F484290
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 874 | 393 | 862 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10991600|Ga0157372_109916003 |
| Length | 102 |
| Sequence | MVALNEMNRDELFAWVADLLAEMFELDRASLSLQSNLYADLDIDSIDAVDLAVRLKQMTDKRLQPEIFKAIRTIGDVVDALVQMAQEPSDAPAAATTEVQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 3 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 4 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 5 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 6 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 7 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 8 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 9 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 10 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 11 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 12 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 13 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 15 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 18 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 19 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 20 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 21 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 24 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 112 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 113 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 114 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 115 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 184 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 185 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 186 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 187 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 188 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 214 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 215 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 216 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 217 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 218 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 219 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 220 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 221 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 222 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 223 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 226 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 227 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 231 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 345 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 346 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 347 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 359 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 361 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 364 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 365 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 367 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 368 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 369 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 370 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 371 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 387 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 388 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 393 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.34 |
| Metatranscriptomes | 2.29 |
| Isolates | 1.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.04 |
| Nodule | 0.23 |
| Rhizoplane | 2.06 |
| Rhizosphere | 85.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214801358 | 2209111006 | Bacteria | 707 |
| 2 | ARcpr5yngRDRAFT_c021294 | 3300000043 | Bacteria | 550 |
| 3 | ARSoilOldRDRAFT_c005349 | 3300000044 | Bacteria | 1083 |
| 4 | ARCol0yngRDRAFT_1011370 | 3300000652 | Bacteria | 654 |
| 5 | JGI25154J39366_1004923 | 3300002738 | Bacteria | 2249 |
| 6 | JGI25158J39367_1020692 | 3300002739 | Bacteria | 802 |
| 7 | JGI25158J39367_1034970 | 3300002739 | Bacteria | 552 |
| 8 | JGI25152J39213_1000052 | 3300002773 | Bacteria | 77690 |
| 9 | JGI25150J39212_1000260 | 3300002774 | Bacteria | 28066 |
| 10 | JGI25150J39212_1001889 | 3300002774 | Bacteria | 5505 |
| 11 | JGI25150J39212_1005558 | 3300002774 | Bacteria | 2681 |
| 12 | JGI25150J39212_1037262 | 3300002774 | Bacteria | 642 |
| 13 | JGI25159J45721_1004841 | 3300002987 | Bacteria | 4349 |
| 14 | JGI25151J46595_10045649 | 3300003187 | Bacteria | 1544 |
| 15 | JGI25153J46596_10005812 | 3300003215 | Bacteria | 6414 |
| 16 | JGI25161J50226_1000052 | 3300003374 | Bacteria | 107273 |
| 17 | Ga0007417J51691_1120058 | 3300003544 | Bacteria | 598 |
| 18 | Ga0007417J51691_1130297 | 3300003544 | Bacteria | 563 |
| 19 | Ga0007409J51694_1042002 | 3300003575 | Bacteria | 631 |
| 20 | Ga0007409J51694_1065768 | 3300003575 | Bacteria | 567 |
| 21 | Ga0007416J51690_1069957 | 3300003577 | Bacteria | 571 |
| 22 | Ga0055526_1000066 | 3300003771 | Bacteria | 101329 |
| 23 | Ga0055526_1000100 | 3300003771 | Bacteria | 76578 |
| 24 | Ga0055526_1000532 | 3300003771 | Bacteria | 30148 |
| 25 | Ga0055526_1007832 | 3300003771 | Bacteria | 5463 |
| 26 | Ga0055537_1002016 | 3300003773 | Bacteria | 7218 |
| 27 | Ga0055537_1003673 | 3300003773 | Bacteria | 4652 |
| 28 | Ga0055537_1016608 | 3300003773 | Bacteria | 1239 |
| 29 | Ga0055524_1001361 | 3300003775 | Bacteria | 14184 |
| 30 | Ga0055524_1001826 | 3300003775 | Bacteria | 11660 |
| 31 | Ga0055524_1003599 | 3300003775 | Bacteria | 7471 |
| 32 | Ga0055534_1003239 | 3300003784 | Bacteria | 5208 |
| 33 | Ga0055534_1014270 | 3300003784 | Bacteria | 1494 |
| 34 | Ga0055528_1025592 | 3300003790 | Bacteria | 1726 |
| 35 | Ga0055530_10000050 | 3300003791 | Bacteria | 105620 |
| 36 | Ga0055530_10003761 | 3300003791 | Bacteria | 8375 |
| 37 | Ga0055530_10005107 | 3300003791 | Bacteria | 6423 |
| 38 | Ga0055531_10000417 | 3300003794 | Bacteria | 40692 |
| 39 | Ga0055531_10056372 | 3300003794 | Bacteria | 991 |
| 40 | Ga0055543_1000038 | 3300004625 | Bacteria | 124032 |
| 41 | Ga0055543_1032808 | 3300004625 | Bacteria | 900 |
| 42 | Ga0065165_1000117 | 3300005262 | Bacteria | 134716 |
| 43 | Ga0065165_1068256 | 3300005262 | Bacteria | 952 |
| 44 | Ga0065165_1078328 | 3300005262 | Bacteria | 863 |
| 45 | Ga0065716_1007397 | 3300005277 | Bacteria | 756 |
| 46 | Ga0065704_10746682 | 3300005289 | Bacteria | 543 |
| 47 | Ga0065712_10000441 | 3300005290 | Bacteria | 22669 |
| 48 | Ga0065715_10301756 | 3300005293 | Bacteria | 1038 |
| 49 | Ga0065715_10863725 | 3300005293 | Unclassified | 576 |
| 50 | Ga0065707_10085234 | 3300005295 | Bacteria | 6333 |
| 51 | Ga0065707_10231485 | 3300005295 | Bacteria | 1187 |
| 52 | Ga0065707_10371062 | 3300005295 | Unclassified | 890 |
| 53 | Ga0065707_10383819 | 3300005295 | Bacteria | 873 |
| 54 | Ga0070676_10424860 | 3300005328 | Bacteria | 929 |
| 55 | Ga0070676_10756834 | 3300005328 | Unclassified | 713 |
| 56 | Ga0070670_101189643 | 3300005331 | Bacteria | 696 |
| 57 | Ga0070666_10162094 | 3300005335 | Bacteria | 1563 |
| 58 | Ga0070680_101287931 | 3300005336 | Unclassified | 632 |
| 59 | Ga0070660_100093105 | 3300005339 | Bacteria | 2379 |
| 60 | Ga0070660_100152177 | 3300005339 | Bacteria | 1860 |
| 61 | Ga0070691_10137087 | 3300005341 | Bacteria | 1244 |
| 62 | Ga0070687_100117513 | 3300005343 | Unclassified | 1515 |
| 63 | Ga0070661_100141316 | 3300005344 | Bacteria | 1814 |
| 64 | Ga0070661_100633787 | 3300005344 | Bacteria | 866 |
| 65 | Ga0070668_102087006 | 3300005347 | Bacteria | 523 |
| 66 | Ga0070669_100051245 | 3300005353 | Unclassified | 3016 |
| 67 | Ga0070669_101517912 | 3300005353 | Bacteria | 582 |
| 68 | Ga0070675_100496289 | 3300005354 | Bacteria | 1099 |
| 69 | Ga0070671_100034253 | 3300005355 | Bacteria | 4204 |
| 70 | Ga0070674_100206699 | 3300005356 | Bacteria | 1519 |
| 71 | Ga0070659_100375674 | 3300005366 | Bacteria | 1196 |
| 72 | Ga0070667_100441740 | 3300005367 | Bacteria | 1188 |
| 73 | Ga0070709_11367593 | 3300005434 | Bacteria | 572 |
| 74 | Ga0070713_100493346 | 3300005436 | Bacteria | 1155 |
| 75 | Ga0070701_10681618 | 3300005438 | Bacteria | 689 |
| 76 | Ga0070711_100122275 | 3300005439 | Bacteria | 1927 |
| 77 | Ga0070705_100523217 | 3300005440 | Bacteria | 904 |
| 78 | Ga0070705_100816530 | 3300005440 | Bacteria | 743 |
| 79 | Ga0070694_101579907 | 3300005444 | Bacteria | 556 |
| 80 | Ga0070708_100605515 | 3300005445 | Bacteria | 1033 |
| 81 | Ga0070663_100754780 | 3300005455 | Bacteria | 831 |
| 82 | Ga0070662_100705557 | 3300005457 | Bacteria | 854 |
| 83 | Ga0070662_100770419 | 3300005457 | Bacteria | 817 |
| 84 | Ga0070681_11426765 | 3300005458 | Bacteria | 616 |
| 85 | Ga0068867_100961894 | 3300005459 | Bacteria | 772 |
| 86 | Ga0070685_10450701 | 3300005466 | Bacteria | 901 |
| 87 | Ga0070684_101158486 | 3300005535 | Bacteria | 727 |
| 88 | Ga0070684_101942936 | 3300005535 | Unclassified | 555 |
| 89 | Ga0068853_100251124 | 3300005539 | Bacteria | 1623 |
| 90 | Ga0070672_100063875 | 3300005543 | Bacteria | 2908 |
| 91 | Ga0070686_101309046 | 3300005544 | Bacteria | 605 |
| 92 | Ga0070695_100123787 | 3300005545 | Bacteria | 1773 |
| 93 | Ga0070695_100330301 | 3300005545 | Bacteria | 1136 |
| 94 | Ga0068855_100028435 | 3300005563 | Bacteria | 6688 |
| 95 | Ga0068855_100059700 | 3300005563 | Bacteria | 4462 |
| 96 | Ga0068855_100175212 | 3300005563 | Bacteria | 2427 |
| 97 | Ga0070664_100310537 | 3300005564 | Bacteria | 1427 |
| 98 | Ga0068857_101162900 | 3300005577 | Bacteria | 746 |
| 99 | Ga0068854_100629307 | 3300005578 | Bacteria | 919 |
| 100 | Ga0068852_100266659 | 3300005616 | Bacteria | 1646 |
| 101 | Ga0068864_100819125 | 3300005618 | Bacteria | 916 |
| 102 | Ga0068861_100770873 | 3300005719 | Bacteria | 900 |
| 103 | Ga0068851_10529453 | 3300005834 | Bacteria | 710 |
| 104 | Ga0068870_10767527 | 3300005840 | Bacteria | 671 |
| 105 | Ga0068858_100325778 | 3300005842 | Unclassified | 1469 |
| 106 | Ga0068860_100199592 | 3300005843 | Bacteria | 1938 |
| 107 | Ga0068862_100807895 | 3300005844 | Bacteria | 916 |
| 108 | Ga0075432_10238350 | 3300006058 | Unclassified | 734 |
| 109 | Ga0070712_100500645 | 3300006175 | Bacteria | 1018 |
| 110 | Ga0075362_10045577 | 3300006177 | Bacteria | 1948 |
| 111 | Ga0097621_100985980 | 3300006237 | Bacteria | 788 |
| 112 | Ga0075370_10280770 | 3300006353 | Bacteria | 989 |
| 113 | Ga0075370_11013201 | 3300006353 | Bacteria | 509 |
| 114 | Ga0075428_100041332 | 3300006844 | Bacteria | 5071 |
| 115 | Ga0075428_100458552 | 3300006844 | Bacteria | 1365 |
| 116 | Ga0075428_101147718 | 3300006844 | Unclassified | 820 |
| 117 | Ga0075430_100037028 | 3300006846 | Bacteria | 4135 |
| 118 | Ga0075430_100667062 | 3300006846 | Unclassified | 857 |
| 119 | Ga0075430_100881657 | 3300006846 | Bacteria | 737 |
| 120 | Ga0075431_100056553 | 3300006847 | Bacteria | 4046 |
| 121 | Ga0075431_100117444 | 3300006847 | Bacteria | 2745 |
| 122 | Ga0075431_100448398 | 3300006847 | Bacteria | 1286 |
| 123 | Ga0075431_100499780 | 3300006847 | Bacteria | 1207 |
| 124 | Ga0075431_101811414 | 3300006847 | Bacteria | 566 |
| 125 | Ga0075433_10010092 | 3300006852 | Bacteria | 7570 |
| 126 | Ga0075433_10107798 | 3300006852 | Bacteria | 2470 |
| 127 | Ga0075433_10306896 | 3300006852 | Bacteria | 1405 |
| 128 | Ga0075433_10419657 | 3300006852 | Bacteria | 1180 |
| 129 | Ga0075434_100025061 | 3300006871 | Bacteria | 5834 |
| 130 | Ga0075434_100040503 | 3300006871 | Bacteria | 4612 |
| 131 | Ga0075434_100113511 | 3300006871 | Bacteria | 2721 |
| 132 | Ga0075434_100212084 | 3300006871 | Bacteria | 1956 |
| 133 | Ga0075434_100469779 | 3300006871 | Bacteria | 1279 |
| 134 | Ga0075434_101507269 | 3300006871 | Bacteria | 682 |
| 135 | Ga0075429_100285419 | 3300006880 | Bacteria | 1445 |
| 136 | Ga0075429_100501130 | 3300006880 | Bacteria | 1064 |
| 137 | Ga0075429_101753200 | 3300006880 | Bacteria | 539 |
| 138 | Ga0068865_100068899 | 3300006881 | Bacteria | 2502 |
| 139 | Ga0068865_101464430 | 3300006881 | Bacteria | 611 |
| 140 | Ga0075436_100042122 | 3300006914 | Bacteria | 3149 |
| 141 | Ga0075436_100052471 | 3300006914 | Unclassified | 2815 |
| 142 | Ga0075436_100309664 | 3300006914 | Bacteria | 1133 |
| 143 | Ga0075436_100536705 | 3300006914 | Bacteria | 858 |
| 144 | Ga0079104_1009935 | 3300006946 | Bacteria | 3178 |
| 145 | Ga0075435_100095664 | 3300007076 | Bacteria | 2456 |
| 146 | Ga0075435_100147909 | 3300007076 | Bacteria | 1974 |
| 147 | Ga0075435_100189958 | 3300007076 | Unclassified | 1738 |
| 148 | Ga0105244_10004503 | 3300009036 | Bacteria | 9568 |
| 149 | Ga0105244_10020520 | 3300009036 | Bacteria | 3669 |
| 150 | Ga0105244_10389660 | 3300009036 | Bacteria | 641 |
| 151 | Ga0105240_10937369 | 3300009093 | Bacteria | 929 |
| 152 | Ga0111539_10122185 | 3300009094 | Bacteria | 3052 |
| 153 | Ga0111539_10204406 | 3300009094 | Unclassified | 2302 |
| 154 | Ga0111539_10237262 | 3300009094 | Bacteria | 2123 |
| 155 | Ga0111539_10300269 | 3300009094 | Bacteria | 1869 |
| 156 | Ga0111539_13107567 | 3300009094 | Bacteria | 536 |
| 157 | Ga0105245_10622927 | 3300009098 | Bacteria | 1107 |
| 158 | Ga0114129_10002450 | 3300009147 | Bacteria | 25774 |
| 159 | Ga0114129_10049272 | 3300009147 | Bacteria | 5918 |
| 160 | Ga0114129_10105333 | 3300009147 | Bacteria | 3898 |
| 161 | Ga0114129_10226564 | 3300009147 | Bacteria | 2519 |
| 162 | Ga0114129_10893646 | 3300009147 | Bacteria | 1126 |
| 163 | Ga0105243_10314652 | 3300009148 | Bacteria | 1424 |
| 164 | Ga0105243_11104213 | 3300009148 | Bacteria | 802 |
| 165 | Ga0105241_10088450 | 3300009174 | Bacteria | 2439 |
| 166 | Ga0105242_10009643 | 3300009176 | Bacteria | 7399 |
| 167 | Ga0105237_10785325 | 3300009545 | Bacteria | 959 |
| 168 | Ga0105238_10197089 | 3300009551 | Bacteria | 1990 |
| 169 | Ga0105239_10136174 | 3300010375 | Bacteria | 2734 |
| 170 | Ga0105239_10262049 | 3300010375 | Unclassified | 1943 |
| 171 | Ga0157323_1004503 | 3300012495 | Bacteria | 894 |
| 172 | Ga0157313_1004665 | 3300012503 | Bacteria | 953 |
| 173 | Ga0157324_1005512 | 3300012506 | Bacteria | 919 |
| 174 | Ga0157316_1013113 | 3300012510 | Bacteria | 806 |
| 175 | Ga0157338_1009589 | 3300012515 | Bacteria | 962 |
| 176 | Ga0157371_11021274 | 3300013102 | Bacteria | 631 |
| 177 | Ga0157374_10417320 | 3300013296 | Bacteria | 1340 |
| 178 | Ga0157378_10014338 | 3300013297 | Bacteria | 6940 |
| 179 | Ga0157378_10351057 | 3300013297 | Bacteria | 1441 |
| 180 | Ga0163162_10040488 | 3300013306 | Bacteria | 4660 |
| 181 | Ga0163162_10268593 | 3300013306 | Bacteria | 1837 |
| 182 | Ga0163162_10963501 | 3300013306 | Bacteria | 964 |
| 183 | Ga0157372_10991600 | 3300013307 | Bacteria | 973 |
| 184 | Ga0157372_11646209 | 3300013307 | Bacteria | 739 |
| 185 | Ga0163163_10715885 | 3300014325 | Bacteria | 1065 |
| 186 | Ga0182008_10000203 | 3300014497 | Bacteria | 46755 |
| 187 | Ga0157377_10295274 | 3300014745 | Bacteria | 1067 |
| 188 | Ga0157379_10216530 | 3300014968 | Bacteria | 1735 |
| 189 | Ga0157376_10116025 | 3300014969 | Bacteria | 2365 |
| 190 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 191 | Ga0182006_1000021 | 3300015261 | Bacteria | 280808 |
| 192 | Ga0182005_1000013 | 3300015265 | Bacteria | 396391 |
| 193 | Ga0209436_100337 | 3300025208 | Bacteria | 21289 |
| 194 | Ga0209436_101644 | 3300025208 | Bacteria | 7466 |
| 195 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 196 | Ga0207425_1000048 | 3300025245 | Bacteria | 188748 |
| 197 | Ga0207425_1000484 | 3300025245 | Bacteria | 25043 |
| 198 | Ga0207425_1048512 | 3300025245 | Bacteria | 783 |
| 199 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 200 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 201 | Ga0209129_1002463 | 3300025258 | Bacteria | 9059 |
| 202 | Ga0209129_1023468 | 3300025258 | Bacteria | 1098 |
| 203 | Ga0209565_1000434 | 3300025263 | Bacteria | 33659 |
| 204 | Ga0209565_1001392 | 3300025263 | Bacteria | 10813 |
| 205 | Ga0209565_1001483 | 3300025263 | Bacteria | 10250 |
| 206 | Ga0209565_1005912 | 3300025263 | Bacteria | 3503 |
| 207 | Ga0209565_1007809 | 3300025263 | Bacteria | 2846 |
| 208 | Ga0209673_1016921 | 3300025273 | Bacteria | 2707 |
| 209 | Ga0209130_1000059 | 3300025284 | Bacteria | 204772 |
| 210 | Ga0209130_1006475 | 3300025284 | Bacteria | 3795 |
| 211 | Ga0209675_1003581 | 3300025291 | Bacteria | 7309 |
| 212 | Ga0209675_1013123 | 3300025291 | Bacteria | 2617 |
| 213 | Ga0209025_1003379 | 3300025294 | Bacteria | 15255 |
| 214 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 215 | Ga0209564_1000045 | 3300025295 | Bacteria | 376549 |
| 216 | Ga0209564_1000219 | 3300025295 | Bacteria | 129725 |
| 217 | Ga0209564_1004289 | 3300025295 | Bacteria | 8838 |
| 218 | Ga0209564_1052664 | 3300025295 | Bacteria | 976 |
| 219 | Ga0209758_1000166 | 3300025297 | Bacteria | 151104 |
| 220 | Ga0209758_1000489 | 3300025297 | Bacteria | 64758 |
| 221 | Ga0209050_1000058 | 3300025298 | Bacteria | 325558 |
| 222 | Ga0209050_1000331 | 3300025298 | Bacteria | 94245 |
| 223 | Ga0209050_1000398 | 3300025298 | Bacteria | 81373 |
| 224 | Ga0209256_1000350 | 3300025299 | Bacteria | 74944 |
| 225 | Ga0209256_1001089 | 3300025299 | Bacteria | 31291 |
| 226 | Ga0209256_1003141 | 3300025299 | Bacteria | 12031 |
| 227 | Ga0207426_1004130 | 3300025302 | Bacteria | 7284 |
| 228 | Ga0209051_1069856 | 3300025303 | Bacteria | 1062 |
| 229 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 230 | Ga0209257_1002437 | 3300025304 | Bacteria | 18503 |
| 231 | Ga0207655_1005618 | 3300025728 | Bacteria | 8489 |
| 232 | Ga0207655_1010491 | 3300025728 | Bacteria | 5609 |
| 233 | Ga0207680_10137161 | 3300025903 | Bacteria | 1618 |
| 234 | Ga0207647_10673622 | 3300025904 | Unclassified | 566 |
| 235 | Ga0207645_10164371 | 3300025907 | Bacteria | 1453 |
| 236 | Ga0207645_10351074 | 3300025907 | Bacteria | 987 |
| 237 | Ga0207654_10050086 | 3300025911 | Bacteria | 2398 |
| 238 | Ga0207693_10785502 | 3300025915 | Bacteria | 734 |
| 239 | Ga0207660_10435681 | 3300025917 | Bacteria | 1059 |
| 240 | Ga0207662_10192268 | 3300025918 | Unclassified | 1317 |
| 241 | Ga0207657_10020487 | 3300025919 | Bacteria | 6247 |
| 242 | Ga0207657_10030993 | 3300025919 | Bacteria | 4848 |
| 243 | Ga0207649_10842271 | 3300025920 | Bacteria | 717 |
| 244 | Ga0207681_10210272 | 3300025923 | Bacteria | 1499 |
| 245 | Ga0207650_10845059 | 3300025925 | Unclassified | 777 |
| 246 | Ga0207659_10097576 | 3300025926 | Bacteria | 2208 |
| 247 | Ga0207690_10129957 | 3300025932 | Unclassified | 1842 |
| 248 | Ga0207706_10117139 | 3300025933 | Bacteria | 2343 |
| 249 | Ga0207706_11379736 | 3300025933 | Bacteria | 579 |
| 250 | Ga0207709_10422916 | 3300025935 | Bacteria | 1024 |
| 251 | Ga0207669_10832332 | 3300025937 | Bacteria | 767 |
| 252 | Ga0207704_10676829 | 3300025938 | Bacteria | 852 |
| 253 | Ga0207691_10033017 | 3300025940 | Bacteria | 4821 |
| 254 | Ga0207689_10898893 | 3300025942 | Bacteria | 747 |
| 255 | Ga0207679_10040567 | 3300025945 | Unclassified | 3333 |
| 256 | Ga0207679_10254290 | 3300025945 | Bacteria | 1495 |
| 257 | Ga0207667_10022603 | 3300025949 | Bacteria | 6941 |
| 258 | Ga0207667_10095750 | 3300025949 | Bacteria | 3064 |
| 259 | Ga0207667_10510595 | 3300025949 | Bacteria | 1218 |
| 260 | Ga0207668_11877242 | 3300025972 | Bacteria | 540 |
| 261 | Ga0207640_11731464 | 3300025981 | Bacteria | 564 |
| 262 | Ga0207703_12071442 | 3300026035 | Unclassified | 545 |
| 263 | Ga0207639_11131807 | 3300026041 | Bacteria | 734 |
| 264 | Ga0207678_10348720 | 3300026067 | Bacteria | 1276 |
| 265 | Ga0207708_11087243 | 3300026075 | Bacteria | 697 |
| 266 | Ga0207702_10837877 | 3300026078 | Bacteria | 910 |
| 267 | Ga0207648_10277946 | 3300026089 | Bacteria | 1497 |
| 268 | Ga0207648_11181972 | 3300026089 | Bacteria | 718 |
| 269 | Ga0207674_10478115 | 3300026116 | Bacteria | 1204 |
| 270 | Ga0207675_100560824 | 3300026118 | Bacteria | 1142 |
| 271 | Ga0207698_10472972 | 3300026142 | Bacteria | 1214 |
| 272 | Ga0209281_1007260 | 3300027111 | Bacteria | 2793 |
| 273 | Ga0209973_1020307 | 3300027252 | Bacteria | 877 |
| 274 | Ga0209998_10039954 | 3300027717 | Bacteria | 1063 |
| 275 | Ga0209974_10011054 | 3300027876 | Bacteria | 3038 |
| 276 | Ga0207428_10104140 | 3300027907 | Bacteria | 2190 |
| 277 | Ga0207428_10196071 | 3300027907 | Bacteria | 1521 |
| 278 | Ga0268265_10705529 | 3300028380 | Bacteria | 975 |
| 279 | Ga0316177_1067489 | 3300030731 | Bacteria | 729 |
| 280 | Ga0316177_1135869 | 3300030731 | Bacteria | 3119 |
| 281 | Ga0316176_1165429 | 3300030732 | Bacteria | 822 |
| 282 | Ga0316178_1030111 | 3300030735 | Bacteria | 952 |
| 283 | Ga0316180_1173247 | 3300030736 | Bacteria | 1875 |
| 284 | Ga0316181_1155464 | 3300030744 | Bacteria | 8057 |
| 285 | Ga0316182_1024771 | 3300030745 | Bacteria | 864 |
| 286 | Ga0316182_1341137 | 3300030745 | Bacteria | 801 |
| 287 | Ga0316182_1353000 | 3300030745 | Bacteria | 2076 |
| 288 | Ga0307513_10311570 | 3300031456 | Bacteria | 1336 |
| 289 | Ga0307408_100000024 | 3300031548 | Bacteria | 279725 |
| 290 | Ga0307408_100000786 | 3300031548 | Bacteria | 25524 |
| 291 | Ga0307408_100009316 | 3300031548 | Bacteria | 6473 |
| 292 | Ga0307408_100013052 | 3300031548 | Bacteria | 5512 |
| 293 | Ga0307408_100098769 | 3300031548 | Bacteria | 2220 |
| 294 | Ga0307405_10105091 | 3300031731 | Bacteria | 1901 |
| 295 | Ga0307405_10255410 | 3300031731 | Bacteria | 1306 |
| 296 | Ga0307413_10000786 | 3300031824 | Bacteria | 11016 |
| 297 | Ga0307413_10262491 | 3300031824 | Bacteria | 1288 |
| 298 | Ga0307410_10024269 | 3300031852 | Bacteria | 3786 |
| 299 | Ga0307407_10139205 | 3300031903 | Bacteria | 1564 |
| 300 | Ga0307412_10132058 | 3300031911 | Bacteria | 1815 |
| 301 | Ga0307412_10142178 | 3300031911 | Bacteria | 1759 |
| 302 | Ga0307412_10323070 | 3300031911 | Bacteria | 1229 |
| 303 | Ga0307409_100001420 | 3300031995 | Bacteria | 11744 |
| 304 | Ga0307416_100005028 | 3300032002 | Bacteria | 8063 |
| 305 | Ga0307416_100213961 | 3300032002 | Bacteria | 1841 |
| 306 | Ga0307414_10001899 | 3300032004 | Bacteria | 10807 |
| 307 | Ga0307414_11478608 | 3300032004 | Bacteria | 632 |
| 308 | Ga0307414_11832630 | 3300032004 | Bacteria | 566 |
| 309 | Ga0307411_10043757 | 3300032005 | Bacteria | 2867 |
| 310 | Ga0307411_10074236 | 3300032005 | Bacteria | 2317 |
| 311 | Ga0307415_100016768 | 3300032126 | Bacteria | 4376 |
| 312 | Ga0307415_100469458 | 3300032126 | Bacteria | 1093 |
| 313 | Ga0373926_0062845 | 3300035083 | Bacteria | 1356 |
| 314 | Ga0373929_0062691 | 3300035085 | Bacteria | 874 |
| 315 | Ga0373932_0015782 | 3300035112 | Bacteria | 1920 |
| 316 | Ga0373943_0176766 | 3300035170 | Bacteria | 1171 |
| 317 | Ga0373931_0389526 | 3300035691 | Bacteria | 880 |
| 318 | Ga0373937_0207565 | 3300036401 | Bacteria | 1842 |
| 319 | Ga0373925_0340038 | 3300037068 | Bacteria | 1217 |
| 320 | Ga0395899_0042641 | 3300037312 | Bacteria | 3386 |
| 321 | Ga0395899_0557547 | 3300037312 | Bacteria | 735 |
| 322 | Ga0395899_0626258 | 3300037312 | Bacteria | 682 |
| 323 | Ga0395900_0000343 | 3300037418 | Bacteria | 68342 |
| 324 | Ga0395900_0014151 | 3300037418 | Bacteria | 8147 |
| 325 | Ga0395900_0028034 | 3300037418 | Bacteria | 5766 |
| 326 | Ga0395900_0072494 | 3300037418 | Bacteria | 3540 |
| 327 | Ga0395900_0131889 | 3300037418 | Bacteria | 2560 |
| 328 | Ga0395898_0050228 | 3300037466 | Bacteria | 4082 |
| 329 | Ga0395898_0111616 | 3300037466 | Bacteria | 2620 |
| 330 | Ga0395905_0011743 | 3300037471 | Bacteria | 8455 |
| 331 | Ga0395905_0034540 | 3300037471 | Bacteria | 4748 |
| 332 | Ga0395905_0899679 | 3300037471 | Bacteria | 788 |
| 333 | Ga0395901_0000033 | 3300038443 | Bacteria | 232357 |
| 334 | Ga0395901_0024025 | 3300038443 | Bacteria | 6251 |
| 335 | Ga0395901_1235360 | 3300038443 | Bacteria | 711 |
| 336 | Ga0395901_1380681 | 3300038443 | Bacteria | 663 |
| 337 | Ga0395901_1826976 | 3300038443 | Bacteria | 556 |
| 338 | Ga0436361_0329036 | 3300039447 | Bacteria | 870 |
| 339 | Ga0436361_0715686 | 3300039447 | Bacteria | 8398 |
| 340 | Ga0439465_0196117 | 3300041413 | Bacteria | 734 |
| 341 | Ga0451843_1127621 | 3300041509 | Bacteria | 726 |
| 342 | Ga0439433_0021264 | 3300041999 | Unclassified | 1451 |
| 343 | Ga0439448_0001668 | 3300042005 | Bacteria | 5823 |
| 344 | Ga0439448_0017001 | 3300042005 | Bacteria | 2218 |
| 345 | Ga0439448_0068228 | 3300042005 | Bacteria | 1182 |
| 346 | Ga0439450_005262 | 3300042008 | Bacteria | 2267 |
| 347 | Ga0439450_039712 | 3300042008 | Bacteria | 1088 |
| 348 | Ga0439454_075217 | 3300042011 | Bacteria | 605 |
| 349 | Ga0439455_0004502 | 3300042012 | Bacteria | 2764 |
| 350 | Ga0439455_0014952 | 3300042012 | Bacteria | 1779 |
| 351 | Ga0439455_0160672 | 3300042012 | Bacteria | 642 |
| 352 | Ga0450911_015461 | 3300042115 | Bacteria | 1011 |
| 353 | Ga0450919_022120 | 3300042121 | Bacteria | 718 |
| 354 | Ga0439458_0141351 | 3300042157 | Bacteria | 641 |
| 355 | Ga0439434_0042555 | 3300042435 | Bacteria | 1396 |
| 356 | Ga0439464_0055119 | 3300042439 | Bacteria | 1156 |
| 357 | Ga0439460_0137148 | 3300042461 | Bacteria | 809 |
| 358 | Ga0450918_116887 | 3300042531 | Bacteria | 531 |
| 359 | Ga0451577_0971137 | 3300042876 | Bacteria | 763 |
| 360 | Ga0466969_0115966 | 3300044656 | Bacteria | 1250 |
| 361 | Ga0466981_0471458 | 3300044669 | Bacteria | 717 |
| 362 | Ga0466982_0155755 | 3300044672 | Bacteria | 1395 |
| 363 | Ga0466965_0006865 | 3300044683 | Bacteria | 5202 |
| 364 | Ga0466965_0037658 | 3300044683 | Bacteria | 2375 |
| 365 | Ga0466966_0048702 | 3300044684 | Bacteria | 2699 |
| 366 | Ga0466961_0036223 | 3300044693 | Bacteria | 3167 |
| 367 | Ga0466963_0337507 | 3300044694 | Bacteria | 1061 |
| 368 | Ga0466964_0025958 | 3300044706 | Bacteria | 2290 |
| 369 | Ga0466964_0050572 | 3300044706 | Bacteria | 1704 |
| 370 | Ga0466971_0144368 | 3300044719 | Bacteria | 1109 |
| 371 | Ga0466970_0306533 | 3300044765 | Bacteria | 896 |
| 372 | Ga0466957_0005776 | 3300044842 | Bacteria | 6953 |
| 373 | Ga0466957_0035160 | 3300044842 | Bacteria | 3007 |
| 374 | Ga0466959_0037085 | 3300045049 | Bacteria | 3601 |
| 375 | Ga0451576_0442275 | 3300045051 | Unclassified | 1364 |
| 376 | Ga0451576_0892854 | 3300045051 | Bacteria | 932 |
| 377 | Ga0466958_0087841 | 3300045836 | Bacteria | 1920 |
| 378 | Ga0466958_0187611 | 3300045836 | Bacteria | 1313 |
| 379 | Ga0466958_0281819 | 3300045836 | Bacteria | 1065 |
| 380 | Ga0495617_000136 | 3300046452 | Bacteria | 48660 |
| 381 | Ga0495617_001313 | 3300046452 | Bacteria | 11067 |
| 382 | Ga0495617_002222 | 3300046452 | Bacteria | 7895 |
| 383 | Ga0495617_071844 | 3300046452 | Bacteria | 1138 |
| 384 | Ga0495627_078961 | 3300046453 | Bacteria | 955 |
| 385 | Ga0495603_0005092 | 3300046455 | Bacteria | 7853 |
| 386 | Ga0495603_0025584 | 3300046455 | Bacteria | 3569 |
| 387 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 388 | Ga0495590_0012377 | 3300046457 | Bacteria | 3166 |
| 389 | Ga0495590_0024568 | 3300046457 | Bacteria | 2123 |
| 390 | Ga0495590_0064625 | 3300046457 | Bacteria | 1280 |
| 391 | Ga0495629_0001542 | 3300046459 | Bacteria | 18094 |
| 392 | Ga0495629_0021310 | 3300046459 | Bacteria | 4624 |
| 393 | Ga0495629_0152798 | 3300046459 | Bacteria | 1604 |
| 394 | Ga0495638_0000091 | 3300046460 | Bacteria | 146548 |
| 395 | Ga0495638_0032890 | 3300046460 | Bacteria | 3319 |
| 396 | Ga0495638_0048943 | 3300046460 | Bacteria | 2644 |
| 397 | Ga0495638_0066703 | 3300046460 | Bacteria | 2211 |
| 398 | Ga0495638_0074696 | 3300046460 | Bacteria | 2067 |
| 399 | Ga0495653_0000013 | 3300046463 | Bacteria | 250453 |
| 400 | Ga0495653_0038844 | 3300046463 | Bacteria | 3734 |
| 401 | Ga0495653_0059962 | 3300046463 | Bacteria | 2884 |
| 402 | Ga0495650_0000097 | 3300046471 | Bacteria | 216051 |
| 403 | Ga0495650_0001058 | 3300046471 | Bacteria | 30529 |
| 404 | Ga0495650_0003792 | 3300046471 | Bacteria | 10770 |
| 405 | Ga0495650_0005750 | 3300046471 | Bacteria | 7919 |
| 406 | Ga0495580_0043058 | 3300046472 | Bacteria | 3214 |
| 407 | Ga0495580_0600533 | 3300046472 | Bacteria | 727 |
| 408 | Ga0495582_0012022 | 3300046473 | Bacteria | 4769 |
| 409 | Ga0495582_0052614 | 3300046473 | Bacteria | 2245 |
| 410 | Ga0495605_0000237 | 3300046474 | Bacteria | 66607 |
| 411 | Ga0495605_0000251 | 3300046474 | Bacteria | 63553 |
| 412 | Ga0495605_0004340 | 3300046474 | Bacteria | 8343 |
| 413 | Ga0495605_0046234 | 3300046474 | Bacteria | 2141 |
| 414 | Ga0495605_0162545 | 3300046474 | Bacteria | 990 |
| 415 | Ga0495584_0000021 | 3300046491 | Bacteria | 130377 |
| 416 | Ga0495584_0004887 | 3300046491 | Bacteria | 7160 |
| 417 | Ga0495584_0006086 | 3300046491 | Bacteria | 6351 |
| 418 | Ga0495584_0008826 | 3300046491 | Bacteria | 5212 |
| 419 | Ga0495584_0018503 | 3300046491 | Bacteria | 3541 |
| 420 | Ga0495584_0059005 | 3300046491 | Bacteria | 1930 |
| 421 | Ga0495584_0086487 | 3300046491 | Bacteria | 1579 |
| 422 | Ga0495584_0092989 | 3300046491 | Bacteria | 1521 |
| 423 | Ga0495584_0184660 | 3300046491 | Bacteria | 1059 |
| 424 | Ga0495584_0222473 | 3300046491 | Bacteria | 959 |
| 425 | Ga0495584_0329487 | 3300046491 | Bacteria | 775 |
| 426 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 427 | Ga0495585_0001467 | 3300046492 | Bacteria | 18447 |
| 428 | Ga0495585_0002213 | 3300046492 | Bacteria | 14101 |
| 429 | Ga0495585_0012965 | 3300046492 | Bacteria | 4897 |
| 430 | Ga0495585_0020200 | 3300046492 | Bacteria | 3832 |
| 431 | Ga0495585_0034439 | 3300046492 | Bacteria | 2862 |
| 432 | Ga0495585_0043835 | 3300046492 | Bacteria | 2500 |
| 433 | Ga0495585_0215273 | 3300046492 | Bacteria | 971 |
| 434 | Ga0495585_0543016 | 3300046492 | Bacteria | 549 |
| 435 | Ga0495585_0592766 | 3300046492 | Bacteria | 521 |
| 436 | Ga0495594_0001115 | 3300046499 | Bacteria | 14012 |
| 437 | Ga0495594_0001246 | 3300046499 | Bacteria | 13339 |
| 438 | Ga0495594_0008633 | 3300046499 | Bacteria | 5249 |
| 439 | Ga0495594_0036691 | 3300046499 | Bacteria | 2673 |
| 440 | Ga0495594_0051830 | 3300046499 | Bacteria | 2258 |
| 441 | Ga0495594_0063605 | 3300046499 | Bacteria | 2044 |
| 442 | Ga0495594_0153478 | 3300046499 | Bacteria | 1307 |
| 443 | Ga0495596_0001726 | 3300046500 | Bacteria | 12278 |
| 444 | Ga0495596_0004831 | 3300046500 | Bacteria | 6476 |
| 445 | Ga0495596_0010803 | 3300046500 | Bacteria | 3962 |
| 446 | Ga0495596_0015531 | 3300046500 | Bacteria | 3186 |
| 447 | Ga0495596_0031926 | 3300046500 | Bacteria | 2101 |
| 448 | Ga0495596_0169181 | 3300046500 | Bacteria | 849 |
| 449 | Ga0495607_0000552 | 3300046501 | Bacteria | 36630 |
| 450 | Ga0495607_0001875 | 3300046501 | Bacteria | 17831 |
| 451 | Ga0495607_0002140 | 3300046501 | Bacteria | 16475 |
| 452 | Ga0495607_0005228 | 3300046501 | Bacteria | 9340 |
| 453 | Ga0495607_0005541 | 3300046501 | Bacteria | 9007 |
| 454 | Ga0495607_0016045 | 3300046501 | Bacteria | 4840 |
| 455 | Ga0495607_0021061 | 3300046501 | Bacteria | 4106 |
| 456 | Ga0495607_0422569 | 3300046501 | Bacteria | 603 |
| 457 | Ga0495607_0502671 | 3300046501 | Bacteria | 537 |
| 458 | Ga0495583_0000060 | 3300046506 | Bacteria | 199091 |
| 459 | Ga0495583_0000155 | 3300046506 | Bacteria | 114870 |
| 460 | Ga0495583_0000197 | 3300046506 | Bacteria | 101236 |
| 461 | Ga0495583_0001514 | 3300046506 | Bacteria | 23104 |
| 462 | Ga0495583_0001589 | 3300046506 | Bacteria | 22354 |
| 463 | Ga0495583_0002755 | 3300046506 | Bacteria | 14519 |
| 464 | Ga0495583_0028812 | 3300046506 | Bacteria | 2725 |
| 465 | Ga0495583_0121994 | 3300046506 | Bacteria | 1096 |
| 466 | Ga0495606_0000068 | 3300046507 | Bacteria | 179653 |
| 467 | Ga0495606_0000141 | 3300046507 | Bacteria | 123586 |
| 468 | Ga0495606_0000266 | 3300046507 | Bacteria | 92444 |
| 469 | Ga0495606_0000371 | 3300046507 | Bacteria | 76806 |
| 470 | Ga0495606_0000696 | 3300046507 | Bacteria | 52177 |
| 471 | Ga0495606_0001419 | 3300046507 | Bacteria | 32193 |
| 472 | Ga0495606_0002432 | 3300046507 | Bacteria | 21688 |
| 473 | Ga0495606_0004896 | 3300046507 | Bacteria | 13112 |
| 474 | Ga0495606_0006056 | 3300046507 | Bacteria | 11309 |
| 475 | Ga0495606_0010295 | 3300046507 | Bacteria | 7781 |
| 476 | Ga0495606_0025398 | 3300046507 | Bacteria | 4244 |
| 477 | Ga0495606_0365622 | 3300046507 | Bacteria | 761 |
| 478 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 479 | Ga0495610_0002073 | 3300046512 | Bacteria | 17105 |
| 480 | Ga0495610_0003707 | 3300046512 | Bacteria | 11708 |
| 481 | Ga0495610_0004426 | 3300046512 | Bacteria | 10394 |
| 482 | Ga0495610_0008134 | 3300046512 | Bacteria | 6849 |
| 483 | Ga0495610_0011693 | 3300046512 | Bacteria | 5339 |
| 484 | Ga0495610_0020097 | 3300046512 | Bacteria | 3715 |
| 485 | Ga0495616_0001023 | 3300046513 | Bacteria | 20012 |
| 486 | Ga0495616_0007652 | 3300046513 | Bacteria | 6462 |
| 487 | Ga0495616_0008642 | 3300046513 | Bacteria | 6012 |
| 488 | Ga0495616_0030110 | 3300046513 | Bacteria | 2856 |
| 489 | Ga0495616_0052318 | 3300046513 | Bacteria | 2033 |
| 490 | Ga0495616_0052592 | 3300046513 | Bacteria | 2027 |
| 491 | Ga0495616_0178052 | 3300046513 | Bacteria | 946 |
| 492 | Ga0495630_0978335 | 3300046517 | Bacteria | 643 |
| 493 | Ga0495631_0000794 | 3300046518 | Bacteria | 20159 |
| 494 | Ga0495631_0002897 | 3300046518 | Bacteria | 9502 |
| 495 | Ga0495631_0029997 | 3300046518 | Bacteria | 2469 |
| 496 | Ga0495631_0040735 | 3300046518 | Bacteria | 2057 |
| 497 | Ga0495631_0112521 | 3300046518 | Bacteria | 1170 |
| 498 | Ga0495632_0001532 | 3300046519 | Bacteria | 19084 |
| 499 | Ga0495632_0005151 | 3300046519 | Bacteria | 8724 |
| 500 | Ga0495632_0063202 | 3300046519 | Bacteria | 1793 |
| 501 | Ga0495632_0123117 | 3300046519 | Bacteria | 1210 |
| 502 | Ga0495632_0204060 | 3300046519 | Bacteria | 899 |
| 503 | Ga0495637_0000087 | 3300046520 | Bacteria | 72113 |
| 504 | Ga0495637_0001405 | 3300046520 | Bacteria | 14249 |
| 505 | Ga0495637_0001439 | 3300046520 | Bacteria | 14028 |
| 506 | Ga0495637_0147508 | 3300046520 | Bacteria | 889 |
| 507 | Ga0495637_0220673 | 3300046520 | Bacteria | 690 |
| 508 | Ga0495643_0000179 | 3300046522 | Bacteria | 100406 |
| 509 | Ga0495643_0000287 | 3300046522 | Bacteria | 72080 |
| 510 | Ga0495643_0000411 | 3300046522 | Bacteria | 56229 |
| 511 | Ga0495643_0002022 | 3300046522 | Bacteria | 16910 |
| 512 | Ga0495643_0006330 | 3300046522 | Bacteria | 7823 |
| 513 | Ga0495643_0007639 | 3300046522 | Bacteria | 6942 |
| 514 | Ga0495643_0022214 | 3300046522 | Bacteria | 3623 |
| 515 | Ga0495643_0118899 | 3300046522 | Bacteria | 1337 |
| 516 | Ga0495643_0179073 | 3300046522 | Bacteria | 1031 |
| 517 | Ga0495643_0331733 | 3300046522 | Bacteria | 685 |
| 518 | Ga0495644_0001232 | 3300046523 | Bacteria | 10476 |
| 519 | Ga0495644_0003276 | 3300046523 | Bacteria | 6403 |
| 520 | Ga0495644_0015254 | 3300046523 | Bacteria | 2942 |
| 521 | Ga0495644_0039826 | 3300046523 | Bacteria | 1771 |
| 522 | Ga0495648_0000058 | 3300046524 | Bacteria | 156717 |
| 523 | Ga0495648_0000076 | 3300046524 | Bacteria | 129413 |
| 524 | Ga0495648_0003974 | 3300046524 | Bacteria | 12794 |
| 525 | Ga0495648_0040255 | 3300046524 | Bacteria | 2965 |
| 526 | Ga0495648_0050158 | 3300046524 | Bacteria | 2553 |
| 527 | Ga0495648_0068927 | 3300046524 | Bacteria | 2061 |
| 528 | Ga0495666_0002872 | 3300046526 | Bacteria | 8631 |
| 529 | Ga0495666_0032240 | 3300046526 | Bacteria | 2565 |
| 530 | Ga0495666_0089262 | 3300046526 | Bacteria | 1455 |
| 531 | Ga0495666_0092058 | 3300046526 | Bacteria | 1430 |
| 532 | Ga0495642_0003894 | 3300046528 | Bacteria | 5850 |
| 533 | Ga0495642_0009867 | 3300046528 | Bacteria | 3658 |
| 534 | Ga0495642_0012001 | 3300046528 | Bacteria | 3338 |
| 535 | Ga0495642_0043363 | 3300046528 | Bacteria | 1834 |
| 536 | Ga0495642_0059845 | 3300046528 | Bacteria | 1579 |
| 537 | Ga0495654_0000074 | 3300046530 | Bacteria | 114325 |
| 538 | Ga0495654_0025930 | 3300046530 | Bacteria | 3018 |
| 539 | Ga0495654_0069756 | 3300046530 | Bacteria | 1668 |
| 540 | Ga0495654_0116543 | 3300046530 | Bacteria | 1213 |
| 541 | Ga0495654_0285936 | 3300046530 | Bacteria | 677 |
| 542 | Ga0495665_0045193 | 3300046531 | Bacteria | 2339 |
| 543 | Ga0495586_0016407 | 3300046535 | Bacteria | 3939 |
| 544 | Ga0495586_0027395 | 3300046535 | Bacteria | 3050 |
| 545 | Ga0495586_0028846 | 3300046535 | Bacteria | 2969 |
| 546 | Ga0495586_0226760 | 3300046535 | Bacteria | 1062 |
| 547 | Ga0495587_0057286 | 3300046536 | Bacteria | 2291 |
| 548 | Ga0495587_0074097 | 3300046536 | Bacteria | 1977 |
| 549 | Ga0495598_0049206 | 3300046537 | Bacteria | 1263 |
| 550 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 551 | Ga0495609_0005728 | 3300046538 | Bacteria | 6465 |
| 552 | Ga0495609_0007261 | 3300046538 | Bacteria | 5549 |
| 553 | Ga0495609_0045721 | 3300046538 | Bacteria | 1961 |
| 554 | Ga0495609_0093367 | 3300046538 | Bacteria | 1307 |
| 555 | Ga0495609_0187920 | 3300046538 | Bacteria | 867 |
| 556 | Ga0495597_0000209 | 3300046542 | Bacteria | 53295 |
| 557 | Ga0495597_0000242 | 3300046542 | Bacteria | 49561 |
| 558 | Ga0495597_0000808 | 3300046542 | Bacteria | 24718 |
| 559 | Ga0495597_0010399 | 3300046542 | Bacteria | 4550 |
| 560 | Ga0495597_0044333 | 3300046542 | Bacteria | 1978 |
| 561 | Ga0495597_0049435 | 3300046542 | Bacteria | 1858 |
| 562 | Ga0495597_0081444 | 3300046542 | Bacteria | 1384 |
| 563 | Ga0495597_0192952 | 3300046542 | Bacteria | 818 |
| 564 | Ga0495597_0310778 | 3300046542 | Bacteria | 610 |
| 565 | Ga0495622_0000054 | 3300046557 | Bacteria | 102782 |
| 566 | Ga0495622_0006805 | 3300046557 | Bacteria | 5304 |
| 567 | Ga0495622_0007685 | 3300046557 | Bacteria | 5009 |
| 568 | Ga0495622_0120436 | 3300046557 | Bacteria | 1198 |
| 569 | Ga0495622_0120835 | 3300046557 | Bacteria | 1196 |
| 570 | Ga0495633_0000119 | 3300046558 | Bacteria | 106455 |
| 571 | Ga0495633_0000249 | 3300046558 | Bacteria | 64232 |
| 572 | Ga0495633_0002342 | 3300046558 | Bacteria | 13463 |
| 573 | Ga0495633_0004458 | 3300046558 | Bacteria | 8900 |
| 574 | Ga0495633_0013226 | 3300046558 | Bacteria | 4357 |
| 575 | Ga0495633_0035907 | 3300046558 | Bacteria | 2377 |
| 576 | Ga0495633_0118990 | 3300046558 | Bacteria | 1223 |
| 577 | Ga0495633_0125818 | 3300046558 | Bacteria | 1186 |
| 578 | Ga0495633_0311792 | 3300046558 | Bacteria | 714 |
| 579 | Ga0495633_0429892 | 3300046558 | Bacteria | 597 |
| 580 | Ga0495656_0048727 | 3300046615 | Bacteria | 1801 |
| 581 | Ga0495656_0055968 | 3300046615 | Bacteria | 1703 |
| 582 | Ga0495656_0144795 | 3300046615 | Bacteria | 1143 |
| 583 | Ga0495656_0163172 | 3300046615 | Bacteria | 1084 |
| 584 | Ga0495656_0173899 | 3300046615 | Bacteria | 1055 |
| 585 | Ga0495656_0698157 | 3300046615 | Bacteria | 546 |
| 586 | Ga0495668_0000466 | 3300046616 | Bacteria | 51377 |
| 587 | Ga0495668_0000493 | 3300046616 | Bacteria | 49476 |
| 588 | Ga0495668_0000935 | 3300046616 | Bacteria | 32582 |
| 589 | Ga0495668_0018090 | 3300046616 | Bacteria | 4078 |
| 590 | Ga0495668_0039812 | 3300046616 | Bacteria | 2623 |
| 591 | Ga0495668_0123190 | 3300046616 | Bacteria | 1418 |
| 592 | Ga0495668_0182577 | 3300046616 | Bacteria | 1149 |
| 593 | Ga0495668_0525150 | 3300046616 | Bacteria | 653 |
| 594 | Ga0495634_0062148 | 3300046642 | Bacteria | 2481 |
| 595 | Ga0495611_0000546 | 3300046648 | Bacteria | 22058 |
| 596 | Ga0495611_0013556 | 3300046648 | Bacteria | 3472 |
| 597 | Ga0495611_0013763 | 3300046648 | Bacteria | 3448 |
| 598 | Ga0495611_0022007 | 3300046648 | Bacteria | 2756 |
| 599 | Ga0495611_0030470 | 3300046648 | Bacteria | 2372 |
| 600 | Ga0495611_0035363 | 3300046648 | Bacteria | 2213 |
| 601 | Ga0495611_0068446 | 3300046648 | Bacteria | 1620 |
| 602 | Ga0495625_0000132 | 3300046660 | Bacteria | 115728 |
| 603 | Ga0495625_0000139 | 3300046660 | Bacteria | 112271 |
| 604 | Ga0495625_0002129 | 3300046660 | Bacteria | 22079 |
| 605 | Ga0495625_0026955 | 3300046660 | Bacteria | 4332 |
| 606 | Ga0495625_0042210 | 3300046660 | Bacteria | 3316 |
| 607 | Ga0495625_0145443 | 3300046660 | Bacteria | 1596 |
| 608 | Ga0495625_0873505 | 3300046660 | Bacteria | 517 |
| 609 | Ga0495635_0024257 | 3300046663 | Bacteria | 4228 |
| 610 | Ga0495659_0000054 | 3300046664 | Bacteria | 51199 |
| 611 | Ga0495659_0012250 | 3300046664 | Bacteria | 2775 |
| 612 | Ga0495659_0209215 | 3300046664 | Bacteria | 802 |
| 613 | Ga0495661_0000094 | 3300046665 | Bacteria | 109394 |
| 614 | Ga0495661_0000638 | 3300046665 | Bacteria | 35563 |
| 615 | Ga0495661_0003699 | 3300046665 | Bacteria | 11235 |
| 616 | Ga0495661_0009088 | 3300046665 | Bacteria | 6832 |
| 617 | Ga0495661_0010487 | 3300046665 | Bacteria | 6321 |
| 618 | Ga0495661_0085948 | 3300046665 | Bacteria | 1801 |
| 619 | Ga0495661_0091910 | 3300046665 | Bacteria | 1725 |
| 620 | Ga0495661_0150872 | 3300046665 | Bacteria | 1255 |
| 621 | Ga0495661_0232634 | 3300046665 | Bacteria | 949 |
| 622 | Ga0495661_0310725 | 3300046665 | Bacteria | 786 |
| 623 | Ga0495588_0000110 | 3300046674 | Bacteria | 142825 |
| 624 | Ga0495588_0008482 | 3300046674 | Bacteria | 4720 |
| 625 | Ga0495588_0013683 | 3300046674 | Bacteria | 3868 |
| 626 | Ga0495588_0077333 | 3300046674 | Bacteria | 1735 |
| 627 | Ga0495588_0207780 | 3300046674 | Bacteria | 1034 |
| 628 | Ga0495658_1057741 | 3300046683 | Bacteria | 518 |
| 629 | Ga0495669_0000041 | 3300046684 | Bacteria | 88966 |
| 630 | Ga0495669_0003144 | 3300046684 | Bacteria | 6798 |
| 631 | Ga0495669_0042156 | 3300046684 | Bacteria | 2028 |
| 632 | Ga0495670_0001500 | 3300046691 | Bacteria | 11387 |
| 633 | Ga0495670_0014196 | 3300046691 | Bacteria | 3918 |
| 634 | Ga0495670_0071938 | 3300046691 | Bacteria | 1751 |
| 635 | Ga0495670_0081519 | 3300046691 | Bacteria | 1649 |
| 636 | Ga0495670_0183320 | 3300046691 | Bacteria | 1106 |
| 637 | Ga0495670_0200145 | 3300046691 | Bacteria | 1057 |
| 638 | Ga0495670_0227746 | 3300046691 | Bacteria | 991 |
| 639 | Ga0495670_0365424 | 3300046691 | Bacteria | 777 |
| 640 | Ga0495670_0398366 | 3300046691 | Bacteria | 743 |
| 641 | Ga0495670_0472284 | 3300046691 | Bacteria | 680 |
| 642 | Ga0495671_0000314 | 3300046692 | Bacteria | 41125 |
| 643 | Ga0495671_0000582 | 3300046692 | Bacteria | 27065 |
| 644 | Ga0495671_0000796 | 3300046692 | Bacteria | 22620 |
| 645 | Ga0495671_0025498 | 3300046692 | Bacteria | 3072 |
| 646 | Ga0495671_0271366 | 3300046692 | Bacteria | 818 |
| 647 | Ga0495671_0567247 | 3300046692 | Bacteria | 540 |
| 648 | Ga0495649_0000049 | 3300046694 | Bacteria | 113865 |
| 649 | Ga0495649_0002757 | 3300046694 | Bacteria | 12229 |
| 650 | Ga0495649_0006737 | 3300046694 | Bacteria | 7118 |
| 651 | Ga0495649_0016666 | 3300046694 | Bacteria | 4164 |
| 652 | Ga0495649_0030801 | 3300046694 | Bacteria | 2961 |
| 653 | Ga0495649_0148941 | 3300046694 | Bacteria | 1230 |
| 654 | Ga0495649_0210152 | 3300046694 | Bacteria | 1008 |
| 655 | Ga0495649_0243215 | 3300046694 | Bacteria | 926 |
| 656 | Ga0495649_0337002 | 3300046694 | Bacteria | 763 |
| 657 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 658 | Ga0495589_0005107 | 3300046794 | Bacteria | 6944 |
| 659 | Ga0495589_0040875 | 3300046794 | Bacteria | 2314 |
| 660 | Ga0495589_0045988 | 3300046794 | Bacteria | 2167 |
| 661 | Ga0495589_0070221 | 3300046794 | Bacteria | 1712 |
| 662 | Ga0495589_0091635 | 3300046794 | Bacteria | 1476 |
| 663 | Ga0495600_0730771 | 3300046809 | Bacteria | 594 |
| 664 | Ga0495660_0000056 | 3300046810 | Bacteria | 134518 |
| 665 | Ga0495660_0000245 | 3300046810 | Bacteria | 53011 |
| 666 | Ga0495660_0005974 | 3300046810 | Bacteria | 7246 |
| 667 | Ga0495660_0011872 | 3300046810 | Bacteria | 5054 |
| 668 | Ga0495660_0036706 | 3300046810 | Bacteria | 2732 |
| 669 | Ga0495581_0007820 | 3300047315 | Bacteria | 6191 |
| 670 | Ga0495581_0077960 | 3300047315 | Bacteria | 1917 |
| 671 | Ga0495581_0090888 | 3300047315 | Bacteria | 1771 |
| 672 | Ga0495581_0422355 | 3300047315 | Bacteria | 777 |
| 673 | Ga0495604_0020138 | 3300047317 | Bacteria | 5331 |
| 674 | Ga0495604_0128224 | 3300047317 | Bacteria | 1826 |
| 675 | Ga0495636_0000998 | 3300047318 | Bacteria | 10579 |
| 676 | Ga0495636_0003923 | 3300047318 | Bacteria | 5806 |
| 677 | Ga0495636_0416534 | 3300047318 | Bacteria | 642 |
| 678 | Ga0495674_0015849 | 3300047319 | Bacteria | 7036 |
| 679 | Ga0495672_0000896 | 3300047320 | Bacteria | 31234 |
| 680 | Ga0495672_0005588 | 3300047320 | Bacteria | 9932 |
| 681 | Ga0495672_0006771 | 3300047320 | Bacteria | 8783 |
| 682 | Ga0495672_0034309 | 3300047320 | Bacteria | 3137 |
| 683 | Ga0495672_0064342 | 3300047320 | Bacteria | 2100 |
| 684 | Ga0495672_0374936 | 3300047320 | Bacteria | 655 |
| 685 | Ga0495676_0065088 | 3300047321 | Bacteria | 2831 |
| 686 | Ga0495680_0010535 | 3300047322 | Bacteria | 8252 |
| 687 | Ga0495680_0270071 | 3300047322 | Bacteria | 1201 |
| 688 | Ga0495683_0007061 | 3300047323 | Bacteria | 6094 |
| 689 | Ga0495683_0007206 | 3300047323 | Bacteria | 6036 |
| 690 | Ga0495683_0012690 | 3300047323 | Bacteria | 4423 |
| 691 | Ga0495683_0028550 | 3300047323 | Bacteria | 2851 |
| 692 | Ga0495683_0035195 | 3300047323 | Bacteria | 2546 |
| 693 | Ga0495683_0078302 | 3300047323 | Bacteria | 1615 |
| 694 | Ga0495683_0376248 | 3300047323 | Bacteria | 595 |
| 695 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 696 | Ga0495687_000296 | 3300047443 | Bacteria | 65626 |
| 697 | Ga0495687_001460 | 3300047443 | Bacteria | 21684 |
| 698 | Ga0495687_001591 | 3300047443 | Bacteria | 20510 |
| 699 | Ga0495687_172501 | 3300047443 | Bacteria | 715 |
| 700 | Ga0495675_0014947 | 3300047444 | Bacteria | 4908 |
| 701 | Ga0495675_0033154 | 3300047444 | Bacteria | 3296 |
| 702 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 703 | Ga0495677_0000667 | 3300047445 | Bacteria | 13868 |
| 704 | Ga0495677_0001645 | 3300047445 | Bacteria | 8980 |
| 705 | Ga0495677_0002047 | 3300047445 | Bacteria | 8040 |
| 706 | Ga0495677_0003240 | 3300047445 | Bacteria | 6349 |
| 707 | Ga0495677_0017435 | 3300047445 | Bacteria | 2603 |
| 708 | Ga0495677_0020023 | 3300047445 | Bacteria | 2425 |
| 709 | Ga0495677_0029222 | 3300047445 | Bacteria | 2004 |
| 710 | Ga0495677_0035926 | 3300047445 | Bacteria | 1809 |
| 711 | Ga0495677_0100181 | 3300047445 | Bacteria | 1096 |
| 712 | Ga0495677_0139571 | 3300047445 | Bacteria | 930 |
| 713 | Ga0495679_015954 | 3300047446 | Bacteria | 2729 |
| 714 | Ga0495679_037879 | 3300047446 | Bacteria | 1514 |
| 715 | Ga0495679_055495 | 3300047446 | Bacteria | 1176 |
| 716 | Ga0495685_000076 | 3300047447 | Bacteria | 37313 |
| 717 | Ga0495685_009255 | 3300047447 | Bacteria | 3285 |
| 718 | Ga0495685_058589 | 3300047447 | Bacteria | 1300 |
| 719 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 720 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 721 | Ga0495673_0035372 | 3300047469 | Bacteria | 2302 |
| 722 | Ga0495681_0004532 | 3300047470 | Bacteria | 9472 |
| 723 | Ga0495681_0005786 | 3300047470 | Bacteria | 8215 |
| 724 | Ga0495681_0018157 | 3300047470 | Bacteria | 3883 |
| 725 | Ga0495681_0052139 | 3300047470 | Bacteria | 1921 |
| 726 | Ga0495681_0071547 | 3300047470 | Bacteria | 1570 |
| 727 | Ga0495681_0179624 | 3300047470 | Bacteria | 870 |
| 728 | Ga0495686_0001364 | 3300047472 | Bacteria | 27253 |
| 729 | Ga0495686_0007184 | 3300047472 | Bacteria | 8385 |
| 730 | Ga0495686_0040141 | 3300047472 | Bacteria | 2987 |
| 731 | Ga0495686_0150041 | 3300047472 | Bacteria | 1369 |
| 732 | Ga0495686_0735421 | 3300047472 | Bacteria | 501 |
| 733 | Ga0495593_0011331 | 3300047673 | Bacteria | 5122 |
| 734 | Ga0495593_0600215 | 3300047673 | Bacteria | 553 |
| 735 | Ga0495602_0042409 | 3300048088 | Bacteria | 4146 |
| 736 | Ga0495614_0002399 | 3300048089 | Bacteria | 8327 |
| 737 | Ga0495614_0014899 | 3300048089 | Bacteria | 3396 |
| 738 | Ga0495614_0088806 | 3300048089 | Bacteria | 1344 |
| 739 | Ga0495626_0000103 | 3300048091 | Bacteria | 110163 |
| 740 | Ga0495626_0000494 | 3300048091 | Bacteria | 39727 |
| 741 | Ga0495626_0000711 | 3300048091 | Bacteria | 31405 |
| 742 | Ga0495626_0001658 | 3300048091 | Bacteria | 17189 |
| 743 | Ga0495626_0001661 | 3300048091 | Bacteria | 17166 |
| 744 | Ga0495626_0011706 | 3300048091 | Bacteria | 4628 |
| 745 | Ga0495626_0057416 | 3300048091 | Bacteria | 1780 |
| 746 | Ga0495626_0098694 | 3300048091 | Bacteria | 1275 |
| 747 | Ga0495626_0154940 | 3300048091 | Bacteria | 963 |
| 748 | Ga0495626_0210110 | 3300048091 | Bacteria | 794 |
| 749 | Ga0496100_0071042 | 3300048903 | Bacteria | 2323 |
| 750 | Ga0496100_1429782 | 3300048903 | Bacteria | 546 |
| 751 | Ga0496101_0119277 | 3300048904 | Bacteria | 1993 |
| 752 | Ga0496102_0314305 | 3300048905 | Bacteria | 1476 |
| 753 | Ga0496102_1081108 | 3300048905 | Bacteria | 722 |
| 754 | Ga0496103_0000631 | 3300048906 | Bacteria | 26992 |
| 755 | Ga0496103_0403362 | 3300048906 | Bacteria | 878 |
| 756 | Ga0496104_0103346 | 3300048907 | Unclassified | 2730 |
| 757 | Ga0496104_0199302 | 3300048907 | Bacteria | 1914 |
| 758 | Ga0496106_0516771 | 3300048909 | Bacteria | 959 |
| 759 | Ga0496107_0005997 | 3300048910 | Bacteria | 8332 |
| 760 | Ga0496109_0291365 | 3300048912 | Bacteria | 1539 |
| 761 | Ga0496111_0141539 | 3300048914 | Bacteria | 1782 |
| 762 | Ga0496112_0299949 | 3300048915 | Unclassified | 1552 |
| 763 | Ga0496113_0458474 | 3300048916 | Bacteria | 1024 |
| 764 | Ga0496113_0587872 | 3300048916 | Bacteria | 892 |
| 765 | Ga0496115_0253476 | 3300048918 | Bacteria | 1448 |
| 766 | Ga0496116_0077132 | 3300048919 | Bacteria | 2084 |
| 767 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 768 | Ga0496118_0000078 | 3300048921 | Bacteria | 190946 |
| 769 | Ga0496122_0028447 | 3300048925 | Bacteria | 4741 |
| 770 | Ga0496123_0001152 | 3300048926 | Bacteria | 39412 |
| 771 | Ga0496124_0041630 | 3300048927 | Bacteria | 3962 |
| 772 | Ga0496124_0065837 | 3300048927 | Bacteria | 3020 |
| 773 | Ga0496124_0066257 | 3300048927 | Bacteria | 3008 |
| 774 | Ga0496124_0066840 | 3300048927 | Bacteria | 2993 |
| 775 | Ga0496125_0003554 | 3300048928 | Bacteria | 18777 |
| 776 | Ga0501308_042493 | 3300049128 | Bacteria | 644 |
| 777 | Ga0501310_001774 | 3300049130 | Bacteria | 1993 |
| 778 | Ga0501343_021108 | 3300049132 | Bacteria | 576 |
| 779 | Ga0501307_023262 | 3300049162 | Bacteria | 820 |
| 780 | Ga0495678_000006 | 3300049459 | Bacteria | 463690 |
| 781 | Ga0495678_000104 | 3300049459 | Bacteria | 103726 |
| 782 | Ga0495678_000365 | 3300049459 | Bacteria | 46300 |
| 783 | Ga0495678_000679 | 3300049459 | Bacteria | 31270 |
| 784 | Ga0495678_003393 | 3300049459 | Bacteria | 9903 |
| 785 | Ga0495678_010124 | 3300049459 | Bacteria | 4599 |
| 786 | Ga0495682_0000188 | 3300049460 | Bacteria | 50664 |
| 787 | Ga0495682_0001280 | 3300049460 | Bacteria | 14063 |
| 788 | Ga0501291_033852 | 3300049514 | Bacteria | 873 |
| 789 | Ga0501292_012174 | 3300049515 | Unclassified | 1310 |
| 790 | Ga0501298_145149 | 3300049521 | Bacteria | 577 |
| 791 | Ga0501299_053153 | 3300049522 | Unclassified | 841 |
| 792 | Ga0501311_071086 | 3300049527 | Bacteria | 578 |
| 793 | Ga0501314_036841 | 3300049530 | Bacteria | 560 |
| 794 | Ga0501315_024960 | 3300049531 | Bacteria | 829 |
| 795 | Ga0501317_043299 | 3300049533 | Bacteria | 695 |
| 796 | Ga0501323_035947 | 3300049539 | Bacteria | 711 |
| 797 | Ga0501323_082475 | 3300049539 | Bacteria | 527 |
| 798 | Ga0501324_027032 | 3300049540 | Bacteria | 611 |
| 799 | Ga0501335_037737 | 3300049551 | Bacteria | 563 |
| 800 | Ga0501337_023380 | 3300049553 | Bacteria | 512 |
| 801 | Ga0501039_0473772 | 3300049575 | Bacteria | 983 |
| 802 | Ga0501074_0548293 | 3300049590 | Bacteria | 819 |
| 803 | Ga0501075_0903534 | 3300049591 | Bacteria | 671 |
| 804 | Ga0501216_041735 | 3300049660 | Unclassified | 879 |
| 805 | Ga0501227_029843 | 3300049665 | Bacteria | 1303 |
| 806 | Ga0501230_041549 | 3300049667 | Unclassified | 892 |
| 807 | Ga0501235_122519 | 3300049669 | Bacteria | 652 |
| 808 | Ga0501235_185550 | 3300049669 | Unclassified | 556 |
| 809 | Ga0501249_004544 | 3300049679 | Bacteria | 2821 |
| 810 | Ga0501249_041483 | 3300049679 | Bacteria | 1044 |
| 811 | Ga0501250_097281 | 3300049680 | Unclassified | 520 |
| 812 | Ga0501257_174061 | 3300049686 | Bacteria | 606 |
| 813 | Ga0501081_0715051 | 3300049743 | Unclassified | 752 |
| 814 | Ga0501263_039517 | 3300049760 | Bacteria | 690 |
| 815 | Ga0501264_004047 | 3300049761 | Unclassified | 1330 |
| 816 | Ga0501266_037682 | 3300049763 | Unclassified | 710 |
| 817 | Ga0501268_106392 | 3300049765 | Unclassified | 607 |
| 818 | Ga0501269_000090 | 3300049766 | Bacteria | 28652 |
| 819 | Ga0501279_001886 | 3300049775 | Bacteria | 2768 |
| 820 | Ga0501279_013648 | 3300049775 | Bacteria | 1114 |
| 821 | Ga0501279_055350 | 3300049775 | Unclassified | 638 |
| 822 | Ga0501279_066451 | 3300049775 | Bacteria | 599 |
| 823 | Ga0501035_0000652 | 3300049822 | Bacteria | 38210 |
| 824 | Ga0501044_0314037 | 3300049823 | Bacteria | 1493 |
| 825 | Ga0501044_0429750 | 3300049823 | Bacteria | 1230 |
| 826 | nmdc:mga03683_37931_c1 | 3300050489 | Bacteria | 1966 |
| 827 | nmdc:mga05p37_14950_c1 | 3300050507 | Bacteria | 9317 |
| 828 | nmdc:mga05p37_1649784_c1 | 3300050507 | Unclassified | 628 |
| 829 | nmdc:mga05p37_411053_c1 | 3300050507 | Bacteria | 1577 |
| 830 | nmdc:mga09592_374167_c1 | 3300050508 | Bacteria | 1232 |
| 831 | nmdc:mga0qj67_63662_c1 | 3300050509 | Bacteria | 2933 |
| 832 | nmdc:mga06r32_142015_c1 | 3300050510 | Bacteria | 2378 |
| 833 | nmdc:mga06r32_1933774_c1 | 3300050510 | Bacteria | 524 |
| 834 | nmdc:mga06r32_474902_c1 | 3300050510 | Unclassified | 1229 |
| 835 | nmdc:mga06r32_94743_c1 | 3300050510 | Bacteria | 2921 |
| 836 | nmdc:mga08y16_1859417_c1 | 3300050511 | Bacteria | 554 |
| 837 | nmdc:mga08y16_349636_c1 | 3300050511 | Bacteria | 1519 |
| 838 | nmdc:mga08y16_902080_c1 | 3300050511 | Bacteria | 870 |
| 839 | nmdc:mga0n895_1263821_c1 | 3300050512 | Bacteria | 710 |
| 840 | nmdc:mga0n895_130130_c1 | 3300050512 | Bacteria | 2542 |
| 841 | nmdc:mga0n895_449961_c1 | 3300050512 | Bacteria | 1300 |
| 842 | nmdc:mga0n895_45644_c1 | 3300050512 | Bacteria | 4276 |
| 843 | nmdc:mga0n895_49005_c1 | 3300050512 | Bacteria | 4137 |
| 844 | nmdc:mga0rr50_129386_c1 | 3300050513 | Bacteria | 2019 |
| 845 | nmdc:mga0rr50_317653_c1 | 3300050513 | Bacteria | 1305 |
| 846 | nmdc:mga0rr50_747643_c1 | 3300050513 | Bacteria | 835 |
| 847 | nmdc:mga08x19_131057_c1 | 3300050514 | Bacteria | 1686 |
| 848 | nmdc:mga08x19_535933_c1 | 3300050514 | Bacteria | 828 |
| 849 | nmdc:mga08x19_901988_c1 | 3300050514 | Bacteria | 628 |
| 850 | nmdc:mga0a205_190188_c1 | 3300050515 | Unclassified | 1945 |
| 851 | nmdc:mga0a205_27400_c1 | 3300050515 | Bacteria | 5442 |
| 852 | nmdc:mga0a205_8501_c1 | 3300050515 | Bacteria | 9337 |
| 853 | Ga0500594_0141141 | 3300053118 | Bacteria | 769 |
| 854 | Ga0500618_014917 | 3300053125 | Bacteria | 1974 |
| 855 | Ga0500559_0211482 | 3300053136 | Bacteria | 915 |
| 856 | Ga0500586_000683 | 3300053145 | Bacteria | 6948 |
| 857 | Ga0590071_052039 | 3300059421 | Bacteria | 994 |
| 858 | Ga0587068_065168 | 3300059641 | Bacteria | 709 |
| 859 | Ga0587079_100248 | 3300059647 | Bacteria | 690 |
| 860 | Ga0466962_0026811 | 3300061719 | Bacteria | 2767 |
| 861 | Ga0530510_0217449 | 3300061734 | Unclassified | 1420 |
| 862 | Ga0530510_0837822 | 3300061734 | Bacteria | 702 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046452 | Ga0495617_002222 | Ga0495617_002222_334_585 | 80 |
| 2 | 3300046491 | Ga0495584_0092989 | Ga0495584_0092989_28_279 | 80 |
| 3 | 3300046492 | Ga0495585_0592766 | Ga0495585_0592766_195_446 | 80 |
| 4 | 3300046501 | Ga0495607_0502671 | Ga0495607_0502671_185_436 | 80 |
| 5 | 3300046512 | Ga0495610_0008134 | Ga0495610_0008134_4181_4432 | 80 |
| 6 | 3300046523 | Ga0495644_0003276 | Ga0495644_0003276_2369_2620 | 80 |
| 7 | 3300046558 | Ga0495633_0035907 | Ga0495633_0035907_631_882 | 80 |
| 8 | 3300046615 | Ga0495656_0048727 | Ga0495656_0048727_1142_1393 | 80 |
| 9 | 3300046660 | Ga0495625_0042210 | Ga0495625_0042210_1342_1593 | 80 |
| 10 | 3300047445 | Ga0495677_0100181 | Ga0495677_0100181_16_267 | 80 |
| 11 | 3300049679 | Ga0501249_004544 | Ga0501249_004544_1319_1570 | 80 |
| 12 | 3300049766 | Ga0501269_000090 | Ga0501269_000090_5060_5311 | 80 |
| 13 | 3300050489 | nmdc:mga03683_37931_c1 | nmdc:mga03683_37931_c1_1334_1585 | 80 |
| 14 | 3300037471 | Ga0395905_0899679 | Ga0395905_0899679_328_582 | 81 |
| 15 | 3300039447 | Ga0436361_0715686 | Ga0436361_0715686_6114_6380 | 81 |
| 16 | 3300042531 | Ga0450918_116887 | Ga0450918_116887_56_310 | 81 |
| 17 | 3300046457 | Ga0495590_0064625 | Ga0495590_0064625_334_600 | 81 |
| 18 | 3300046474 | Ga0495605_0046234 | Ga0495605_0046234_532_786 | 81 |
| 19 | 3300046506 | Ga0495583_0001514 | Ga0495583_0001514_4256_4510 | 81 |
| 20 | 3300046513 | Ga0495616_0001023 | Ga0495616_0001023_15920_16174 | 81 |
| 21 | 3300046530 | Ga0495654_0025930 | Ga0495654_0025930_716_973 | 81 |
| 22 | 3300046615 | Ga0495656_0163172 | Ga0495656_0163172_615_869 | 81 |
| 23 | 3300047320 | Ga0495672_0374936 | Ga0495672_0374936_15_269 | 81 |
| 24 | 3300047443 | Ga0495687_172501 | Ga0495687_172501_128_382 | 81 |
| 25 | 3300048907 | Ga0496104_0199302 | Ga0496104_0199302_11_271 | 81 |
| 26 | 3300049531 | Ga0501315_024960 | Ga0501315_024960_410_664 | 81 |
| 27 | 3300049540 | Ga0501324_027032 | Ga0501324_027032_11_265 | 81 |
| 28 | 3300049665 | Ga0501227_029843 | Ga0501227_029843_841_1095 | 81 |
| 29 | 3300049775 | Ga0501279_066451 | Ga0501279_066451_221_475 | 81 |
| 30 | 3300005535 | Ga0070684_101942936 | Ga0070684_1019429361 | 82 |
| 31 | iso_pu_bacteria | 2643221554 | 2643791622 | 82 |
| 32 | iso_pu_bacteria | 2842711865 | 2842714497 | 82 |
| 33 | iso_pu_bacteria | 2857553236 | 2857553530 | 82 |
| 34 | iso_pu_bacteria | 2857558681 | 2857561603 | 82 |
| 35 | iso_pu_bacteria | 2857564685 | 2857565166 | 82 |
| 36 | iso_pu_bacteria | 2904424332 | 2904426475 | 82 |
| 37 | iso_pu_bacteria | 2919476304 | 2919481380 | 82 |
| 38 | iso_pu_bacteria | 2600255292 | 2601667279 | 83 |
| 39 | iso_pu_bacteria | 2643221645 | 2644252459 | 83 |
| 40 | iso_pu_bacteria | 2857547612 | 2857552530 | 83 |
| 41 | iso_pu_bacteria | 2885080285 | 2885082846 | 83 |
| 42 | iso_pu_bacteria | 8047673197 | 8047673329 | 83 |
| 43 | 3300014497 | Ga0182008_10000203 | Ga0182008_1000020317 | 84 |
| 44 | 3300015261 | Ga0182006_1000002 | Ga0182006_1000002210 | 84 |
| 45 | 3300048914 | Ga0496111_0141539 | Ga0496111_0141539_1244_1510 | 84 |
| 46 | 3300048919 | Ga0496116_0077132 | Ga0496116_0077132_1274_1540 | 84 |
| 47 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_1842714_1842980 | 84 |
| 48 | 3300048921 | Ga0496118_0000078 | Ga0496118_0000078_151826_152092 | 84 |
| 49 | 3300048925 | Ga0496122_0028447 | Ga0496122_0028447_1832_2098 | 84 |
| 50 | 3300048926 | Ga0496123_0001152 | Ga0496123_0001152_3036_3302 | 84 |
| 51 | 3300048927 | Ga0496124_0066257 | Ga0496124_0066257_450_716 | 84 |
| 52 | 3300048928 | Ga0496125_0003554 | Ga0496125_0003554_17284_17550 | 84 |
| 53 | 3300002738 | JGI25154J39366_1004923 | JGI25154J39366_10049233 | 86 |
| 54 | 3300002739 | JGI25158J39367_1020692 | JGI25158J39367_10206921 | 86 |
| 55 | 3300002739 | JGI25158J39367_1034970 | JGI25158J39367_10349701 | 86 |
| 56 | 3300002774 | JGI25150J39212_1001889 | JGI25150J39212_10018896 | 86 |
| 57 | 3300002774 | JGI25150J39212_1005558 | JGI25150J39212_10055584 | 86 |
| 58 | 3300002987 | JGI25159J45721_1004841 | JGI25159J45721_10048413 | 86 |
| 59 | 3300003187 | JGI25151J46595_10045649 | JGI25151J46595_100456493 | 86 |
| 60 | 3300003374 | JGI25161J50226_1000052 | JGI25161J50226_100005276 | 86 |
| 61 | 3300003544 | Ga0007417J51691_1130297 | Ga0007417J51691_11302972 | 86 |
| 62 | 3300003771 | Ga0055526_1000066 | Ga0055526_100006626 | 86 |
| 63 | 3300003771 | Ga0055526_1000100 | Ga0055526_100010032 | 86 |
| 64 | 3300003771 | Ga0055526_1000532 | Ga0055526_10005323 | 86 |
| 65 | 3300003771 | Ga0055526_1007832 | Ga0055526_10078325 | 86 |
| 66 | 3300003773 | Ga0055537_1002016 | Ga0055537_10020166 | 86 |
| 67 | 3300003773 | Ga0055537_1003673 | Ga0055537_10036733 | 86 |
| 68 | 3300003775 | Ga0055524_1001826 | Ga0055524_10018265 | 86 |
| 69 | 3300003775 | Ga0055524_1003599 | Ga0055524_10035996 | 86 |
| 70 | 3300003784 | Ga0055534_1003239 | Ga0055534_10032395 | 86 |
| 71 | 3300003784 | Ga0055534_1014270 | Ga0055534_10142702 | 86 |
| 72 | 3300003790 | Ga0055528_1025592 | Ga0055528_10255921 | 86 |
| 73 | 3300003791 | Ga0055530_10000050 | Ga0055530_1000005059 | 86 |
| 74 | 3300003791 | Ga0055530_10003761 | Ga0055530_100037618 | 86 |
| 75 | 3300003791 | Ga0055530_10005107 | Ga0055530_100051075 | 86 |
| 76 | 3300003794 | Ga0055531_10000417 | Ga0055531_1000041730 | 86 |
| 77 | 3300003794 | Ga0055531_10056372 | Ga0055531_100563722 | 86 |
| 78 | 3300004625 | Ga0055543_1000038 | Ga0055543_100003842 | 86 |
| 79 | 3300004625 | Ga0055543_1032808 | Ga0055543_10328083 | 86 |
| 80 | 3300005262 | Ga0065165_1000117 | Ga0065165_100011749 | 86 |
| 81 | 3300005262 | Ga0065165_1068256 | Ga0065165_10682562 | 86 |
| 82 | 3300005290 | Ga0065712_10000441 | Ga0065712_1000044124 | 86 |
| 83 | 3300005293 | Ga0065715_10301756 | Ga0065715_103017562 | 86 |
| 84 | 3300005293 | Ga0065715_10863725 | Ga0065715_108637251 | 86 |
| 85 | 3300005295 | Ga0065707_10231485 | Ga0065707_102314853 | 86 |
| 86 | 3300005328 | Ga0070676_10756834 | Ga0070676_107568342 | 86 |
| 87 | 3300005335 | Ga0070666_10162094 | Ga0070666_101620943 | 86 |
| 88 | 3300005339 | Ga0070660_100152177 | Ga0070660_1001521773 | 86 |
| 89 | 3300005341 | Ga0070691_10137087 | Ga0070691_101370871 | 86 |
| 90 | 3300005343 | Ga0070687_100117513 | Ga0070687_1001175132 | 86 |
| 91 | 3300005344 | Ga0070661_100633787 | Ga0070661_1006337871 | 86 |
| 92 | 3300005353 | Ga0070669_100051245 | Ga0070669_1000512454 | 86 |
| 93 | 3300005354 | Ga0070675_100496289 | Ga0070675_1004962891 | 86 |
| 94 | 3300005355 | Ga0070671_100034253 | Ga0070671_1000342534 | 86 |
| 95 | 3300005366 | Ga0070659_100375674 | Ga0070659_1003756742 | 86 |
| 96 | 3300005434 | Ga0070709_11367593 | Ga0070709_113675931 | 86 |
| 97 | 3300005436 | Ga0070713_100493346 | Ga0070713_1004933462 | 86 |
| 98 | 3300005439 | Ga0070711_100122275 | Ga0070711_1001222751 | 86 |
| 99 | 3300005440 | Ga0070705_100523217 | Ga0070705_1005232171 | 86 |
| 100 | 3300005458 | Ga0070681_11426765 | Ga0070681_114267652 | 86 |
| 101 | 3300005459 | Ga0068867_100961894 | Ga0068867_1009618942 | 86 |
| 102 | 3300005466 | Ga0070685_10450701 | Ga0070685_104507013 | 86 |
| 103 | 3300005539 | Ga0068853_100251124 | Ga0068853_1002511242 | 86 |
| 104 | 3300005543 | Ga0070672_100063875 | Ga0070672_1000638753 | 86 |
| 105 | 3300005544 | Ga0070686_101309046 | Ga0070686_1013090461 | 86 |
| 106 | 3300005545 | Ga0070695_100123787 | Ga0070695_1001237873 | 86 |
| 107 | 3300005563 | Ga0068855_100059700 | Ga0068855_1000597004 | 86 |
| 108 | 3300005578 | Ga0068854_100629307 | Ga0068854_1006293072 | 86 |
| 109 | 3300005618 | Ga0068864_100819125 | Ga0068864_1008191252 | 86 |
| 110 | 3300005719 | Ga0068861_100770873 | Ga0068861_1007708732 | 86 |
| 111 | 3300005840 | Ga0068870_10767527 | Ga0068870_107675272 | 86 |
| 112 | 3300005842 | Ga0068858_100325778 | Ga0068858_1003257783 | 86 |
| 113 | 3300005844 | Ga0068862_100807895 | Ga0068862_1008078952 | 86 |
| 114 | 3300006058 | Ga0075432_10238350 | Ga0075432_102383502 | 86 |
| 115 | 3300006175 | Ga0070712_100500645 | Ga0070712_1005006452 | 86 |
| 116 | 3300006177 | Ga0075362_10045577 | Ga0075362_100455773 | 86 |
| 117 | 3300006353 | Ga0075370_10280770 | Ga0075370_102807702 | 86 |
| 118 | 3300006353 | Ga0075370_11013201 | Ga0075370_110132012 | 86 |
| 119 | 3300006844 | Ga0075428_101147718 | Ga0075428_1011477182 | 86 |
| 120 | 3300006871 | Ga0075434_100113511 | Ga0075434_1001135113 | 86 |
| 121 | 3300006880 | Ga0075429_101753200 | Ga0075429_1017532001 | 86 |
| 122 | 3300006914 | Ga0075436_100052471 | Ga0075436_1000524715 | 86 |
| 123 | 3300006946 | Ga0079104_1009935 | Ga0079104_10099353 | 86 |
| 124 | 3300007076 | Ga0075435_100189958 | Ga0075435_1001899583 | 86 |
| 125 | 3300009036 | Ga0105244_10004503 | Ga0105244_100045036 | 86 |
| 126 | 3300009036 | Ga0105244_10020520 | Ga0105244_100205203 | 86 |
| 127 | 3300009094 | Ga0111539_10204406 | Ga0111539_102044063 | 86 |
| 128 | 3300009098 | Ga0105245_10622927 | Ga0105245_106229272 | 86 |
| 129 | 3300010375 | Ga0105239_10262049 | Ga0105239_102620493 | 86 |
| 130 | 3300012495 | Ga0157323_1004503 | Ga0157323_10045032 | 86 |
| 131 | 3300012506 | Ga0157324_1005512 | Ga0157324_10055122 | 86 |
| 132 | 3300013296 | Ga0157374_10417320 | Ga0157374_104173203 | 86 |
| 133 | 3300013297 | Ga0157378_10351057 | Ga0157378_103510573 | 86 |
| 134 | 3300013306 | Ga0163162_10963501 | Ga0163162_109635012 | 86 |
| 135 | 3300014325 | Ga0163163_10715885 | Ga0163163_107158853 | 86 |
| 136 | 3300014745 | Ga0157377_10295274 | Ga0157377_102952741 | 86 |
| 137 | 3300014968 | Ga0157379_10216530 | Ga0157379_102165303 | 86 |
| 138 | 3300014969 | Ga0157376_10116025 | Ga0157376_101160253 | 86 |
| 139 | 3300015261 | Ga0182006_1000021 | Ga0182006_1000021186 | 86 |
| 140 | 3300015265 | Ga0182005_1000013 | Ga0182005_100001316 | 86 |
| 141 | 3300025208 | Ga0209436_100337 | Ga0209436_10033722 | 86 |
| 142 | 3300025208 | Ga0209436_101644 | Ga0209436_1016443 | 86 |
| 143 | 3300025245 | Ga0207425_1000048 | Ga0207425_1000048106 | 86 |
| 144 | 3300025245 | Ga0207425_1000484 | Ga0207425_100048420 | 86 |
| 145 | 3300025246 | Ga0209646_1000010 | Ga0209646_1000010528 | 86 |
| 146 | 3300025258 | Ga0209129_1002463 | Ga0209129_10024637 | 86 |
| 147 | 3300025263 | Ga0209565_1000434 | Ga0209565_100043413 | 86 |
| 148 | 3300025263 | Ga0209565_1001392 | Ga0209565_10013929 | 86 |
| 149 | 3300025263 | Ga0209565_1001483 | Ga0209565_10014839 | 86 |
| 150 | 3300025263 | Ga0209565_1007809 | Ga0209565_10078093 | 86 |
| 151 | 3300025273 | Ga0209673_1016921 | Ga0209673_10169211 | 86 |
| 152 | 3300025284 | Ga0209130_1000059 | Ga0209130_1000059111 | 86 |
| 153 | 3300025284 | Ga0209130_1006475 | Ga0209130_10064753 | 86 |
| 154 | 3300025291 | Ga0209675_1003581 | Ga0209675_10035813 | 86 |
| 155 | 3300025291 | Ga0209675_1013123 | Ga0209675_10131233 | 86 |
| 156 | 3300025294 | Ga0209025_1003379 | Ga0209025_100337917 | 86 |
| 157 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009616 | 86 |
| 158 | 3300025295 | Ga0209564_1000045 | Ga0209564_100004542 | 86 |
| 159 | 3300025295 | Ga0209564_1000219 | Ga0209564_100021944 | 86 |
| 160 | 3300025295 | Ga0209564_1004289 | Ga0209564_10042899 | 86 |
| 161 | 3300025295 | Ga0209564_1052664 | Ga0209564_10526642 | 86 |
| 162 | 3300025297 | Ga0209758_1000489 | Ga0209758_100048927 | 86 |
| 163 | 3300025298 | Ga0209050_1000058 | Ga0209050_1000058117 | 86 |
| 164 | 3300025298 | Ga0209050_1000331 | Ga0209050_100033154 | 86 |
| 165 | 3300025298 | Ga0209050_1000398 | Ga0209050_100039814 | 86 |
| 166 | 3300025299 | Ga0209256_1001089 | Ga0209256_100108928 | 86 |
| 167 | 3300025299 | Ga0209256_1003141 | Ga0209256_100314111 | 86 |
| 168 | 3300025302 | Ga0207426_1004130 | Ga0207426_10041303 | 86 |
| 169 | 3300025303 | Ga0209051_1069856 | Ga0209051_10698562 | 86 |
| 170 | 3300025304 | Ga0209257_1000003 | Ga0209257_1000003739 | 86 |
| 171 | 3300025304 | Ga0209257_1002437 | Ga0209257_100243714 | 86 |
| 172 | 3300025728 | Ga0207655_1005618 | Ga0207655_10056185 | 86 |
| 173 | 3300025728 | Ga0207655_1010491 | Ga0207655_10104913 | 86 |
| 174 | 3300025903 | Ga0207680_10137161 | Ga0207680_101371613 | 86 |
| 175 | 3300025907 | Ga0207645_10164371 | Ga0207645_101643713 | 86 |
| 176 | 3300025915 | Ga0207693_10785502 | Ga0207693_107855022 | 86 |
| 177 | 3300025918 | Ga0207662_10192268 | Ga0207662_101922683 | 86 |
| 178 | 3300025919 | Ga0207657_10030993 | Ga0207657_100309935 | 86 |
| 179 | 3300025920 | Ga0207649_10842271 | Ga0207649_108422712 | 86 |
| 180 | 3300025923 | Ga0207681_10210272 | Ga0207681_102102721 | 86 |
| 181 | 3300025925 | Ga0207650_10845059 | Ga0207650_108450592 | 86 |
| 182 | 3300025926 | Ga0207659_10097576 | Ga0207659_100975763 | 86 |
| 183 | 3300025932 | Ga0207690_10129957 | Ga0207690_101299573 | 86 |
| 184 | 3300025933 | Ga0207706_10117139 | Ga0207706_101171394 | 86 |
| 185 | 3300025940 | Ga0207691_10033017 | Ga0207691_100330173 | 86 |
| 186 | 3300025945 | Ga0207679_10040567 | Ga0207679_100405672 | 86 |
| 187 | 3300025949 | Ga0207667_10510595 | Ga0207667_105105953 | 86 |
| 188 | 3300026035 | Ga0207703_12071442 | Ga0207703_120714422 | 86 |
| 189 | 3300026041 | Ga0207639_11131807 | Ga0207639_111318072 | 86 |
| 190 | 3300026089 | Ga0207648_10277946 | Ga0207648_102779462 | 86 |
| 191 | 3300026116 | Ga0207674_10478115 | Ga0207674_104781153 | 86 |
| 192 | 3300026118 | Ga0207675_100560824 | Ga0207675_1005608242 | 86 |
| 193 | 3300027111 | Ga0209281_1007260 | Ga0209281_10072603 | 86 |
| 194 | 3300028380 | Ga0268265_10705529 | Ga0268265_107055292 | 86 |
| 195 | 3300030744 | Ga0316181_1155464 | Ga0316181_11554644 | 86 |
| 196 | 3300031548 | Ga0307408_100000024 | Ga0307408_10000002469 | 86 |
| 197 | 3300031548 | Ga0307408_100000786 | Ga0307408_10000078625 | 86 |
| 198 | 3300031548 | Ga0307408_100009316 | Ga0307408_1000093165 | 86 |
| 199 | 3300032004 | Ga0307414_11832630 | Ga0307414_118326301 | 86 |
| 200 | 3300035085 | Ga0373929_0062691 | Ga0373929_0062691_90_356 | 86 |
| 201 | 3300035691 | Ga0373931_0389526 | Ga0373931_0389526_311_577 | 86 |
| 202 | 3300041509 | Ga0451843_1127621 | Ga0451843_1127621_118_387 | 86 |
| 203 | 3300042005 | Ga0439448_0068228 | Ga0439448_0068228_305_571 | 86 |
| 204 | 3300042011 | Ga0439454_075217 | Ga0439454_075217_222_542 | 86 |
| 205 | 3300042012 | Ga0439455_0160672 | Ga0439455_0160672_304_570 | 86 |
| 206 | 3300042439 | Ga0439464_0055119 | Ga0439464_0055119_613_879 | 86 |
| 207 | 3300042876 | Ga0451577_0971137 | Ga0451577_0971137_181_447 | 86 |
| 208 | 3300044669 | Ga0466981_0471458 | Ga0466981_0471458_101_370 | 86 |
| 209 | 3300044672 | Ga0466982_0155755 | Ga0466982_0155755_1077_1346 | 86 |
| 210 | 3300045051 | Ga0451576_0442275 | Ga0451576_0442275_1042_1308 | 86 |
| 211 | 3300045051 | Ga0451576_0892854 | Ga0451576_0892854_308_574 | 86 |
| 212 | 3300046452 | Ga0495617_001313 | Ga0495617_001313_5065_5334 | 86 |
| 213 | 3300046453 | Ga0495627_078961 | Ga0495627_078961_163_432 | 86 |
| 214 | 3300046457 | Ga0495590_0000003 | Ga0495590_0000003_384927_385196 | 86 |
| 215 | 3300046457 | Ga0495590_0012377 | Ga0495590_0012377_750_1019 | 86 |
| 216 | 3300046460 | Ga0495638_0000091 | Ga0495638_0000091_114909_115178 | 86 |
| 217 | 3300046460 | Ga0495638_0032890 | Ga0495638_0032890_312_581 | 86 |
| 218 | 3300046460 | Ga0495638_0048943 | Ga0495638_0048943_2068_2337 | 86 |
| 219 | 3300046460 | Ga0495638_0066703 | Ga0495638_0066703_1011_1280 | 86 |
| 220 | 3300046460 | Ga0495638_0074696 | Ga0495638_0074696_1251_1520 | 86 |
| 221 | 3300046463 | Ga0495653_0000013 | Ga0495653_0000013_154982_155251 | 86 |
| 222 | 3300046471 | Ga0495650_0000097 | Ga0495650_0000097_70966_71235 | 86 |
| 223 | 3300046471 | Ga0495650_0001058 | Ga0495650_0001058_20127_20396 | 86 |
| 224 | 3300046471 | Ga0495650_0003792 | Ga0495650_0003792_4185_4454 | 86 |
| 225 | 3300046471 | Ga0495650_0005750 | Ga0495650_0005750_2559_2828 | 86 |
| 226 | 3300046474 | Ga0495605_0000251 | Ga0495605_0000251_29475_29744 | 86 |
| 227 | 3300046474 | Ga0495605_0004340 | Ga0495605_0004340_4873_5142 | 86 |
| 228 | 3300046491 | Ga0495584_0018503 | Ga0495584_0018503_1062_1331 | 86 |
| 229 | 3300046491 | Ga0495584_0184660 | Ga0495584_0184660_723_992 | 86 |
| 230 | 3300046492 | Ga0495585_0002213 | Ga0495585_0002213_2577_2846 | 86 |
| 231 | 3300046492 | Ga0495585_0043835 | Ga0495585_0043835_541_810 | 86 |
| 232 | 3300046501 | Ga0495607_0001875 | Ga0495607_0001875_232_501 | 86 |
| 233 | 3300046501 | Ga0495607_0002140 | Ga0495607_0002140_2335_2604 | 86 |
| 234 | 3300046501 | Ga0495607_0016045 | Ga0495607_0016045_1972_2241 | 86 |
| 235 | 3300046506 | Ga0495583_0000155 | Ga0495583_0000155_2280_2549 | 86 |
| 236 | 3300046506 | Ga0495583_0000197 | Ga0495583_0000197_70456_70725 | 86 |
| 237 | 3300046506 | Ga0495583_0002755 | Ga0495583_0002755_12450_12719 | 86 |
| 238 | 3300046507 | Ga0495606_0000141 | Ga0495606_0000141_96400_96669 | 86 |
| 239 | 3300046507 | Ga0495606_0000266 | Ga0495606_0000266_24593_24862 | 86 |
| 240 | 3300046507 | Ga0495606_0000371 | Ga0495606_0000371_66949_67218 | 86 |
| 241 | 3300046507 | Ga0495606_0000696 | Ga0495606_0000696_35258_35527 | 86 |
| 242 | 3300046507 | Ga0495606_0002432 | Ga0495606_0002432_5189_5458 | 86 |
| 243 | 3300046507 | Ga0495606_0004896 | Ga0495606_0004896_411_680 | 86 |
| 244 | 3300046507 | Ga0495606_0010295 | Ga0495606_0010295_323_592 | 86 |
| 245 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_81624_81893 | 86 |
| 246 | 3300046512 | Ga0495610_0002073 | Ga0495610_0002073_15044_15313 | 86 |
| 247 | 3300046512 | Ga0495610_0003707 | Ga0495610_0003707_2427_2696 | 86 |
| 248 | 3300046512 | Ga0495610_0004426 | Ga0495610_0004426_4166_4435 | 86 |
| 249 | 3300046512 | Ga0495610_0011693 | Ga0495610_0011693_1532_1801 | 86 |
| 250 | 3300046512 | Ga0495610_0020097 | Ga0495610_0020097_1392_1661 | 86 |
| 251 | 3300046513 | Ga0495616_0178052 | Ga0495616_0178052_154_423 | 86 |
| 252 | 3300046520 | Ga0495637_0000087 | Ga0495637_0000087_36548_36817 | 86 |
| 253 | 3300046520 | Ga0495637_0001405 | Ga0495637_0001405_12692_12961 | 86 |
| 254 | 3300046522 | Ga0495643_0000179 | Ga0495643_0000179_25660_25929 | 86 |
| 255 | 3300046522 | Ga0495643_0000287 | Ga0495643_0000287_71270_71539 | 86 |
| 256 | 3300046522 | Ga0495643_0179073 | Ga0495643_0179073_92_361 | 86 |
| 257 | 3300046523 | Ga0495644_0015254 | Ga0495644_0015254_325_594 | 86 |
| 258 | 3300046524 | Ga0495648_0000058 | Ga0495648_0000058_77461_77730 | 86 |
| 259 | 3300046524 | Ga0495648_0003974 | Ga0495648_0003974_11469_11738 | 86 |
| 260 | 3300046524 | Ga0495648_0040255 | Ga0495648_0040255_1186_1455 | 86 |
| 261 | 3300046524 | Ga0495648_0068927 | Ga0495648_0068927_1411_1680 | 86 |
| 262 | 3300046528 | Ga0495642_0003894 | Ga0495642_0003894_3601_3870 | 86 |
| 263 | 3300046530 | Ga0495654_0000074 | Ga0495654_0000074_43465_43734 | 86 |
| 264 | 3300046530 | Ga0495654_0285936 | Ga0495654_0285936_318_587 | 86 |
| 265 | 3300046538 | Ga0495609_0005728 | Ga0495609_0005728_2349_2618 | 86 |
| 266 | 3300046538 | Ga0495609_0093367 | Ga0495609_0093367_233_502 | 86 |
| 267 | 3300046538 | Ga0495609_0187920 | Ga0495609_0187920_176_445 | 86 |
| 268 | 3300046542 | Ga0495597_0000209 | Ga0495597_0000209_50417_50686 | 86 |
| 269 | 3300046542 | Ga0495597_0000242 | Ga0495597_0000242_43071_43340 | 86 |
| 270 | 3300046557 | Ga0495622_0000054 | Ga0495622_0000054_70116_70385 | 86 |
| 271 | 3300046557 | Ga0495622_0006805 | Ga0495622_0006805_2300_2569 | 86 |
| 272 | 3300046558 | Ga0495633_0000119 | Ga0495633_0000119_82278_82547 | 86 |
| 273 | 3300046558 | Ga0495633_0000249 | Ga0495633_0000249_32528_32797 | 86 |
| 274 | 3300046558 | Ga0495633_0002342 | Ga0495633_0002342_9658_9927 | 86 |
| 275 | 3300046558 | Ga0495633_0118990 | Ga0495633_0118990_14_283 | 86 |
| 276 | 3300046616 | Ga0495668_0000466 | Ga0495668_0000466_30640_30909 | 86 |
| 277 | 3300046616 | Ga0495668_0000935 | Ga0495668_0000935_30593_30862 | 86 |
| 278 | 3300046616 | Ga0495668_0182577 | Ga0495668_0182577_804_1073 | 86 |
| 279 | 3300046648 | Ga0495611_0022007 | Ga0495611_0022007_2381_2650 | 86 |
| 280 | 3300046648 | Ga0495611_0068446 | Ga0495611_0068446_1245_1514 | 86 |
| 281 | 3300046660 | Ga0495625_0000132 | Ga0495625_0000132_31306_31575 | 86 |
| 282 | 3300046660 | Ga0495625_0000139 | Ga0495625_0000139_85634_85903 | 86 |
| 283 | 3300046660 | Ga0495625_0002129 | Ga0495625_0002129_2285_2554 | 86 |
| 284 | 3300046660 | Ga0495625_0026955 | Ga0495625_0026955_1232_1501 | 86 |
| 285 | 3300046660 | Ga0495625_0873505 | Ga0495625_0873505_37_306 | 86 |
| 286 | 3300046664 | Ga0495659_0012250 | Ga0495659_0012250_2164_2433 | 86 |
| 287 | 3300046664 | Ga0495659_0209215 | Ga0495659_0209215_308_577 | 86 |
| 288 | 3300046665 | Ga0495661_0232634 | Ga0495661_0232634_372_641 | 86 |
| 289 | 3300046691 | Ga0495670_0001500 | Ga0495670_0001500_5544_5813 | 86 |
| 290 | 3300046691 | Ga0495670_0081519 | Ga0495670_0081519_1043_1312 | 86 |
| 291 | 3300046691 | Ga0495670_0472284 | Ga0495670_0472284_275_544 | 86 |
| 292 | 3300046692 | Ga0495671_0000582 | Ga0495671_0000582_23661_23930 | 86 |
| 293 | 3300046692 | Ga0495671_0025498 | Ga0495671_0025498_1501_1770 | 86 |
| 294 | 3300046692 | Ga0495671_0271366 | Ga0495671_0271366_345_614 | 86 |
| 295 | 3300046694 | Ga0495649_0006737 | Ga0495649_0006737_4377_4646 | 86 |
| 296 | 3300046694 | Ga0495649_0030801 | Ga0495649_0030801_1350_1619 | 86 |
| 297 | 3300046694 | Ga0495649_0148941 | Ga0495649_0148941_196_465 | 86 |
| 298 | 3300046694 | Ga0495649_0337002 | Ga0495649_0337002_25_294 | 86 |
| 299 | 3300046794 | Ga0495589_0091635 | Ga0495589_0091635_615_884 | 86 |
| 300 | 3300046810 | Ga0495660_0000056 | Ga0495660_0000056_85779_86045 | 86 |
| 301 | 3300046810 | Ga0495660_0005974 | Ga0495660_0005974_1595_1864 | 86 |
| 302 | 3300047318 | Ga0495636_0000998 | Ga0495636_0000998_6980_7249 | 86 |
| 303 | 3300047320 | Ga0495672_0000896 | Ga0495672_0000896_4888_5157 | 86 |
| 304 | 3300047320 | Ga0495672_0006771 | Ga0495672_0006771_6063_6332 | 86 |
| 305 | 3300047320 | Ga0495672_0064342 | Ga0495672_0064342_1602_1871 | 86 |
| 306 | 3300047323 | Ga0495683_0028550 | Ga0495683_0028550_1960_2229 | 86 |
| 307 | 3300047443 | Ga0495687_000296 | Ga0495687_000296_33872_34141 | 86 |
| 308 | 3300047443 | Ga0495687_001591 | Ga0495687_001591_17977_18246 | 86 |
| 309 | 3300047445 | Ga0495677_0017435 | Ga0495677_0017435_1276_1545 | 86 |
| 310 | 3300047445 | Ga0495677_0139571 | Ga0495677_0139571_628_897 | 86 |
| 311 | 3300047446 | Ga0495679_037879 | Ga0495679_037879_582_851 | 86 |
| 312 | 3300047447 | Ga0495685_000076 | Ga0495685_000076_4314_4583 | 86 |
| 313 | 3300047447 | Ga0495685_009255 | Ga0495685_009255_2580_2849 | 86 |
| 314 | 3300047469 | Ga0495673_0000006 | Ga0495673_0000006_601162_601431 | 86 |
| 315 | 3300047469 | Ga0495673_0000024 | Ga0495673_0000024_239971_240240 | 86 |
| 316 | 3300047469 | Ga0495673_0035372 | Ga0495673_0035372_966_1235 | 86 |
| 317 | 3300047470 | Ga0495681_0018157 | Ga0495681_0018157_721_987 | 86 |
| 318 | 3300047472 | Ga0495686_0001364 | Ga0495686_0001364_2259_2528 | 86 |
| 319 | 3300047472 | Ga0495686_0007184 | Ga0495686_0007184_1274_1543 | 86 |
| 320 | 3300047472 | Ga0495686_0040141 | Ga0495686_0040141_1154_1423 | 86 |
| 321 | 3300048903 | Ga0496100_1429782 | Ga0496100_1429782_105_371 | 86 |
| 322 | 3300048906 | Ga0496103_0000631 | Ga0496103_0000631_18259_18528 | 86 |
| 323 | 3300048907 | Ga0496104_0103346 | Ga0496104_0103346_1801_2067 | 86 |
| 324 | 3300048912 | Ga0496109_0291365 | Ga0496109_0291365_1219_1485 | 86 |
| 325 | 3300048915 | Ga0496112_0299949 | Ga0496112_0299949_733_999 | 86 |
| 326 | 3300048916 | Ga0496113_0458474 | Ga0496113_0458474_304_570 | 86 |
| 327 | 3300048927 | Ga0496124_0041630 | Ga0496124_0041630_1218_1484 | 86 |
| 328 | 3300048927 | Ga0496124_0066840 | Ga0496124_0066840_152_421 | 86 |
| 329 | 3300049130 | Ga0501310_001774 | Ga0501310_001774_780_1049 | 86 |
| 330 | 3300049132 | Ga0501343_021108 | Ga0501343_021108_85_354 | 86 |
| 331 | 3300049162 | Ga0501307_023262 | Ga0501307_023262_294_563 | 86 |
| 332 | 3300049459 | Ga0495678_000006 | Ga0495678_000006_58018_58284 | 86 |
| 333 | 3300049459 | Ga0495678_000365 | Ga0495678_000365_15743_16012 | 86 |
| 334 | 3300049459 | Ga0495678_000679 | Ga0495678_000679_25650_25919 | 86 |
| 335 | 3300049459 | Ga0495678_010124 | Ga0495678_010124_1347_1616 | 86 |
| 336 | 3300049460 | Ga0495682_0000188 | Ga0495682_0000188_32195_32464 | 86 |
| 337 | 3300049460 | Ga0495682_0001280 | Ga0495682_0001280_10592_10861 | 86 |
| 338 | 3300049521 | Ga0501298_145149 | Ga0501298_145149_60_329 | 86 |
| 339 | 3300049527 | Ga0501311_071086 | Ga0501311_071086_266_535 | 86 |
| 340 | 3300049530 | Ga0501314_036841 | Ga0501314_036841_228_497 | 86 |
| 341 | 3300049533 | Ga0501317_043299 | Ga0501317_043299_55_324 | 86 |
| 342 | 3300049539 | Ga0501323_082475 | Ga0501323_082475_141_410 | 86 |
| 343 | 3300049551 | Ga0501335_037737 | Ga0501335_037737_146_415 | 86 |
| 344 | 3300049553 | Ga0501337_023380 | Ga0501337_023380_174_443 | 86 |
| 345 | 3300049760 | Ga0501263_039517 | Ga0501263_039517_90_359 | 86 |
| 346 | 3300049775 | Ga0501279_001886 | Ga0501279_001886_945_1214 | 86 |
| 347 | 3300050511 | nmdc:mga08y16_1859417_c1 | nmdc:mga08y16_1859417_c1_225_485 | 86 |
| 348 | 3300050512 | nmdc:mga0n895_49005_c1 | nmdc:mga0n895_49005_c1_100_366 | 86 |
| 349 | 3300050513 | nmdc:mga0rr50_747643_c1 | nmdc:mga0rr50_747643_c1_491_757 | 86 |
| 350 | 3300050514 | nmdc:mga08x19_535933_c1 | nmdc:mga08x19_535933_c1_254_520 | 86 |
| 351 | 3300050515 | nmdc:mga0a205_190188_c1 | nmdc:mga0a205_190188_c1_1492_1758 | 86 |
| 352 | 3300053118 | Ga0500594_0141141 | Ga0500594_0141141_185_454 | 86 |
| 353 | 3300053125 | Ga0500618_014917 | Ga0500618_014917_1144_1422 | 86 |
| 354 | 3300053136 | Ga0500559_0211482 | Ga0500559_0211482_98_367 | 86 |
| 355 | 3300053145 | Ga0500586_000683 | Ga0500586_000683_5178_5447 | 86 |
| 356 | 2209111006 | 2214801358 | 2213831042 | 87 |
| 357 | 3300000043 | ARcpr5yngRDRAFT_c021294 | ARcpr5yngRDRAFT_0212942 | 87 |
| 358 | 3300000044 | ARSoilOldRDRAFT_c005349 | ARSoilOldRDRAFT_0053493 | 87 |
| 359 | 3300000652 | ARCol0yngRDRAFT_1011370 | ARCol0yngRDRAFT_10113702 | 87 |
| 360 | 3300002773 | JGI25152J39213_1000052 | JGI25152J39213_10000525 | 87 |
| 361 | 3300002774 | JGI25150J39212_1000260 | JGI25150J39212_100026027 | 87 |
| 362 | 3300002774 | JGI25150J39212_1037262 | JGI25150J39212_10372622 | 87 |
| 363 | 3300003215 | JGI25153J46596_10005812 | JGI25153J46596_100058127 | 87 |
| 364 | 3300003544 | Ga0007417J51691_1120058 | Ga0007417J51691_11200582 | 87 |
| 365 | 3300003575 | Ga0007409J51694_1042002 | Ga0007409J51694_10420022 | 87 |
| 366 | 3300003575 | Ga0007409J51694_1065768 | Ga0007409J51694_10657682 | 87 |
| 367 | 3300003577 | Ga0007416J51690_1069957 | Ga0007416J51690_10699572 | 87 |
| 368 | 3300003773 | Ga0055537_1016608 | Ga0055537_10166083 | 87 |
| 369 | 3300003775 | Ga0055524_1001361 | Ga0055524_10013615 | 87 |
| 370 | 3300005262 | Ga0065165_1078328 | Ga0065165_10783282 | 87 |
| 371 | 3300005277 | Ga0065716_1007397 | Ga0065716_10073972 | 87 |
| 372 | 3300005289 | Ga0065704_10746682 | Ga0065704_107466821 | 87 |
| 373 | 3300005295 | Ga0065707_10085234 | Ga0065707_100852347 | 87 |
| 374 | 3300005295 | Ga0065707_10371062 | Ga0065707_103710622 | 87 |
| 375 | 3300005295 | Ga0065707_10383819 | Ga0065707_103838193 | 87 |
| 376 | 3300005328 | Ga0070676_10424860 | Ga0070676_104248602 | 87 |
| 377 | 3300005331 | Ga0070670_101189643 | Ga0070670_1011896432 | 87 |
| 378 | 3300005336 | Ga0070680_101287931 | Ga0070680_1012879311 | 87 |
| 379 | 3300005339 | Ga0070660_100093105 | Ga0070660_1000931053 | 87 |
| 380 | 3300005344 | Ga0070661_100141316 | Ga0070661_1001413162 | 87 |
| 381 | 3300005347 | Ga0070668_102087006 | Ga0070668_1020870062 | 87 |
| 382 | 3300005353 | Ga0070669_101517912 | Ga0070669_1015179122 | 87 |
| 383 | 3300005356 | Ga0070674_100206699 | Ga0070674_1002066993 | 87 |
| 384 | 3300005367 | Ga0070667_100441740 | Ga0070667_1004417402 | 87 |
| 385 | 3300005438 | Ga0070701_10681618 | Ga0070701_106816182 | 87 |
| 386 | 3300005440 | Ga0070705_100816530 | Ga0070705_1008165302 | 87 |
| 387 | 3300005444 | Ga0070694_101579907 | Ga0070694_1015799071 | 87 |
| 388 | 3300005445 | Ga0070708_100605515 | Ga0070708_1006055152 | 87 |
| 389 | 3300005455 | Ga0070663_100754780 | Ga0070663_1007547802 | 87 |
| 390 | 3300005457 | Ga0070662_100705557 | Ga0070662_1007055572 | 87 |
| 391 | 3300005457 | Ga0070662_100770419 | Ga0070662_1007704192 | 87 |
| 392 | 3300005535 | Ga0070684_101158486 | Ga0070684_1011584862 | 87 |
| 393 | 3300005545 | Ga0070695_100330301 | Ga0070695_1003303012 | 87 |
| 394 | 3300005563 | Ga0068855_100028435 | Ga0068855_1000284357 | 87 |
| 395 | 3300005563 | Ga0068855_100175212 | Ga0068855_1001752123 | 87 |
| 396 | 3300005564 | Ga0070664_100310537 | Ga0070664_1003105372 | 87 |
| 397 | 3300005577 | Ga0068857_101162900 | Ga0068857_1011629002 | 87 |
| 398 | 3300005616 | Ga0068852_100266659 | Ga0068852_1002666593 | 87 |
| 399 | 3300005834 | Ga0068851_10529453 | Ga0068851_105294532 | 87 |
| 400 | 3300005843 | Ga0068860_100199592 | Ga0068860_1001995923 | 87 |
| 401 | 3300006237 | Ga0097621_100985980 | Ga0097621_1009859801 | 87 |
| 402 | 3300006844 | Ga0075428_100041332 | Ga0075428_1000413323 | 87 |
| 403 | 3300006844 | Ga0075428_100458552 | Ga0075428_1004585523 | 87 |
| 404 | 3300006846 | Ga0075430_100037028 | Ga0075430_1000370283 | 87 |
| 405 | 3300006846 | Ga0075430_100667062 | Ga0075430_1006670622 | 87 |
| 406 | 3300006846 | Ga0075430_100881657 | Ga0075430_1008816572 | 87 |
| 407 | 3300006847 | Ga0075431_100056553 | Ga0075431_1000565534 | 87 |
| 408 | 3300006847 | Ga0075431_100117444 | Ga0075431_1001174442 | 87 |
| 409 | 3300006847 | Ga0075431_100448398 | Ga0075431_1004483983 | 87 |
| 410 | 3300006847 | Ga0075431_100499780 | Ga0075431_1004997803 | 87 |
| 411 | 3300006847 | Ga0075431_101811414 | Ga0075431_1018114141 | 87 |
| 412 | 3300006852 | Ga0075433_10010092 | Ga0075433_100100926 | 87 |
| 413 | 3300006852 | Ga0075433_10107798 | Ga0075433_101077983 | 87 |
| 414 | 3300006852 | Ga0075433_10306896 | Ga0075433_103068963 | 87 |
| 415 | 3300006852 | Ga0075433_10419657 | Ga0075433_104196572 | 87 |
| 416 | 3300006871 | Ga0075434_100025061 | Ga0075434_1000250616 | 87 |
| 417 | 3300006871 | Ga0075434_100040503 | Ga0075434_1000405034 | 87 |
| 418 | 3300006871 | Ga0075434_100212084 | Ga0075434_1002120843 | 87 |
| 419 | 3300006871 | Ga0075434_100469779 | Ga0075434_1004697792 | 87 |
| 420 | 3300006871 | Ga0075434_101507269 | Ga0075434_1015072692 | 87 |
| 421 | 3300006880 | Ga0075429_100285419 | Ga0075429_1002854192 | 87 |
| 422 | 3300006880 | Ga0075429_100501130 | Ga0075429_1005011303 | 87 |
| 423 | 3300006881 | Ga0068865_100068899 | Ga0068865_1000688992 | 87 |
| 424 | 3300006881 | Ga0068865_101464430 | Ga0068865_1014644301 | 87 |
| 425 | 3300006914 | Ga0075436_100042122 | Ga0075436_1000421224 | 87 |
| 426 | 3300006914 | Ga0075436_100309664 | Ga0075436_1003096643 | 87 |
| 427 | 3300006914 | Ga0075436_100536705 | Ga0075436_1005367052 | 87 |
| 428 | 3300007076 | Ga0075435_100095664 | Ga0075435_1000956643 | 87 |
| 429 | 3300007076 | Ga0075435_100147909 | Ga0075435_1001479093 | 87 |
| 430 | 3300009036 | Ga0105244_10389660 | Ga0105244_103896602 | 87 |
| 431 | 3300009093 | Ga0105240_10937369 | Ga0105240_109373693 | 87 |
| 432 | 3300009094 | Ga0111539_10122185 | Ga0111539_101221855 | 87 |
| 433 | 3300009094 | Ga0111539_10237262 | Ga0111539_102372622 | 87 |
| 434 | 3300009094 | Ga0111539_10300269 | Ga0111539_103002692 | 87 |
| 435 | 3300009094 | Ga0111539_13107567 | Ga0111539_131075671 | 87 |
| 436 | 3300009147 | Ga0114129_10002450 | Ga0114129_1000245017 | 87 |
| 437 | 3300009147 | Ga0114129_10049272 | Ga0114129_100492724 | 87 |
| 438 | 3300009147 | Ga0114129_10105333 | Ga0114129_101053333 | 87 |
| 439 | 3300009147 | Ga0114129_10226564 | Ga0114129_102265644 | 87 |
| 440 | 3300009147 | Ga0114129_10893646 | Ga0114129_108936462 | 87 |
| 441 | 3300009148 | Ga0105243_10314652 | Ga0105243_103146523 | 87 |
| 442 | 3300009148 | Ga0105243_11104213 | Ga0105243_111042132 | 87 |
| 443 | 3300009174 | Ga0105241_10088450 | Ga0105241_100884503 | 87 |
| 444 | 3300009176 | Ga0105242_10009643 | Ga0105242_100096437 | 87 |
| 445 | 3300009545 | Ga0105237_10785325 | Ga0105237_107853252 | 87 |
| 446 | 3300009551 | Ga0105238_10197089 | Ga0105238_101970893 | 87 |
| 447 | 3300010375 | Ga0105239_10136174 | Ga0105239_101361742 | 87 |
| 448 | 3300012503 | Ga0157313_1004665 | Ga0157313_10046651 | 87 |
| 449 | 3300012510 | Ga0157316_1013113 | Ga0157316_10131132 | 87 |
| 450 | 3300012515 | Ga0157338_1009589 | Ga0157338_10095892 | 87 |
| 451 | 3300013102 | Ga0157371_11021274 | Ga0157371_110212742 | 87 |
| 452 | 3300013297 | Ga0157378_10014338 | Ga0157378_100143388 | 87 |
| 453 | 3300013306 | Ga0163162_10040488 | Ga0163162_100404882 | 87 |
| 454 | 3300013306 | Ga0163162_10268593 | Ga0163162_102685932 | 87 |
| 455 | 3300013307 | Ga0157372_10991600 | Ga0157372_109916003 | 87 |
| 456 | 3300013307 | Ga0157372_11646209 | Ga0157372_116462092 | 87 |
| 457 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011818 | 87 |
| 458 | 3300025245 | Ga0207425_1048512 | Ga0207425_10485122 | 87 |
| 459 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001995 | 87 |
| 460 | 3300025258 | Ga0209129_1023468 | Ga0209129_10234682 | 87 |
| 461 | 3300025263 | Ga0209565_1005912 | Ga0209565_10059123 | 87 |
| 462 | 3300025297 | Ga0209758_1000166 | Ga0209758_100016648 | 87 |
| 463 | 3300025299 | Ga0209256_1000350 | Ga0209256_10003505 | 87 |
| 464 | 3300025904 | Ga0207647_10673622 | Ga0207647_106736222 | 87 |
| 465 | 3300025907 | Ga0207645_10351074 | Ga0207645_103510742 | 87 |
| 466 | 3300025911 | Ga0207654_10050086 | Ga0207654_100500863 | 87 |
| 467 | 3300025917 | Ga0207660_10435681 | Ga0207660_104356812 | 87 |
| 468 | 3300025919 | Ga0207657_10020487 | Ga0207657_100204875 | 87 |
| 469 | 3300025933 | Ga0207706_11379736 | Ga0207706_113797363 | 87 |
| 470 | 3300025935 | Ga0207709_10422916 | Ga0207709_104229163 | 87 |
| 471 | 3300025937 | Ga0207669_10832332 | Ga0207669_108323322 | 87 |
| 472 | 3300025938 | Ga0207704_10676829 | Ga0207704_106768293 | 87 |
| 473 | 3300025942 | Ga0207689_10898893 | Ga0207689_108988932 | 87 |
| 474 | 3300025945 | Ga0207679_10254290 | Ga0207679_102542902 | 87 |
| 475 | 3300025949 | Ga0207667_10022603 | Ga0207667_100226033 | 87 |
| 476 | 3300025949 | Ga0207667_10095750 | Ga0207667_100957502 | 87 |
| 477 | 3300025972 | Ga0207668_11877242 | Ga0207668_118772422 | 87 |
| 478 | 3300025981 | Ga0207640_11731464 | Ga0207640_117314642 | 87 |
| 479 | 3300026067 | Ga0207678_10348720 | Ga0207678_103487202 | 87 |
| 480 | 3300026075 | Ga0207708_11087243 | Ga0207708_110872432 | 87 |
| 481 | 3300026078 | Ga0207702_10837877 | Ga0207702_108378771 | 87 |
| 482 | 3300026089 | Ga0207648_11181972 | Ga0207648_111819722 | 87 |
| 483 | 3300026142 | Ga0207698_10472972 | Ga0207698_104729722 | 87 |
| 484 | 3300027252 | Ga0209973_1020307 | Ga0209973_10203072 | 87 |
| 485 | 3300027717 | Ga0209998_10039954 | Ga0209998_100399542 | 87 |
| 486 | 3300027876 | Ga0209974_10011054 | Ga0209974_100110543 | 87 |
| 487 | 3300027907 | Ga0207428_10104140 | Ga0207428_101041403 | 87 |
| 488 | 3300027907 | Ga0207428_10196071 | Ga0207428_101960713 | 87 |
| 489 | 3300030731 | Ga0316177_1067489 | Ga0316177_10674892 | 87 |
| 490 | 3300030731 | Ga0316177_1135869 | Ga0316177_11358694 | 87 |
| 491 | 3300030732 | Ga0316176_1165429 | Ga0316176_11654292 | 87 |
| 492 | 3300030735 | Ga0316178_1030111 | Ga0316178_10301112 | 87 |
| 493 | 3300030736 | Ga0316180_1173247 | Ga0316180_11732473 | 87 |
| 494 | 3300030745 | Ga0316182_1024771 | Ga0316182_10247712 | 87 |
| 495 | 3300030745 | Ga0316182_1341137 | Ga0316182_13411373 | 87 |
| 496 | 3300030745 | Ga0316182_1353000 | Ga0316182_13530004 | 87 |
| 497 | 3300031456 | Ga0307513_10311570 | Ga0307513_103115703 | 87 |
| 498 | 3300031548 | Ga0307408_100013052 | Ga0307408_1000130521 | 87 |
| 499 | 3300031548 | Ga0307408_100098769 | Ga0307408_1000987693 | 87 |
| 500 | 3300031731 | Ga0307405_10105091 | Ga0307405_101050912 | 87 |
| 501 | 3300031731 | Ga0307405_10255410 | Ga0307405_102554103 | 87 |
| 502 | 3300031824 | Ga0307413_10000786 | Ga0307413_1000078613 | 87 |
| 503 | 3300031824 | Ga0307413_10262491 | Ga0307413_102624912 | 87 |
| 504 | 3300031852 | Ga0307410_10024269 | Ga0307410_100242693 | 87 |
| 505 | 3300031903 | Ga0307407_10139205 | Ga0307407_101392052 | 87 |
| 506 | 3300031911 | Ga0307412_10132058 | Ga0307412_101320584 | 87 |
| 507 | 3300031911 | Ga0307412_10142178 | Ga0307412_101421783 | 87 |
| 508 | 3300031911 | Ga0307412_10323070 | Ga0307412_103230702 | 87 |
| 509 | 3300031995 | Ga0307409_100001420 | Ga0307409_1000014209 | 87 |
| 510 | 3300032002 | Ga0307416_100005028 | Ga0307416_1000050289 | 87 |
| 511 | 3300032002 | Ga0307416_100213961 | Ga0307416_1002139613 | 87 |
| 512 | 3300032004 | Ga0307414_10001899 | Ga0307414_100018999 | 87 |
| 513 | 3300032004 | Ga0307414_11478608 | Ga0307414_114786081 | 87 |
| 514 | 3300032005 | Ga0307411_10043757 | Ga0307411_100437574 | 87 |
| 515 | 3300032005 | Ga0307411_10074236 | Ga0307411_100742363 | 87 |
| 516 | 3300032126 | Ga0307415_100016768 | Ga0307415_1000167687 | 87 |
| 517 | 3300032126 | Ga0307415_100469458 | Ga0307415_1004694582 | 87 |
| 518 | 3300035083 | Ga0373926_0062845 | Ga0373926_0062845_902_1165 | 87 |
| 519 | 3300035112 | Ga0373932_0015782 | Ga0373932_0015782_1001_1264 | 87 |
| 520 | 3300035170 | Ga0373943_0176766 | Ga0373943_0176766_594_857 | 87 |
| 521 | 3300036401 | Ga0373937_0207565 | Ga0373937_0207565_1314_1577 | 87 |
| 522 | 3300037068 | Ga0373925_0340038 | Ga0373925_0340038_607_870 | 87 |
| 523 | 3300037312 | Ga0395899_0042641 | Ga0395899_0042641_2889_3152 | 87 |
| 524 | 3300037312 | Ga0395899_0557547 | Ga0395899_0557547_420_698 | 87 |
| 525 | 3300037312 | Ga0395899_0626258 | Ga0395899_0626258_376_660 | 87 |
| 526 | 3300037418 | Ga0395900_0000343 | Ga0395900_0000343_32990_33286 | 87 |
| 527 | 3300037418 | Ga0395900_0014151 | Ga0395900_0014151_1305_1583 | 87 |
| 528 | 3300037418 | Ga0395900_0028034 | Ga0395900_0028034_2379_2642 | 87 |
| 529 | 3300037418 | Ga0395900_0072494 | Ga0395900_0072494_892_1176 | 87 |
| 530 | 3300037418 | Ga0395900_0131889 | Ga0395900_0131889_517_801 | 87 |
| 531 | 3300037466 | Ga0395898_0050228 | Ga0395898_0050228_2061_2324 | 87 |
| 532 | 3300037466 | Ga0395898_0111616 | Ga0395898_0111616_412_690 | 87 |
| 533 | 3300037471 | Ga0395905_0011743 | Ga0395905_0011743_2189_2461 | 87 |
| 534 | 3300037471 | Ga0395905_0034540 | Ga0395905_0034540_1409_1687 | 87 |
| 535 | 3300038443 | Ga0395901_0000033 | Ga0395901_0000033_31633_31929 | 87 |
| 536 | 3300038443 | Ga0395901_0024025 | Ga0395901_0024025_3595_3858 | 87 |
| 537 | 3300038443 | Ga0395901_1235360 | Ga0395901_1235360_75_359 | 87 |
| 538 | 3300038443 | Ga0395901_1380681 | Ga0395901_1380681_74_352 | 87 |
| 539 | 3300038443 | Ga0395901_1826976 | Ga0395901_1826976_232_522 | 87 |
| 540 | 3300039447 | Ga0436361_0329036 | Ga0436361_0329036_508_780 | 87 |
| 541 | 3300041413 | Ga0439465_0196117 | Ga0439465_0196117_351_629 | 87 |
| 542 | 3300041999 | Ga0439433_0021264 | Ga0439433_0021264_366_629 | 87 |
| 543 | 3300042005 | Ga0439448_0001668 | Ga0439448_0001668_668_961 | 87 |
| 544 | 3300042005 | Ga0439448_0017001 | Ga0439448_0017001_1834_2130 | 87 |
| 545 | 3300042008 | Ga0439450_005262 | Ga0439450_005262_1746_2042 | 87 |
| 546 | 3300042008 | Ga0439450_039712 | Ga0439450_039712_239_532 | 87 |
| 547 | 3300042012 | Ga0439455_0004502 | Ga0439455_0004502_1948_2244 | 87 |
| 548 | 3300042012 | Ga0439455_0014952 | Ga0439455_0014952_162_455 | 87 |
| 549 | 3300042115 | Ga0450911_015461 | Ga0450911_015461_700_996 | 87 |
| 550 | 3300042121 | Ga0450919_022120 | Ga0450919_022120_242_523 | 87 |
| 551 | 3300042157 | Ga0439458_0141351 | Ga0439458_0141351_206_499 | 87 |
| 552 | 3300042435 | Ga0439434_0042555 | Ga0439434_0042555_636_899 | 87 |
| 553 | 3300042461 | Ga0439460_0137148 | Ga0439460_0137148_79_342 | 87 |
| 554 | 3300044656 | Ga0466969_0115966 | Ga0466969_0115966_839_1135 | 87 |
| 555 | 3300044683 | Ga0466965_0006865 | Ga0466965_0006865_4713_5009 | 87 |
| 556 | 3300044683 | Ga0466965_0037658 | Ga0466965_0037658_1952_2224 | 87 |
| 557 | 3300044684 | Ga0466966_0048702 | Ga0466966_0048702_1023_1319 | 87 |
| 558 | 3300044693 | Ga0466961_0036223 | Ga0466961_0036223_1073_1369 | 87 |
| 559 | 3300044694 | Ga0466963_0337507 | Ga0466963_0337507_422_700 | 87 |
| 560 | 3300044706 | Ga0466964_0025958 | Ga0466964_0025958_333_629 | 87 |
| 561 | 3300044706 | Ga0466964_0050572 | Ga0466964_0050572_222_500 | 87 |
| 562 | 3300044719 | Ga0466971_0144368 | Ga0466971_0144368_484_780 | 87 |
| 563 | 3300044765 | Ga0466970_0306533 | Ga0466970_0306533_424_720 | 87 |
| 564 | 3300044842 | Ga0466957_0005776 | Ga0466957_0005776_6002_6298 | 87 |
| 565 | 3300044842 | Ga0466957_0035160 | Ga0466957_0035160_2566_2838 | 87 |
| 566 | 3300045049 | Ga0466959_0037085 | Ga0466959_0037085_3224_3520 | 87 |
| 567 | 3300045836 | Ga0466958_0087841 | Ga0466958_0087841_1609_1908 | 87 |
| 568 | 3300045836 | Ga0466958_0187611 | Ga0466958_0187611_948_1226 | 87 |
| 569 | 3300045836 | Ga0466958_0281819 | Ga0466958_0281819_635_931 | 87 |
| 570 | 3300046452 | Ga0495617_000136 | Ga0495617_000136_41886_42158 | 87 |
| 571 | 3300046452 | Ga0495617_071844 | Ga0495617_071844_53_325 | 87 |
| 572 | 3300046455 | Ga0495603_0005092 | Ga0495603_0005092_1676_1948 | 87 |
| 573 | 3300046455 | Ga0495603_0025584 | Ga0495603_0025584_1338_1610 | 87 |
| 574 | 3300046457 | Ga0495590_0024568 | Ga0495590_0024568_1030_1326 | 87 |
| 575 | 3300046459 | Ga0495629_0001542 | Ga0495629_0001542_7444_7716 | 87 |
| 576 | 3300046459 | Ga0495629_0021310 | Ga0495629_0021310_1475_1747 | 87 |
| 577 | 3300046459 | Ga0495629_0152798 | Ga0495629_0152798_1273_1545 | 87 |
| 578 | 3300046463 | Ga0495653_0038844 | Ga0495653_0038844_2200_2484 | 87 |
| 579 | 3300046463 | Ga0495653_0059962 | Ga0495653_0059962_1047_1319 | 87 |
| 580 | 3300046472 | Ga0495580_0043058 | Ga0495580_0043058_1125_1409 | 87 |
| 581 | 3300046472 | Ga0495580_0600533 | Ga0495580_0600533_383_655 | 87 |
| 582 | 3300046473 | Ga0495582_0012022 | Ga0495582_0012022_1444_1716 | 87 |
| 583 | 3300046473 | Ga0495582_0052614 | Ga0495582_0052614_1918_2202 | 87 |
| 584 | 3300046474 | Ga0495605_0000237 | Ga0495605_0000237_40564_40860 | 87 |
| 585 | 3300046474 | Ga0495605_0162545 | Ga0495605_0162545_392_664 | 87 |
| 586 | 3300046491 | Ga0495584_0000021 | Ga0495584_0000021_107711_107983 | 87 |
| 587 | 3300046491 | Ga0495584_0004887 | Ga0495584_0004887_1376_1648 | 87 |
| 588 | 3300046491 | Ga0495584_0006086 | Ga0495584_0006086_2570_2842 | 87 |
| 589 | 3300046491 | Ga0495584_0008826 | Ga0495584_0008826_4637_4936 | 87 |
| 590 | 3300046491 | Ga0495584_0059005 | Ga0495584_0059005_925_1197 | 87 |
| 591 | 3300046491 | Ga0495584_0086487 | Ga0495584_0086487_916_1188 | 87 |
| 592 | 3300046491 | Ga0495584_0222473 | Ga0495584_0222473_630_938 | 87 |
| 593 | 3300046491 | Ga0495584_0329487 | Ga0495584_0329487_296_568 | 87 |
| 594 | 3300046492 | Ga0495585_0000005 | Ga0495585_0000005_74665_74937 | 87 |
| 595 | 3300046492 | Ga0495585_0001467 | Ga0495585_0001467_3033_3332 | 87 |
| 596 | 3300046492 | Ga0495585_0012965 | Ga0495585_0012965_4570_4869 | 87 |
| 597 | 3300046492 | Ga0495585_0020200 | Ga0495585_0020200_2742_3014 | 87 |
| 598 | 3300046492 | Ga0495585_0034439 | Ga0495585_0034439_1146_1418 | 87 |
| 599 | 3300046492 | Ga0495585_0215273 | Ga0495585_0215273_314_586 | 87 |
| 600 | 3300046492 | Ga0495585_0543016 | Ga0495585_0543016_171_443 | 87 |
| 601 | 3300046499 | Ga0495594_0001115 | Ga0495594_0001115_7050_7322 | 87 |
| 602 | 3300046499 | Ga0495594_0001246 | Ga0495594_0001246_10533_10817 | 87 |
| 603 | 3300046499 | Ga0495594_0008633 | Ga0495594_0008633_882_1181 | 87 |
| 604 | 3300046499 | Ga0495594_0036691 | Ga0495594_0036691_1165_1437 | 87 |
| 605 | 3300046499 | Ga0495594_0051830 | Ga0495594_0051830_1692_1964 | 87 |
| 606 | 3300046499 | Ga0495594_0063605 | Ga0495594_0063605_1325_1597 | 87 |
| 607 | 3300046499 | Ga0495594_0153478 | Ga0495594_0153478_824_1096 | 87 |
| 608 | 3300046500 | Ga0495596_0001726 | Ga0495596_0001726_4793_5065 | 87 |
| 609 | 3300046500 | Ga0495596_0004831 | Ga0495596_0004831_3575_3847 | 87 |
| 610 | 3300046500 | Ga0495596_0010803 | Ga0495596_0010803_52_324 | 87 |
| 611 | 3300046500 | Ga0495596_0015531 | Ga0495596_0015531_1744_2043 | 87 |
| 612 | 3300046500 | Ga0495596_0031926 | Ga0495596_0031926_848_1147 | 87 |
| 613 | 3300046500 | Ga0495596_0169181 | Ga0495596_0169181_551_823 | 87 |
| 614 | 3300046501 | Ga0495607_0000552 | Ga0495607_0000552_32615_32887 | 87 |
| 615 | 3300046501 | Ga0495607_0005228 | Ga0495607_0005228_3378_3650 | 87 |
| 616 | 3300046501 | Ga0495607_0005541 | Ga0495607_0005541_1573_1869 | 87 |
| 617 | 3300046501 | Ga0495607_0021061 | Ga0495607_0021061_557_829 | 87 |
| 618 | 3300046501 | Ga0495607_0422569 | Ga0495607_0422569_235_534 | 87 |
| 619 | 3300046506 | Ga0495583_0000060 | Ga0495583_0000060_153831_154103 | 87 |
| 620 | 3300046506 | Ga0495583_0001589 | Ga0495583_0001589_5709_6017 | 87 |
| 621 | 3300046506 | Ga0495583_0028812 | Ga0495583_0028812_2141_2413 | 87 |
| 622 | 3300046506 | Ga0495583_0121994 | Ga0495583_0121994_337_609 | 87 |
| 623 | 3300046507 | Ga0495606_0000068 | Ga0495606_0000068_158583_158855 | 87 |
| 624 | 3300046507 | Ga0495606_0001419 | Ga0495606_0001419_13740_14012 | 87 |
| 625 | 3300046507 | Ga0495606_0006056 | Ga0495606_0006056_1992_2255 | 87 |
| 626 | 3300046507 | Ga0495606_0025398 | Ga0495606_0025398_1194_1466 | 87 |
| 627 | 3300046507 | Ga0495606_0365622 | Ga0495606_0365622_370_672 | 87 |
| 628 | 3300046513 | Ga0495616_0007652 | Ga0495616_0007652_1046_1348 | 87 |
| 629 | 3300046513 | Ga0495616_0008642 | Ga0495616_0008642_1028_1300 | 87 |
| 630 | 3300046513 | Ga0495616_0030110 | Ga0495616_0030110_556_828 | 87 |
| 631 | 3300046513 | Ga0495616_0052318 | Ga0495616_0052318_1305_1577 | 87 |
| 632 | 3300046513 | Ga0495616_0052592 | Ga0495616_0052592_1124_1396 | 87 |
| 633 | 3300046517 | Ga0495630_0978335 | Ga0495630_0978335_278_550 | 87 |
| 634 | 3300046518 | Ga0495631_0000794 | Ga0495631_0000794_3009_3308 | 87 |
| 635 | 3300046518 | Ga0495631_0002897 | Ga0495631_0002897_4960_5259 | 87 |
| 636 | 3300046518 | Ga0495631_0029997 | Ga0495631_0029997_1685_1957 | 87 |
| 637 | 3300046518 | Ga0495631_0040735 | Ga0495631_0040735_749_1021 | 87 |
| 638 | 3300046518 | Ga0495631_0112521 | Ga0495631_0112521_133_405 | 87 |
| 639 | 3300046519 | Ga0495632_0001532 | Ga0495632_0001532_1811_2083 | 87 |
| 640 | 3300046519 | Ga0495632_0005151 | Ga0495632_0005151_5864_6136 | 87 |
| 641 | 3300046519 | Ga0495632_0063202 | Ga0495632_0063202_695_979 | 87 |
| 642 | 3300046519 | Ga0495632_0123117 | Ga0495632_0123117_615_887 | 87 |
| 643 | 3300046519 | Ga0495632_0204060 | Ga0495632_0204060_516_812 | 87 |
| 644 | 3300046520 | Ga0495637_0001439 | Ga0495637_0001439_2582_2881 | 87 |
| 645 | 3300046520 | Ga0495637_0147508 | Ga0495637_0147508_576_848 | 87 |
| 646 | 3300046520 | Ga0495637_0220673 | Ga0495637_0220673_267_539 | 87 |
| 647 | 3300046522 | Ga0495643_0000411 | Ga0495643_0000411_41279_41551 | 87 |
| 648 | 3300046522 | Ga0495643_0002022 | Ga0495643_0002022_2119_2418 | 87 |
| 649 | 3300046522 | Ga0495643_0006330 | Ga0495643_0006330_35_331 | 87 |
| 650 | 3300046522 | Ga0495643_0007639 | Ga0495643_0007639_4867_5163 | 87 |
| 651 | 3300046522 | Ga0495643_0022214 | Ga0495643_0022214_1455_1727 | 87 |
| 652 | 3300046522 | Ga0495643_0118899 | Ga0495643_0118899_559_831 | 87 |
| 653 | 3300046522 | Ga0495643_0331733 | Ga0495643_0331733_313_615 | 87 |
| 654 | 3300046523 | Ga0495644_0001232 | Ga0495644_0001232_1207_1479 | 87 |
| 655 | 3300046523 | Ga0495644_0039826 | Ga0495644_0039826_1160_1432 | 87 |
| 656 | 3300046524 | Ga0495648_0000076 | Ga0495648_0000076_54500_54772 | 87 |
| 657 | 3300046524 | Ga0495648_0050158 | Ga0495648_0050158_470_766 | 87 |
| 658 | 3300046526 | Ga0495666_0002872 | Ga0495666_0002872_2264_2548 | 87 |
| 659 | 3300046526 | Ga0495666_0032240 | Ga0495666_0032240_15_287 | 87 |
| 660 | 3300046526 | Ga0495666_0089262 | Ga0495666_0089262_364_636 | 87 |
| 661 | 3300046526 | Ga0495666_0092058 | Ga0495666_0092058_1109_1381 | 87 |
| 662 | 3300046528 | Ga0495642_0009867 | Ga0495642_0009867_677_949 | 87 |
| 663 | 3300046528 | Ga0495642_0012001 | Ga0495642_0012001_2546_2818 | 87 |
| 664 | 3300046528 | Ga0495642_0043363 | Ga0495642_0043363_1102_1401 | 87 |
| 665 | 3300046528 | Ga0495642_0059845 | Ga0495642_0059845_421_723 | 87 |
| 666 | 3300046530 | Ga0495654_0069756 | Ga0495654_0069756_990_1262 | 87 |
| 667 | 3300046530 | Ga0495654_0116543 | Ga0495654_0116543_395_667 | 87 |
| 668 | 3300046531 | Ga0495665_0045193 | Ga0495665_0045193_1120_1392 | 87 |
| 669 | 3300046535 | Ga0495586_0016407 | Ga0495586_0016407_1417_1701 | 87 |
| 670 | 3300046535 | Ga0495586_0027395 | Ga0495586_0027395_1351_1623 | 87 |
| 671 | 3300046535 | Ga0495586_0028846 | Ga0495586_0028846_2267_2539 | 87 |
| 672 | 3300046535 | Ga0495586_0226760 | Ga0495586_0226760_407_679 | 87 |
| 673 | 3300046536 | Ga0495587_0057286 | Ga0495587_0057286_683_967 | 87 |
| 674 | 3300046536 | Ga0495587_0074097 | Ga0495587_0074097_1653_1937 | 87 |
| 675 | 3300046537 | Ga0495598_0049206 | Ga0495598_0049206_917_1180 | 87 |
| 676 | 3300046538 | Ga0495609_0000039 | Ga0495609_0000039_88614_88916 | 87 |
| 677 | 3300046538 | Ga0495609_0007261 | Ga0495609_0007261_807_1079 | 87 |
| 678 | 3300046538 | Ga0495609_0045721 | Ga0495609_0045721_805_1077 | 87 |
| 679 | 3300046542 | Ga0495597_0000808 | Ga0495597_0000808_5936_6235 | 87 |
| 680 | 3300046542 | Ga0495597_0010399 | Ga0495597_0010399_2327_2599 | 87 |
| 681 | 3300046542 | Ga0495597_0044333 | Ga0495597_0044333_1085_1357 | 87 |
| 682 | 3300046542 | Ga0495597_0049435 | Ga0495597_0049435_1234_1506 | 87 |
| 683 | 3300046542 | Ga0495597_0081444 | Ga0495597_0081444_1100_1372 | 87 |
| 684 | 3300046542 | Ga0495597_0192952 | Ga0495597_0192952_116_388 | 87 |
| 685 | 3300046542 | Ga0495597_0310778 | Ga0495597_0310778_268_564 | 87 |
| 686 | 3300046557 | Ga0495622_0007685 | Ga0495622_0007685_2276_2548 | 87 |
| 687 | 3300046557 | Ga0495622_0120436 | Ga0495622_0120436_839_1111 | 87 |
| 688 | 3300046557 | Ga0495622_0120835 | Ga0495622_0120835_693_965 | 87 |
| 689 | 3300046558 | Ga0495633_0004458 | Ga0495633_0004458_2891_3163 | 87 |
| 690 | 3300046558 | Ga0495633_0013226 | Ga0495633_0013226_3054_3326 | 87 |
| 691 | 3300046558 | Ga0495633_0125818 | Ga0495633_0125818_473_745 | 87 |
| 692 | 3300046558 | Ga0495633_0311792 | Ga0495633_0311792_174_482 | 87 |
| 693 | 3300046558 | Ga0495633_0429892 | Ga0495633_0429892_136_408 | 87 |
| 694 | 3300046615 | Ga0495656_0055968 | Ga0495656_0055968_507_779 | 87 |
| 695 | 3300046615 | Ga0495656_0144795 | Ga0495656_0144795_152_415 | 87 |
| 696 | 3300046615 | Ga0495656_0173899 | Ga0495656_0173899_75_347 | 87 |
| 697 | 3300046615 | Ga0495656_0698157 | Ga0495656_0698157_230_502 | 87 |
| 698 | 3300046616 | Ga0495668_0000493 | Ga0495668_0000493_13353_13652 | 87 |
| 699 | 3300046616 | Ga0495668_0018090 | Ga0495668_0018090_3029_3337 | 87 |
| 700 | 3300046616 | Ga0495668_0039812 | Ga0495668_0039812_1431_1703 | 87 |
| 701 | 3300046616 | Ga0495668_0123190 | Ga0495668_0123190_385_657 | 87 |
| 702 | 3300046616 | Ga0495668_0525150 | Ga0495668_0525150_267_569 | 87 |
| 703 | 3300046642 | Ga0495634_0062148 | Ga0495634_0062148_1271_1555 | 87 |
| 704 | 3300046648 | Ga0495611_0000546 | Ga0495611_0000546_15395_15694 | 87 |
| 705 | 3300046648 | Ga0495611_0013556 | Ga0495611_0013556_1794_2066 | 87 |
| 706 | 3300046648 | Ga0495611_0013763 | Ga0495611_0013763_973_1245 | 87 |
| 707 | 3300046648 | Ga0495611_0030470 | Ga0495611_0030470_551_823 | 87 |
| 708 | 3300046648 | Ga0495611_0035363 | Ga0495611_0035363_1564_1836 | 87 |
| 709 | 3300046660 | Ga0495625_0145443 | Ga0495625_0145443_693_965 | 87 |
| 710 | 3300046663 | Ga0495635_0024257 | Ga0495635_0024257_1711_1983 | 87 |
| 711 | 3300046664 | Ga0495659_0000054 | Ga0495659_0000054_19207_19479 | 87 |
| 712 | 3300046665 | Ga0495661_0000094 | Ga0495661_0000094_18653_18955 | 87 |
| 713 | 3300046665 | Ga0495661_0000638 | Ga0495661_0000638_6041_6337 | 87 |
| 714 | 3300046665 | Ga0495661_0003699 | Ga0495661_0003699_4145_4417 | 87 |
| 715 | 3300046665 | Ga0495661_0009088 | Ga0495661_0009088_4960_5256 | 87 |
| 716 | 3300046665 | Ga0495661_0010487 | Ga0495661_0010487_4547_4846 | 87 |
| 717 | 3300046665 | Ga0495661_0085948 | Ga0495661_0085948_367_639 | 87 |
| 718 | 3300046665 | Ga0495661_0091910 | Ga0495661_0091910_635_943 | 87 |
| 719 | 3300046665 | Ga0495661_0150872 | Ga0495661_0150872_171_443 | 87 |
| 720 | 3300046665 | Ga0495661_0310725 | Ga0495661_0310725_20_292 | 87 |
| 721 | 3300046674 | Ga0495588_0000110 | Ga0495588_0000110_19044_19322 | 87 |
| 722 | 3300046674 | Ga0495588_0008482 | Ga0495588_0008482_3420_3692 | 87 |
| 723 | 3300046674 | Ga0495588_0013683 | Ga0495588_0013683_3385_3657 | 87 |
| 724 | 3300046674 | Ga0495588_0077333 | Ga0495588_0077333_103_375 | 87 |
| 725 | 3300046674 | Ga0495588_0207780 | Ga0495588_0207780_305_604 | 87 |
| 726 | 3300046683 | Ga0495658_1057741 | Ga0495658_1057741_240_503 | 87 |
| 727 | 3300046684 | Ga0495669_0000041 | Ga0495669_0000041_43330_43602 | 87 |
| 728 | 3300046684 | Ga0495669_0003144 | Ga0495669_0003144_1369_1668 | 87 |
| 729 | 3300046684 | Ga0495669_0042156 | Ga0495669_0042156_512_784 | 87 |
| 730 | 3300046691 | Ga0495670_0014196 | Ga0495670_0014196_1028_1300 | 87 |
| 731 | 3300046691 | Ga0495670_0071938 | Ga0495670_0071938_1059_1331 | 87 |
| 732 | 3300046691 | Ga0495670_0183320 | Ga0495670_0183320_77_376 | 87 |
| 733 | 3300046691 | Ga0495670_0200145 | Ga0495670_0200145_674_946 | 87 |
| 734 | 3300046691 | Ga0495670_0227746 | Ga0495670_0227746_510_773 | 87 |
| 735 | 3300046691 | Ga0495670_0365424 | Ga0495670_0365424_29_301 | 87 |
| 736 | 3300046691 | Ga0495670_0398366 | Ga0495670_0398366_340_612 | 87 |
| 737 | 3300046692 | Ga0495671_0000314 | Ga0495671_0000314_3649_3921 | 87 |
| 738 | 3300046692 | Ga0495671_0000796 | Ga0495671_0000796_16643_16951 | 87 |
| 739 | 3300046692 | Ga0495671_0567247 | Ga0495671_0567247_32_304 | 87 |
| 740 | 3300046694 | Ga0495649_0000049 | Ga0495649_0000049_18313_18612 | 87 |
| 741 | 3300046694 | Ga0495649_0002757 | Ga0495649_0002757_4425_4697 | 87 |
| 742 | 3300046694 | Ga0495649_0016666 | Ga0495649_0016666_762_1034 | 87 |
| 743 | 3300046694 | Ga0495649_0210152 | Ga0495649_0210152_553_825 | 87 |
| 744 | 3300046694 | Ga0495649_0243215 | Ga0495649_0243215_254_550 | 87 |
| 745 | 3300046794 | Ga0495589_0000019 | Ga0495589_0000019_90385_90687 | 87 |
| 746 | 3300046794 | Ga0495589_0005107 | Ga0495589_0005107_3886_4158 | 87 |
| 747 | 3300046794 | Ga0495589_0040875 | Ga0495589_0040875_16_312 | 87 |
| 748 | 3300046794 | Ga0495589_0045988 | Ga0495589_0045988_600_872 | 87 |
| 749 | 3300046794 | Ga0495589_0070221 | Ga0495589_0070221_678_950 | 87 |
| 750 | 3300046809 | Ga0495600_0730771 | Ga0495600_0730771_290_562 | 87 |
| 751 | 3300046810 | Ga0495660_0000245 | Ga0495660_0000245_28171_28467 | 87 |
| 752 | 3300046810 | Ga0495660_0011872 | Ga0495660_0011872_1503_1802 | 87 |
| 753 | 3300046810 | Ga0495660_0036706 | Ga0495660_0036706_385_657 | 87 |
| 754 | 3300047315 | Ga0495581_0007820 | Ga0495581_0007820_4238_4510 | 87 |
| 755 | 3300047315 | Ga0495581_0077960 | Ga0495581_0077960_270_542 | 87 |
| 756 | 3300047315 | Ga0495581_0090888 | Ga0495581_0090888_1407_1679 | 87 |
| 757 | 3300047315 | Ga0495581_0422355 | Ga0495581_0422355_73_345 | 87 |
| 758 | 3300047317 | Ga0495604_0020138 | Ga0495604_0020138_2822_3094 | 87 |
| 759 | 3300047317 | Ga0495604_0128224 | Ga0495604_0128224_691_975 | 87 |
| 760 | 3300047318 | Ga0495636_0003923 | Ga0495636_0003923_4669_4941 | 87 |
| 761 | 3300047318 | Ga0495636_0416534 | Ga0495636_0416534_258_530 | 87 |
| 762 | 3300047319 | Ga0495674_0015849 | Ga0495674_0015849_5708_5980 | 87 |
| 763 | 3300047320 | Ga0495672_0005588 | Ga0495672_0005588_4152_4448 | 87 |
| 764 | 3300047320 | Ga0495672_0034309 | Ga0495672_0034309_2845_3117 | 87 |
| 765 | 3300047321 | Ga0495676_0065088 | Ga0495676_0065088_312_584 | 87 |
| 766 | 3300047322 | Ga0495680_0010535 | Ga0495680_0010535_6651_6923 | 87 |
| 767 | 3300047322 | Ga0495680_0270071 | Ga0495680_0270071_869_1141 | 87 |
| 768 | 3300047323 | Ga0495683_0007061 | Ga0495683_0007061_3056_3328 | 87 |
| 769 | 3300047323 | Ga0495683_0007206 | Ga0495683_0007206_2997_3296 | 87 |
| 770 | 3300047323 | Ga0495683_0012690 | Ga0495683_0012690_2662_2934 | 87 |
| 771 | 3300047323 | Ga0495683_0035195 | Ga0495683_0035195_2220_2516 | 87 |
| 772 | 3300047323 | Ga0495683_0078302 | Ga0495683_0078302_771_1043 | 87 |
| 773 | 3300047323 | Ga0495683_0376248 | Ga0495683_0376248_270_542 | 87 |
| 774 | 3300047443 | Ga0495687_000059 | Ga0495687_000059_88614_88916 | 87 |
| 775 | 3300047443 | Ga0495687_001460 | Ga0495687_001460_4167_4463 | 87 |
| 776 | 3300047444 | Ga0495675_0014947 | Ga0495675_0014947_3206_3490 | 87 |
| 777 | 3300047444 | Ga0495675_0033154 | Ga0495675_0033154_1296_1568 | 87 |
| 778 | 3300047445 | Ga0495677_0000006 | Ga0495677_0000006_110315_110617 | 87 |
| 779 | 3300047445 | Ga0495677_0000667 | Ga0495677_0000667_162_458 | 87 |
| 780 | 3300047445 | Ga0495677_0001645 | Ga0495677_0001645_8340_8612 | 87 |
| 781 | 3300047445 | Ga0495677_0002047 | Ga0495677_0002047_7218_7490 | 87 |
| 782 | 3300047445 | Ga0495677_0003240 | Ga0495677_0003240_608_880 | 87 |
| 783 | 3300047445 | Ga0495677_0020023 | Ga0495677_0020023_540_812 | 87 |
| 784 | 3300047445 | Ga0495677_0029222 | Ga0495677_0029222_772_1080 | 87 |
| 785 | 3300047445 | Ga0495677_0035926 | Ga0495677_0035926_104_403 | 87 |
| 786 | 3300047446 | Ga0495679_015954 | Ga0495679_015954_254_526 | 87 |
| 787 | 3300047446 | Ga0495679_055495 | Ga0495679_055495_226_498 | 87 |
| 788 | 3300047447 | Ga0495685_058589 | Ga0495685_058589_231_503 | 87 |
| 789 | 3300047470 | Ga0495681_0004532 | Ga0495681_0004532_3009_3308 | 87 |
| 790 | 3300047470 | Ga0495681_0005786 | Ga0495681_0005786_5890_6162 | 87 |
| 791 | 3300047470 | Ga0495681_0052139 | Ga0495681_0052139_814_1086 | 87 |
| 792 | 3300047470 | Ga0495681_0071547 | Ga0495681_0071547_524_796 | 87 |
| 793 | 3300047470 | Ga0495681_0179624 | Ga0495681_0179624_378_650 | 87 |
| 794 | 3300047472 | Ga0495686_0150041 | Ga0495686_0150041_854_1150 | 87 |
| 795 | 3300047472 | Ga0495686_0735421 | Ga0495686_0735421_72_371 | 87 |
| 796 | 3300047673 | Ga0495593_0011331 | Ga0495593_0011331_1818_2090 | 87 |
| 797 | 3300047673 | Ga0495593_0600215 | Ga0495593_0600215_95_367 | 87 |
| 798 | 3300048088 | Ga0495602_0042409 | Ga0495602_0042409_592_876 | 87 |
| 799 | 3300048089 | Ga0495614_0002399 | Ga0495614_0002399_6638_6910 | 87 |
| 800 | 3300048089 | Ga0495614_0014899 | Ga0495614_0014899_172_444 | 87 |
| 801 | 3300048089 | Ga0495614_0088806 | Ga0495614_0088806_270_542 | 87 |
| 802 | 3300048091 | Ga0495626_0000103 | Ga0495626_0000103_12469_12765 | 87 |
| 803 | 3300048091 | Ga0495626_0000494 | Ga0495626_0000494_35017_35319 | 87 |
| 804 | 3300048091 | Ga0495626_0000711 | Ga0495626_0000711_22198_22470 | 87 |
| 805 | 3300048091 | Ga0495626_0001658 | Ga0495626_0001658_14112_14411 | 87 |
| 806 | 3300048091 | Ga0495626_0001661 | Ga0495626_0001661_9008_9307 | 87 |
| 807 | 3300048091 | Ga0495626_0011706 | Ga0495626_0011706_2082_2354 | 87 |
| 808 | 3300048091 | Ga0495626_0057416 | Ga0495626_0057416_941_1213 | 87 |
| 809 | 3300048091 | Ga0495626_0098694 | Ga0495626_0098694_815_1087 | 87 |
| 810 | 3300048091 | Ga0495626_0154940 | Ga0495626_0154940_529_801 | 87 |
| 811 | 3300048091 | Ga0495626_0210110 | Ga0495626_0210110_453_725 | 87 |
| 812 | 3300048903 | Ga0496100_0071042 | Ga0496100_0071042_2000_2278 | 87 |
| 813 | 3300048904 | Ga0496101_0119277 | Ga0496101_0119277_529_807 | 87 |
| 814 | 3300048905 | Ga0496102_0314305 | Ga0496102_0314305_1063_1335 | 87 |
| 815 | 3300048905 | Ga0496102_1081108 | Ga0496102_1081108_43_327 | 87 |
| 816 | 3300048906 | Ga0496103_0403362 | Ga0496103_0403362_517_801 | 87 |
| 817 | 3300048909 | Ga0496106_0516771 | Ga0496106_0516771_489_767 | 87 |
| 818 | 3300048910 | Ga0496107_0005997 | Ga0496107_0005997_5409_5693 | 87 |
| 819 | 3300048916 | Ga0496113_0587872 | Ga0496113_0587872_299_562 | 87 |
| 820 | 3300048918 | Ga0496115_0253476 | Ga0496115_0253476_1135_1407 | 87 |
| 821 | 3300048927 | Ga0496124_0065837 | Ga0496124_0065837_1677_1973 | 87 |
| 822 | 3300049128 | Ga0501308_042493 | Ga0501308_042493_53_349 | 87 |
| 823 | 3300049459 | Ga0495678_000104 | Ga0495678_000104_70392_70691 | 87 |
| 824 | 3300049459 | Ga0495678_003393 | Ga0495678_003393_5018_5290 | 87 |
| 825 | 3300049514 | Ga0501291_033852 | Ga0501291_033852_277_540 | 87 |
| 826 | 3300049515 | Ga0501292_012174 | Ga0501292_012174_930_1193 | 87 |
| 827 | 3300049522 | Ga0501299_053153 | Ga0501299_053153_23_286 | 87 |
| 828 | 3300049539 | Ga0501323_035947 | Ga0501323_035947_293_565 | 87 |
| 829 | 3300049575 | Ga0501039_0473772 | Ga0501039_0473772_436_699 | 87 |
| 830 | 3300049590 | Ga0501074_0548293 | Ga0501074_0548293_55_318 | 87 |
| 831 | 3300049591 | Ga0501075_0903534 | Ga0501075_0903534_103_366 | 87 |
| 832 | 3300049660 | Ga0501216_041735 | Ga0501216_041735_31_294 | 87 |
| 833 | 3300049667 | Ga0501230_041549 | Ga0501230_041549_354_617 | 87 |
| 834 | 3300049669 | Ga0501235_122519 | Ga0501235_122519_150_422 | 87 |
| 835 | 3300049669 | Ga0501235_185550 | Ga0501235_185550_165_428 | 87 |
| 836 | 3300049679 | Ga0501249_041483 | Ga0501249_041483_162_443 | 87 |
| 837 | 3300049680 | Ga0501250_097281 | Ga0501250_097281_116_379 | 87 |
| 838 | 3300049686 | Ga0501257_174061 | Ga0501257_174061_233_505 | 87 |
| 839 | 3300049743 | Ga0501081_0715051 | Ga0501081_0715051_13_294 | 87 |
| 840 | 3300049761 | Ga0501264_004047 | Ga0501264_004047_898_1161 | 87 |
| 841 | 3300049763 | Ga0501266_037682 | Ga0501266_037682_253_516 | 87 |
| 842 | 3300049765 | Ga0501268_106392 | Ga0501268_106392_269_532 | 87 |
| 843 | 3300049775 | Ga0501279_013648 | Ga0501279_013648_519_791 | 87 |
| 844 | 3300049775 | Ga0501279_055350 | Ga0501279_055350_301_564 | 87 |
| 845 | 3300049822 | Ga0501035_0000652 | Ga0501035_0000652_21425_21721 | 87 |
| 846 | 3300049823 | Ga0501044_0314037 | Ga0501044_0314037_153_449 | 87 |
| 847 | 3300049823 | Ga0501044_0429750 | Ga0501044_0429750_209_481 | 87 |
| 848 | 3300050507 | nmdc:mga05p37_14950_c1 | nmdc:mga05p37_14950_c1_7592_7870 | 87 |
| 849 | 3300050507 | nmdc:mga05p37_1649784_c1 | nmdc:mga05p37_1649784_c1_166_429 | 87 |
| 850 | 3300050507 | nmdc:mga05p37_411053_c1 | nmdc:mga05p37_411053_c1_363_626 | 87 |
| 851 | 3300050508 | nmdc:mga09592_374167_c1 | nmdc:mga09592_374167_c1_665_928 | 87 |
| 852 | 3300050509 | nmdc:mga0qj67_63662_c1 | nmdc:mga0qj67_63662_c1_1130_1393 | 87 |
| 853 | 3300050510 | nmdc:mga06r32_142015_c1 | nmdc:mga06r32_142015_c1_1555_1818 | 87 |
| 854 | 3300050510 | nmdc:mga06r32_1933774_c1 | nmdc:mga06r32_1933774_c1_97_360 | 87 |
| 855 | 3300050510 | nmdc:mga06r32_474902_c1 | nmdc:mga06r32_474902_c1_613_876 | 87 |
| 856 | 3300050510 | nmdc:mga06r32_94743_c1 | nmdc:mga06r32_94743_c1_886_1149 | 87 |
| 857 | 3300050511 | nmdc:mga08y16_349636_c1 | nmdc:mga08y16_349636_c1_444_707 | 87 |
| 858 | 3300050511 | nmdc:mga08y16_902080_c1 | nmdc:mga08y16_902080_c1_446_709 | 87 |
| 859 | 3300050512 | nmdc:mga0n895_1263821_c1 | nmdc:mga0n895_1263821_c1_96_359 | 87 |
| 860 | 3300050512 | nmdc:mga0n895_130130_c1 | nmdc:mga0n895_130130_c1_1662_1925 | 87 |
| 861 | 3300050512 | nmdc:mga0n895_449961_c1 | nmdc:mga0n895_449961_c1_116_394 | 87 |
| 862 | 3300050512 | nmdc:mga0n895_45644_c1 | nmdc:mga0n895_45644_c1_2681_2944 | 87 |
| 863 | 3300050513 | nmdc:mga0rr50_129386_c1 | nmdc:mga0rr50_129386_c1_222_485 | 87 |
| 864 | 3300050513 | nmdc:mga0rr50_317653_c1 | nmdc:mga0rr50_317653_c1_380_658 | 87 |
| 865 | 3300050514 | nmdc:mga08x19_131057_c1 | nmdc:mga08x19_131057_c1_440_703 | 87 |
| 866 | 3300050514 | nmdc:mga08x19_901988_c1 | nmdc:mga08x19_901988_c1_141_419 | 87 |
| 867 | 3300050515 | nmdc:mga0a205_27400_c1 | nmdc:mga0a205_27400_c1_2368_2646 | 87 |
| 868 | 3300050515 | nmdc:mga0a205_8501_c1 | nmdc:mga0a205_8501_c1_6279_6542 | 87 |
| 869 | 3300059421 | Ga0590071_052039 | Ga0590071_052039_276_539 | 87 |
| 870 | 3300059641 | Ga0587068_065168 | Ga0587068_065168_14_310 | 87 |
| 871 | 3300059647 | Ga0587079_100248 | Ga0587079_100248_42_320 | 87 |
| 872 | 3300061719 | Ga0466962_0026811 | Ga0466962_0026811_2029_2325 | 87 |
| 873 | 3300061734 | Ga0530510_0217449 | Ga0530510_0217449_295_576 | 87 |
| 874 | 3300061734 | Ga0530510_0837822 | Ga0530510_0837822_373_636 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dxe-assembly2.cif.gz_J | 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col | 0.9335 | 8 | 81 |
| 1f80-assembly1.cif.gz_F | holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) | 0.9206 | 11 | 79 |
| 6lvu-assembly2.cif.gz_B | crystal structure of apo acyl carrier protein from thermotoga maritima | 0.9133 | 8 | 83 |
| 8jfh-assembly1.cif.gz_E | crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery | 0.9104 | 10 | 83 |
| 5h9g-assembly2.cif.gz_B | apo-acp from helicobacter pylori | 0.9088 | 9 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6A8_1_78_1.10.1200.10 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9227 | 12 | 85 | 1.10.1200.10 |
| 1f80F00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9206 | 11 | 79 | 1.10.1200.10 |
| af_Q7KWJ1_42_137_1.10.1200.10 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9127 | 9 | 87 | 1.10.1200.10 |
| 2cgqA00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9078 | 12 | 84 | 1.10.1200.10 |
| 1f80D00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9055 | 10 | 79 | 1.10.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G0QG68-F1-model_v4 | Acyl carrier protein (ACP) | 0.977 | 7 | 86 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |
| AF-A0A5C6CS83-F1-model_v4 | Acyl carrier protein | 0.9768 | 12 | 87 |
|
| AF-A0A430HST8-F1-model_v4 | Acyl carrier protein | 0.9751 | 7 | 86 |
|
| AF-A0A0D0K8Q1-F1-model_v4 | Acyl carrier protein (ACP) | 0.9742 | 12 | 86 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |
| AF-A0A5C4NLN9-F1-model_v4 | Acyl carrier protein | 0.9736 | 7 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar