ga0075431_102149406 | 3300006847 | Bacteria | 513 |
| 151 | Ga0075433_10155467 | 3300006852 | Bacteria | 2035 |
| 152 | Ga0075433_10178415 | 3300006852 | Bacteria | 1890 |
| 153 | Ga0075433_10904819 | 3300006852 | Bacteria | 770 |
| 154 | Ga0075434_100038530 | 3300006871 | Bacteria | 4733 |
| 155 | Ga0075434_100117206 | 3300006871 | Bacteria | 2676 |
| 156 | Ga0075434_100126032 | 3300006871 | Bacteria | 2578 |
| 157 | Ga0075434_100463129 | 3300006871 | Bacteria | 1289 |
| 158 | Ga0075434_100537395 | 3300006871 | Bacteria | 1189 |
| 159 | Ga0075434_100613686 | 3300006871 | Bacteria | 1107 |
| 160 | Ga0075429_100014633 | 3300006880 | Bacteria | 6800 |
| 161 | Ga0075429_100109304 | 3300006880 | Bacteria | 2416 |
| 162 | Ga0075429_100123503 | 3300006880 | Bacteria | 2264 |
| 163 | Ga0075429_100133661 | 3300006880 | Bacteria | 2170 |
| 164 | Ga0075429_100372912 | 3300006880 | Bacteria | 1249 |
| 165 | Ga0075436_100001542 | 3300006914 | Bacteria | 15741 |
| 166 | Ga0075436_100467350 | 3300006914 | Bacteria | 920 |
| 167 | Ga0097620_100000085 | 3300006931 | Bacteria | 85748 |
| 168 | Ga0097620_100300081 | 3300006931 | Bacteria | 1700 |
| 169 | Ga0075435_100140740 | 3300007076 | Bacteria | 2024 |
| 170 | Ga0075435_100149234 | 3300007076 | Bacteria | 1965 |
| 171 | Ga0099794_10458384 | 3300007265 | Bacteria | 669 |
| 172 | Ga0099795_10003373 | 3300007788 | Bacteria | 3941 |
| 173 | Ga0105251_10493214 | 3300009011 | Bacteria | 571 |
| 174 | Ga0111539_10063480 | 3300009094 | Bacteria | 4370 |
| 175 | Ga0111539_10558960 | 3300009094 | Bacteria | 1333 |
| 176 | Ga0105247_10000438 | 3300009101 | Bacteria | 35374 |
| 177 | Ga0105247_10307914 | 3300009101 | Bacteria | 1101 |
| 178 | Ga0114129_10004898 | 3300009147 | Bacteria | 18897 |
| 179 | Ga0114129_10049809 | 3300009147 | Bacteria | 5885 |
| 180 | Ga0114129_10141497 | 3300009147 | Bacteria | 3297 |
| 181 | Ga0114129_10147114 | 3300009147 | Bacteria | 3226 |
| 182 | Ga0114129_10160327 | 3300009147 | Bacteria | 3073 |
| 183 | Ga0114129_10205246 | 3300009147 | Bacteria | 2667 |
| 184 | Ga0114129_10229744 | 3300009147 | Bacteria | 2499 |
| 185 | Ga0114129_10494042 | 3300009147 | Bacteria | 1599 |
| 186 | Ga0105243_10030780 | 3300009148 | Bacteria | 4135 |
| 187 | Ga0105243_10511886 | 3300009148 | Bacteria | 1140 |
| 188 | Ga0105243_10519416 | 3300009148 | Unclassified | 1132 |
| 189 | Ga0105241_10338741 | 3300009174 | Bacteria | 1302 |
| 190 | Ga0105242_10657443 | 3300009176 | Bacteria | 1020 |
| 191 | Ga0105242_11025471 | 3300009176 | Bacteria | 834 |
| 192 | Ga0105248_10163052 | 3300009177 | Bacteria | 2513 |
| 193 | Ga0105237_10534107 | 3300009545 | Bacteria | 1179 |
| 194 | Ga0105249_10001806 | 3300009553 | Bacteria | 18608 |
| 195 | Ga0105249_10060852 | 3300009553 | Bacteria | 3464 |
| 196 | Ga0105249_10112038 | 3300009553 | Bacteria | 2580 |
| 197 | Ga0105249_10504573 | 3300009553 | Bacteria | 1255 |
| 198 | Ga0105249_10556248 | 3300009553 | Bacteria | 1198 |
| 199 | Ga0105249_10578433 | 3300009553 | Bacteria | 1176 |
| 200 | Ga0105028_100757 | 3300009993 | Bacteria | 3444 |
| 201 | Ga0105246_10023821 | 3300011119 | Bacteria | 3967 |
| 202 | Ga0105246_10900262 | 3300011119 | Bacteria | 793 |
| 203 | Ga0105246_11057456 | 3300011119 | Bacteria | 738 |
| 204 | Ga0157370_10672307 | 3300013104 | Bacteria | 946 |
| 205 | Ga0157374_10286084 | 3300013296 | Bacteria | 1628 |
| 206 | Ga0163162_10269519 | 3300013306 | Bacteria | 1834 |
| 207 | Ga0163162_10595939 | 3300013306 | Bacteria | 1232 |
| 208 | Ga0163163_10247489 | 3300014325 | Bacteria | 1833 |
| 209 | Ga0157380_10174682 | 3300014326 | Bacteria | 1881 |
| 210 | Ga0157380_10537631 | 3300014326 | Bacteria | 1144 |
| 211 | Ga0157380_10820954 | 3300014326 | Bacteria | 949 |
| 212 | Ga0182008_10094039 | 3300014497 | Bacteria | 1479 |
| 213 | Ga0157377_10519744 | 3300014745 | Bacteria | 835 |
| 214 | Ga0157377_10713072 | 3300014745 | Bacteria | 730 |
| 215 | Ga0157379_10073319 | 3300014968 | Bacteria | 3064 |
| 216 | Ga0157379_10124606 | 3300014968 | Bacteria | 2318 |
| 217 | Ga0157379_11734173 | 3300014968 | Bacteria | 612 |
| 218 | Ga0163161_10036820 | 3300017792 | Bacteria | 3505 |
| 219 | Ga0163161_10755954 | 3300017792 | Bacteria | 814 |
| 220 | Ga0197907_10360951 | 3300020069 | Bacteria | 884 |
| 221 | Ga0206356_10082133 | 3300020070 | Bacteria | 846 |
| 222 | Ga0206349_1462337 | 3300020075 | Bacteria | 880 |
| 223 | Ga0206355_1196808 | 3300020076 | Bacteria | 650 |
| 224 | Ga0206350_10302126 | 3300020080 | Bacteria | 1106 |
| 225 | Ga0206354_10569944 | 3300020081 | Bacteria | 1089 |
| 226 | Ga0206353_10491213 | 3300020082 | Bacteria | 993 |
| 227 | Ga0206353_10537727 | 3300020082 | Bacteria | 758 |
| 228 | Ga0213875_10002415 | 3300021388 | Bacteria | 11225 |
| 229 | Ga0213875_10003082 | 3300021388 | Bacteria | 9629 |
| 230 | Ga0213875_10294443 | 3300021388 | Bacteria | 767 |
| 231 | Ga0224712_10072693 | 3300022467 | Bacteria | 1401 |
| 232 | Ga0224712_10206572 | 3300022467 | Bacteria | 894 |
| 233 | Ga0224712_10381521 | 3300022467 | Bacteria | 670 |
| 234 | Ga0209233_1019045 | 3300025261 | Bacteria | 1833 |
| 235 | Ga0207697_10000381 | 3300025315 | Bacteria | 24849 |
| 236 | Ga0207653_10078893 | 3300025885 | Bacteria | 1137 |
| 237 | Ga0207653_10124470 | 3300025885 | Bacteria | 931 |
| 238 | Ga0207710_10136610 | 3300025900 | Bacteria | 1181 |
| 239 | Ga0207680_10000082 | 3300025903 | Bacteria | 42968 |
| 240 | Ga0207643_10114717 | 3300025908 | Bacteria | 1590 |
| 241 | Ga0207643_10352094 | 3300025908 | Bacteria | 925 |
| 242 | Ga0207684_10001113 | 3300025910 | Bacteria | 30041 |
| 243 | Ga0207684_10211116 | 3300025910 | Bacteria | 1675 |
| 244 | Ga0207684_10392937 | 3300025910 | Bacteria | 1192 |
| 245 | Ga0207684_10472176 | 3300025910 | Bacteria | 1076 |
| 246 | Ga0207684_10831299 | 3300025910 | Bacteria | 779 |
| 247 | Ga0207660_11380080 | 3300025917 | Bacteria | 571 |
| 248 | Ga0207662_10851305 | 3300025918 | Bacteria | 644 |
| 249 | Ga0207646_10001188 | 3300025922 | Bacteria | 32801 |
| 250 | Ga0207646_10045525 | 3300025922 | Bacteria | 3939 |
| 251 | Ga0207646_10048225 | 3300025922 | Bacteria | 3818 |
| 252 | Ga0207646_10323037 | 3300025922 | Bacteria | 1394 |
| 253 | Ga0207646_10330675 | 3300025922 | Bacteria | 1377 |
| 254 | Ga0207646_10523517 | 3300025922 | Bacteria | 1067 |
| 255 | Ga0207646_10623900 | 3300025922 | Bacteria | 967 |
| 256 | Ga0207646_10804106 | 3300025922 | Bacteria | 837 |
| 257 | Ga0207681_10000042 | 3300025923 | Bacteria | 137167 |
| 258 | Ga0207650_10004482 | 3300025925 | Bacteria | 9545 |
| 259 | Ga0207644_10000071 | 3300025931 | Bacteria | 74753 |
| 260 | Ga0207686_10262900 | 3300025934 | Bacteria | 1266 |
| 261 | Ga0207709_10337753 | 3300025935 | Bacteria | 1133 |
| 262 | Ga0207709_11017229 | 3300025935 | Unclassified | 678 |
| 263 | Ga0207665_10160995 | 3300025939 | Bacteria | 1614 |
| 264 | Ga0207665_10213043 | 3300025939 | Bacteria | 1412 |
| 265 | Ga0207711_10136600 | 3300025941 | Bacteria | 2203 |
| 266 | Ga0207661_11253850 | 3300025944 | Bacteria | 682 |
| 267 | Ga0207712_10008761 | 3300025961 | Bacteria | 6400 |
| 268 | Ga0207668_10047534 | 3300025972 | Bacteria | 2938 |
| 269 | Ga0207668_10131170 | 3300025972 | Bacteria | 1914 |
| 270 | Ga0207640_11474713 | 3300025981 | Bacteria | 611 |
| 271 | Ga0207658_10001962 | 3300025986 | Bacteria | 15343 |
| 272 | Ga0207703_10010626 | 3300026035 | Bacteria | 7191 |
| 273 | Ga0207708_10297926 | 3300026075 | Bacteria | 1311 |
| 274 | Ga0207708_10802055 | 3300026075 | Bacteria | 810 |
| 275 | Ga0207708_11080675 | 3300026075 | Bacteria | 699 |
| 276 | Ga0207641_10055708 | 3300026088 | Bacteria | 3357 |
| 277 | Ga0207676_10194571 | 3300026095 | Bacteria | 1787 |
| 278 | Ga0207674_10073966 | 3300026116 | Bacteria | 3420 |
| 279 | Ga0207674_10330925 | 3300026116 | Unclassified | 1473 |
| 280 | Ga0207675_100001141 | 3300026118 | Bacteria | 26317 |
| 281 | Ga0207675_100065675 | 3300026118 | Bacteria | 3391 |
| 282 | Ga0207675_100281090 | 3300026118 | Bacteria | 1617 |
| 283 | Ga0209999_1059243 | 3300027543 | Bacteria | 728 |
| 284 | Ga0209983_1025499 | 3300027665 | Bacteria | 1247 |
| 285 | Ga0209588_1004644 | 3300027671 | Bacteria | 3892 |
| 286 | Ga0209966_1000148 | 3300027695 | Bacteria | 29881 |
| 287 | Ga0209998_10019930 | 3300027717 | Bacteria | 1432 |
| 288 | Ga0209813_10120840 | 3300027866 | Bacteria | 912 |
| 289 | Ga0209974_10459737 | 3300027876 | Bacteria | 506 |
| 290 | Ga0268265_10000043 | 3300028380 | Bacteria | 186081 |
| 291 | Ga0268265_10007163 | 3300028380 | Bacteria | 7535 |
| 292 | Ga0268265_10019052 | 3300028380 | Bacteria | 4765 |
| 293 | Ga0268265_10104798 | 3300028380 | Bacteria | 2293 |
| 294 | Ga0268265_10434206 | 3300028380 | Bacteria | 1222 |
| 295 | Ga0268265_10761576 | 3300028380 | Bacteria | 940 |
| 296 | Ga0268264_10000154 | 3300028381 | Bacteria | 156992 |
| 297 | Ga0268264_10259498 | 3300028381 | Bacteria | 1618 |
| 298 | Ga0265326_10014825 | 3300028558 | Bacteria | 2267 |
| 299 | Ga0265334_10011438 | 3300028573 | Bacteria | 3738 |
| 300 | Ga0265318_10013800 | 3300028577 | Bacteria | 3403 |
| 301 | Ga0265318_10114316 | 3300028577 | Bacteria | 992 |
| 302 | Ga0265323_10020880 | 3300028653 | Bacteria | 2516 |
| 303 | Ga0265323_10207737 | 3300028653 | Bacteria | 615 |
| 304 | Ga0307515_10475269 | 3300028794 | Bacteria | 863 |
| 305 | Ga0265330_10182556 | 3300031235 | Bacteria | 889 |
| 306 | Ga0265328_10037602 | 3300031239 | Bacteria | 1787 |
| 307 | Ga0265328_10155856 | 3300031239 | Bacteria | 860 |
| 308 | Ga0265328_10305604 | 3300031239 | Bacteria | 615 |
| 309 | Ga0265320_10022503 | 3300031240 | Bacteria | 3370 |
| 310 | Ga0265320_10067806 | 3300031240 | Bacteria | 1687 |
| 311 | Ga0265320_10484300 | 3300031240 | Bacteria | 546 |
| 312 | Ga0265329_10034920 | 3300031242 | Bacteria | 1623 |
| 313 | Ga0265340_10007384 | 3300031247 | Bacteria | 5968 |
| 314 | Ga0265331_10064179 | 3300031250 | Unclassified | 1729 |
| 315 | Ga0265316_10473253 | 3300031344 | Bacteria | 897 |
| 316 | Ga0265316_10475738 | 3300031344 | Unclassified | 894 |
| 317 | Ga0265316_10974529 | 3300031344 | Bacteria | 591 |
| 318 | Ga0307408_100150622 | 3300031548 | Bacteria | 1836 |
| 319 | Ga0307408_102179042 | 3300031548 | Bacteria | 535 |
| 320 | Ga0316575_10006897 | 3300031665 | Bacteria | 4111 |
| 321 | Ga0316575_10009777 | 3300031665 | Bacteria | 3516 |
| 322 | Ga0316575_10026808 | 3300031665 | Bacteria | 2240 |
| 323 | Ga0316575_10045949 | 3300031665 | Bacteria | 1734 |
| 324 | Ga0316575_10218184 | 3300031665 | Bacteria | 796 |
| 325 | Ga0316579_10008407 | 3300031691 | Bacteria | 4300 |
| 326 | Ga0316579_10008867 | 3300031691 | Bacteria | 4210 |
| 327 | Ga0316579_10182585 | 3300031691 | Bacteria | 1014 |
| 328 | Ga0316579_10452884 | 3300031691 | Unclassified | 621 |
| 329 | Ga0316579_10564004 | 3300031691 | Unclassified | 551 |
| 330 | Ga0265314_10004886 | 3300031711 | Bacteria | 12256 |
| 331 | Ga0265314_10029849 | 3300031711 | Bacteria | 4046 |
| 332 | Ga0265314_10035342 | 3300031711 | Bacteria | 3643 |
| 333 | Ga0265314_10228268 | 3300031711 | Bacteria | 1082 |
| 334 | Ga0316576_10017915 | 3300031727 | Bacteria | 4825 |
| 335 | Ga0316576_10023326 | 3300031727 | Bacteria | 4308 |
| 336 | Ga0316576_10063223 | 3300031727 | Bacteria | 2716 |
| 337 | Ga0316576_10100736 | 3300031727 | Bacteria | 2159 |
| 338 | Ga0316576_10144038 | 3300031727 | Bacteria | 1794 |
| 339 | Ga0316576_10176271 | 3300031727 | Bacteria | 1613 |
| 340 | Ga0316576_10187714 | 3300031727 | Unclassified | 1559 |
| 341 | Ga0316576_10371041 | 3300031727 | Bacteria | 1063 |
| 342 | Ga0316576_10404329 | 3300031727 | Bacteria | 1012 |
| 343 | Ga0316576_10475752 | 3300031727 | Bacteria | 921 |
| 344 | Ga0316576_10541232 | 3300031727 | Bacteria | 854 |
| 345 | Ga0316576_10701600 | 3300031727 | Bacteria | 733 |
| 346 | Ga0316578_10018162 | 3300031728 | Bacteria | 3847 |
| 347 | Ga0316578_10045005 | 3300031728 | Bacteria | 2568 |
| 348 | Ga0316578_10121285 | 3300031728 | Bacteria | 1572 |
| 349 | Ga0316578_10179398 | 3300031728 | Bacteria | 1276 |
| 350 | Ga0316578_10188545 | 3300031728 | Bacteria | 1242 |
| 351 | Ga0316578_10193035 | 3300031728 | Bacteria | 1227 |
| 352 | Ga0316578_10210053 | 3300031728 | Bacteria | 1171 |
| 353 | Ga0316578_10486911 | 3300031728 | Unclassified | 727 |
| 354 | Ga0307405_10071186 | 3300031731 | Bacteria | 2236 |
| 355 | Ga0316577_10011084 | 3300031733 | Bacteria | 4878 |
| 356 | Ga0316577_10012690 | 3300031733 | Bacteria | 4594 |
| 357 | Ga0316577_10018038 | 3300031733 | Bacteria | 3901 |
| 358 | Ga0316577_10018842 | 3300031733 | Bacteria | 3818 |
| 359 | Ga0316577_10019936 | 3300031733 | Bacteria | 3714 |
| 360 | Ga0316577_10019982 | 3300031733 | Bacteria | 3709 |
| 361 | Ga0316577_10028499 | 3300031733 | Bacteria | 3115 |
| 362 | Ga0316577_10029540 | 3300031733 | Bacteria | 3059 |
| 363 | Ga0316577_10185603 | 3300031733 | Bacteria | 1175 |
| 364 | Ga0316577_10191994 | 3300031733 | Unclassified | 1154 |
| 365 | Ga0316577_10199153 | 3300031733 | Bacteria | 1132 |
| 366 | Ga0316577_10206470 | 3300031733 | Bacteria | 1110 |
| 367 | Ga0316577_10222059 | 3300031733 | Bacteria | 1068 |
| 368 | Ga0316577_10316790 | 3300031733 | Unclassified | 884 |
| 369 | Ga0316577_10464088 | 3300031733 | Bacteria | 720 |
| 370 | Ga0316577_10680772 | 3300031733 | Bacteria | 585 |
| 371 | Ga0307413_10014248 | 3300031824 | Bacteria | 4030 |
| 372 | Ga0307410_10156666 | 3300031852 | Bacteria | 1702 |
| 373 | Ga0307410_10443381 | 3300031852 | Bacteria | 1058 |
| 374 | Ga0307407_10004321 | 3300031903 | Bacteria | 6006 |
| 375 | Ga0307409_100026443 | 3300031995 | Bacteria | 4093 |
| 376 | Ga0307409_100202902 | 3300031995 | Bacteria | 1776 |
| 377 | Ga0307409_100623147 | 3300031995 | Bacteria | 1069 |
| 378 | Ga0307416_100992455 | 3300032002 | Bacteria | 942 |
| 379 | Ga0307416_101457642 | 3300032002 | Bacteria | 790 |
| 380 | Ga0307414_10493557 | 3300032004 | Bacteria | 1082 |
| 381 | Ga0307411_10159570 | 3300032005 | Bacteria | 1687 |
| 382 | Ga0307415_100486586 | 3300032126 | Bacteria | 1075 |
| 383 | Ga0307415_100523370 | 3300032126 | Bacteria | 1041 |
| 384 | Ga0307415_102343120 | 3300032126 | Bacteria | 524 |
| 385 | Ga0316585_10009054 | 3300032137 | Bacteria | 2895 |
| 386 | Ga0316585_10044701 | 3300032137 | Bacteria | 1416 |
| 387 | Ga0316585_10151965 | 3300032137 | Bacteria | 764 |
| 388 | Ga0316585_10169046 | 3300032137 | Bacteria | 722 |
| 389 | Ga0316585_10299250 | 3300032137 | Bacteria | 534 |
| 390 | Ga0316580_10169036 | 3300032139 | Bacteria | 672 |
| 391 | Ga0316593_10003827 | 3300032168 | Bacteria | 3784 |
| 392 | Ga0316593_10005544 | 3300032168 | Bacteria | 3340 |
| 393 | Ga0316593_10009218 | 3300032168 | Bacteria | 2780 |
| 394 | Ga0316593_10009227 | 3300032168 | Bacteria | 2779 |
| 395 | Ga0316593_10013031 | 3300032168 | Bacteria | 2453 |
| 396 | Ga0316593_10030117 | 3300032168 | Bacteria | 1760 |
| 397 | Ga0316593_10035522 | 3300032168 | Bacteria | 1640 |
| 398 | Ga0316593_10044666 | 3300032168 | Bacteria | 1483 |
| 399 | Ga0316593_10054056 | 3300032168 | Bacteria | 1362 |
| 400 | Ga0316593_10073632 | 3300032168 | Bacteria | 1184 |
| 401 | Ga0316593_10130154 | 3300032168 | Bacteria | 907 |
| 402 | Ga0316593_10131286 | 3300032168 | Bacteria | 904 |
| 403 | Ga0316593_10194141 | 3300032168 | Bacteria | 749 |
| 404 | Ga0316593_10295562 | 3300032168 | Unclassified | 612 |
| 405 | Ga0316592_1001374 | 3300033524 | Bacteria | 3888 |
| 406 | Ga0316592_1009153 | 3300033524 | Unclassified | 1977 |
| 407 | Ga0316592_1014905 | 3300033524 | Bacteria | 1615 |
| 408 | Ga0316592_1016455 | 3300033524 | Bacteria | 1545 |
| 409 | Ga0316592_1016479 | 3300033524 | Bacteria | 1544 |
| 410 | Ga0316592_1017300 | 3300033524 | Bacteria | 1512 |
| 411 | Ga0316592_1089009 | 3300033524 | Bacteria | 705 |
| 412 | Ga0316592_1089924 | 3300033524 | Bacteria | 702 |
| 413 | Ga0316592_1099943 | 3300033524 | Bacteria | 667 |
| 414 | Ga0316596_1003416 | 3300033541 | Bacteria | 3477 |
| 415 | Ga0316596_1007889 | 3300033541 | Bacteria | 2524 |
| 416 | Ga0316596_1016720 | 3300033541 | Bacteria | 1839 |
| 417 | Ga0316596_1085949 | 3300033541 | Bacteria | 847 |
| 418 | Ga0316596_1149157 | 3300033541 | Bacteria | 642 |
| 419 | Ga0373948_0027238 | 3300034817 | Bacteria | 1131 |
| 420 | Ga0373948_0069808 | 3300034817 | Bacteria | 786 |
| 421 | Ga0373926_0039742 | 3300035083 | Bacteria | 1678 |
| 422 | Ga0373940_0218119 | 3300035088 | Bacteria | 633 |
| 423 | Ga0373936_0043941 | 3300035113 | Bacteria | 1797 |
| 424 | Ga0373956_0071437 | 3300035119 | Bacteria | 1584 |
| 425 | Ga0373960_0214859 | 3300035121 | Bacteria | 686 |
| 426 | Ga0373946_0103214 | 3300035171 | Bacteria | 1281 |
| 427 | Ga0316574_0000261 | 3300035398 | Bacteria | 19379 |
| 428 | Ga0316574_0003387 | 3300035398 | Bacteria | 8207 |
| 429 | Ga0316574_0004920 | 3300035398 | Bacteria | 7075 |
| 430 | Ga0316574_0006478 | 3300035398 | Bacteria | 6331 |
| 431 | Ga0316574_0045246 | 3300035398 | Bacteria | 2725 |
| 432 | Ga0316574_0187099 | 3300035398 | Bacteria | 1332 |
| 433 | Ga0316574_0585571 | 3300035398 | Bacteria | 690 |
| 434 | Ga0316574_0749365 | 3300035398 | Bacteria | 597 |
| 435 | Ga0373927_0026088 | 3300035695 | Bacteria | 3819 |
| 436 | Ga0373933_0098252 | 3300035724 | Bacteria | 1814 |
| 437 | Ga0373937_0079421 | 3300036401 | Bacteria | 3032 |
| 438 | Ga0373937_0094576 | 3300036401 | Bacteria | 2771 |
| 439 | Ga0316582_0006715 | 3300036647 | Bacteria | 6072 |
| 440 | Ga0316582_0010401 | 3300036647 | Bacteria | 5094 |
| 441 | Ga0316582_0015629 | 3300036647 | Bacteria | 4347 |
| 442 | Ga0316582_0049422 | 3300036647 | Bacteria | 2660 |
| 443 | Ga0316582_0056916 | 3300036647 | Bacteria | 2496 |
| 444 | Ga0316582_0067497 | 3300036647 | Bacteria | 2307 |
| 445 | Ga0316582_0107805 | 3300036647 | Bacteria | 1851 |
| 446 | Ga0316582_0113717 | 3300036647 | Bacteria | 1804 |
| 447 | Ga0316582_0163234 | 3300036647 | Bacteria | 1510 |
| 448 | Ga0316582_0186601 | 3300036647 | Bacteria | 1412 |
| 449 | Ga0316582_0245904 | 3300036647 | Bacteria | 1226 |
| 450 | Ga0316582_0443986 | 3300036647 | Unclassified | 894 |
| 451 | Ga0316582_0661319 | 3300036647 | Bacteria | 718 |
| 452 | Ga0316584_0002700 | 3300036712 | Bacteria | 11335 |
| 453 | Ga0316584_0011449 | 3300036712 | Bacteria | 6232 |
| 454 | Ga0316584_0018735 | 3300036712 | Bacteria | 4996 |
| 455 | Ga0316584_0024312 | 3300036712 | Bacteria | 4433 |
| 456 | Ga0316584_0025694 | 3300036712 | Bacteria | 4320 |
| 457 | Ga0316584_0033125 | 3300036712 | Bacteria | 3825 |
| 458 | Ga0316584_0043744 | 3300036712 | Bacteria | 3340 |
| 459 | Ga0316584_0048608 | 3300036712 | Bacteria | 3169 |
| 460 | Ga0316584_0121292 | 3300036712 | Bacteria | 1953 |
| 461 | Ga0316584_0124523 | 3300036712 | Bacteria | 1925 |
| 462 | Ga0316584_0128922 | 3300036712 | Bacteria | 1889 |
| 463 | Ga0316584_0130815 | 3300036712 | Bacteria | 1875 |
| 464 | Ga0316584_0155437 | 3300036712 | Bacteria | 1701 |
| 465 | Ga0316584_0181196 | 3300036712 | Bacteria | 1559 |
| 466 | Ga0316584_0240828 | 3300036712 | Unclassified | 1324 |
| 467 | Ga0316584_0379554 | 3300036712 | Bacteria | 1010 |
| 468 | Ga0316584_0434188 | 3300036712 | Bacteria | 931 |
| 469 | Ga0316584_0654154 | 3300036712 | Unclassified | 724 |
| 470 | Ga0373925_0091251 | 3300037068 | Bacteria | 2329 |
| 471 | Ga0316581_0002414 | 3300037588 | Bacteria | 4465 |
| 472 | Ga0316581_0003008 | 3300037588 | Bacteria | 4146 |
| 473 | Ga0316581_0012762 | 3300037588 | Bacteria | 2371 |
| 474 | Ga0316581_0091350 | 3300037588 | Bacteria | 937 |
| 475 | Ga0316581_0145709 | 3300037588 | Bacteria | 730 |
| 476 | Ga0436364_0037967 | 3300037853 | Bacteria | 6863 |
| 477 | Ga0436364_0145179 | 3300037853 | Bacteria | 5161 |
| 478 | Ga0436364_1200244 | 3300037853 | Bacteria | 15836 |
| 479 | Ga0395901_0604199 | 3300038443 | Bacteria | 1106 |
| 480 | Ga0436365_0615669 | 3300039437 | Bacteria | 1222 |
| 481 | Ga0436365_1357939 | 3300039437 | Bacteria | 724 |
| 482 | Ga0436360_0200572 | 3300039438 | Bacteria | 823 |
| 483 | Ga0436360_0929768 | 3300039438 | Bacteria | 2260 |
| 484 | Ga0436361_0803629 | 3300039447 | Bacteria | 3262 |
| 485 | Ga0436363_0907150 | 3300039450 | Bacteria | 821 |
| 486 | Ga0436362_0185069 | 3300039453 | Bacteria | 538 |
| 487 | Ga0436362_0489543 | 3300039453 | Bacteria | 891 |
| 488 | Ga0439453_0069258 | 3300041408 | Bacteria | 744 |
| 489 | Ga0439466_0198862 | 3300041411 | Bacteria | 610 |
| 490 | Ga0451800_1124329 | 3300041459 | Bacteria | 1155 |
| 491 | Ga0439458_0209270 | 3300042157 | Bacteria | 535 |
| 492 | Ga0451577_0000255 | 3300042876 | Bacteria | 105353 |
| 493 | Ga0451577_0016422 | 3300042876 | Bacteria | 6858 |
| 494 | Ga0451577_0036920 | 3300042876 | Bacteria | 4399 |
| 495 | Ga0451577_0046722 | 3300042876 | Bacteria | 3873 |
| 496 | Ga0451577_0073510 | 3300042876 | Bacteria | 3050 |
| 497 | Ga0451577_0090038 | 3300042876 | Bacteria | 2738 |
| 498 | Ga0451577_0146669 | 3300042876 | Bacteria | 2122 |
| 499 | Ga0451577_0168986 | 3300042876 | Bacteria | 1970 |
| 500 | Ga0451577_0212722 | 3300042876 | Bacteria | 1747 |
| 501 | Ga0451577_0218263 | 3300042876 | Bacteria | 1723 |
| 502 | Ga0451577_0226400 | 3300042876 | Bacteria | 1691 |
| 503 | Ga0451577_0255749 | 3300042876 | Bacteria | 1586 |
| 504 | Ga0451577_0263217 | 3300042876 | Bacteria | 1561 |
| 505 | Ga0451577_0410475 | 3300042876 | Bacteria | 1229 |
| 506 | Ga0451577_0581871 | 3300042876 | Bacteria | 1016 |
| 507 | Ga0451577_0602394 | 3300042876 | Bacteria | 997 |
| 508 | Ga0451577_0609500 | 3300042876 | Bacteria | 991 |
| 509 | Ga0451577_0756892 | 3300042876 | Bacteria | 878 |
| 510 | Ga0451577_0841821 | 3300042876 | Bacteria | 828 |
| 511 | Ga0451577_1264012 | 3300042876 | Bacteria | 657 |
| 512 | Ga0451577_1465795 | 3300042876 | Bacteria | 604 |
| 513 | Ga0451577_1771656 | 3300042876 | Bacteria | 542 |
| 514 | Ga0451577_1788530 | 3300042876 | Bacteria | 539 |
| 515 | Ga0453683_0002238 | 3300044673 | Bacteria | 15295 |
| 516 | Ga0453683_0009016 | 3300044673 | Bacteria | 6663 |
| 517 | Ga0453683_0029392 | 3300044673 | Bacteria | 3475 |
| 518 | Ga0453683_0054006 | 3300044673 | Bacteria | 2515 |
| 519 | Ga0453683_0054407 | 3300044673 | Bacteria | 2504 |
| 520 | Ga0453683_0080038 | 3300044673 | Bacteria | 2046 |
| 521 | Ga0453683_0097859 | 3300044673 | Bacteria | 1842 |
| 522 | Ga0453683_0117932 | 3300044673 | Bacteria | 1670 |
| 523 | Ga0453683_0156879 | 3300044673 | Bacteria | 1439 |
| 524 | Ga0453683_0177459 | 3300044673 | Bacteria | 1350 |
| 525 | Ga0453683_0269711 | 3300044673 | Bacteria | 1086 |
| 526 | Ga0453683_0320961 | 3300044673 | Bacteria | 992 |
| 527 | Ga0453683_0717326 | 3300044673 | Bacteria | 656 |
| 528 | Ga0453683_0969191 | 3300044673 | Bacteria | 564 |
| 529 | Ga0453684_0000024 | 3300044712 | Bacteria | 819351 |
| 530 | Ga0453684_0000053 | 3300044712 | Bacteria | 545350 |
| 531 | Ga0453684_0000095 | 3300044712 | Bacteria | 378681 |
| 532 | Ga0453684_0001390 | 3300044712 | Bacteria | 70039 |
| 533 | Ga0453684_0004574 | 3300044712 | Bacteria | 28877 |
| 534 | Ga0453684_0007412 | 3300044712 | Bacteria | 20193 |
| 535 | Ga0453684_0009456 | 3300044712 | Bacteria | 17047 |
| 536 | Ga0453684_0015826 | 3300044712 | Bacteria | 11859 |
| 537 | Ga0453684_0016312 | 3300044712 | Bacteria | 11631 |
| 538 | Ga0453684_0024636 | 3300044712 | Bacteria | 8780 |
| 539 | Ga0453684_0040080 | 3300044712 | Bacteria | 6368 |
| 540 | Ga0453684_0040272 | 3300044712 | Bacteria | 6350 |
| 541 | Ga0453684_0042774 | 3300044712 | Bacteria | 6100 |
| 542 | Ga0453684_0056281 | 3300044712 | Bacteria | 5103 |
| 543 | Ga0453684_0056484 | 3300044712 | Bacteria | 5092 |
| 544 | Ga0453684_0061849 | 3300044712 | Bacteria | 4803 |
| 545 | Ga0453684_0067627 | 3300044712 | Bacteria | 4543 |
| 546 | Ga0453684_0093633 | 3300044712 | Bacteria | 3700 |
| 547 | Ga0453684_0106015 | 3300044712 | Bacteria | 3426 |
| 548 | Ga0453684_0115884 | 3300044712 | Bacteria | 3246 |
| 549 | Ga0453684_0135193 | 3300044712 | Bacteria | 2953 |
| 550 | Ga0453684_0136380 | 3300044712 | Bacteria | 2937 |
| 551 | Ga0453684_0142003 | 3300044712 | Bacteria | 2866 |
| 552 | Ga0453684_0143867 | 3300044712 | Bacteria | 2843 |
| 553 | Ga0453684_0163981 | 3300044712 | Bacteria | 2625 |
| 554 | Ga0453684_0168281 | 3300044712 | Bacteria | 2585 |
| 555 | Ga0453684_0168954 | 3300044712 | Bacteria | 2579 |
| 556 | Ga0453684_0186040 | 3300044712 | Bacteria | 2434 |
| 557 | Ga0453684_0206616 | 3300044712 | Bacteria | 2285 |
| 558 | Ga0453684_0208059 | 3300044712 | Bacteria | 2276 |
| 559 | Ga0453684_0222013 | 3300044712 | Bacteria | 2188 |
| 560 | Ga0453684_0236903 | 3300044712 | Bacteria | 2104 |
| 561 | Ga0453684_0243717 | 3300044712 | Bacteria | 2068 |
| 562 | Ga0453684_0244698 | 3300044712 | Bacteria | 2063 |
| 563 | Ga0453684_0258597 | 3300044712 | Bacteria | 1995 |
| 564 | Ga0453684_0259192 | 3300044712 | Bacteria | 1993 |
| 565 | Ga0453684_0265491 | 3300044712 | Unclassified | 1964 |
| 566 | Ga0453684_0277435 | 3300044712 | Bacteria | 1913 |
| 567 | Ga0453684_0286127 | 3300044712 | Bacteria | 1878 |
| 568 | Ga0453684_0334890 | 3300044712 | Bacteria | 1710 |
| 569 | Ga0453684_0348656 | 3300044712 | Bacteria | 1670 |
| 570 | Ga0453684_0368765 | 3300044712 | Bacteria | 1615 |
| 571 | Ga0453684_0370521 | 3300044712 | Bacteria | 1610 |
| 572 | Ga0453684_0386516 | 3300044712 | Bacteria | 1570 |
| 573 | Ga0453684_0400397 | 3300044712 | Bacteria | 1537 |
| 574 | Ga0453684_0405751 | 3300044712 | Bacteria | 1525 |
| 575 | Ga0453684_0468984 | 3300044712 | Bacteria | 1398 |
| 576 | Ga0453684_0470285 | 3300044712 | Bacteria | 1396 |
| 577 | Ga0453684_0550092 | 3300044712 | Unclassified | 1271 |
| 578 | Ga0453684_0673974 | 3300044712 | Bacteria | 1126 |
| 579 | Ga0453684_0725474 | 3300044712 | Bacteria | 1078 |
| 580 | Ga0453684_0828962 | 3300044712 | Unclassified | 995 |
| 581 | Ga0453684_0896859 | 3300044712 | Bacteria | 950 |
| 582 | Ga0453684_1007802 | 3300044712 | Bacteria | 885 |
| 583 | Ga0453684_1100885 | 3300044712 | Unclassified | 839 |
| 584 | Ga0453684_1103443 | 3300044712 | Unclassified | 838 |
| 585 | Ga0453684_1134295 | 3300044712 | Bacteria | 824 |
| 586 | Ga0453684_1166842 | 3300044712 | Bacteria | 810 |
| 587 | Ga0453684_1259523 | 3300044712 | Bacteria | 773 |
| 588 | Ga0453684_1431369 | 3300044712 | Bacteria | 715 |
| 589 | Ga0453684_2265119 | 3300044712 | Unclassified | 541 |
| 590 | Ga0451576_0011013 | 3300045051 | Bacteria | 10326 |
| 591 | Ga0451576_0011617 | 3300045051 | Bacteria | 9977 |
| 592 | Ga0451576_0013575 | 3300045051 | Bacteria | 9108 |
| 593 | Ga0451576_0021913 | 3300045051 | Bacteria | 6936 |
| 594 | Ga0451576_0043649 | 3300045051 | Bacteria | 4730 |
| 595 | Ga0451576_0063214 | 3300045051 | Bacteria | 3858 |
| 596 | Ga0451576_0072849 | 3300045051 | Bacteria | 3574 |
| 597 | Ga0451576_0079806 | 3300045051 | Bacteria | 3405 |
| 598 | Ga0451576_0092060 | 3300045051 | Bacteria | 3154 |
| 599 | Ga0451576_0101166 | 3300045051 | Bacteria | 2997 |
| 600 | Ga0451576_0105136 | 3300045051 | Bacteria | 2937 |
| 601 | Ga0451576_0310380 | 3300045051 | Bacteria | 1650 |
| 602 | Ga0451576_0963338 | 3300045051 | Bacteria | 894 |
| 603 | Ga0451576_1006448 | 3300045051 | Bacteria | 873 |
| 604 | Ga0451576_1087639 | 3300045051 | Bacteria | 837 |
| 605 | Ga0451576_1092440 | 3300045051 | Bacteria | 835 |
| 606 | Ga0451576_1363348 | 3300045051 | Bacteria | 738 |
| 607 | Ga0466958_0416663 | 3300045836 | Bacteria | 868 |
| 608 | Ga0466967_0224153 | 3300045976 | Bacteria | 1788 |
| 609 | Ga0495590_0051707 | 3300046457 | Bacteria | 1435 |
| 610 | Ga0495629_0312010 | 3300046459 | Bacteria | 1076 |
| 611 | Ga0495642_0313804 | 3300046528 | Bacteria | 687 |
| 612 | Ga0495640_0912413 | 3300046533 | Bacteria | 520 |
| 613 | Ga0495622_0173732 | 3300046557 | Bacteria | 968 |
| 614 | Ga0495656_0075412 | 3300046615 | Bacteria | 1509 |
| 615 | Ga0495668_0542568 | 3300046616 | Bacteria | 642 |
| 616 | Ga0495635_0099575 | 3300046663 | Bacteria | 1987 |
| 617 | Ga0495658_0491456 | 3300046683 | Bacteria | 785 |
| 618 | Ga0495675_0182819 | 3300047444 | Bacteria | 1283 |
| 619 | Ga0495684_0245864 | 3300047471 | Bacteria | 1303 |
| 620 | Ga0496106_0650809 | 3300048909 | Bacteria | 842 |
| 621 | Ga0496116_0000092 | 3300048919 | Bacteria | 206620 |
| 622 | Ga0496117_0010168 | 3300048920 | Bacteria | 8633 |
| 623 | Ga0496118_0023887 | 3300048921 | Bacteria | 5294 |
| 624 | Ga0496124_0110978 | 3300048927 | Bacteria | 2207 |
| 625 | Ga0501298_012192 | 3300049521 | Bacteria | 1504 |
| 626 | Ga0501031_0006137 | 3300049568 | Bacteria | 7843 |
| 627 | Ga0501031_0017790 | 3300049568 | Bacteria | 4622 |
| 628 | Ga0501031_0039136 | 3300049568 | Bacteria | 3094 |
| 629 | Ga0501032_0071743 | 3300049569 | Bacteria | 2308 |
| 630 | Ga0501033_0016696 | 3300049570 | Bacteria | 5553 |
| 631 | Ga0501033_0812166 | 3300049570 | Bacteria | 632 |
| 632 | Ga0501034_0240422 | 3300049571 | Bacteria | 1757 |
| 633 | Ga0501034_0738917 | 3300049571 | Bacteria | 880 |
| 634 | Ga0501036_0029257 | 3300049572 | Bacteria | 4656 |
| 635 | Ga0501036_0060101 | 3300049572 | Bacteria | 3219 |
| 636 | Ga0501036_0307862 | 3300049572 | Bacteria | 1325 |
| 637 | Ga0501036_0986953 | 3300049572 | Bacteria | 690 |
| 638 | Ga0501036_1291202 | 3300049572 | Bacteria | 593 |
| 639 | Ga0501038_0000140 | 3300049574 | Bacteria | 61841 |
| 640 | Ga0501038_0102379 | 3300049574 | Bacteria | 2383 |
| 641 | Ga0501038_0302085 | 3300049574 | Bacteria | 1256 |
| 642 | Ga0501038_0598282 | 3300049574 | Bacteria | 835 |
| 643 | Ga0501038_0733590 | 3300049574 | Bacteria | 738 |
| 644 | Ga0501039_0027193 | 3300049575 | Bacteria | 4398 |
| 645 | Ga0501039_0104589 | 3300049575 | Bacteria | 2210 |
| 646 | Ga0501039_0328474 | 3300049575 | Bacteria | 1202 |
| 647 | Ga0501039_0354780 | 3300049575 | Bacteria | 1152 |
| 648 | Ga0501039_0492356 | 3300049575 | Bacteria | 963 |
| 649 | Ga0501039_0826327 | 3300049575 | Bacteria | 722 |
| 650 | Ga0501040_0007490 | 3300049576 | Bacteria | 7064 |
| 651 | Ga0501040_0057264 | 3300049576 | Bacteria | 2675 |
| 652 | Ga0501040_0094358 | 3300049576 | Bacteria | 2082 |
| 653 | Ga0501041_0060371 | 3300049577 | Bacteria | 2321 |
| 654 | Ga0501041_0429487 | 3300049577 | Bacteria | 838 |
| 655 | Ga0501041_0551320 | 3300049577 | Bacteria | 735 |
| 656 | Ga0501042_0000966 | 3300049578 | Bacteria | 16238 |
| 657 | Ga0501042_0050428 | 3300049578 | Bacteria | 2968 |
| 658 | Ga0501042_0080226 | 3300049578 | Unclassified | 2338 |
| 659 | Ga0501042_0270114 | 3300049578 | Bacteria | 1228 |
| 660 | Ga0501042_0542896 | 3300049578 | Bacteria | 845 |
| 661 | Ga0501042_1392025 | 3300049578 | Bacteria | 512 |
| 662 | Ga0501043_0129609 | 3300049579 | Bacteria | 1977 |
| 663 | Ga0501043_0173935 | 3300049579 | Bacteria | 1679 |
| 664 | Ga0501043_0478221 | 3300049579 | Bacteria | 933 |
| 665 | Ga0501046_0020824 | 3300049580 | Bacteria | 5416 |
| 666 | Ga0501046_0102038 | 3300049580 | Bacteria | 2199 |
| 667 | Ga0501046_0220323 | 3300049580 | Bacteria | 1405 |
| 668 | Ga0501046_0810389 | 3300049580 | Bacteria | 656 |
| 669 | Ga0501046_0941317 | 3300049580 | Bacteria | 601 |
| 670 | Ga0501046_0957906 | 3300049580 | Bacteria | 595 |
| 671 | Ga0501046_1109699 | 3300049580 | Bacteria | 546 |
| 672 | Ga0501048_0003982 | 3300049582 | Bacteria | 11217 |
| 673 | Ga0501048_0134002 | 3300049582 | Bacteria | 1750 |
| 674 | Ga0501048_0218848 | 3300049582 | Bacteria | 1351 |
| 675 | Ga0501048_0220195 | 3300049582 | Bacteria | 1346 |
| 676 | Ga0501048_0445721 | 3300049582 | Bacteria | 927 |
| 677 | Ga0501067_0252617 | 3300049583 | Bacteria | 981 |
| 678 | Ga0501068_0059339 | 3300049584 | Bacteria | 2323 |
| 679 | Ga0501068_0226780 | 3300049584 | Bacteria | 1188 |
| 680 | Ga0501068_0638226 | 3300049584 | Bacteria | 695 |
| 681 | Ga0501069_0219682 | 3300049585 | Bacteria | 1104 |
| 682 | Ga0501069_0225820 | 3300049585 | Bacteria | 1089 |
| 683 | Ga0501069_0273407 | 3300049585 | Bacteria | 988 |
| 684 | Ga0501070_0248543 | 3300049586 | Bacteria | 1455 |
| 685 | Ga0501070_0564142 | 3300049586 | Bacteria | 910 |
| 686 | Ga0501070_0905336 | 3300049586 | Bacteria | 688 |
| 687 | Ga0501071_0002399 | 3300049587 | Bacteria | 11360 |
| 688 | Ga0501071_0033419 | 3300049587 | Bacteria | 3654 |
| 689 | Ga0501071_0091805 | 3300049587 | Bacteria | 2231 |
| 690 | Ga0501071_0140343 | 3300049587 | Bacteria | 1799 |
| 691 | Ga0501071_0162909 | 3300049587 | Bacteria | 1667 |
| 692 | Ga0501071_0517056 | 3300049587 | Bacteria | 916 |
| 693 | Ga0501071_0830502 | 3300049587 | Bacteria | 713 |
| 694 | Ga0501071_1162193 | 3300049587 | Bacteria | 596 |
| 695 | Ga0501072_0049264 | 3300049588 | Bacteria | 3316 |
| 696 | Ga0501072_0051154 | 3300049588 | Bacteria | 3253 |
| 697 | Ga0501072_0099059 | 3300049588 | Bacteria | 2317 |
| 698 | Ga0501072_0518337 | 3300049588 | Bacteria | 942 |
| 699 | Ga0501072_0693601 | 3300049588 | Bacteria | 800 |
| 700 | Ga0501072_0743960 | 3300049588 | Bacteria | 769 |
| 701 | Ga0501072_0759455 | 3300049588 | Bacteria | 760 |
| 702 | Ga0501072_0773310 | 3300049588 | Bacteria | 753 |
| 703 | Ga0501073_0036681 | 3300049589 | Bacteria | 3482 |
| 704 | Ga0501073_0076612 | 3300049589 | Bacteria | 2327 |
| 705 | Ga0501073_0086289 | 3300049589 | Bacteria | 2183 |
| 706 | Ga0501073_0251473 | 3300049589 | Bacteria | 1220 |
| 707 | Ga0501073_0348421 | 3300049589 | Bacteria | 1022 |
| 708 | Ga0501073_0431355 | 3300049589 | Bacteria | 911 |
| 709 | Ga0501073_0671992 | 3300049589 | Bacteria | 715 |
| 710 | Ga0501074_0016422 | 3300049590 | Bacteria | 5376 |
| 711 | Ga0501074_0079308 | 3300049590 | Bacteria | 2356 |
| 712 | Ga0501074_0268305 | 3300049590 | Bacteria | 1213 |
| 713 | Ga0501074_0297213 | 3300049590 | Bacteria | 1147 |
| 714 | Ga0501074_0338384 | 3300049590 | Bacteria | 1068 |
| 715 | Ga0501074_0448980 | 3300049590 | Bacteria | 914 |
| 716 | Ga0501074_0696404 | 3300049590 | Bacteria | 717 |
| 717 | Ga0501075_0002441 | 3300049591 | Bacteria | 12380 |
| 718 | Ga0501075_0035988 | 3300049591 | Bacteria | 3693 |
| 719 | Ga0501075_0038454 | 3300049591 | Bacteria | 3577 |
| 720 | Ga0501075_0080504 | 3300049591 | Bacteria | 2465 |
| 721 | Ga0501075_0092774 | 3300049591 | Bacteria | 2292 |
| 722 | Ga0501075_0122775 | 3300049591 | Bacteria | 1977 |
| 723 | Ga0501075_0365290 | 3300049591 | Bacteria | 1100 |
| 724 | Ga0501075_1297839 | 3300049591 | Unclassified | 552 |
| 725 | Ga0501076_0005164 | 3300049592 | Bacteria | 9349 |
| 726 | Ga0501076_0008455 | 3300049592 | Bacteria | 7546 |
| 727 | Ga0501076_0013865 | 3300049592 | Bacteria | 6052 |
| 728 | Ga0501076_0139293 | 3300049592 | Bacteria | 1970 |
| 729 | Ga0501076_0143588 | 3300049592 | Bacteria | 1940 |
| 730 | Ga0501076_0147379 | 3300049592 | Bacteria | 1914 |
| 731 | Ga0501076_0308304 | 3300049592 | Bacteria | 1298 |
| 732 | Ga0501076_0386281 | 3300049592 | Unclassified | 1151 |
| 733 | Ga0501076_0587765 | 3300049592 | Bacteria | 918 |
| 734 | Ga0501076_0647614 | 3300049592 | Bacteria | 872 |
| 735 | Ga0501076_1178914 | 3300049592 | Bacteria | 630 |
| 736 | Ga0501076_1371489 | 3300049592 | Bacteria | 581 |
| 737 | Ga0501076_1410950 | 3300049592 | Bacteria | 572 |
| 738 | Ga0501077_0068981 | 3300049593 | Bacteria | 2241 |
| 739 | Ga0501077_0084123 | 3300049593 | Bacteria | 2016 |
| 740 | Ga0501077_0104769 | 3300049593 | Bacteria | 1792 |
| 741 | Ga0501077_0202462 | 3300049593 | Bacteria | 1261 |
| 742 | Ga0501077_0400460 | 3300049593 | Bacteria | 877 |
| 743 | Ga0501077_0403642 | 3300049593 | Bacteria | 874 |
| 744 | Ga0501209_179047 | 3300049656 | Bacteria | 647 |
| 745 | Ga0501079_0002098 | 3300049741 | Bacteria | 14307 |
| 746 | Ga0501079_0005630 | 3300049741 | Bacteria | 9351 |
| 747 | Ga0501079_0023971 | 3300049741 | Bacteria | 4681 |
| 748 | Ga0501079_0072572 | 3300049741 | Bacteria | 2660 |
| 749 | Ga0501079_0300999 | 3300049741 | Bacteria | 1255 |
| 750 | Ga0501079_0340091 | 3300049741 | Bacteria | 1176 |
| 751 | Ga0501079_1261081 | 3300049741 | Bacteria | 582 |
| 752 | Ga0501080_0030270 | 3300049742 | Bacteria | 5043 |
| 753 | Ga0501080_0040197 | 3300049742 | Bacteria | 4363 |
| 754 | Ga0501080_0095099 | 3300049742 | Bacteria | 2767 |
| 755 | Ga0501080_0102268 | 3300049742 | Bacteria | 2658 |
| 756 | Ga0501080_0239101 | 3300049742 | Bacteria | 1658 |
| 757 | Ga0501080_0858215 | 3300049742 | Bacteria | 793 |
| 758 | Ga0501080_1252096 | 3300049742 | Bacteria | 636 |
| 759 | Ga0501081_0002409 | 3300049743 | Bacteria | 11788 |
| 760 | Ga0501081_0005918 | 3300049743 | Bacteria | 7913 |
| 761 | Ga0501081_0109731 | 3300049743 | Bacteria | 1957 |
| 762 | Ga0501081_0124088 | 3300049743 | Bacteria | 1841 |
| 763 | Ga0501081_0376322 | 3300049743 | Bacteria | 1049 |
| 764 | Ga0501081_0398367 | 3300049743 | Bacteria | 1019 |
| 765 | Ga0501081_0506892 | 3300049743 | Bacteria | 900 |
| 766 | Ga0501081_0767914 | 3300049743 | Bacteria | 725 |
| 767 | Ga0501083_0356909 | 3300049744 | Bacteria | 950 |
| 768 | Ga0501083_0563725 | 3300049744 | Bacteria | 741 |
| 769 | Ga0501083_0972331 | 3300049744 | Bacteria | 552 |
| 770 | Ga0501035_0076232 | 3300049822 | Bacteria | 2965 |
| 771 | Ga0501035_0302366 | 3300049822 | Bacteria | 1348 |
| 772 | Ga0501035_0525495 | 3300049822 | Bacteria | 972 |
| 773 | Ga0501044_0417707 | 3300049823 | Bacteria | 1252 |
| 774 | Ga0501044_0629000 | 3300049823 | Bacteria | 964 |
| 775 | Ga0501045_0005722 | 3300049824 | Bacteria | 8606 |
| 776 | Ga0501045_0010612 | 3300049824 | Bacteria | 6454 |
| 777 | Ga0501045_0032913 | 3300049824 | Bacteria | 3758 |
| 778 | Ga0501045_0227387 | 3300049824 | Bacteria | 1389 |
| 779 | Ga0501045_0282110 | 3300049824 | Bacteria | 1237 |
| 780 | Ga0501045_0299896 | 3300049824 | Bacteria | 1196 |
| 781 | nmdc:mga03683_109939_c1 | 3300050489 | Bacteria | 1218 |
| 782 | nmdc:mga00v17_1044914_c1 | 3300050491 | Bacteria | 513 |
| 783 | nmdc:mga00v17_291758_c1 | 3300050491 | Bacteria | 1059 |
| 784 | nmdc:mga00v17_333465_c1 | 3300050491 | Bacteria | 986 |
| 785 | nmdc:mga00v17_392319_c1 | 3300050491 | Bacteria | 902 |
| 786 | nmdc:mga00v17_691652_c1 | 3300050491 | Bacteria | 654 |
| 787 | nmdc:mga0k408_75406_c1 | 3300050493 | Bacteria | 1632 |
| 788 | nmdc:mga04h51_212827_c1 | 3300050495 | Bacteria | 763 |
| 789 | nmdc:mga04h51_256975_c1 | 3300050495 | Bacteria | 702 |
| 790 | nmdc:mga07m45_39171_c1 | 3300050496 | Bacteria | 2648 |
| 791 | nmdc:mga05p37_177127_c1 | 3300050507 | Bacteria | 2597 |
| 792 | nmdc:mga05p37_18425_c1 | 3300050507 | Bacteria | 8434 |
| 793 | nmdc:mga05p37_22072_c1 | 3300050507 | Bacteria | 7715 |
| 794 | nmdc:mga05p37_35685_c1 | 3300050507 | Bacteria | 6098 |
| 795 | nmdc:mga05p37_387053_c1 | 3300050507 | Bacteria | 1637 |
| 796 | nmdc:mga05p37_50766_c1 | 3300050507 | Bacteria | 5102 |
| 797 | nmdc:mga05p37_785304_c1 | 3300050507 | Bacteria | 1044 |
| 798 | nmdc:mga05p37_87693_c1 | 3300050507 | Bacteria | 3835 |
| 799 | nmdc:mga05p37_97390_c1 | 3300050507 | Bacteria | 3624 |
| 800 | nmdc:mga05p37_98021_c1 | 3300050507 | Bacteria | 3611 |
| 801 | nmdc:mga09592_107846_c1 | 3300050508 | Bacteria | 2389 |
| 802 | nmdc:mga09592_152944_c1 | 3300050508 | Bacteria | 1991 |
| 803 | nmdc:mga09592_160523_c2 | 3300050508 | Bacteria | 1141 |
| 804 | nmdc:mga09592_1856_c1 | 3300050508 | Bacteria | 17016 |
| 805 | nmdc:mga09592_226277_c1 | 3300050508 | Unclassified | 1621 |
| 806 | nmdc:mga09592_45050_c1 | 3300050508 | Bacteria | 3715 |
| 807 | nmdc:mga09592_903730_c1 | 3300050508 | Bacteria | 742 |
| 808 | nmdc:mga0qj67_10673_c1 | 3300050509 | Bacteria | 6865 |
| 809 | nmdc:mga0qj67_171004_c1 | 3300050509 | Bacteria | 1764 |
| 810 | nmdc:mga0qj67_198978_c1 | 3300050509 | Bacteria | 1628 |
| 811 | nmdc:mga0qj67_289596_c1 | 3300050509 | Unclassified | 1327 |
| 812 | nmdc:mga06r32_219869_c1 | 3300050510 | Bacteria | 1888 |
| 813 | nmdc:mga06r32_37109_c1 | 3300050510 | Bacteria | 4610 |
| 814 | nmdc:mga06r32_87496_c1 | 3300050510 | Bacteria | 3040 |
| 815 | nmdc:mga08y16_569055_c1 | 3300050511 | Bacteria | 1145 |
| 816 | nmdc:mga08y16_952220_c1 | 3300050511 | Bacteria | 841 |
| 817 | nmdc:mga0n895_1548846_c1 | 3300050512 | Bacteria | 628 |
| 818 | nmdc:mga0n895_37094_c1 | 3300050512 | Bacteria | 4713 |
| 819 | nmdc:mga0n895_459380_c1 | 3300050512 | Bacteria | 1285 |
| 820 | nmdc:mga0n895_616367_c1 | 3300050512 | Unclassified | 1086 |
| 821 | nmdc:mga0rr50_19091_c1 | 3300050513 | Bacteria | 4619 |
| 822 | nmdc:mga0rr50_285193_c1 | 3300050513 | Bacteria | 1379 |
| 823 | nmdc:mga08x19_197965_c1 | 3300050514 | Bacteria | 1376 |
| 824 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 825 | nmdc:mga08x19_549823_c1 | 3300050514 | Bacteria | 817 |
| 826 | nmdc:mga0a205_330564_c1 | 3300050515 | Unclassified | 1394 |
| 827 | nmdc:mga0a205_370702_c1 | 3300050515 | Bacteria | 1298 |
| 828 | nmdc:mga0a205_56751_c1 | 3300050515 | Bacteria | 3781 |
| 829 | nmdc:mga0a205_83999_c1 | 3300050515 | Bacteria | 620 |
| 830 | nmdc:mga0sz30_28570_c1 | 3300050516 | Bacteria | 2296 |
| 831 | Ga0495601_0138168 | 3300053077 | Bacteria | 1589 |
| 832 | Ga0495619_0234416 | 3300053085 | Bacteria | 1272 |
| 833 | Ga0500562_161722 | 3300053108 | Bacteria | 609 |
| 834 | Ga0500627_0028900 | 3300053158 | Bacteria | 2307 |
| 835 | Ga0501084_0000338 | 3300054114 | Bacteria | 35721 |
| 836 | Ga0501084_0013743 | 3300054114 | Bacteria | 6700 |
| 837 | Ga0501084_0021138 | 3300054114 | Bacteria | 5427 |
| 838 | Ga0501084_0058449 | 3300054114 | Bacteria | 3226 |
| 839 | Ga0501084_0139313 | 3300054114 | Bacteria | 2042 |
| 840 | Ga0501084_0323131 | 3300054114 | Bacteria | 1303 |
| 841 | Ga0501084_0588195 | 3300054114 | Bacteria | 940 |
| 842 | Ga0501084_0593448 | 3300054114 | Bacteria | 936 |
| 843 | Ga0501084_0862624 | 3300054114 | Bacteria | 762 |
| 844 | Ga0501084_1843839 | 3300054114 | Bacteria | 505 |
| 845 | Ga0590075_158602 | 3300059424 | Unclassified | 597 |
| 846 | Ga0587084_104359 | 3300059477 | Bacteria | 578 |
| 847 | Ga0587066_110821 | 3300059490 | Bacteria | 636 |
| 848 | Ga0587070_031893 | 3300059491 | Bacteria | 960 |
| 849 | Ga0587080_107446 | 3300059503 | Bacteria | 604 |
| 850 | Ga0587083_0181122 | 3300059505 | Bacteria | 590 |
| 851 | Ga0587086_100215 | 3300059507 | Bacteria | 533 |
| 852 | Ga0587088_085767 | 3300059508 | Bacteria | 681 |
| 853 | Ga0587109_105257 | 3300059624 | Bacteria | 653 |
| 854 | Ga0587078_014165 | 3300059646 | Bacteria | 951 |
| 855 | Ga0587110_028893 | 3300059654 | Bacteria | 667 |
| 856 | Ga0501082_0008258 | 3300060353 | Bacteria | 8978 |
| 857 | Ga0501082_0008983 | 3300060353 | Bacteria | 8626 |
| 858 | Ga0501082_0016387 | 3300060353 | Bacteria | 6380 |
| 859 | Ga0501082_0262155 | 3300060353 | Bacteria | 1503 |
| 860 | Ga0501082_0327236 | 3300060353 | Bacteria | 1335 |
| 861 | Ga0501082_0431359 | 3300060353 | Bacteria | 1151 |
| 862 | Ga0501082_0438188 | 3300060353 | Bacteria | 1141 |
| 863 | Ga0501082_0810293 | 3300060353 | Bacteria | 819 |
| 864 | Ga0501082_1439441 | 3300060353 | Bacteria | 602 |
| 865 | Ga0530510_0029550 | 3300061734 | Bacteria | 3934 |
| 866 | Ga0530510_0052557 | 3300061734 | Bacteria | 2944 |
| 867 | Ga0530510_0138506 | 3300061734 | Bacteria | 1792 |
| 868 | Ga0530510_0260937 | 3300061734 | Bacteria | 1292 |
| 869 | Ga0530510_0329864 | 3300061734 | Bacteria | 1145 |
| 870 | Ga0530510_0388927 | 3300061734 | Bacteria | 1050 |
| 871 | Ga0530510_0861663 | 3300061734 | Bacteria | 692 |
| 872 | Ga0530510_0898528 | 3300061734 | Bacteria | 677 |
| 873 | Ga0530510_1166486 | 3300061734 | Bacteria | 590 |
| 874 | 2643755759 | 2643221547 | Bacteria | 4740017 |
| 875 | 2772436823 | 2772190666 | Bacteria | 5117644 |
| 876 | 2888366874 | 2888366609 | Bacteria | 5155009 |
| 877 | 2908674615 | 2908669403 | Bacteria | 5740494 |
| 878 | 2937969512 | 2937967321 | Bacteria | 5094075 |
| 879 | 8004595852 | 8004592986 | Bacteria | 5122074 |
| 880 | 8015398591 | 8015394850 | Bacteria | 5064660 |
| 881 | 8054846333 | 8054844752 | Bacteria | 4450330 |
| 882 | 8054852268 | 8054849141 | Bacteria | 5232694 |
| 883 | Ga0114129_10062088 | |||
| 884 | JGI24034J26672_10111802 | |||
| 885 | JGI24751J29686_10027219 | |||
| 886 | Ga0058858_1403602 | |||
| 887 | Ga0065712_10477473 | |||
| 888 | Ga0065707_10000587 | |||
| 889 | Ga0065707_10006372 | |||
| 890 | Ga0065707_10050454 | |||
| 891 | Ga0065707_10092154 | |||
| 892 | Ga0065707_10115339 | |||
| 893 | Ga0065707_10170592 | |||
| 894 | Ga0065707_10340054 | |||
| 895 | Ga0065707_10424300 | |||
| 896 | Ga0065707_10555710 | |||
| 897 | Ga0070658_10046451 | |||
| 898 | Ga0070670_100005811 | |||
| 899 | Ga0070666_10001479 | |||
| 900 | Ga0070680_100195578 | |||
| 901 | Ga0070680_101050704 | |||
| 902 | Ga0070689_100260311 | |||
| 903 | Ga0070687_100054259 | |||
| 904 | Ga0070692_10421072 | |||
| 905 | Ga0070668_100003599 | |||
| 906 | Ga0070669_100000113 | |||
| 907 | Ga0070671_100000038 | |||
| 908 | Ga0070674_100196525 | |||
| 909 | Ga0070667_101393565 | |||
| 910 | Ga0070709_11289928 | |||
| 911 | Ga0070713_100208085 | |||
| 912 | Ga0070713_100556082 | |||
| 913 | Ga0070705_100009106 | |||
| 914 | Ga0070705_100068415 | |||
| 915 | Ga0070705_100240918 | |||
| 916 | Ga0070705_100256481 | |||
| 917 | Ga0070705_100324597 | |||
| 918 | Ga0070700_100752885 | |||
| 919 | Ga0070694_100055848 | |||
| 920 | Ga0070694_100070258 | |||
| 921 | Ga0070694_100145184 | |||
| 922 | Ga0070708_100099333 | |||
| 923 | Ga0070708_100178155 | |||
| 924 | Ga0070708_100319026 | |||
| 925 | Ga0070706_100001045 | |||
| 926 | Ga0070706_100026404 | |||
| 927 | Ga0070706_100122224 | |||
| 928 | Ga0070706_100414079 | |||
| 929 | Ga0070706_100622995 | |||
| 930 | Ga0070706_100786578 | |||
| 931 | Ga0070707_100049061 | |||
| 932 | Ga0070707_100122242 | |||
| 933 | Ga0070707_100262622 | |||
| 934 | Ga0070707_100419285 | |||
| 935 | Ga0070698_100006184 | |||
| 936 | Ga0070698_100008324 | |||
| 937 | Ga0070698_100044974 | |||
| 938 | Ga0070698_100137731 | |||
| 939 | Ga0070698_100165246 | |||
| 940 | Ga0070698_100301028 | |||
| 941 | Ga0070698_101142738 | |||
| 942 | Ga0070699_100000572 | |||
| 943 | Ga0070699_100003541 | |||
| 944 | Ga0070699_100035302 | |||
| 945 | Ga0070699_100120697 | |||
| 946 | Ga0070699_100127764 | |||
| 947 | Ga0070699_101089545 | |||
| 948 | Ga0070699_101823367 | |||
| 949 | Ga0070679_100563618 | |||
| 950 | Ga0070684_101497415 | |||
| 951 | Ga0070697_100016412 | |||
| 952 | Ga0070697_100025069 | |||
| 953 | Ga0070697_100335985 | |||
| 954 | Ga0070697_100394786 | |||
| 955 | Ga0070686_100298953 | |||
| 956 | Ga0070695_100007042 | |||
| 957 | Ga0070695_100017089 | |||
| 958 | Ga0070695_100065547 | |||
| 959 | Ga0070695_100114297 | |||
| 960 | Ga0070695_100154749 | |||
| 961 | Ga0070695_100854077 | |||
| 962 | Ga0070696_100041162 | |||
| 963 | Ga0070696_100278885 | |||
| 964 | Ga0070665_100018152 | |||
| 965 | Ga0070704_100168145 | |||
| 966 | Ga0070704_100428141 | |||
| 967 | Ga0070704_100625199 | |||
| 968 | Ga0068857_100199871 | |||
| 969 | Ga0068857_100403110 | |||
| 970 | Ga0068854_101501230 | |||
| 971 | Ga0068854_101525047 | |||
| 972 | Ga0068856_100147198 | |||
| 973 | Ga0068859_100000085 | |||
| 974 | Ga0068859_100300106 | |||
| 975 | Ga0068864_100000774 | |||
| 976 | Ga0068864_100046272 | |||
| 977 | Ga0068866_10815849 | |||
| 978 | Ga0068861_100003294 | |||
| 979 | Ga0068861_100036368 | |||
| 980 | Ga0068861_100103177 | |||
| 981 | Ga0068861_100511266 | |||
| 982 | Ga0068861_101170129 | |||
| 983 | Ga0068870_10632578 | |||
| 984 | Ga0068863_100043591 | |||
| 985 | Ga0068858_100001589 | |||
| 986 | Ga0068860_100017147 | |||
| 987 | Ga0068860_100076778 | |||
| 988 | Ga0068860_100301438 | |||
| 989 | Ga0068862_100001040 | |||
| 990 | Ga0068862_100004463 | |||
| 991 | Ga0068862_100030047 | |||
| 992 | Ga0068862_100067977 | |||
| 993 | Ga0068862_100127802 | |||
| 994 | Ga0068862_100575944 | |||
| 995 | Ga0081455_10164677 | |||
| 996 | Ga0081455_10623787 | |||
| 997 | Ga0081539_10001957 | |||
| 998 | Ga0081539_10184672 | |||
| 999 | Ga0070717_10000098 | |||
| 1000 | Ga0070717_10094351 | |||
| 1001 | Ga0075368_10077154 | |||
| 1002 | Ga0075368_10179707 | |||
| 1003 | Ga0075368_10491003 | |||
| 1004 | Ga0075363_100069917 | |||
| 1005 | Ga0075364_10043992 | |||
| 1006 | Ga0075364_10411738 | |||
| 1007 | Ga0075364_10416663 | |||
| 1008 | Ga0070716_100179443 | |||
| 1009 | Ga0070712_100441704 | |||
| 1010 | Ga0075362_10182741 | |||
| 1011 | Ga0075367_10172354 | |||
| 1012 | Ga0075367_10520862 | |||
| 1013 | Ga0075427_10004500 | |||
| 1014 | Ga0075427_10007147 | |||
| 1015 | Ga0075366_10019611 | |||
| 1016 | Ga0075370_10061129 | |||
| 1017 | Ga0075428_100004514 | |||
| 1018 | Ga0075428_100079686 | |||
| 1019 | Ga0075428_100165332 | |||
| 1020 | Ga0075428_100590207 | |||
| 1021 | Ga0075428_101573631 | |||
| 1022 | Ga0075428_101753941 | |||
| 1023 | Ga0075428_102195189 | |||
| 1024 | Ga0075428_102398873 | |||
| 1025 | Ga0075430_100043161 | |||
| 1026 | Ga0075430_100552790 | |||
| 1027 | Ga0075430_100564293 | |||
| 1028 | Ga0075431_100026658 | |||
| 1029 | Ga0075431_100057206 | |||
| 1030 | Ga0075431_100085999 | |||
| 1031 | Ga0075431_101298981 | |||
| 1032 | Ga0075431_102149406 | |||
| 1033 | Ga0075433_10155467 | |||
| 1034 | Ga0075433_10178415 | |||
| 1035 | Ga0075433_10904819 | |||
| 1036 | Ga0075434_100038530 | |||
| 1037 | Ga0075434_100117206 | |||
| 1038 | Ga0075434_100126032 | |||
| 1039 | Ga0075434_100463129 | |||
| 1040 | Ga0075434_100537395 | |||
| 1041 | Ga0075434_100613686 | |||
| 1042 | Ga0075429_100014633 | |||
| 1043 | Ga0075429_100109304 | |||
| 1044 | Ga0075429_100123503 | |||
| 1045 | Ga0075429_100133661 | |||
| 1046 | Ga0075429_100372912 | |||
| 1047 | Ga0075436_100001542 | |||
| 1048 | Ga0075436_100467350 | |||
| 1049 | Ga0097620_100000085 | |||
| 1050 | Ga0097620_100300081 | |||
| 1051 | Ga0075435_100140740 | |||
| 1052 | Ga0075435_100149234 | |||
| 1053 | Ga0099794_10458384 | |||
| 1054 | Ga0099795_10003373 | |||
| 1055 | Ga0105251_10493214 | |||
| 1056 | Ga0111539_10063480 | |||
| 1057 | Ga0111539_10558960 | |||
| 1058 | Ga0105247_10000438 | |||
| 1059 | Ga0105247_10307914 | |||
| 1060 | Ga0114129_10004898 | |||
| 1061 | Ga0114129_10049809 | |||
| 1062 | Ga0114129_10141497 | |||
| 1063 | Ga0114129_10147114 | |||
| 1064 | Ga0114129_10160327 | |||
| 1065 | Ga0114129_10205246 | |||
| 1066 | Ga0114129_10229744 | |||
| 1067 | Ga0114129_10494042 | |||
| 1068 | Ga0105243_10030780 | |||
| 1069 | Ga0105243_10511886 | |||
| 1070 | Ga0105243_10519416 | |||
| 1071 | Ga0105241_10338741 | |||
| 1072 | Ga0105242_10657443 | |||
| 1073 | Ga0105242_11025471 | |||
| 1074 | Ga0105248_10163052 | |||
| 1075 | Ga0105237_10534107 | |||
| 1076 | Ga0105249_10001806 | |||
| 1077 | Ga0105249_10060852 | |||
| 1078 | Ga0105249_10112038 | |||
| 1079 | Ga0105249_10504573 | |||
| 1080 | Ga0105249_10556248 | |||
| 1081 | Ga0105249_10578433 | |||
| 1082 | Ga0105028_100757 | |||
| 1083 | Ga0105246_10023821 | |||
| 1084 | Ga0105246_10900262 | |||
| 1085 | Ga0105246_11057456 | |||
| 1086 | Ga0157370_10672307 | |||
| 1087 | Ga0157374_10286084 | |||
| 1088 | Ga0163162_10269519 | |||
| 1089 | Ga0163162_10595939 | |||
| 1090 | Ga0163163_10247489 | |||
| 1091 | Ga0157380_10174682 | |||
| 1092 | Ga0157380_10537631 | |||
| 1093 | Ga0157380_10820954 | |||
| 1094 | Ga0182008_10094039 | |||
| 1095 | Ga0157377_10519744 | |||
| 1096 | Ga0157377_10713072 | |||
| 1097 | Ga0157379_10073319 | |||
| 1098 | Ga0157379_10124606 | |||
| 1099 | Ga0157379_11734173 | |||
| 1100 | Ga0163161_10036820 | |||
| 1101 | Ga0163161_10755954 | |||
| 1102 | Ga0197907_10360951 | |||
| 1103 | Ga0206356_10082133 | |||
| 1104 | Ga0206349_1462337 | |||
| 1105 | Ga0206355_1196808 | |||
| 1106 | Ga0206350_10302126 | |||
| 1107 | Ga0206354_10569944 | |||
| 1108 | Ga0206353_10491213 | |||
| 1109 | Ga0206353_10537727 | |||
| 1110 | Ga0213875_10002415 | |||
| 1111 | Ga0213875_10003082 | |||
| 1112 | Ga0213875_10294443 | |||
| 1113 | Ga0224712_10072693 | |||
| 1114 | Ga0224712_10206572 | |||
| 1115 | Ga0224712_10381521 | |||
| 1116 | Ga0209233_1019045 | |||
| 1117 | Ga0207697_10000381 | |||
| 1118 | Ga0207653_10078893 | |||
| 1119 | Ga0207653_10124470 | |||
| 1120 | Ga0207710_10136610 | |||
| 1121 | Ga0207680_10000082 | |||
| 1122 | Ga0207643_10114717 | |||
| 1123 | Ga0207643_10352094 | |||
| 1124 | Ga0207684_10001113 | |||
| 1125 | Ga0207684_10211116 | |||
| 1126 | Ga0207684_10392937 | |||
| 1127 | Ga0207684_10472176 | |||
| 1128 | Ga0207684_10831299 | |||
| 1129 | Ga0207660_11380080 | |||
| 1130 | Ga0207662_10851305 | |||
| 1131 | Ga0207646_10001188 | |||
| 1132 | Ga0207646_10045525 | |||
| 1133 | Ga0207646_10048225 | |||
| 1134 | Ga0207646_10323037 | |||
| 1135 | Ga0207646_10330675 | |||
| 1136 | Ga0207646_10523517 | |||
| 1137 | Ga0207646_10623900 | |||
| 1138 | Ga0207646_10804106 | |||
| 1139 | Ga0207681_10000042 | |||
| 1140 | Ga0207650_10004482 | |||
| 1141 | Ga0207644_10000071 | |||
| 1142 | Ga0207686_10262900 | |||
| 1143 | Ga0207709_10337753 | |||
| 1144 | Ga0207709_11017229 | |||
| 1145 | Ga0207665_10160995 | |||
| 1146 | Ga0207665_10213043 | |||
| 1147 | Ga0207711_10136600 | |||
| 1148 | Ga0207661_11253850 | |||
| 1149 | Ga0207712_10008761 | |||
| 1150 | Ga0207668_10047534 | |||
| 1151 | Ga0207668_10131170 | |||
| 1152 | Ga0207640_11474713 | |||
| 1153 | Ga0207658_10001962 | |||
| 1154 | Ga0207703_10010626 | |||
| 1155 | Ga0207708_10297926 | |||
| 1156 | Ga0207708_10802055 | |||
| 1157 | Ga0207708_11080675 | |||
| 1158 | Ga0207641_10055708 | |||
| 1159 | Ga0207676_10194571 | |||
| 1160 | Ga0207674_10073966 | |||
| 1161 | Ga0207674_10330925 | |||
| 1162 | Ga0207675_100001141 | |||
| 1163 | Ga0207675_100065675 | |||
| 1164 | Ga0207675_100281090 | |||
| 1165 | Ga0209999_1059243 | |||
| 1166 | Ga0209983_1025499 | |||
| 1167 | Ga0209588_1004644 | |||
| 1168 | Ga0209966_1000148 | |||
| 1169 | Ga0209998_10019930 | |||
| 1170 | Ga0209813_10120840 | |||
| 1171 | Ga0209974_10459737 | |||
| 1172 | Ga0268265_10000043 | |||
| 1173 | Ga0268265_10007163 | |||
| 1174 | Ga0268265_10019052 | |||
| 1175 | Ga0268265_10104798 | |||
| 1176 | Ga0268265_10434206 | |||
| 1177 | Ga0268265_10761576 | |||
| 1178 | Ga0268264_10000154 | |||
| 1179 | Ga0268264_10259498 | |||
| 1180 | Ga0265326_10014825 | |||
| 1181 | Ga0265334_10011438 | |||
| 1182 | Ga0265318_10013800 | |||
| 1183 | Ga0265318_10114316 | |||
| 1184 | Ga0265323_10020880 | |||
| 1185 | Ga0265323_10207737 | |||
| 1186 | Ga0307515_10475269 | |||
| 1187 | Ga0265330_10182556 | |||
| 1188 | Ga0265328_10037602 | |||
| 1189 | Ga0265328_10155856 | |||
| 1190 | Ga0265328_10305604 | |||
| 1191 | Ga0265320_10022503 | |||
| 1192 | Ga0265320_10067806 | |||
| 1193 | Ga0265320_10484300 | |||
| 1194 | Ga0265329_10034920 | |||
| 1195 | Ga0265340_10007384 | |||
| 1196 | Ga0265331_10064179 | |||
| 1197 | Ga0265316_10473253 | |||
| 1198 | Ga0265316_10475738 | |||
| 1199 | Ga0265316_10974529 | |||
| 1200 | Ga0307408_100150622 | |||
| 1201 | Ga0307408_102179042 | |||
| 1202 | Ga0316575_10006897 | |||
| 1203 | Ga0316575_10009777 | |||
| 1204 | Ga0316575_10026808 | |||
| 1205 | Ga0316575_10045949 | |||
| 1206 | Ga0316575_10218184 | |||
| 1207 | Ga0316579_10008407 | |||
| 1208 | Ga0316579_10008867 | |||
| 1209 | Ga0316579_10182585 | |||
| 1210 | Ga0316579_10452884 | |||
| 1211 | Ga0316579_10564004 | |||
| 1212 | Ga0265314_10004886 | |||
| 1213 | Ga0265314_10029849 | |||
| 1214 | Ga0265314_10035342 | |||
| 1215 | Ga0265314_10228268 | |||
| 1216 | Ga0316576_10017915 | |||
| 1217 | Ga0316576_10023326 | |||
| 1218 | Ga0316576_10063223 | |||
| 1219 | Ga0316576_10100736 | |||
| 1220 | Ga0316576_10144038 | |||
| 1221 | Ga0316576_10176271 | |||
| 1222 | Ga0316576_10187714 | |||
| 1223 | Ga0316576_10371041 | |||
| 1224 | Ga0316576_10404329 | |||
| 1225 | Ga0316576_10475752 | |||
| 1226 | Ga0316576_10541232 | |||
| 1227 | Ga0316576_10701600 | |||
| 1228 | Ga0316578_10018162 | |||
| 1229 | Ga0316578_10045005 | |||
| 1230 | Ga0316578_10121285 | |||
| 1231 | Ga0316578_10179398 | |||
| 1232 | Ga0316578_10188545 | |||
| 1233 | Ga0316578_10193035 | |||
| 1234 | Ga0316578_10210053 | |||
| 1235 | Ga0316578_10486911 | |||
| 1236 | Ga0307405_10071186 | |||
| 1237 | Ga0316577_10011084 | |||
| 1238 | Ga0316577_10012690 | |||
| 1239 | Ga0316577_10018038 | |||
| 1240 | Ga0316577_10018842 | |||
| 1241 | Ga0316577_10019936 | |||
| 1242 | Ga0316577_10019982 | |||
| 1243 | Ga0316577_10028499 | |||
| 1244 | Ga0316577_10029540 | |||
| 1245 | Ga0316577_10185603 | |||
| 1246 | Ga0316577_10191994 | |||
| 1247 | Ga0316577_10199153 | |||
| 1248 | Ga0316577_10206470 | |||
| 1249 | Ga0316577_10222059 | |||
| 1250 | Ga0316577_10316790 | |||
| 1251 | Ga0316577_10464088 | |||
| 1252 | Ga0316577_10680772 | |||
| 1253 | Ga0307413_10014248 | |||
| 1254 | Ga0307410_10156666 | |||
| 1255 | Ga0307410_10443381 | |||
| 1256 | Ga0307407_10004321 | |||
| 1257 | Ga0307409_100026443 | |||
| 1258 | Ga0307409_100202902 | |||
| 1259 | Ga0307409_100623147 | |||
| 1260 | Ga0307416_100992455 | |||
| 1261 | Ga0307416_101457642 | |||
| 1262 | Ga0307414_10493557 | |||
| 1263 | Ga0307411_10159570 | |||
| 1264 | Ga0307415_100486586 | |||
| 1265 | Ga0307415_100523370 | |||
| 1266 | Ga0307415_102343120 | |||
| 1267 | Ga0316585_10009054 | |||
| 1268 | Ga0316585_10044701 | |||
| 1269 | Ga0316585_10151965 | |||
| 1270 | Ga0316585_10169046 | |||
| 1271 | Ga0316585_10299250 | |||
| 1272 | Ga0316580_10169036 | |||
| 1273 | Ga0316593_10003827 | |||
| 1274 | Ga0316593_10005544 | |||
| 1275 | Ga0316593_10009218 | |||
| 1276 | Ga0316593_10009227 | |||
| 1277 | Ga0316593_10013031 | |||
| 1278 | Ga0316593_10030117 | |||
| 1279 | Ga0316593_10035522 | |||
| 1280 | Ga0316593_10044666 | |||
| 1281 | Ga0316593_10054056 | |||
| 1282 | Ga0316593_10073632 | |||
| 1283 | Ga0316593_10130154 | |||
| 1284 | Ga0316593_10131286 | |||
| 1285 | Ga0316593_10194141 | |||
| 1286 | Ga0316593_10295562 | |||
| 1287 | Ga0316592_1001374 | |||
| 1288 | Ga0316592_1009153 | |||
| 1289 | Ga0316592_1014905 | |||
| 1290 | Ga0316592_1016455 | |||
| 1291 | Ga0316592_1016479 | |||
| 1292 | Ga0316592_1017300 | |||
| 1293 | Ga0316592_1089009 | |||
| 1294 | Ga0316592_1089924 | |||
| 1295 | Ga0316592_1099943 | |||
| 1296 | Ga0316596_1003416 | |||
| 1297 | Ga0316596_1007889 | |||
| 1298 | Ga0316596_1016720 | |||
| 1299 | Ga0316596_1085949 | |||
| 1300 | Ga0316596_1149157 | |||
| 1301 | Ga0373948_0027238 | |||
| 1302 | Ga0373948_0069808 | |||
| 1303 | Ga0373926_0039742 | |||
| 1304 | Ga0373940_0218119 | |||
| 1305 | Ga0373936_0043941 | |||
| 1306 | Ga0373956_0071437 | |||
| 1307 | Ga0373960_0214859 | |||
| 1308 | Ga0373946_0103214 | |||
| 1309 | Ga0316574_0000261 | |||
| 1310 | Ga0316574_0003387 | |||
| 1311 | Ga0316574_0004920 | |||
| 1312 | Ga0316574_0006478 | |||
| 1313 | Ga0316574_0045246 | |||
| 1314 | Ga0316574_0187099 | |||
| 1315 | Ga0316574_0585571 | |||
| 1316 | Ga0316574_0749365 | |||
| 1317 | Ga0373927_0026088 | |||
| 1318 | Ga0373933_0098252 | |||
| 1319 | Ga0373937_0079421 | |||
| 1320 | Ga0373937_0094576 | |||
| 1321 | Ga0316582_0006715 | |||
| 1322 | Ga0316582_0010401 | |||
| 1323 | Ga0316582_0015629 | |||
| 1324 | Ga0316582_0049422 | |||
| 1325 | Ga0316582_0056916 | |||
| 1326 | Ga0316582_0067497 | |||
| 1327 | Ga0316582_0107805 | |||
| 1328 | Ga0316582_0113717 | |||
| 1329 | Ga0316582_0163234 | |||
| 1330 | Ga0316582_0186601 | |||
| 1331 | Ga0316582_0245904 | |||
| 1332 | Ga0316582_0443986 | |||
| 1333 | Ga0316582_0661319 | |||
| 1334 | Ga0316584_0002700 | |||
| 1335 | Ga0316584_0011449 | |||
| 1336 | Ga0316584_0018735 | |||
| 1337 | Ga0316584_0024312 | |||
| 1338 | Ga0316584_0025694 | |||
| 1339 | Ga0316584_0033125 | |||
| 1340 | Ga0316584_0043744 | |||
| 1341 | Ga0316584_0048608 | |||
| 1342 | Ga0316584_0121292 | |||
| 1343 | Ga0316584_0124523 | |||
| 1344 | Ga0316584_0128922 | |||
| 1345 | Ga0316584_0130815 | |||
| 1346 | Ga0316584_0155437 | |||
| 1347 | Ga0316584_0181196 | |||
| 1348 | Ga0316584_0240828 | |||
| 1349 | Ga0316584_0379554 | |||
| 1350 | Ga0316584_0434188 | |||
| 1351 | Ga0316584_0654154 | |||
| 1352 | Ga0373925_0091251 | |||
| 1353 | Ga0316581_0002414 | |||
| 1354 | Ga0316581_0003008 | |||
| 1355 | Ga0316581_0012762 | |||
| 1356 | Ga0316581_0091350 | |||
| 1357 | Ga0316581_0145709 | |||
| 1358 | Ga0436364_0037967 | |||
| 1359 | Ga0436364_0145179 | |||
| 1360 | Ga0436364_1200244 | |||
| 1361 | Ga0395901_0604199 | |||
| 1362 | Ga0436365_0615669 | |||
| 1363 | Ga0436365_1357939 | |||
| 1364 | Ga0436360_0200572 | |||
| 1365 | Ga0436360_0929768 | |||
| 1366 | Ga0436361_0803629 | |||
| 1367 | Ga0436363_0907150 | |||
| 1368 | Ga0436362_0185069 | |||
| 1369 | Ga0436362_0489543 | |||
| 1370 | Ga0439453_0069258 | |||
| 1371 | Ga0439466_0198862 | |||
| 1372 | Ga0451800_1124329 | |||
| 1373 | Ga0439458_0209270 | |||
| 1374 | Ga0451577_0000255 | |||
| 1375 | Ga0451577_0016422 | |||
| 1376 | Ga0451577_0036920 | |||
| 1377 | Ga0451577_0046722 | |||
| 1378 | Ga0451577_0073510 | |||
| 1379 | Ga0451577_0090038 | |||
| 1380 | Ga0451577_0146669 | |||
| 1381 | Ga0451577_0168986 | |||
| 1382 | Ga0451577_0212722 | |||
| 1383 | Ga0451577_0218263 | |||
| 1384 | Ga0451577_0226400 | |||
| 1385 | Ga0451577_0255749 | |||
| 1386 | Ga0451577_0263217 | |||
| 1387 | Ga0451577_0410475 | |||
| 1388 | Ga0451577_0581871 | |||
| 1389 | Ga0451577_0602394 | |||
| 1390 | Ga0451577_0609500 | |||
| 1391 | Ga0451577_0756892 | |||
| 1392 | Ga0451577_0841821 | |||
| 1393 | Ga0451577_1264012 | |||
| 1394 | Ga0451577_1465795 | |||
| 1395 | Ga0451577_1771656 | |||
| 1396 | Ga0451577_1788530 | |||
| 1397 | Ga0453683_0002238 | |||
| 1398 | Ga0453683_0009016 | |||
| 1399 | Ga0453683_0029392 | |||
| 1400 | Ga0453683_0054006 | |||
| 1401 | Ga0453683_0054407 | |||
| 1402 | Ga0453683_0080038 | |||
| 1403 | Ga0453683_0097859 | |||
| 1404 | Ga0453683_0117932 | |||
| 1405 | Ga0453683_0156879 | |||
| 1406 | Ga0453683_0177459 | |||
| 1407 | Ga0453683_0269711 | |||
| 1408 | Ga0453683_0320961 | |||
| 1409 | Ga0453683_0717326 | |||
| 1410 | Ga0453683_0969191 | |||
| 1411 | Ga0453684_0000024 | |||
| 1412 | Ga0453684_0000053 | |||
| 1413 | Ga0453684_0000095 | |||
| 1414 | Ga0453684_0001390 | |||
| 1415 | Ga0453684_0004574 | |||
| 1416 | Ga0453684_0007412 | |||
| 1417 | Ga0453684_0009456 | |||
| 1418 | Ga0453684_0015826 | |||
| 1419 | Ga0453684_0016312 | |||
| 1420 | Ga0453684_0024636 | |||
| 1421 | Ga0453684_0040080 | |||
| 1422 | Ga0453684_0040272 | |||
| 1423 | Ga0453684_0042774 | |||
| 1424 | Ga0453684_0056281 | |||
| 1425 | Ga0453684_0056484 | |||
| 1426 | Ga0453684_0061849 | |||
| 1427 | Ga0453684_0067627 | |||
| 1428 | Ga0453684_0093633 | |||
| 1429 | Ga0453684_0106015 | |||
| 1430 | Ga0453684_0115884 | |||
| 1431 | Ga0453684_0135193 | |||
| 1432 | Ga0453684_0136380 | |||
| 1433 | Ga0453684_0142003 | |||
| 1434 | Ga0453684_0143867 | |||
| 1435 | Ga0453684_0163981 | |||
| 1436 | Ga0453684_0168281 | |||
| 1437 | Ga0453684_0168954 | |||
| 1438 | Ga0453684_0186040 | |||
| 1439 | Ga0453684_0206616 | |||
| 1440 | Ga0453684_0208059 | |||
| 1441 | Ga0453684_0222013 | |||
| 1442 | Ga0453684_0236903 | |||
| 1443 | Ga0453684_0243717 | |||
| 1444 | Ga0453684_0244698 | |||
| 1445 | Ga0453684_0258597 | |||
| 1446 | Ga0453684_0259192 | |||
| 1447 | Ga0453684_0265491 | |||
| 1448 | Ga0453684_0277435 | |||
| 1449 | Ga0453684_0286127 | |||
| 1450 | Ga0453684_0334890 | |||
| 1451 | Ga0453684_0348656 | |||
| 1452 | Ga0453684_0368765 | |||
| 1453 | Ga0453684_0370521 | |||
| 1454 | Ga0453684_0386516 | |||
| 1455 | Ga0453684_0400397 | |||
| 1456 | Ga0453684_0405751 | |||
| 1457 | Ga0453684_0468984 | |||
| 1458 | Ga0453684_0470285 | |||
| 1459 | Ga0453684_0550092 | |||
| 1460 | Ga0453684_0673974 | |||
| 1461 | Ga0453684_0725474 | |||
| 1462 | Ga0453684_0828962 | |||
| 1463 | Ga0453684_0896859 | |||
| 1464 | Ga0453684_1007802 | |||
| 1465 | Ga0453684_1100885 | |||
| 1466 | Ga0453684_1103443 | |||
| 1467 | Ga0453684_1134295 | |||
| 1468 | Ga0453684_1166842 | |||
| 1469 | Ga0453684_1259523 | |||
| 1470 | Ga0453684_1431369 | |||
| 1471 | Ga0453684_2265119 | |||
| 1472 | Ga0451576_0011013 | |||
| 1473 | Ga0451576_0011617 | |||
| 1474 | Ga0451576_0013575 | |||
| 1475 | Ga0451576_0021913 | |||
| 1476 | Ga0451576_0043649 | |||
| 1477 | Ga0451576_0063214 | |||
| 1478 | Ga0451576_0072849 | |||
| 1479 | Ga0451576_0079806 | |||
| 1480 | Ga0451576_0092060 | |||
| 1481 | Ga0451576_0101166 | |||
| 1482 | Ga0451576_0105136 | |||
| 1483 | Ga0451576_0310380 | |||
| 1484 | Ga0451576_0963338 | |||
| 1485 | Ga0451576_1006448 | |||
| 1486 | Ga0451576_1087639 | |||
| 1487 | Ga0451576_1092440 | |||
| 1488 | Ga0451576_1363348 | |||
| 1489 | Ga0466958_0416663 | |||
| 1490 | Ga0466967_0224153 | |||
| 1491 | Ga0495590_0051707 | |||
| 1492 | Ga0495629_0312010 | |||
| 1493 | Ga0495642_0313804 | |||
| 1494 | Ga0495640_0912413 | |||
| 1495 | Ga0495622_0173732 | |||
| 1496 | Ga0495656_0075412 | |||
| 1497 | Ga0495668_0542568 | |||
| 1498 | Ga0495635_0099575 | |||
| 1499 | Ga0495658_0491456 | |||
| 1500 | Ga0495675_0182819 | |||
| 1501 | Ga0495684_0245864 | |||
| 1502 | Ga0496106_0650809 | |||
| 1503 | Ga0496116_0000092 | |||
| 1504 | Ga0496117_0010168 | |||
| 1505 | Ga0496118_0023887 | |||
| 1506 | Ga0496124_0110978 | |||
| 1507 | Ga0501298_012192 | |||
| 1508 | Ga0501031_0006137 | |||
| 1509 | Ga0501031_0017790 | |||
| 1510 | Ga0501031_0039136 | |||
| 1511 | Ga0501032_0071743 | |||
| 1512 | Ga0501033_0016696 | |||
| 1513 | Ga0501033_0812166 | |||
| 1514 | Ga0501034_0240422 | |||
| 1515 | Ga0501034_0738917 | |||
| 1516 | Ga0501036_0029257 | |||
| 1517 | Ga0501036_0060101 | |||
| 1518 | Ga0501036_0307862 | |||
| 1519 | Ga0501036_0986953 | |||
| 1520 | Ga0501036_1291202 | |||
| 1521 | Ga0501038_0000140 | |||
| 1522 | Ga0501038_0102379 | |||
| 1523 | Ga0501038_0302085 | |||
| 1524 | Ga0501038_0598282 | |||
| 1525 | Ga0501038_0733590 | |||
| 1526 | Ga0501039_0027193 | |||
| 1527 | Ga0501039_0104589 | |||
| 1528 | Ga0501039_0328474 | |||
| 1529 | Ga0501039_0354780 | |||
| 1530 | Ga0501039_0492356 | |||
| 1531 | Ga0501039_0826327 | |||
| 1532 | Ga0501040_0007490 | |||
| 1533 | Ga0501040_0057264 | |||
| 1534 | Ga0501040_0094358 | |||
| 1535 | Ga0501041_0060371 | |||
| 1536 | Ga0501041_0429487 | |||
| 1537 | Ga0501041_0551320 | |||
| 1538 | Ga0501042_0000966 | |||
| 1539 | Ga0501042_0050428 | |||
| 1540 | Ga0501042_0080226 | |||
| 1541 | Ga0501042_0270114 | |||
| 1542 | Ga0501042_0542896 | |||
| 1543 | Ga0501042_1392025 | |||
| 1544 | Ga0501043_0129609 | |||
| 1545 | Ga0501043_0173935 | |||
| 1546 | Ga0501043_0478221 | |||
| 1547 | Ga0501046_0020824 | |||
| 1548 | Ga0501046_0102038 | |||
| 1549 | Ga0501046_0220323 | |||
| 1550 | Ga0501046_0810389 | |||
| 1551 | Ga0501046_0941317 | |||
| 1552 | Ga0501046_0957906 | |||
| 1553 | Ga0501046_1109699 | |||
| 1554 | Ga0501048_0003982 | |||
| 1555 | Ga0501048_0134002 | |||
| 1556 | Ga0501048_0218848 | |||
| 1557 | Ga0501048_0220195 | |||
| 1558 | Ga0501048_0445721 | |||
| 1559 | Ga0501067_0252617 | |||
| 1560 | Ga0501068_0059339 | |||
| 1561 | Ga0501068_0226780 | |||
| 1562 | Ga0501068_0638226 | |||
| 1563 | Ga0501069_0219682 | |||
| 1564 | Ga0501069_0225820 | |||
| 1565 | Ga0501069_0273407 | |||
| 1566 | Ga0501070_0248543 | |||
| 1567 | Ga0501070_0564142 | |||
| 1568 | Ga0501070_0905336 | |||
| 1569 | Ga0501071_0002399 | |||
| 1570 | Ga0501071_0033419 | |||
| 1571 | Ga0501071_0091805 | |||
| 1572 | Ga0501071_0140343 | |||
| 1573 | Ga0501071_0162909 | |||
| 1574 | Ga0501071_0517056 | |||
| 1575 | Ga0501071_0830502 | |||
| 1576 | Ga0501071_1162193 | |||
| 1577 | Ga0501072_0049264 | |||
| 1578 | Ga0501072_0051154 | |||
| 1579 | Ga0501072_0099059 | |||
| 1580 | Ga0501072_0518337 | |||
| 1581 | Ga0501072_0693601 | |||
| 1582 | Ga0501072_0743960 | |||
| 1583 | Ga0501072_0759455 | |||
| 1584 | Ga0501072_0773310 | |||
| 1585 | Ga0501073_0036681 | |||
| 1586 | Ga0501073_0076612 | |||
| 1587 | Ga0501073_0086289 | |||
| 1588 | Ga0501073_0251473 | |||
| 1589 | Ga0501073_0348421 | |||
| 1590 | Ga0501073_0431355 | |||
| 1591 | Ga0501073_0671992 | |||
| 1592 | Ga0501074_0016422 | |||
| 1593 | Ga0501074_0079308 | |||
| 1594 | Ga0501074_0268305 | |||
| 1595 | Ga0501074_0297213 | |||
| 1596 | Ga0501074_0338384 | |||
| 1597 | Ga0501074_0448980 | |||
| 1598 | Ga0501074_0696404 | |||
| 1599 | Ga0501075_0002441 | |||
| 1600 | Ga0501075_0035988 | |||
| 1601 | Ga0501075_0038454 | |||
| 1602 | Ga0501075_0080504 | |||
| 1603 | Ga0501075_0092774 | |||
| 1604 | Ga0501075_0122775 | |||
| 1605 | Ga0501075_0365290 | |||
| 1606 | Ga0501075_1297839 | |||
| 1607 | Ga0501076_0005164 | |||
| 1608 | Ga0501076_0008455 | |||
| 1609 | Ga0501076_0013865 | |||
| 1610 | Ga0501076_0139293 | |||
| 1611 | Ga0501076_0143588 | |||
| 1612 | Ga0501076_0147379 | |||
| 1613 | Ga0501076_0308304 | |||
| 1614 | Ga0501076_0386281 | |||
| 1615 | Ga0501076_0587765 | |||
| 1616 | Ga0501076_0647614 | |||
| 1617 | Ga0501076_1178914 | |||
| 1618 | Ga0501076_1371489 | |||
| 1619 | Ga0501076_1410950 | |||
| 1620 | Ga0501077_0068981 | |||
| 1621 | Ga0501077_0084123 | |||
| 1622 | Ga0501077_0104769 | |||
| 1623 | Ga0501077_0202462 | |||
| 1624 | Ga0501077_0400460 | |||
| 1625 | Ga0501077_0403642 | |||
| 1626 | Ga0501209_179047 | |||
| 1627 | Ga0501079_0002098 | |||
| 1628 | Ga0501079_0005630 | |||
| 1629 | Ga0501079_0023971 | |||
| 1630 | Ga0501079_0072572 | |||
| 1631 | Ga0501079_0300999 | |||
| 1632 | Ga0501079_0340091 | |||
| 1633 | Ga0501079_1261081 | |||
| 1634 | Ga0501080_0030270 | |||
| 1635 | Ga0501080_0040197 | |||
| 1636 | Ga0501080_0095099 | |||
| 1637 | Ga0501080_0102268 | |||
| 1638 | Ga0501080_0239101 | |||
| 1639 | Ga0501080_0858215 | |||
| 1640 | Ga0501080_1252096 | |||
| 1641 | Ga0501081_0002409 | |||
| 1642 | Ga0501081_0005918 | |||
| 1643 | Ga0501081_0109731 | |||
| 1644 | Ga0501081_0124088 | |||
| 1645 | Ga0501081_0376322 | |||
| 1646 | Ga0501081_0398367 | |||
| 1647 | Ga0501081_0506892 | |||
| 1648 | Ga0501081_0767914 | |||
| 1649 | Ga0501083_0356909 | |||
| 1650 | Ga0501083_0563725 | |||
| 1651 | Ga0501083_0972331 | |||
| 1652 | Ga0501035_0076232 | |||
| 1653 | Ga0501035_0302366 | |||
| 1654 | Ga0501035_0525495 | |||
| 1655 | Ga0501044_0417707 | |||
| 1656 | Ga0501044_0629000 | |||
| 1657 | Ga0501045_0005722 | |||
| 1658 | Ga0501045_0010612 | |||
| 1659 | Ga0501045_0032913 | |||
| 1660 | Ga0501045_0227387 | |||
| 1661 | Ga0501045_0282110 | |||
| 1662 | Ga0501045_0299896 | |||
| 1663 | nmdc:mga03683_109939_c1 | |||
| 1664 | nmdc:mga00v17_1044914_c1 | |||
| 1665 | nmdc:mga00v17_291758_c1 | |||
| 1666 | nmdc:mga00v17_333465_c1 | |||
| 1667 | nmdc:mga00v17_392319_c1 | |||
| 1668 | nmdc:mga00v17_691652_c1 | |||
| 1669 | nmdc:mga0k408_75406_c1 | |||
| 1670 | nmdc:mga04h51_212827_c1 | |||
| 1671 | nmdc:mga04h51_256975_c1 | |||
| 1672 | nmdc:mga07m45_39171_c1 | |||
| 1673 | nmdc:mga05p37_177127_c1 | |||
| 1674 | nmdc:mga05p37_18425_c1 | |||
| 1675 | nmdc:mga05p37_22072_c1 | |||
| 1676 | nmdc:mga05p37_35685_c1 | |||
| 1677 | nmdc:mga05p37_387053_c1 | |||
| 1678 | nmdc:mga05p37_50766_c1 | |||
| 1679 | nmdc:mga05p37_785304_c1 | |||
| 1680 | nmdc:mga05p37_87693_c1 | |||
| 1681 | nmdc:mga05p37_97390_c1 | |||
| 1682 | nmdc:mga05p37_98021_c1 | |||
| 1683 | nmdc:mga09592_107846_c1 | |||
| 1684 | nmdc:mga09592_152944_c1 | |||
| 1685 | nmdc:mga09592_160523_c2 | |||
| 1686 | nmdc:mga09592_1856_c1 | |||
| 1687 | nmdc:mga09592_226277_c1 | |||
| 1688 | nmdc:mga09592_45050_c1 | |||
| 1689 | nmdc:mga09592_903730_c1 | |||
| 1690 | nmdc:mga0qj67_10673_c1 | |||
| 1691 | nmdc:mga0qj67_171004_c1 | |||
| 1692 | nmdc:mga0qj67_198978_c1 | |||
| 1693 | nmdc:mga0qj67_289596_c1 | |||
| 1694 | nmdc:mga06r32_219869_c1 | |||
| 1695 | nmdc:mga06r32_37109_c1 | |||
| 1696 | nmdc:mga06r32_87496_c1 | |||
| 1697 | nmdc:mga08y16_569055_c1 | |||
| 1698 | nmdc:mga08y16_952220_c1 | |||
| 1699 | nmdc:mga0n895_1548846_c1 | |||
| 1700 | nmdc:mga0n895_37094_c1 | |||
| 1701 | nmdc:mga0n895_459380_c1 | |||
| 1702 | nmdc:mga0n895_616367_c1 | |||
| 1703 | nmdc:mga0rr50_19091_c1 | |||
| 1704 | nmdc:mga0rr50_285193_c1 | |||
| 1705 | nmdc:mga08x19_197965_c1 | |||
| 1706 | nmdc:mga08x19_23_c1 | |||
| 1707 | nmdc:mga08x19_549823_c1 | |||
| 1708 | nmdc:mga0a205_330564_c1 | |||
| 1709 | nmdc:mga0a205_370702_c1 | |||
| 1710 | nmdc:mga0a205_56751_c1 | |||
| 1711 | nmdc:mga0a205_83999_c1 | |||
| 1712 | nmdc:mga0sz30_28570_c1 | |||
| 1713 | Ga0495601_0138168 | |||
| 1714 | Ga0495619_0234416 | |||
| 1715 | Ga0500562_161722 | |||
| 1716 | Ga0500627_0028900 | |||
| 1717 | Ga0501084_0000338 | |||
| 1718 | Ga0501084_0013743 | |||
| 1719 | Ga0501084_0021138 | |||
| 1720 | Ga0501084_0058449 | |||
| 1721 | Ga0501084_0139313 | |||
| 1722 | Ga0501084_0323131 | |||
| 1723 | Ga0501084_0588195 | |||
| 1724 | Ga0501084_0593448 | |||
| 1725 | Ga0501084_0862624 | |||
| 1726 | Ga0501084_1843839 | |||
| 1727 | Ga0590075_158602 | |||
| 1728 | Ga0587084_104359 | |||
| 1729 | Ga0587066_110821 | |||
| 1730 | Ga0587070_031893 | |||
| 1731 | Ga0587080_107446 | |||
| 1732 | Ga0587083_0181122 | |||
| 1733 | Ga0587086_100215 | |||
| 1734 | Ga0587088_085767 | |||
| 1735 | Ga0587109_105257 | |||
| 1736 | Ga0587078_014165 | |||
| 1737 | Ga0587110_028893 | |||
| 1738 | Ga0501082_0008258 | |||
| 1739 | Ga0501082_0008983 | |||
| 1740 | Ga0501082_0016387 | |||
| 1741 | Ga0501082_0262155 | |||
| 1742 | Ga0501082_0327236 | |||
| 1743 | Ga0501082_0431359 | |||
| 1744 | Ga0501082_0438188 | |||
| 1745 | Ga0501082_0810293 | |||
| 1746 | Ga0501082_1439441 | |||
| 1747 | Ga0530510_0029550 | |||
| 1748 | Ga0530510_0052557 | |||
| 1749 | Ga0530510_0138506 | |||
| 1750 | Ga0530510_0260937 | |||
| 1751 | Ga0530510_0329864 | |||
| 1752 | Ga0530510_0388927 | |||
| 1753 | Ga0530510_0861663 | |||
| 1754 | Ga0530510_0898528 | |||
| 1755 | Ga0530510_1166486 | |||
| 1756 | 2643755759 | |||
| 1757 | 2772436823 | |||
| 1758 | 2888366874 | |||
| 1759 | 2908674615 | |||
| 1760 | 2937969512 | |||
| 1761 | 8004595852 | |||
| 1762 | 8015398591 | |||
| 1763 | 8054846333 | |||
| 1764 | 8054852268 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y39-assembly2.cif.gz_B | co-evolution of protein and rna structures within a highly conserved ribosomal domain | 0.9706 | 71 | 142 |
| 1mms-assembly2.cif.gz_B | crystal structure of the ribosomal protein l11-rna complex | 0.9705 | 72 | 141 |
| 1hc8-assembly2.cif.gz_B | crystal structure of a conserved ribosomal protein-rna complex | 0.9679 | 72 | 141 |
| 5h5u-assembly1.cif.gz_J | mechanistic insights into the alternative translation termination by arfa and rf2 | 0.9623 | 71 | 141 |
| 5gae-assembly1.cif.gz_J | rnc in complex with a translocating secyeg | 0.9594 | 72 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9848 | 2 | 68 | 3.30.1550.10 |
| af_I1J9L7_135_215_1.10.10.250 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9754 | 73 | 140 | 1.10.10.250 |
| af_Q9VFJ2_20_96_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9683 | 6 | 78 | 3.30.1550.10 |
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9567 | 2 | 68 | 3.30.1550.10 |
| af_Q8IIQ5_3_68_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9555 | 6 | 70 | 3.30.1550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A379KAS4-F1-model_v4 | 50S ribosomal protein L11 | 1.003 | 1 | 73 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7Y3CRS9-F1-model_v4 | 50S ribosomal protein L11 | 1 | 1 | 73 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A316VVS0-F1-model_v4 | Large ribosomal subunit protein uL11 N-terminal domain-containing protein | 0.9984 | 7 | 73 |
GO:0003735
GO:0005762 GO:0006412 GO:0070180 |
| AF-A0A7C7KR99-F1-model_v4 | 50S ribosomal protein L11 | 0.9979 | 1 | 70 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A4Q3RV35-F1-model_v4 | 50S ribosomal protein L11 | 0.9978 | 1 | 64 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |