F484290

General Info

Members Datasets Scaffolds Average Seq Length
874 393 862 90

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10991600|Ga0157372_109916003
Length 102
Sequence MVALNEMNRDELFAWVADLLAEMFELDRASLSLQSNLYADLDIDSIDAVDLAVRLKQMTDKRLQPEIFKAIRTIGDVVDALVQMAQEPSDAPAAATTEVQAA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2842711865 Duganella sp. R-73148 Isolate Unclassified
6 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
7 2857553236 Duganella sp. R-74557 Isolate Unclassified
8 2857558681 Duganella sp. R-74565 Isolate Unclassified
9 2857564685 Duganella sp. R-74599 Isolate Unclassified
10 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
11 2904424332 Duganella sp. 1411 Isolate Rhizosphere
12 2919476304 Duganella sp. 3397 Isolate Unclassified
13 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
14 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
15 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
112 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
113 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
114 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
115 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
178 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
184 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
185 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
186 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
187 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
188 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
222 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
223 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
226 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
227 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
231 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
344 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
345 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
346 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
347 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
359 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
360 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
361 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
362 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
363 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
364 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
365 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
366 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
367 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
368 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
369 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
370 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
371 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
385 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
386 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
387 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
388 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
393 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 2.29
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.04
Nodule 0.23
Rhizoplane 2.06
Rhizosphere 85.93
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214801358 2209111006 Bacteria 707
2 ARcpr5yngRDRAFT_c021294 3300000043 Bacteria 550
3 ARSoilOldRDRAFT_c005349 3300000044 Bacteria 1083
4 ARCol0yngRDRAFT_1011370 3300000652 Bacteria 654
5 JGI25154J39366_1004923 3300002738 Bacteria 2249
6 JGI25158J39367_1020692 3300002739 Bacteria 802
7 JGI25158J39367_1034970 3300002739 Bacteria 552
8 JGI25152J39213_1000052 3300002773 Bacteria 77690
9 JGI25150J39212_1000260 3300002774 Bacteria 28066
10 JGI25150J39212_1001889 3300002774 Bacteria 5505
11 JGI25150J39212_1005558 3300002774 Bacteria 2681
12 JGI25150J39212_1037262 3300002774 Bacteria 642
13 JGI25159J45721_1004841 3300002987 Bacteria 4349
14 JGI25151J46595_10045649 3300003187 Bacteria 1544
15 JGI25153J46596_10005812 3300003215 Bacteria 6414
16 JGI25161J50226_1000052 3300003374 Bacteria 107273
17 Ga0007417J51691_1120058 3300003544 Bacteria 598
18 Ga0007417J51691_1130297 3300003544 Bacteria 563
19 Ga0007409J51694_1042002 3300003575 Bacteria 631
20 Ga0007409J51694_1065768 3300003575 Bacteria 567
21 Ga0007416J51690_1069957 3300003577 Bacteria 571
22 Ga0055526_1000066 3300003771 Bacteria 101329
23 Ga0055526_1000100 3300003771 Bacteria 76578
24 Ga0055526_1000532 3300003771 Bacteria 30148
25 Ga0055526_1007832 3300003771 Bacteria 5463
26 Ga0055537_1002016 3300003773 Bacteria 7218
27 Ga0055537_1003673 3300003773 Bacteria 4652
28 Ga0055537_1016608 3300003773 Bacteria 1239
29 Ga0055524_1001361 3300003775 Bacteria 14184
30 Ga0055524_1001826 3300003775 Bacteria 11660
31 Ga0055524_1003599 3300003775 Bacteria 7471
32 Ga0055534_1003239 3300003784 Bacteria 5208
33 Ga0055534_1014270 3300003784 Bacteria 1494
34 Ga0055528_1025592 3300003790 Bacteria 1726
35 Ga0055530_10000050 3300003791 Bacteria 105620
36 Ga0055530_10003761 3300003791 Bacteria 8375
37 Ga0055530_10005107 3300003791 Bacteria 6423
38 Ga0055531_10000417 3300003794 Bacteria 40692
39 Ga0055531_10056372 3300003794 Bacteria 991
40 Ga0055543_1000038 3300004625 Bacteria 124032
41 Ga0055543_1032808 3300004625 Bacteria 900
42 Ga0065165_1000117 3300005262 Bacteria 134716
43 Ga0065165_1068256 3300005262 Bacteria 952
44 Ga0065165_1078328 3300005262 Bacteria 863
45 Ga0065716_1007397 3300005277 Bacteria 756
46 Ga0065704_10746682 3300005289 Bacteria 543
47 Ga0065712_10000441 3300005290 Bacteria 22669
48 Ga0065715_10301756 3300005293 Bacteria 1038
49 Ga0065715_10863725 3300005293 Unclassified 576
50 Ga0065707_10085234 3300005295 Bacteria 6333
51 Ga0065707_10231485 3300005295 Bacteria 1187
52 Ga0065707_10371062 3300005295 Unclassified 890
53 Ga0065707_10383819 3300005295 Bacteria 873
54 Ga0070676_10424860 3300005328 Bacteria 929
55 Ga0070676_10756834 3300005328 Unclassified 713
56 Ga0070670_101189643 3300005331 Bacteria 696
57 Ga0070666_10162094 3300005335 Bacteria 1563
58 Ga0070680_101287931 3300005336 Unclassified 632
59 Ga0070660_100093105 3300005339 Bacteria 2379
60 Ga0070660_100152177 3300005339 Bacteria 1860
61 Ga0070691_10137087 3300005341 Bacteria 1244
62 Ga0070687_100117513 3300005343 Unclassified 1515
63 Ga0070661_100141316 3300005344 Bacteria 1814
64 Ga0070661_100633787 3300005344 Bacteria 866
65 Ga0070668_102087006 3300005347 Bacteria 523
66 Ga0070669_100051245 3300005353 Unclassified 3016
67 Ga0070669_101517912 3300005353 Bacteria 582
68 Ga0070675_100496289 3300005354 Bacteria 1099
69 Ga0070671_100034253 3300005355 Bacteria 4204
70 Ga0070674_100206699 3300005356 Bacteria 1519
71 Ga0070659_100375674 3300005366 Bacteria 1196
72 Ga0070667_100441740 3300005367 Bacteria 1188
73 Ga0070709_11367593 3300005434 Bacteria 572
74 Ga0070713_100493346 3300005436 Bacteria 1155
75 Ga0070701_10681618 3300005438 Bacteria 689
76 Ga0070711_100122275 3300005439 Bacteria 1927
77 Ga0070705_100523217 3300005440 Bacteria 904
78 Ga0070705_100816530 3300005440 Bacteria 743
79 Ga0070694_101579907 3300005444 Bacteria 556
80 Ga0070708_100605515 3300005445 Bacteria 1033
81 Ga0070663_100754780 3300005455 Bacteria 831
82 Ga0070662_100705557 3300005457 Bacteria 854
83 Ga0070662_100770419 3300005457 Bacteria 817
84 Ga0070681_11426765 3300005458 Bacteria 616
85 Ga0068867_100961894 3300005459 Bacteria 772
86 Ga0070685_10450701 3300005466 Bacteria 901
87 Ga0070684_101158486 3300005535 Bacteria 727
88 Ga0070684_101942936 3300005535 Unclassified 555
89 Ga0068853_100251124 3300005539 Bacteria 1623
90 Ga0070672_100063875 3300005543 Bacteria 2908
91 Ga0070686_101309046 3300005544 Bacteria 605
92 Ga0070695_100123787 3300005545 Bacteria 1773
93 Ga0070695_100330301 3300005545 Bacteria 1136
94 Ga0068855_100028435 3300005563 Bacteria 6688
95 Ga0068855_100059700 3300005563 Bacteria 4462
96 Ga0068855_100175212 3300005563 Bacteria 2427
97 Ga0070664_100310537 3300005564 Bacteria 1427
98 Ga0068857_101162900 3300005577 Bacteria 746
99 Ga0068854_100629307 3300005578 Bacteria 919
100 Ga0068852_100266659 3300005616 Bacteria 1646
101 Ga0068864_100819125 3300005618 Bacteria 916
102 Ga0068861_100770873 3300005719 Bacteria 900
103 Ga0068851_10529453 3300005834 Bacteria 710
104 Ga0068870_10767527 3300005840 Bacteria 671
105 Ga0068858_100325778 3300005842 Unclassified 1469
106 Ga0068860_100199592 3300005843 Bacteria 1938
107 Ga0068862_100807895 3300005844 Bacteria 916
108 Ga0075432_10238350 3300006058 Unclassified 734
109 Ga0070712_100500645 3300006175 Bacteria 1018
110 Ga0075362_10045577 3300006177 Bacteria 1948
111 Ga0097621_100985980 3300006237 Bacteria 788
112 Ga0075370_10280770 3300006353 Bacteria 989
113 Ga0075370_11013201 3300006353 Bacteria 509
114 Ga0075428_100041332 3300006844 Bacteria 5071
115 Ga0075428_100458552 3300006844 Bacteria 1365
116 Ga0075428_101147718 3300006844 Unclassified 820
117 Ga0075430_100037028 3300006846 Bacteria 4135
118 Ga0075430_100667062 3300006846 Unclassified 857
119 Ga0075430_100881657 3300006846 Bacteria 737
120 Ga0075431_100056553 3300006847 Bacteria 4046
121 Ga0075431_100117444 3300006847 Bacteria 2745
122 Ga0075431_100448398 3300006847 Bacteria 1286
123 Ga0075431_100499780 3300006847 Bacteria 1207
124 Ga0075431_101811414 3300006847 Bacteria 566
125 Ga0075433_10010092 3300006852 Bacteria 7570
126 Ga0075433_10107798 3300006852 Bacteria 2470
127 Ga0075433_10306896 3300006852 Bacteria 1405
128 Ga0075433_10419657 3300006852 Bacteria 1180
129 Ga0075434_100025061 3300006871 Bacteria 5834
130 Ga0075434_100040503 3300006871 Bacteria 4612
131 Ga0075434_100113511 3300006871 Bacteria 2721
132 Ga0075434_100212084 3300006871 Bacteria 1956
133 Ga0075434_100469779 3300006871 Bacteria 1279
134 Ga0075434_101507269 3300006871 Bacteria 682
135 Ga0075429_100285419 3300006880 Bacteria 1445
136 Ga0075429_100501130 3300006880 Bacteria 1064
137 Ga0075429_101753200 3300006880 Bacteria 539
138 Ga0068865_100068899 3300006881 Bacteria 2502
139 Ga0068865_101464430 3300006881 Bacteria 611
140 Ga0075436_100042122 3300006914 Bacteria 3149
141 Ga0075436_100052471 3300006914 Unclassified 2815
142 Ga0075436_100309664 3300006914 Bacteria 1133
143 Ga0075436_100536705 3300006914 Bacteria 858
144 Ga0079104_1009935 3300006946 Bacteria 3178
145 Ga0075435_100095664 3300007076 Bacteria 2456
146 Ga0075435_100147909 3300007076 Bacteria 1974
147 Ga0075435_100189958 3300007076 Unclassified 1738
148 Ga0105244_10004503 3300009036 Bacteria 9568
149 Ga0105244_10020520 3300009036 Bacteria 3669
150 Ga0105244_10389660 3300009036 Bacteria 641
151 Ga0105240_10937369 3300009093 Bacteria 929
152 Ga0111539_10122185 3300009094 Bacteria 3052
153 Ga0111539_10204406 3300009094 Unclassified 2302
154 Ga0111539_10237262 3300009094 Bacteria 2123
155 Ga0111539_10300269 3300009094 Bacteria 1869
156 Ga0111539_13107567 3300009094 Bacteria 536
157 Ga0105245_10622927 3300009098 Bacteria 1107
158 Ga0114129_10002450 3300009147 Bacteria 25774
159 Ga0114129_10049272 3300009147 Bacteria 5918
160 Ga0114129_10105333 3300009147 Bacteria 3898
161 Ga0114129_10226564 3300009147 Bacteria 2519
162 Ga0114129_10893646 3300009147 Bacteria 1126
163 Ga0105243_10314652 3300009148 Bacteria 1424
164 Ga0105243_11104213 3300009148 Bacteria 802
165 Ga0105241_10088450 3300009174 Bacteria 2439
166 Ga0105242_10009643 3300009176 Bacteria 7399
167 Ga0105237_10785325 3300009545 Bacteria 959
168 Ga0105238_10197089 3300009551 Bacteria 1990
169 Ga0105239_10136174 3300010375 Bacteria 2734
170 Ga0105239_10262049 3300010375 Unclassified 1943
171 Ga0157323_1004503 3300012495 Bacteria 894
172 Ga0157313_1004665 3300012503 Bacteria 953
173 Ga0157324_1005512 3300012506 Bacteria 919
174 Ga0157316_1013113 3300012510 Bacteria 806
175 Ga0157338_1009589 3300012515 Bacteria 962
176 Ga0157371_11021274 3300013102 Bacteria 631
177 Ga0157374_10417320 3300013296 Bacteria 1340
178 Ga0157378_10014338 3300013297 Bacteria 6940
179 Ga0157378_10351057 3300013297 Bacteria 1441
180 Ga0163162_10040488 3300013306 Bacteria 4660
181 Ga0163162_10268593 3300013306 Bacteria 1837
182 Ga0163162_10963501 3300013306 Bacteria 964
183 Ga0157372_10991600 3300013307 Bacteria 973
184 Ga0157372_11646209 3300013307 Bacteria 739
185 Ga0163163_10715885 3300014325 Bacteria 1065
186 Ga0182008_10000203 3300014497 Bacteria 46755
187 Ga0157377_10295274 3300014745 Bacteria 1067
188 Ga0157379_10216530 3300014968 Bacteria 1735
189 Ga0157376_10116025 3300014969 Bacteria 2365
190 Ga0182006_1000002 3300015261 Bacteria 887990
191 Ga0182006_1000021 3300015261 Bacteria 280808
192 Ga0182005_1000013 3300015265 Bacteria 396391
193 Ga0209436_100337 3300025208 Bacteria 21289
194 Ga0209436_101644 3300025208 Bacteria 7466
195 Ga0207425_1000001 3300025245 Bacteria 2525432
196 Ga0207425_1000048 3300025245 Bacteria 188748
197 Ga0207425_1000484 3300025245 Bacteria 25043
198 Ga0207425_1048512 3300025245 Bacteria 783
199 Ga0209646_1000010 3300025246 Bacteria 573803
200 Ga0209129_1000001 3300025258 Bacteria 1452436
201 Ga0209129_1002463 3300025258 Bacteria 9059
202 Ga0209129_1023468 3300025258 Bacteria 1098
203 Ga0209565_1000434 3300025263 Bacteria 33659
204 Ga0209565_1001392 3300025263 Bacteria 10813
205 Ga0209565_1001483 3300025263 Bacteria 10250
206 Ga0209565_1005912 3300025263 Bacteria 3503
207 Ga0209565_1007809 3300025263 Bacteria 2846
208 Ga0209673_1016921 3300025273 Bacteria 2707
209 Ga0209130_1000059 3300025284 Bacteria 204772
210 Ga0209130_1006475 3300025284 Bacteria 3795
211 Ga0209675_1003581 3300025291 Bacteria 7309
212 Ga0209675_1013123 3300025291 Bacteria 2617
213 Ga0209025_1003379 3300025294 Bacteria 15255
214 Ga0209564_1000009 3300025295 Bacteria 950196
215 Ga0209564_1000045 3300025295 Bacteria 376549
216 Ga0209564_1000219 3300025295 Bacteria 129725
217 Ga0209564_1004289 3300025295 Bacteria 8838
218 Ga0209564_1052664 3300025295 Bacteria 976
219 Ga0209758_1000166 3300025297 Bacteria 151104
220 Ga0209758_1000489 3300025297 Bacteria 64758
221 Ga0209050_1000058 3300025298 Bacteria 325558
222 Ga0209050_1000331 3300025298 Bacteria 94245
223 Ga0209050_1000398 3300025298 Bacteria 81373
224 Ga0209256_1000350 3300025299 Bacteria 74944
225 Ga0209256_1001089 3300025299 Bacteria 31291
226 Ga0209256_1003141 3300025299 Bacteria 12031
227 Ga0207426_1004130 3300025302 Bacteria 7284
228 Ga0209051_1069856 3300025303 Bacteria 1062
229 Ga0209257_1000003 3300025304 Bacteria 1702593
230 Ga0209257_1002437 3300025304 Bacteria 18503
231 Ga0207655_1005618 3300025728 Bacteria 8489
232 Ga0207655_1010491 3300025728 Bacteria 5609
233 Ga0207680_10137161 3300025903 Bacteria 1618
234 Ga0207647_10673622 3300025904 Unclassified 566
235 Ga0207645_10164371 3300025907 Bacteria 1453
236 Ga0207645_10351074 3300025907 Bacteria 987
237 Ga0207654_10050086 3300025911 Bacteria 2398
238 Ga0207693_10785502 3300025915 Bacteria 734
239 Ga0207660_10435681 3300025917 Bacteria 1059
240 Ga0207662_10192268 3300025918 Unclassified 1317
241 Ga0207657_10020487 3300025919 Bacteria 6247
242 Ga0207657_10030993 3300025919 Bacteria 4848
243 Ga0207649_10842271 3300025920 Bacteria 717
244 Ga0207681_10210272 3300025923 Bacteria 1499
245 Ga0207650_10845059 3300025925 Unclassified 777
246 Ga0207659_10097576 3300025926 Bacteria 2208
247 Ga0207690_10129957 3300025932 Unclassified 1842
248 Ga0207706_10117139 3300025933 Bacteria 2343
249 Ga0207706_11379736 3300025933 Bacteria 579
250 Ga0207709_10422916 3300025935 Bacteria 1024
251 Ga0207669_10832332 3300025937 Bacteria 767
252 Ga0207704_10676829 3300025938 Bacteria 852
253 Ga0207691_10033017 3300025940 Bacteria 4821
254 Ga0207689_10898893 3300025942 Bacteria 747
255 Ga0207679_10040567 3300025945 Unclassified 3333
256 Ga0207679_10254290 3300025945 Bacteria 1495
257 Ga0207667_10022603 3300025949 Bacteria 6941
258 Ga0207667_10095750 3300025949 Bacteria 3064
259 Ga0207667_10510595 3300025949 Bacteria 1218
260 Ga0207668_11877242 3300025972 Bacteria 540
261 Ga0207640_11731464 3300025981 Bacteria 564
262 Ga0207703_12071442 3300026035 Unclassified 545
263 Ga0207639_11131807 3300026041 Bacteria 734
264 Ga0207678_10348720 3300026067 Bacteria 1276
265 Ga0207708_11087243 3300026075 Bacteria 697
266 Ga0207702_10837877 3300026078 Bacteria 910
267 Ga0207648_10277946 3300026089 Bacteria 1497
268 Ga0207648_11181972 3300026089 Bacteria 718
269 Ga0207674_10478115 3300026116 Bacteria 1204
270 Ga0207675_100560824 3300026118 Bacteria 1142
271 Ga0207698_10472972 3300026142 Bacteria 1214
272 Ga0209281_1007260 3300027111 Bacteria 2793
273 Ga0209973_1020307 3300027252 Bacteria 877
274 Ga0209998_10039954 3300027717 Bacteria 1063
275 Ga0209974_10011054 3300027876 Bacteria 3038
276 Ga0207428_10104140 3300027907 Bacteria 2190
277 Ga0207428_10196071 3300027907 Bacteria 1521
278 Ga0268265_10705529 3300028380 Bacteria 975
279 Ga0316177_1067489 3300030731 Bacteria 729
280 Ga0316177_1135869 3300030731 Bacteria 3119
281 Ga0316176_1165429 3300030732 Bacteria 822
282 Ga0316178_1030111 3300030735 Bacteria 952
283 Ga0316180_1173247 3300030736 Bacteria 1875
284 Ga0316181_1155464 3300030744 Bacteria 8057
285 Ga0316182_1024771 3300030745 Bacteria 864
286 Ga0316182_1341137 3300030745 Bacteria 801
287 Ga0316182_1353000 3300030745 Bacteria 2076
288 Ga0307513_10311570 3300031456 Bacteria 1336
289 Ga0307408_100000024 3300031548 Bacteria 279725
290 Ga0307408_100000786 3300031548 Bacteria 25524
291 Ga0307408_100009316 3300031548 Bacteria 6473
292 Ga0307408_100013052 3300031548 Bacteria 5512
293 Ga0307408_100098769 3300031548 Bacteria 2220
294 Ga0307405_10105091 3300031731 Bacteria 1901
295 Ga0307405_10255410 3300031731 Bacteria 1306
296 Ga0307413_10000786 3300031824 Bacteria 11016
297 Ga0307413_10262491 3300031824 Bacteria 1288
298 Ga0307410_10024269 3300031852 Bacteria 3786
299 Ga0307407_10139205 3300031903 Bacteria 1564
300 Ga0307412_10132058 3300031911 Bacteria 1815
301 Ga0307412_10142178 3300031911 Bacteria 1759
302 Ga0307412_10323070 3300031911 Bacteria 1229
303 Ga0307409_100001420 3300031995 Bacteria 11744
304 Ga0307416_100005028 3300032002 Bacteria 8063
305 Ga0307416_100213961 3300032002 Bacteria 1841
306 Ga0307414_10001899 3300032004 Bacteria 10807
307 Ga0307414_11478608 3300032004 Bacteria 632
308 Ga0307414_11832630 3300032004 Bacteria 566
309 Ga0307411_10043757 3300032005 Bacteria 2867
310 Ga0307411_10074236 3300032005 Bacteria 2317
311 Ga0307415_100016768 3300032126 Bacteria 4376
312 Ga0307415_100469458 3300032126 Bacteria 1093
313 Ga0373926_0062845 3300035083 Bacteria 1356
314 Ga0373929_0062691 3300035085 Bacteria 874
315 Ga0373932_0015782 3300035112 Bacteria 1920
316 Ga0373943_0176766 3300035170 Bacteria 1171
317 Ga0373931_0389526 3300035691 Bacteria 880
318 Ga0373937_0207565 3300036401 Bacteria 1842
319 Ga0373925_0340038 3300037068 Bacteria 1217
320 Ga0395899_0042641 3300037312 Bacteria 3386
321 Ga0395899_0557547 3300037312 Bacteria 735
322 Ga0395899_0626258 3300037312 Bacteria 682
323 Ga0395900_0000343 3300037418 Bacteria 68342
324 Ga0395900_0014151 3300037418 Bacteria 8147
325 Ga0395900_0028034 3300037418 Bacteria 5766
326 Ga0395900_0072494 3300037418 Bacteria 3540
327 Ga0395900_0131889 3300037418 Bacteria 2560
328 Ga0395898_0050228 3300037466 Bacteria 4082
329 Ga0395898_0111616 3300037466 Bacteria 2620
330 Ga0395905_0011743 3300037471 Bacteria 8455
331 Ga0395905_0034540 3300037471 Bacteria 4748
332 Ga0395905_0899679 3300037471 Bacteria 788
333 Ga0395901_0000033 3300038443 Bacteria 232357
334 Ga0395901_0024025 3300038443 Bacteria 6251
335 Ga0395901_1235360 3300038443 Bacteria 711
336 Ga0395901_1380681 3300038443 Bacteria 663
337 Ga0395901_1826976 3300038443 Bacteria 556
338 Ga0436361_0329036 3300039447 Bacteria 870
339 Ga0436361_0715686 3300039447 Bacteria 8398
340 Ga0439465_0196117 3300041413 Bacteria 734
341 Ga0451843_1127621 3300041509 Bacteria 726
342 Ga0439433_0021264 3300041999 Unclassified 1451
343 Ga0439448_0001668 3300042005 Bacteria 5823
344 Ga0439448_0017001 3300042005 Bacteria 2218
345 Ga0439448_0068228 3300042005 Bacteria 1182
346 Ga0439450_005262 3300042008 Bacteria 2267
347 Ga0439450_039712 3300042008 Bacteria 1088
348 Ga0439454_075217 3300042011 Bacteria 605
349 Ga0439455_0004502 3300042012 Bacteria 2764
350 Ga0439455_0014952 3300042012 Bacteria 1779
351 Ga0439455_0160672 3300042012 Bacteria 642
352 Ga0450911_015461 3300042115 Bacteria 1011
353 Ga0450919_022120 3300042121 Bacteria 718
354 Ga0439458_0141351 3300042157 Bacteria 641
355 Ga0439434_0042555 3300042435 Bacteria 1396
356 Ga0439464_0055119 3300042439 Bacteria 1156
357 Ga0439460_0137148 3300042461 Bacteria 809
358 Ga0450918_116887 3300042531 Bacteria 531
359 Ga0451577_0971137 3300042876 Bacteria 763
360 Ga0466969_0115966 3300044656 Bacteria 1250
361 Ga0466981_0471458 3300044669 Bacteria 717
362 Ga0466982_0155755 3300044672 Bacteria 1395
363 Ga0466965_0006865 3300044683 Bacteria 5202
364 Ga0466965_0037658 3300044683 Bacteria 2375
365 Ga0466966_0048702 3300044684 Bacteria 2699
366 Ga0466961_0036223 3300044693 Bacteria 3167
367 Ga0466963_0337507 3300044694 Bacteria 1061
368 Ga0466964_0025958 3300044706 Bacteria 2290
369 Ga0466964_0050572 3300044706 Bacteria 1704
370 Ga0466971_0144368 3300044719 Bacteria 1109
371 Ga0466970_0306533 3300044765 Bacteria 896
372 Ga0466957_0005776 3300044842 Bacteria 6953
373 Ga0466957_0035160 3300044842 Bacteria 3007
374 Ga0466959_0037085 3300045049 Bacteria 3601
375 Ga0451576_0442275 3300045051 Unclassified 1364
376 Ga0451576_0892854 3300045051 Bacteria 932
377 Ga0466958_0087841 3300045836 Bacteria 1920
378 Ga0466958_0187611 3300045836 Bacteria 1313
379 Ga0466958_0281819 3300045836 Bacteria 1065
380 Ga0495617_000136 3300046452 Bacteria 48660
381 Ga0495617_001313 3300046452 Bacteria 11067
382 Ga0495617_002222 3300046452 Bacteria 7895
383 Ga0495617_071844 3300046452 Bacteria 1138
384 Ga0495627_078961 3300046453 Bacteria 955
385 Ga0495603_0005092 3300046455 Bacteria 7853
386 Ga0495603_0025584 3300046455 Bacteria 3569
387 Ga0495590_0000003 3300046457 Bacteria 478593
388 Ga0495590_0012377 3300046457 Bacteria 3166
389 Ga0495590_0024568 3300046457 Bacteria 2123
390 Ga0495590_0064625 3300046457 Bacteria 1280
391 Ga0495629_0001542 3300046459 Bacteria 18094
392 Ga0495629_0021310 3300046459 Bacteria 4624
393 Ga0495629_0152798 3300046459 Bacteria 1604
394 Ga0495638_0000091 3300046460 Bacteria 146548
395 Ga0495638_0032890 3300046460 Bacteria 3319
396 Ga0495638_0048943 3300046460 Bacteria 2644
397 Ga0495638_0066703 3300046460 Bacteria 2211
398 Ga0495638_0074696 3300046460 Bacteria 2067
399 Ga0495653_0000013 3300046463 Bacteria 250453
400 Ga0495653_0038844 3300046463 Bacteria 3734
401 Ga0495653_0059962 3300046463 Bacteria 2884
402 Ga0495650_0000097 3300046471 Bacteria 216051
403 Ga0495650_0001058 3300046471 Bacteria 30529
404 Ga0495650_0003792 3300046471 Bacteria 10770
405 Ga0495650_0005750 3300046471 Bacteria 7919
406 Ga0495580_0043058 3300046472 Bacteria 3214
407 Ga0495580_0600533 3300046472 Bacteria 727
408 Ga0495582_0012022 3300046473 Bacteria 4769
409 Ga0495582_0052614 3300046473 Bacteria 2245
410 Ga0495605_0000237 3300046474 Bacteria 66607
411 Ga0495605_0000251 3300046474 Bacteria 63553
412 Ga0495605_0004340 3300046474 Bacteria 8343
413 Ga0495605_0046234 3300046474 Bacteria 2141
414 Ga0495605_0162545 3300046474 Bacteria 990
415 Ga0495584_0000021 3300046491 Bacteria 130377
416 Ga0495584_0004887 3300046491 Bacteria 7160
417 Ga0495584_0006086 3300046491 Bacteria 6351
418 Ga0495584_0008826 3300046491 Bacteria 5212
419 Ga0495584_0018503 3300046491 Bacteria 3541
420 Ga0495584_0059005 3300046491 Bacteria 1930
421 Ga0495584_0086487 3300046491 Bacteria 1579
422 Ga0495584_0092989 3300046491 Bacteria 1521
423 Ga0495584_0184660 3300046491 Bacteria 1059
424 Ga0495584_0222473 3300046491 Bacteria 959
425 Ga0495584_0329487 3300046491 Bacteria 775
426 Ga0495585_0000005 3300046492 Bacteria 328103
427 Ga0495585_0001467 3300046492 Bacteria 18447
428 Ga0495585_0002213 3300046492 Bacteria 14101
429 Ga0495585_0012965 3300046492 Bacteria 4897
430 Ga0495585_0020200 3300046492 Bacteria 3832
431 Ga0495585_0034439 3300046492 Bacteria 2862
432 Ga0495585_0043835 3300046492 Bacteria 2500
433 Ga0495585_0215273 3300046492 Bacteria 971
434 Ga0495585_0543016 3300046492 Bacteria 549
435 Ga0495585_0592766 3300046492 Bacteria 521
436 Ga0495594_0001115 3300046499 Bacteria 14012
437 Ga0495594_0001246 3300046499 Bacteria 13339
438 Ga0495594_0008633 3300046499 Bacteria 5249
439 Ga0495594_0036691 3300046499 Bacteria 2673
440 Ga0495594_0051830 3300046499 Bacteria 2258
441 Ga0495594_0063605 3300046499 Bacteria 2044
442 Ga0495594_0153478 3300046499 Bacteria 1307
443 Ga0495596_0001726 3300046500 Bacteria 12278
444 Ga0495596_0004831 3300046500 Bacteria 6476
445 Ga0495596_0010803 3300046500 Bacteria 3962
446 Ga0495596_0015531 3300046500 Bacteria 3186
447 Ga0495596_0031926 3300046500 Bacteria 2101
448 Ga0495596_0169181 3300046500 Bacteria 849
449 Ga0495607_0000552 3300046501 Bacteria 36630
450 Ga0495607_0001875 3300046501 Bacteria 17831
451 Ga0495607_0002140 3300046501 Bacteria 16475
452 Ga0495607_0005228 3300046501 Bacteria 9340
453 Ga0495607_0005541 3300046501 Bacteria 9007
454 Ga0495607_0016045 3300046501 Bacteria 4840
455 Ga0495607_0021061 3300046501 Bacteria 4106
456 Ga0495607_0422569 3300046501 Bacteria 603
457 Ga0495607_0502671 3300046501 Bacteria 537
458 Ga0495583_0000060 3300046506 Bacteria 199091
459 Ga0495583_0000155 3300046506 Bacteria 114870
460 Ga0495583_0000197 3300046506 Bacteria 101236
461 Ga0495583_0001514 3300046506 Bacteria 23104
462 Ga0495583_0001589 3300046506 Bacteria 22354
463 Ga0495583_0002755 3300046506 Bacteria 14519
464 Ga0495583_0028812 3300046506 Bacteria 2725
465 Ga0495583_0121994 3300046506 Bacteria 1096
466 Ga0495606_0000068 3300046507 Bacteria 179653
467 Ga0495606_0000141 3300046507 Bacteria 123586
468 Ga0495606_0000266 3300046507 Bacteria 92444
469 Ga0495606_0000371 3300046507 Bacteria 76806
470 Ga0495606_0000696 3300046507 Bacteria 52177
471 Ga0495606_0001419 3300046507 Bacteria 32193
472 Ga0495606_0002432 3300046507 Bacteria 21688
473 Ga0495606_0004896 3300046507 Bacteria 13112
474 Ga0495606_0006056 3300046507 Bacteria 11309
475 Ga0495606_0010295 3300046507 Bacteria 7781
476 Ga0495606_0025398 3300046507 Bacteria 4244
477 Ga0495606_0365622 3300046507 Bacteria 761
478 Ga0495610_0000003 3300046512 Bacteria 1203910
479 Ga0495610_0002073 3300046512 Bacteria 17105
480 Ga0495610_0003707 3300046512 Bacteria 11708
481 Ga0495610_0004426 3300046512 Bacteria 10394
482 Ga0495610_0008134 3300046512 Bacteria 6849
483 Ga0495610_0011693 3300046512 Bacteria 5339
484 Ga0495610_0020097 3300046512 Bacteria 3715
485 Ga0495616_0001023 3300046513 Bacteria 20012
486 Ga0495616_0007652 3300046513 Bacteria 6462
487 Ga0495616_0008642 3300046513 Bacteria 6012
488 Ga0495616_0030110 3300046513 Bacteria 2856
489 Ga0495616_0052318 3300046513 Bacteria 2033
490 Ga0495616_0052592 3300046513 Bacteria 2027
491 Ga0495616_0178052 3300046513 Bacteria 946
492 Ga0495630_0978335 3300046517 Bacteria 643
493 Ga0495631_0000794 3300046518 Bacteria 20159
494 Ga0495631_0002897 3300046518 Bacteria 9502
495 Ga0495631_0029997 3300046518 Bacteria 2469
496 Ga0495631_0040735 3300046518 Bacteria 2057
497 Ga0495631_0112521 3300046518 Bacteria 1170
498 Ga0495632_0001532 3300046519 Bacteria 19084
499 Ga0495632_0005151 3300046519 Bacteria 8724
500 Ga0495632_0063202 3300046519 Bacteria 1793
501 Ga0495632_0123117 3300046519 Bacteria 1210
502 Ga0495632_0204060 3300046519 Bacteria 899
503 Ga0495637_0000087 3300046520 Bacteria 72113
504 Ga0495637_0001405 3300046520 Bacteria 14249
505 Ga0495637_0001439 3300046520 Bacteria 14028
506 Ga0495637_0147508 3300046520 Bacteria 889
507 Ga0495637_0220673 3300046520 Bacteria 690
508 Ga0495643_0000179 3300046522 Bacteria 100406
509 Ga0495643_0000287 3300046522 Bacteria 72080
510 Ga0495643_0000411 3300046522 Bacteria 56229
511 Ga0495643_0002022 3300046522 Bacteria 16910
512 Ga0495643_0006330 3300046522 Bacteria 7823
513 Ga0495643_0007639 3300046522 Bacteria 6942
514 Ga0495643_0022214 3300046522 Bacteria 3623
515 Ga0495643_0118899 3300046522 Bacteria 1337
516 Ga0495643_0179073 3300046522 Bacteria 1031
517 Ga0495643_0331733 3300046522 Bacteria 685
518 Ga0495644_0001232 3300046523 Bacteria 10476
519 Ga0495644_0003276 3300046523 Bacteria 6403
520 Ga0495644_0015254 3300046523 Bacteria 2942
521 Ga0495644_0039826 3300046523 Bacteria 1771
522 Ga0495648_0000058 3300046524 Bacteria 156717
523 Ga0495648_0000076 3300046524 Bacteria 129413
524 Ga0495648_0003974 3300046524 Bacteria 12794
525 Ga0495648_0040255 3300046524 Bacteria 2965
526 Ga0495648_0050158 3300046524 Bacteria 2553
527 Ga0495648_0068927 3300046524 Bacteria 2061
528 Ga0495666_0002872 3300046526 Bacteria 8631
529 Ga0495666_0032240 3300046526 Bacteria 2565
530 Ga0495666_0089262 3300046526 Bacteria 1455
531 Ga0495666_0092058 3300046526 Bacteria 1430
532 Ga0495642_0003894 3300046528 Bacteria 5850
533 Ga0495642_0009867 3300046528 Bacteria 3658
534 Ga0495642_0012001 3300046528 Bacteria 3338
535 Ga0495642_0043363 3300046528 Bacteria 1834
536 Ga0495642_0059845 3300046528 Bacteria 1579
537 Ga0495654_0000074 3300046530 Bacteria 114325
538 Ga0495654_0025930 3300046530 Bacteria 3018
539 Ga0495654_0069756 3300046530 Bacteria 1668
540 Ga0495654_0116543 3300046530 Bacteria 1213
541 Ga0495654_0285936 3300046530 Bacteria 677
542 Ga0495665_0045193 3300046531 Bacteria 2339
543 Ga0495586_0016407 3300046535 Bacteria 3939
544 Ga0495586_0027395 3300046535 Bacteria 3050
545 Ga0495586_0028846 3300046535 Bacteria 2969
546 Ga0495586_0226760 3300046535 Bacteria 1062
547 Ga0495587_0057286 3300046536 Bacteria 2291
548 Ga0495587_0074097 3300046536 Bacteria 1977
549 Ga0495598_0049206 3300046537 Bacteria 1263
550 Ga0495609_0000039 3300046538 Bacteria 179384
551 Ga0495609_0005728 3300046538 Bacteria 6465
552 Ga0495609_0007261 3300046538 Bacteria 5549
553 Ga0495609_0045721 3300046538 Bacteria 1961
554 Ga0495609_0093367 3300046538 Bacteria 1307
555 Ga0495609_0187920 3300046538 Bacteria 867
556 Ga0495597_0000209 3300046542 Bacteria 53295
557 Ga0495597_0000242 3300046542 Bacteria 49561
558 Ga0495597_0000808 3300046542 Bacteria 24718
559 Ga0495597_0010399 3300046542 Bacteria 4550
560 Ga0495597_0044333 3300046542 Bacteria 1978
561 Ga0495597_0049435 3300046542 Bacteria 1858
562 Ga0495597_0081444 3300046542 Bacteria 1384
563 Ga0495597_0192952 3300046542 Bacteria 818
564 Ga0495597_0310778 3300046542 Bacteria 610
565 Ga0495622_0000054 3300046557 Bacteria 102782
566 Ga0495622_0006805 3300046557 Bacteria 5304
567 Ga0495622_0007685 3300046557 Bacteria 5009
568 Ga0495622_0120436 3300046557 Bacteria 1198
569 Ga0495622_0120835 3300046557 Bacteria 1196
570 Ga0495633_0000119 3300046558 Bacteria 106455
571 Ga0495633_0000249 3300046558 Bacteria 64232
572 Ga0495633_0002342 3300046558 Bacteria 13463
573 Ga0495633_0004458 3300046558 Bacteria 8900
574 Ga0495633_0013226 3300046558 Bacteria 4357
575 Ga0495633_0035907 3300046558 Bacteria 2377
576 Ga0495633_0118990 3300046558 Bacteria 1223
577 Ga0495633_0125818 3300046558 Bacteria 1186
578 Ga0495633_0311792 3300046558 Bacteria 714
579 Ga0495633_0429892 3300046558 Bacteria 597
580 Ga0495656_0048727 3300046615 Bacteria 1801
581 Ga0495656_0055968 3300046615 Bacteria 1703
582 Ga0495656_0144795 3300046615 Bacteria 1143
583 Ga0495656_0163172 3300046615 Bacteria 1084
584 Ga0495656_0173899 3300046615 Bacteria 1055
585 Ga0495656_0698157 3300046615 Bacteria 546
586 Ga0495668_0000466 3300046616 Bacteria 51377
587 Ga0495668_0000493 3300046616 Bacteria 49476
588 Ga0495668_0000935 3300046616 Bacteria 32582
589 Ga0495668_0018090 3300046616 Bacteria 4078
590 Ga0495668_0039812 3300046616 Bacteria 2623
591 Ga0495668_0123190 3300046616 Bacteria 1418
592 Ga0495668_0182577 3300046616 Bacteria 1149
593 Ga0495668_0525150 3300046616 Bacteria 653
594 Ga0495634_0062148 3300046642 Bacteria 2481
595 Ga0495611_0000546 3300046648 Bacteria 22058
596 Ga0495611_0013556 3300046648 Bacteria 3472
597 Ga0495611_0013763 3300046648 Bacteria 3448
598 Ga0495611_0022007 3300046648 Bacteria 2756
599 Ga0495611_0030470 3300046648 Bacteria 2372
600 Ga0495611_0035363 3300046648 Bacteria 2213
601 Ga0495611_0068446 3300046648 Bacteria 1620
602 Ga0495625_0000132 3300046660 Bacteria 115728
603 Ga0495625_0000139 3300046660 Bacteria 112271
604 Ga0495625_0002129 3300046660 Bacteria 22079
605 Ga0495625_0026955 3300046660 Bacteria 4332
606 Ga0495625_0042210 3300046660 Bacteria 3316
607 Ga0495625_0145443 3300046660 Bacteria 1596
608 Ga0495625_0873505 3300046660 Bacteria 517
609 Ga0495635_0024257 3300046663 Bacteria 4228
610 Ga0495659_0000054 3300046664 Bacteria 51199
611 Ga0495659_0012250 3300046664 Bacteria 2775
612 Ga0495659_0209215 3300046664 Bacteria 802
613 Ga0495661_0000094 3300046665 Bacteria 109394
614 Ga0495661_0000638 3300046665 Bacteria 35563
615 Ga0495661_0003699 3300046665 Bacteria 11235
616 Ga0495661_0009088 3300046665 Bacteria 6832
617 Ga0495661_0010487 3300046665 Bacteria 6321
618 Ga0495661_0085948 3300046665 Bacteria 1801
619 Ga0495661_0091910 3300046665 Bacteria 1725
620 Ga0495661_0150872 3300046665 Bacteria 1255
621 Ga0495661_0232634 3300046665 Bacteria 949
622 Ga0495661_0310725 3300046665 Bacteria 786
623 Ga0495588_0000110 3300046674 Bacteria 142825
624 Ga0495588_0008482 3300046674 Bacteria 4720
625 Ga0495588_0013683 3300046674 Bacteria 3868
626 Ga0495588_0077333 3300046674 Bacteria 1735
627 Ga0495588_0207780 3300046674 Bacteria 1034
628 Ga0495658_1057741 3300046683 Bacteria 518
629 Ga0495669_0000041 3300046684 Bacteria 88966
630 Ga0495669_0003144 3300046684 Bacteria 6798
631 Ga0495669_0042156 3300046684 Bacteria 2028
632 Ga0495670_0001500 3300046691 Bacteria 11387
633 Ga0495670_0014196 3300046691 Bacteria 3918
634 Ga0495670_0071938 3300046691 Bacteria 1751
635 Ga0495670_0081519 3300046691 Bacteria 1649
636 Ga0495670_0183320 3300046691 Bacteria 1106
637 Ga0495670_0200145 3300046691 Bacteria 1057
638 Ga0495670_0227746 3300046691 Bacteria 991
639 Ga0495670_0365424 3300046691 Bacteria 777
640 Ga0495670_0398366 3300046691 Bacteria 743
641 Ga0495670_0472284 3300046691 Bacteria 680
642 Ga0495671_0000314 3300046692 Bacteria 41125
643 Ga0495671_0000582 3300046692 Bacteria 27065
644 Ga0495671_0000796 3300046692 Bacteria 22620
645 Ga0495671_0025498 3300046692 Bacteria 3072
646 Ga0495671_0271366 3300046692 Bacteria 818
647 Ga0495671_0567247 3300046692 Bacteria 540
648 Ga0495649_0000049 3300046694 Bacteria 113865
649 Ga0495649_0002757 3300046694 Bacteria 12229
650 Ga0495649_0006737 3300046694 Bacteria 7118
651 Ga0495649_0016666 3300046694 Bacteria 4164
652 Ga0495649_0030801 3300046694 Bacteria 2961
653 Ga0495649_0148941 3300046694 Bacteria 1230
654 Ga0495649_0210152 3300046694 Bacteria 1008
655 Ga0495649_0243215 3300046694 Bacteria 926
656 Ga0495649_0337002 3300046694 Bacteria 763
657 Ga0495589_0000019 3300046794 Bacteria 200814
658 Ga0495589_0005107 3300046794 Bacteria 6944
659 Ga0495589_0040875 3300046794 Bacteria 2314
660 Ga0495589_0045988 3300046794 Bacteria 2167
661 Ga0495589_0070221 3300046794 Bacteria 1712
662 Ga0495589_0091635 3300046794 Bacteria 1476
663 Ga0495600_0730771 3300046809 Bacteria 594
664 Ga0495660_0000056 3300046810 Bacteria 134518
665 Ga0495660_0000245 3300046810 Bacteria 53011
666 Ga0495660_0005974 3300046810 Bacteria 7246
667 Ga0495660_0011872 3300046810 Bacteria 5054
668 Ga0495660_0036706 3300046810 Bacteria 2732
669 Ga0495581_0007820 3300047315 Bacteria 6191
670 Ga0495581_0077960 3300047315 Bacteria 1917
671 Ga0495581_0090888 3300047315 Bacteria 1771
672 Ga0495581_0422355 3300047315 Bacteria 777
673 Ga0495604_0020138 3300047317 Bacteria 5331
674 Ga0495604_0128224 3300047317 Bacteria 1826
675 Ga0495636_0000998 3300047318 Bacteria 10579
676 Ga0495636_0003923 3300047318 Bacteria 5806
677 Ga0495636_0416534 3300047318 Bacteria 642
678 Ga0495674_0015849 3300047319 Bacteria 7036
679 Ga0495672_0000896 3300047320 Bacteria 31234
680 Ga0495672_0005588 3300047320 Bacteria 9932
681 Ga0495672_0006771 3300047320 Bacteria 8783
682 Ga0495672_0034309 3300047320 Bacteria 3137
683 Ga0495672_0064342 3300047320 Bacteria 2100
684 Ga0495672_0374936 3300047320 Bacteria 655
685 Ga0495676_0065088 3300047321 Bacteria 2831
686 Ga0495680_0010535 3300047322 Bacteria 8252
687 Ga0495680_0270071 3300047322 Bacteria 1201
688 Ga0495683_0007061 3300047323 Bacteria 6094
689 Ga0495683_0007206 3300047323 Bacteria 6036
690 Ga0495683_0012690 3300047323 Bacteria 4423
691 Ga0495683_0028550 3300047323 Bacteria 2851
692 Ga0495683_0035195 3300047323 Bacteria 2546
693 Ga0495683_0078302 3300047323 Bacteria 1615
694 Ga0495683_0376248 3300047323 Bacteria 595
695 Ga0495687_000059 3300047443 Bacteria 179357
696 Ga0495687_000296 3300047443 Bacteria 65626
697 Ga0495687_001460 3300047443 Bacteria 21684
698 Ga0495687_001591 3300047443 Bacteria 20510
699 Ga0495687_172501 3300047443 Bacteria 715
700 Ga0495675_0014947 3300047444 Bacteria 4908
701 Ga0495675_0033154 3300047444 Bacteria 3296
702 Ga0495677_0000006 3300047445 Bacteria 199230
703 Ga0495677_0000667 3300047445 Bacteria 13868
704 Ga0495677_0001645 3300047445 Bacteria 8980
705 Ga0495677_0002047 3300047445 Bacteria 8040
706 Ga0495677_0003240 3300047445 Bacteria 6349
707 Ga0495677_0017435 3300047445 Bacteria 2603
708 Ga0495677_0020023 3300047445 Bacteria 2425
709 Ga0495677_0029222 3300047445 Bacteria 2004
710 Ga0495677_0035926 3300047445 Bacteria 1809
711 Ga0495677_0100181 3300047445 Bacteria 1096
712 Ga0495677_0139571 3300047445 Bacteria 930
713 Ga0495679_015954 3300047446 Bacteria 2729
714 Ga0495679_037879 3300047446 Bacteria 1514
715 Ga0495679_055495 3300047446 Bacteria 1176
716 Ga0495685_000076 3300047447 Bacteria 37313
717 Ga0495685_009255 3300047447 Bacteria 3285
718 Ga0495685_058589 3300047447 Bacteria 1300
719 Ga0495673_0000006 3300047469 Bacteria 908691
720 Ga0495673_0000024 3300047469 Bacteria 521349
721 Ga0495673_0035372 3300047469 Bacteria 2302
722 Ga0495681_0004532 3300047470 Bacteria 9472
723 Ga0495681_0005786 3300047470 Bacteria 8215
724 Ga0495681_0018157 3300047470 Bacteria 3883
725 Ga0495681_0052139 3300047470 Bacteria 1921
726 Ga0495681_0071547 3300047470 Bacteria 1570
727 Ga0495681_0179624 3300047470 Bacteria 870
728 Ga0495686_0001364 3300047472 Bacteria 27253
729 Ga0495686_0007184 3300047472 Bacteria 8385
730 Ga0495686_0040141 3300047472 Bacteria 2987
731 Ga0495686_0150041 3300047472 Bacteria 1369
732 Ga0495686_0735421 3300047472 Bacteria 501
733 Ga0495593_0011331 3300047673 Bacteria 5122
734 Ga0495593_0600215 3300047673 Bacteria 553
735 Ga0495602_0042409 3300048088 Bacteria 4146
736 Ga0495614_0002399 3300048089 Bacteria 8327
737 Ga0495614_0014899 3300048089 Bacteria 3396
738 Ga0495614_0088806 3300048089 Bacteria 1344
739 Ga0495626_0000103 3300048091 Bacteria 110163
740 Ga0495626_0000494 3300048091 Bacteria 39727
741 Ga0495626_0000711 3300048091 Bacteria 31405
742 Ga0495626_0001658 3300048091 Bacteria 17189
743 Ga0495626_0001661 3300048091 Bacteria 17166
744 Ga0495626_0011706 3300048091 Bacteria 4628
745 Ga0495626_0057416 3300048091 Bacteria 1780
746 Ga0495626_0098694 3300048091 Bacteria 1275
747 Ga0495626_0154940 3300048091 Bacteria 963
748 Ga0495626_0210110 3300048091 Bacteria 794
749 Ga0496100_0071042 3300048903 Bacteria 2323
750 Ga0496100_1429782 3300048903 Bacteria 546
751 Ga0496101_0119277 3300048904 Bacteria 1993
752 Ga0496102_0314305 3300048905 Bacteria 1476
753 Ga0496102_1081108 3300048905 Bacteria 722
754 Ga0496103_0000631 3300048906 Bacteria 26992
755 Ga0496103_0403362 3300048906 Bacteria 878
756 Ga0496104_0103346 3300048907 Unclassified 2730
757 Ga0496104_0199302 3300048907 Bacteria 1914
758 Ga0496106_0516771 3300048909 Bacteria 959
759 Ga0496107_0005997 3300048910 Bacteria 8332
760 Ga0496109_0291365 3300048912 Bacteria 1539
761 Ga0496111_0141539 3300048914 Bacteria 1782
762 Ga0496112_0299949 3300048915 Unclassified 1552
763 Ga0496113_0458474 3300048916 Bacteria 1024
764 Ga0496113_0587872 3300048916 Bacteria 892
765 Ga0496115_0253476 3300048918 Bacteria 1448
766 Ga0496116_0077132 3300048919 Bacteria 2084
767 Ga0496117_0000001 3300048920 Bacteria 2526244
768 Ga0496118_0000078 3300048921 Bacteria 190946
769 Ga0496122_0028447 3300048925 Bacteria 4741
770 Ga0496123_0001152 3300048926 Bacteria 39412
771 Ga0496124_0041630 3300048927 Bacteria 3962
772 Ga0496124_0065837 3300048927 Bacteria 3020
773 Ga0496124_0066257 3300048927 Bacteria 3008
774 Ga0496124_0066840 3300048927 Bacteria 2993
775 Ga0496125_0003554 3300048928 Bacteria 18777
776 Ga0501308_042493 3300049128 Bacteria 644
777 Ga0501310_001774 3300049130 Bacteria 1993
778 Ga0501343_021108 3300049132 Bacteria 576
779 Ga0501307_023262 3300049162 Bacteria 820
780 Ga0495678_000006 3300049459 Bacteria 463690
781 Ga0495678_000104 3300049459 Bacteria 103726
782 Ga0495678_000365 3300049459 Bacteria 46300
783 Ga0495678_000679 3300049459 Bacteria 31270
784 Ga0495678_003393 3300049459 Bacteria 9903
785 Ga0495678_010124 3300049459 Bacteria 4599
786 Ga0495682_0000188 3300049460 Bacteria 50664
787 Ga0495682_0001280 3300049460 Bacteria 14063
788 Ga0501291_033852 3300049514 Bacteria 873
789 Ga0501292_012174 3300049515 Unclassified 1310
790 Ga0501298_145149 3300049521 Bacteria 577
791 Ga0501299_053153 3300049522 Unclassified 841
792 Ga0501311_071086 3300049527 Bacteria 578
793 Ga0501314_036841 3300049530 Bacteria 560
794 Ga0501315_024960 3300049531 Bacteria 829
795 Ga0501317_043299 3300049533 Bacteria 695
796 Ga0501323_035947 3300049539 Bacteria 711
797 Ga0501323_082475 3300049539 Bacteria 527
798 Ga0501324_027032 3300049540 Bacteria 611
799 Ga0501335_037737 3300049551 Bacteria 563
800 Ga0501337_023380 3300049553 Bacteria 512
801 Ga0501039_0473772 3300049575 Bacteria 983
802 Ga0501074_0548293 3300049590 Bacteria 819
803 Ga0501075_0903534 3300049591 Bacteria 671
804 Ga0501216_041735 3300049660 Unclassified 879
805 Ga0501227_029843 3300049665 Bacteria 1303
806 Ga0501230_041549 3300049667 Unclassified 892
807 Ga0501235_122519 3300049669 Bacteria 652
808 Ga0501235_185550 3300049669 Unclassified 556
809 Ga0501249_004544 3300049679 Bacteria 2821
810 Ga0501249_041483 3300049679 Bacteria 1044
811 Ga0501250_097281 3300049680 Unclassified 520
812 Ga0501257_174061 3300049686 Bacteria 606
813 Ga0501081_0715051 3300049743 Unclassified 752
814 Ga0501263_039517 3300049760 Bacteria 690
815 Ga0501264_004047 3300049761 Unclassified 1330
816 Ga0501266_037682 3300049763 Unclassified 710
817 Ga0501268_106392 3300049765 Unclassified 607
818 Ga0501269_000090 3300049766 Bacteria 28652
819 Ga0501279_001886 3300049775 Bacteria 2768
820 Ga0501279_013648 3300049775 Bacteria 1114
821 Ga0501279_055350 3300049775 Unclassified 638
822 Ga0501279_066451 3300049775 Bacteria 599
823 Ga0501035_0000652 3300049822 Bacteria 38210
824 Ga0501044_0314037 3300049823 Bacteria 1493
825 Ga0501044_0429750 3300049823 Bacteria 1230
826 nmdc:mga03683_37931_c1 3300050489 Bacteria 1966
827 nmdc:mga05p37_14950_c1 3300050507 Bacteria 9317
828 nmdc:mga05p37_1649784_c1 3300050507 Unclassified 628
829 nmdc:mga05p37_411053_c1 3300050507 Bacteria 1577
830 nmdc:mga09592_374167_c1 3300050508 Bacteria 1232
831 nmdc:mga0qj67_63662_c1 3300050509 Bacteria 2933
832 nmdc:mga06r32_142015_c1 3300050510 Bacteria 2378
833 nmdc:mga06r32_1933774_c1 3300050510 Bacteria 524
834 nmdc:mga06r32_474902_c1 3300050510 Unclassified 1229
835 nmdc:mga06r32_94743_c1 3300050510 Bacteria 2921
836 nmdc:mga08y16_1859417_c1 3300050511 Bacteria 554
837 nmdc:mga08y16_349636_c1 3300050511 Bacteria 1519
838 nmdc:mga08y16_902080_c1 3300050511 Bacteria 870
839 nmdc:mga0n895_1263821_c1 3300050512 Bacteria 710
840 nmdc:mga0n895_130130_c1 3300050512 Bacteria 2542
841 nmdc:mga0n895_449961_c1 3300050512 Bacteria 1300
842 nmdc:mga0n895_45644_c1 3300050512 Bacteria 4276
843 nmdc:mga0n895_49005_c1 3300050512 Bacteria 4137
844 nmdc:mga0rr50_129386_c1 3300050513 Bacteria 2019
845 nmdc:mga0rr50_317653_c1 3300050513 Bacteria 1305
846 nmdc:mga0rr50_747643_c1 3300050513 Bacteria 835
847 nmdc:mga08x19_131057_c1 3300050514 Bacteria 1686
848 nmdc:mga08x19_535933_c1 3300050514 Bacteria 828
849 nmdc:mga08x19_901988_c1 3300050514 Bacteria 628
850 nmdc:mga0a205_190188_c1 3300050515 Unclassified 1945
851 nmdc:mga0a205_27400_c1 3300050515 Bacteria 5442
852 nmdc:mga0a205_8501_c1 3300050515 Bacteria 9337
853 Ga0500594_0141141 3300053118 Bacteria 769
854 Ga0500618_014917 3300053125 Bacteria 1974
855 Ga0500559_0211482 3300053136 Bacteria 915
856 Ga0500586_000683 3300053145 Bacteria 6948
857 Ga0590071_052039 3300059421 Bacteria 994
858 Ga0587068_065168 3300059641 Bacteria 709
859 Ga0587079_100248 3300059647 Bacteria 690
860 Ga0466962_0026811 3300061719 Bacteria 2767
861 Ga0530510_0217449 3300061734 Unclassified 1420
862 Ga0530510_0837822 3300061734 Bacteria 702

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046452 Ga0495617_002222 Ga0495617_002222_334_585 80
2 3300046491 Ga0495584_0092989 Ga0495584_0092989_28_279 80
3 3300046492 Ga0495585_0592766 Ga0495585_0592766_195_446 80
4 3300046501 Ga0495607_0502671 Ga0495607_0502671_185_436 80
5 3300046512 Ga0495610_0008134 Ga0495610_0008134_4181_4432 80
6 3300046523 Ga0495644_0003276 Ga0495644_0003276_2369_2620 80
7 3300046558 Ga0495633_0035907 Ga0495633_0035907_631_882 80
8 3300046615 Ga0495656_0048727 Ga0495656_0048727_1142_1393 80
9 3300046660 Ga0495625_0042210 Ga0495625_0042210_1342_1593 80
10 3300047445 Ga0495677_0100181 Ga0495677_0100181_16_267 80
11 3300049679 Ga0501249_004544 Ga0501249_004544_1319_1570 80
12 3300049766 Ga0501269_000090 Ga0501269_000090_5060_5311 80
13 3300050489 nmdc:mga03683_37931_c1 nmdc:mga03683_37931_c1_1334_1585 80
14 3300037471 Ga0395905_0899679 Ga0395905_0899679_328_582 81
15 3300039447 Ga0436361_0715686 Ga0436361_0715686_6114_6380 81
16 3300042531 Ga0450918_116887 Ga0450918_116887_56_310 81
17 3300046457 Ga0495590_0064625 Ga0495590_0064625_334_600 81
18 3300046474 Ga0495605_0046234 Ga0495605_0046234_532_786 81
19 3300046506 Ga0495583_0001514 Ga0495583_0001514_4256_4510 81
20 3300046513 Ga0495616_0001023 Ga0495616_0001023_15920_16174 81
21 3300046530 Ga0495654_0025930 Ga0495654_0025930_716_973 81
22 3300046615 Ga0495656_0163172 Ga0495656_0163172_615_869 81
23 3300047320 Ga0495672_0374936 Ga0495672_0374936_15_269 81
24 3300047443 Ga0495687_172501 Ga0495687_172501_128_382 81
25 3300048907 Ga0496104_0199302 Ga0496104_0199302_11_271 81
26 3300049531 Ga0501315_024960 Ga0501315_024960_410_664 81
27 3300049540 Ga0501324_027032 Ga0501324_027032_11_265 81
28 3300049665 Ga0501227_029843 Ga0501227_029843_841_1095 81
29 3300049775 Ga0501279_066451 Ga0501279_066451_221_475 81
30 3300005535 Ga0070684_101942936 Ga0070684_1019429361 82
31 iso_pu_bacteria 2643221554 2643791622 82
32 iso_pu_bacteria 2842711865 2842714497 82
33 iso_pu_bacteria 2857553236 2857553530 82
34 iso_pu_bacteria 2857558681 2857561603 82
35 iso_pu_bacteria 2857564685 2857565166 82
36 iso_pu_bacteria 2904424332 2904426475 82
37 iso_pu_bacteria 2919476304 2919481380 82
38 iso_pu_bacteria 2600255292 2601667279 83
39 iso_pu_bacteria 2643221645 2644252459 83
40 iso_pu_bacteria 2857547612 2857552530 83
41 iso_pu_bacteria 2885080285 2885082846 83
42 iso_pu_bacteria 8047673197 8047673329 83
43 3300014497 Ga0182008_10000203 Ga0182008_1000020317 84
44 3300015261 Ga0182006_1000002 Ga0182006_1000002210 84
45 3300048914 Ga0496111_0141539 Ga0496111_0141539_1244_1510 84
46 3300048919 Ga0496116_0077132 Ga0496116_0077132_1274_1540 84
47 3300048920 Ga0496117_0000001 Ga0496117_0000001_1842714_1842980 84
48 3300048921 Ga0496118_0000078 Ga0496118_0000078_151826_152092 84
49 3300048925 Ga0496122_0028447 Ga0496122_0028447_1832_2098 84
50 3300048926 Ga0496123_0001152 Ga0496123_0001152_3036_3302 84
51 3300048927 Ga0496124_0066257 Ga0496124_0066257_450_716 84
52 3300048928 Ga0496125_0003554 Ga0496125_0003554_17284_17550 84
53 3300002738 JGI25154J39366_1004923 JGI25154J39366_10049233 86
54 3300002739 JGI25158J39367_1020692 JGI25158J39367_10206921 86
55 3300002739 JGI25158J39367_1034970 JGI25158J39367_10349701 86
56 3300002774 JGI25150J39212_1001889 JGI25150J39212_10018896 86
57 3300002774 JGI25150J39212_1005558 JGI25150J39212_10055584 86
58 3300002987 JGI25159J45721_1004841 JGI25159J45721_10048413 86
59 3300003187 JGI25151J46595_10045649 JGI25151J46595_100456493 86
60 3300003374 JGI25161J50226_1000052 JGI25161J50226_100005276 86
61 3300003544 Ga0007417J51691_1130297 Ga0007417J51691_11302972 86
62 3300003771 Ga0055526_1000066 Ga0055526_100006626 86
63 3300003771 Ga0055526_1000100 Ga0055526_100010032 86
64 3300003771 Ga0055526_1000532 Ga0055526_10005323 86
65 3300003771 Ga0055526_1007832 Ga0055526_10078325 86
66 3300003773 Ga0055537_1002016 Ga0055537_10020166 86
67 3300003773 Ga0055537_1003673 Ga0055537_10036733 86
68 3300003775 Ga0055524_1001826 Ga0055524_10018265 86
69 3300003775 Ga0055524_1003599 Ga0055524_10035996 86
70 3300003784 Ga0055534_1003239 Ga0055534_10032395 86
71 3300003784 Ga0055534_1014270 Ga0055534_10142702 86
72 3300003790 Ga0055528_1025592 Ga0055528_10255921 86
73 3300003791 Ga0055530_10000050 Ga0055530_1000005059 86
74 3300003791 Ga0055530_10003761 Ga0055530_100037618 86
75 3300003791 Ga0055530_10005107 Ga0055530_100051075 86
76 3300003794 Ga0055531_10000417 Ga0055531_1000041730 86
77 3300003794 Ga0055531_10056372 Ga0055531_100563722 86
78 3300004625 Ga0055543_1000038 Ga0055543_100003842 86
79 3300004625 Ga0055543_1032808 Ga0055543_10328083 86
80 3300005262 Ga0065165_1000117 Ga0065165_100011749 86
81 3300005262 Ga0065165_1068256 Ga0065165_10682562 86
82 3300005290 Ga0065712_10000441 Ga0065712_1000044124 86
83 3300005293 Ga0065715_10301756 Ga0065715_103017562 86
84 3300005293 Ga0065715_10863725 Ga0065715_108637251 86
85 3300005295 Ga0065707_10231485 Ga0065707_102314853 86
86 3300005328 Ga0070676_10756834 Ga0070676_107568342 86
87 3300005335 Ga0070666_10162094 Ga0070666_101620943 86
88 3300005339 Ga0070660_100152177 Ga0070660_1001521773 86
89 3300005341 Ga0070691_10137087 Ga0070691_101370871 86
90 3300005343 Ga0070687_100117513 Ga0070687_1001175132 86
91 3300005344 Ga0070661_100633787 Ga0070661_1006337871 86
92 3300005353 Ga0070669_100051245 Ga0070669_1000512454 86
93 3300005354 Ga0070675_100496289 Ga0070675_1004962891 86
94 3300005355 Ga0070671_100034253 Ga0070671_1000342534 86
95 3300005366 Ga0070659_100375674 Ga0070659_1003756742 86
96 3300005434 Ga0070709_11367593 Ga0070709_113675931 86
97 3300005436 Ga0070713_100493346 Ga0070713_1004933462 86
98 3300005439 Ga0070711_100122275 Ga0070711_1001222751 86
99 3300005440 Ga0070705_100523217 Ga0070705_1005232171 86
100 3300005458 Ga0070681_11426765 Ga0070681_114267652 86
101 3300005459 Ga0068867_100961894 Ga0068867_1009618942 86
102 3300005466 Ga0070685_10450701 Ga0070685_104507013 86
103 3300005539 Ga0068853_100251124 Ga0068853_1002511242 86
104 3300005543 Ga0070672_100063875 Ga0070672_1000638753 86
105 3300005544 Ga0070686_101309046 Ga0070686_1013090461 86
106 3300005545 Ga0070695_100123787 Ga0070695_1001237873 86
107 3300005563 Ga0068855_100059700 Ga0068855_1000597004 86
108 3300005578 Ga0068854_100629307 Ga0068854_1006293072 86
109 3300005618 Ga0068864_100819125 Ga0068864_1008191252 86
110 3300005719 Ga0068861_100770873 Ga0068861_1007708732 86
111 3300005840 Ga0068870_10767527 Ga0068870_107675272 86
112 3300005842 Ga0068858_100325778 Ga0068858_1003257783 86
113 3300005844 Ga0068862_100807895 Ga0068862_1008078952 86
114 3300006058 Ga0075432_10238350 Ga0075432_102383502 86
115 3300006175 Ga0070712_100500645 Ga0070712_1005006452 86
116 3300006177 Ga0075362_10045577 Ga0075362_100455773 86
117 3300006353 Ga0075370_10280770 Ga0075370_102807702 86
118 3300006353 Ga0075370_11013201 Ga0075370_110132012 86
119 3300006844 Ga0075428_101147718 Ga0075428_1011477182 86
120 3300006871 Ga0075434_100113511 Ga0075434_1001135113 86
121 3300006880 Ga0075429_101753200 Ga0075429_1017532001 86
122 3300006914 Ga0075436_100052471 Ga0075436_1000524715 86
123 3300006946 Ga0079104_1009935 Ga0079104_10099353 86
124 3300007076 Ga0075435_100189958 Ga0075435_1001899583 86
125 3300009036 Ga0105244_10004503 Ga0105244_100045036 86
126 3300009036 Ga0105244_10020520 Ga0105244_100205203 86
127 3300009094 Ga0111539_10204406 Ga0111539_102044063 86
128 3300009098 Ga0105245_10622927 Ga0105245_106229272 86
129 3300010375 Ga0105239_10262049 Ga0105239_102620493 86
130 3300012495 Ga0157323_1004503 Ga0157323_10045032 86
131 3300012506 Ga0157324_1005512 Ga0157324_10055122 86
132 3300013296 Ga0157374_10417320 Ga0157374_104173203 86
133 3300013297 Ga0157378_10351057 Ga0157378_103510573 86
134 3300013306 Ga0163162_10963501 Ga0163162_109635012 86
135 3300014325 Ga0163163_10715885 Ga0163163_107158853 86
136 3300014745 Ga0157377_10295274 Ga0157377_102952741 86
137 3300014968 Ga0157379_10216530 Ga0157379_102165303 86
138 3300014969 Ga0157376_10116025 Ga0157376_101160253 86
139 3300015261 Ga0182006_1000021 Ga0182006_1000021186 86
140 3300015265 Ga0182005_1000013 Ga0182005_100001316 86
141 3300025208 Ga0209436_100337 Ga0209436_10033722 86
142 3300025208 Ga0209436_101644 Ga0209436_1016443 86
143 3300025245 Ga0207425_1000048 Ga0207425_1000048106 86
144 3300025245 Ga0207425_1000484 Ga0207425_100048420 86
145 3300025246 Ga0209646_1000010 Ga0209646_1000010528 86
146 3300025258 Ga0209129_1002463 Ga0209129_10024637 86
147 3300025263 Ga0209565_1000434 Ga0209565_100043413 86
148 3300025263 Ga0209565_1001392 Ga0209565_10013929 86
149 3300025263 Ga0209565_1001483 Ga0209565_10014839 86
150 3300025263 Ga0209565_1007809 Ga0209565_10078093 86
151 3300025273 Ga0209673_1016921 Ga0209673_10169211 86
152 3300025284 Ga0209130_1000059 Ga0209130_1000059111 86
153 3300025284 Ga0209130_1006475 Ga0209130_10064753 86
154 3300025291 Ga0209675_1003581 Ga0209675_10035813 86
155 3300025291 Ga0209675_1013123 Ga0209675_10131233 86
156 3300025294 Ga0209025_1003379 Ga0209025_100337917 86
157 3300025295 Ga0209564_1000009 Ga0209564_1000009616 86
158 3300025295 Ga0209564_1000045 Ga0209564_100004542 86
159 3300025295 Ga0209564_1000219 Ga0209564_100021944 86
160 3300025295 Ga0209564_1004289 Ga0209564_10042899 86
161 3300025295 Ga0209564_1052664 Ga0209564_10526642 86
162 3300025297 Ga0209758_1000489 Ga0209758_100048927 86
163 3300025298 Ga0209050_1000058 Ga0209050_1000058117 86
164 3300025298 Ga0209050_1000331 Ga0209050_100033154 86
165 3300025298 Ga0209050_1000398 Ga0209050_100039814 86
166 3300025299 Ga0209256_1001089 Ga0209256_100108928 86
167 3300025299 Ga0209256_1003141 Ga0209256_100314111 86
168 3300025302 Ga0207426_1004130 Ga0207426_10041303 86
169 3300025303 Ga0209051_1069856 Ga0209051_10698562 86
170 3300025304 Ga0209257_1000003 Ga0209257_1000003739 86
171 3300025304 Ga0209257_1002437 Ga0209257_100243714 86
172 3300025728 Ga0207655_1005618 Ga0207655_10056185 86
173 3300025728 Ga0207655_1010491 Ga0207655_10104913 86
174 3300025903 Ga0207680_10137161 Ga0207680_101371613 86
175 3300025907 Ga0207645_10164371 Ga0207645_101643713 86
176 3300025915 Ga0207693_10785502 Ga0207693_107855022 86
177 3300025918 Ga0207662_10192268 Ga0207662_101922683 86
178 3300025919 Ga0207657_10030993 Ga0207657_100309935 86
179 3300025920 Ga0207649_10842271 Ga0207649_108422712 86
180 3300025923 Ga0207681_10210272 Ga0207681_102102721 86
181 3300025925 Ga0207650_10845059 Ga0207650_108450592 86
182 3300025926 Ga0207659_10097576 Ga0207659_100975763 86
183 3300025932 Ga0207690_10129957 Ga0207690_101299573 86
184 3300025933 Ga0207706_10117139 Ga0207706_101171394 86
185 3300025940 Ga0207691_10033017 Ga0207691_100330173 86
186 3300025945 Ga0207679_10040567 Ga0207679_100405672 86
187 3300025949 Ga0207667_10510595 Ga0207667_105105953 86
188 3300026035 Ga0207703_12071442 Ga0207703_120714422 86
189 3300026041 Ga0207639_11131807 Ga0207639_111318072 86
190 3300026089 Ga0207648_10277946 Ga0207648_102779462 86
191 3300026116 Ga0207674_10478115 Ga0207674_104781153 86
192 3300026118 Ga0207675_100560824 Ga0207675_1005608242 86
193 3300027111 Ga0209281_1007260 Ga0209281_10072603 86
194 3300028380 Ga0268265_10705529 Ga0268265_107055292 86
195 3300030744 Ga0316181_1155464 Ga0316181_11554644 86
196 3300031548 Ga0307408_100000024 Ga0307408_10000002469 86
197 3300031548 Ga0307408_100000786 Ga0307408_10000078625 86
198 3300031548 Ga0307408_100009316 Ga0307408_1000093165 86
199 3300032004 Ga0307414_11832630 Ga0307414_118326301 86
200 3300035085 Ga0373929_0062691 Ga0373929_0062691_90_356 86
201 3300035691 Ga0373931_0389526 Ga0373931_0389526_311_577 86
202 3300041509 Ga0451843_1127621 Ga0451843_1127621_118_387 86
203 3300042005 Ga0439448_0068228 Ga0439448_0068228_305_571 86
204 3300042011 Ga0439454_075217 Ga0439454_075217_222_542 86
205 3300042012 Ga0439455_0160672 Ga0439455_0160672_304_570 86
206 3300042439 Ga0439464_0055119 Ga0439464_0055119_613_879 86
207 3300042876 Ga0451577_0971137 Ga0451577_0971137_181_447 86
208 3300044669 Ga0466981_0471458 Ga0466981_0471458_101_370 86
209 3300044672 Ga0466982_0155755 Ga0466982_0155755_1077_1346 86
210 3300045051 Ga0451576_0442275 Ga0451576_0442275_1042_1308 86
211 3300045051 Ga0451576_0892854 Ga0451576_0892854_308_574 86
212 3300046452 Ga0495617_001313 Ga0495617_001313_5065_5334 86
213 3300046453 Ga0495627_078961 Ga0495627_078961_163_432 86
214 3300046457 Ga0495590_0000003 Ga0495590_0000003_384927_385196 86
215 3300046457 Ga0495590_0012377 Ga0495590_0012377_750_1019 86
216 3300046460 Ga0495638_0000091 Ga0495638_0000091_114909_115178 86
217 3300046460 Ga0495638_0032890 Ga0495638_0032890_312_581 86
218 3300046460 Ga0495638_0048943 Ga0495638_0048943_2068_2337 86
219 3300046460 Ga0495638_0066703 Ga0495638_0066703_1011_1280 86
220 3300046460 Ga0495638_0074696 Ga0495638_0074696_1251_1520 86
221 3300046463 Ga0495653_0000013 Ga0495653_0000013_154982_155251 86
222 3300046471 Ga0495650_0000097 Ga0495650_0000097_70966_71235 86
223 3300046471 Ga0495650_0001058 Ga0495650_0001058_20127_20396 86
224 3300046471 Ga0495650_0003792 Ga0495650_0003792_4185_4454 86
225 3300046471 Ga0495650_0005750 Ga0495650_0005750_2559_2828 86
226 3300046474 Ga0495605_0000251 Ga0495605_0000251_29475_29744 86
227 3300046474 Ga0495605_0004340 Ga0495605_0004340_4873_5142 86
228 3300046491 Ga0495584_0018503 Ga0495584_0018503_1062_1331 86
229 3300046491 Ga0495584_0184660 Ga0495584_0184660_723_992 86
230 3300046492 Ga0495585_0002213 Ga0495585_0002213_2577_2846 86
231 3300046492 Ga0495585_0043835 Ga0495585_0043835_541_810 86
232 3300046501 Ga0495607_0001875 Ga0495607_0001875_232_501 86
233 3300046501 Ga0495607_0002140 Ga0495607_0002140_2335_2604 86
234 3300046501 Ga0495607_0016045 Ga0495607_0016045_1972_2241 86
235 3300046506 Ga0495583_0000155 Ga0495583_0000155_2280_2549 86
236 3300046506 Ga0495583_0000197 Ga0495583_0000197_70456_70725 86
237 3300046506 Ga0495583_0002755 Ga0495583_0002755_12450_12719 86
238 3300046507 Ga0495606_0000141 Ga0495606_0000141_96400_96669 86
239 3300046507 Ga0495606_0000266 Ga0495606_0000266_24593_24862 86
240 3300046507 Ga0495606_0000371 Ga0495606_0000371_66949_67218 86
241 3300046507 Ga0495606_0000696 Ga0495606_0000696_35258_35527 86
242 3300046507 Ga0495606_0002432 Ga0495606_0002432_5189_5458 86
243 3300046507 Ga0495606_0004896 Ga0495606_0004896_411_680 86
244 3300046507 Ga0495606_0010295 Ga0495606_0010295_323_592 86
245 3300046512 Ga0495610_0000003 Ga0495610_0000003_81624_81893 86
246 3300046512 Ga0495610_0002073 Ga0495610_0002073_15044_15313 86
247 3300046512 Ga0495610_0003707 Ga0495610_0003707_2427_2696 86
248 3300046512 Ga0495610_0004426 Ga0495610_0004426_4166_4435 86
249 3300046512 Ga0495610_0011693 Ga0495610_0011693_1532_1801 86
250 3300046512 Ga0495610_0020097 Ga0495610_0020097_1392_1661 86
251 3300046513 Ga0495616_0178052 Ga0495616_0178052_154_423 86
252 3300046520 Ga0495637_0000087 Ga0495637_0000087_36548_36817 86
253 3300046520 Ga0495637_0001405 Ga0495637_0001405_12692_12961 86
254 3300046522 Ga0495643_0000179 Ga0495643_0000179_25660_25929 86
255 3300046522 Ga0495643_0000287 Ga0495643_0000287_71270_71539 86
256 3300046522 Ga0495643_0179073 Ga0495643_0179073_92_361 86
257 3300046523 Ga0495644_0015254 Ga0495644_0015254_325_594 86
258 3300046524 Ga0495648_0000058 Ga0495648_0000058_77461_77730 86
259 3300046524 Ga0495648_0003974 Ga0495648_0003974_11469_11738 86
260 3300046524 Ga0495648_0040255 Ga0495648_0040255_1186_1455 86
261 3300046524 Ga0495648_0068927 Ga0495648_0068927_1411_1680 86
262 3300046528 Ga0495642_0003894 Ga0495642_0003894_3601_3870 86
263 3300046530 Ga0495654_0000074 Ga0495654_0000074_43465_43734 86
264 3300046530 Ga0495654_0285936 Ga0495654_0285936_318_587 86
265 3300046538 Ga0495609_0005728 Ga0495609_0005728_2349_2618 86
266 3300046538 Ga0495609_0093367 Ga0495609_0093367_233_502 86
267 3300046538 Ga0495609_0187920 Ga0495609_0187920_176_445 86
268 3300046542 Ga0495597_0000209 Ga0495597_0000209_50417_50686 86
269 3300046542 Ga0495597_0000242 Ga0495597_0000242_43071_43340 86
270 3300046557 Ga0495622_0000054 Ga0495622_0000054_70116_70385 86
271 3300046557 Ga0495622_0006805 Ga0495622_0006805_2300_2569 86
272 3300046558 Ga0495633_0000119 Ga0495633_0000119_82278_82547 86
273 3300046558 Ga0495633_0000249 Ga0495633_0000249_32528_32797 86
274 3300046558 Ga0495633_0002342 Ga0495633_0002342_9658_9927 86
275 3300046558 Ga0495633_0118990 Ga0495633_0118990_14_283 86
276 3300046616 Ga0495668_0000466 Ga0495668_0000466_30640_30909 86
277 3300046616 Ga0495668_0000935 Ga0495668_0000935_30593_30862 86
278 3300046616 Ga0495668_0182577 Ga0495668_0182577_804_1073 86
279 3300046648 Ga0495611_0022007 Ga0495611_0022007_2381_2650 86
280 3300046648 Ga0495611_0068446 Ga0495611_0068446_1245_1514 86
281 3300046660 Ga0495625_0000132 Ga0495625_0000132_31306_31575 86
282 3300046660 Ga0495625_0000139 Ga0495625_0000139_85634_85903 86
283 3300046660 Ga0495625_0002129 Ga0495625_0002129_2285_2554 86
284 3300046660 Ga0495625_0026955 Ga0495625_0026955_1232_1501 86
285 3300046660 Ga0495625_0873505 Ga0495625_0873505_37_306 86
286 3300046664 Ga0495659_0012250 Ga0495659_0012250_2164_2433 86
287 3300046664 Ga0495659_0209215 Ga0495659_0209215_308_577 86
288 3300046665 Ga0495661_0232634 Ga0495661_0232634_372_641 86
289 3300046691 Ga0495670_0001500 Ga0495670_0001500_5544_5813 86
290 3300046691 Ga0495670_0081519 Ga0495670_0081519_1043_1312 86
291 3300046691 Ga0495670_0472284 Ga0495670_0472284_275_544 86
292 3300046692 Ga0495671_0000582 Ga0495671_0000582_23661_23930 86
293 3300046692 Ga0495671_0025498 Ga0495671_0025498_1501_1770 86
294 3300046692 Ga0495671_0271366 Ga0495671_0271366_345_614 86
295 3300046694 Ga0495649_0006737 Ga0495649_0006737_4377_4646 86
296 3300046694 Ga0495649_0030801 Ga0495649_0030801_1350_1619 86
297 3300046694 Ga0495649_0148941 Ga0495649_0148941_196_465 86
298 3300046694 Ga0495649_0337002 Ga0495649_0337002_25_294 86
299 3300046794 Ga0495589_0091635 Ga0495589_0091635_615_884 86
300 3300046810 Ga0495660_0000056 Ga0495660_0000056_85779_86045 86
301 3300046810 Ga0495660_0005974 Ga0495660_0005974_1595_1864 86
302 3300047318 Ga0495636_0000998 Ga0495636_0000998_6980_7249 86
303 3300047320 Ga0495672_0000896 Ga0495672_0000896_4888_5157 86
304 3300047320 Ga0495672_0006771 Ga0495672_0006771_6063_6332 86
305 3300047320 Ga0495672_0064342 Ga0495672_0064342_1602_1871 86
306 3300047323 Ga0495683_0028550 Ga0495683_0028550_1960_2229 86
307 3300047443 Ga0495687_000296 Ga0495687_000296_33872_34141 86
308 3300047443 Ga0495687_001591 Ga0495687_001591_17977_18246 86
309 3300047445 Ga0495677_0017435 Ga0495677_0017435_1276_1545 86
310 3300047445 Ga0495677_0139571 Ga0495677_0139571_628_897 86
311 3300047446 Ga0495679_037879 Ga0495679_037879_582_851 86
312 3300047447 Ga0495685_000076 Ga0495685_000076_4314_4583 86
313 3300047447 Ga0495685_009255 Ga0495685_009255_2580_2849 86
314 3300047469 Ga0495673_0000006 Ga0495673_0000006_601162_601431 86
315 3300047469 Ga0495673_0000024 Ga0495673_0000024_239971_240240 86
316 3300047469 Ga0495673_0035372 Ga0495673_0035372_966_1235 86
317 3300047470 Ga0495681_0018157 Ga0495681_0018157_721_987 86
318 3300047472 Ga0495686_0001364 Ga0495686_0001364_2259_2528 86
319 3300047472 Ga0495686_0007184 Ga0495686_0007184_1274_1543 86
320 3300047472 Ga0495686_0040141 Ga0495686_0040141_1154_1423 86
321 3300048903 Ga0496100_1429782 Ga0496100_1429782_105_371 86
322 3300048906 Ga0496103_0000631 Ga0496103_0000631_18259_18528 86
323 3300048907 Ga0496104_0103346 Ga0496104_0103346_1801_2067 86
324 3300048912 Ga0496109_0291365 Ga0496109_0291365_1219_1485 86
325 3300048915 Ga0496112_0299949 Ga0496112_0299949_733_999 86
326 3300048916 Ga0496113_0458474 Ga0496113_0458474_304_570 86
327 3300048927 Ga0496124_0041630 Ga0496124_0041630_1218_1484 86
328 3300048927 Ga0496124_0066840 Ga0496124_0066840_152_421 86
329 3300049130 Ga0501310_001774 Ga0501310_001774_780_1049 86
330 3300049132 Ga0501343_021108 Ga0501343_021108_85_354 86
331 3300049162 Ga0501307_023262 Ga0501307_023262_294_563 86
332 3300049459 Ga0495678_000006 Ga0495678_000006_58018_58284 86
333 3300049459 Ga0495678_000365 Ga0495678_000365_15743_16012 86
334 3300049459 Ga0495678_000679 Ga0495678_000679_25650_25919 86
335 3300049459 Ga0495678_010124 Ga0495678_010124_1347_1616 86
336 3300049460 Ga0495682_0000188 Ga0495682_0000188_32195_32464 86
337 3300049460 Ga0495682_0001280 Ga0495682_0001280_10592_10861 86
338 3300049521 Ga0501298_145149 Ga0501298_145149_60_329 86
339 3300049527 Ga0501311_071086 Ga0501311_071086_266_535 86
340 3300049530 Ga0501314_036841 Ga0501314_036841_228_497 86
341 3300049533 Ga0501317_043299 Ga0501317_043299_55_324 86
342 3300049539 Ga0501323_082475 Ga0501323_082475_141_410 86
343 3300049551 Ga0501335_037737 Ga0501335_037737_146_415 86
344 3300049553 Ga0501337_023380 Ga0501337_023380_174_443 86
345 3300049760 Ga0501263_039517 Ga0501263_039517_90_359 86
346 3300049775 Ga0501279_001886 Ga0501279_001886_945_1214 86
347 3300050511 nmdc:mga08y16_1859417_c1 nmdc:mga08y16_1859417_c1_225_485 86
348 3300050512 nmdc:mga0n895_49005_c1 nmdc:mga0n895_49005_c1_100_366 86
349 3300050513 nmdc:mga0rr50_747643_c1 nmdc:mga0rr50_747643_c1_491_757 86
350 3300050514 nmdc:mga08x19_535933_c1 nmdc:mga08x19_535933_c1_254_520 86
351 3300050515 nmdc:mga0a205_190188_c1 nmdc:mga0a205_190188_c1_1492_1758 86
352 3300053118 Ga0500594_0141141 Ga0500594_0141141_185_454 86
353 3300053125 Ga0500618_014917 Ga0500618_014917_1144_1422 86
354 3300053136 Ga0500559_0211482 Ga0500559_0211482_98_367 86
355 3300053145 Ga0500586_000683 Ga0500586_000683_5178_5447 86
356 2209111006 2214801358 2213831042 87
357 3300000043 ARcpr5yngRDRAFT_c021294 ARcpr5yngRDRAFT_0212942 87
358 3300000044 ARSoilOldRDRAFT_c005349 ARSoilOldRDRAFT_0053493 87
359 3300000652 ARCol0yngRDRAFT_1011370 ARCol0yngRDRAFT_10113702 87
360 3300002773 JGI25152J39213_1000052 JGI25152J39213_10000525 87
361 3300002774 JGI25150J39212_1000260 JGI25150J39212_100026027 87
362 3300002774 JGI25150J39212_1037262 JGI25150J39212_10372622 87
363 3300003215 JGI25153J46596_10005812 JGI25153J46596_100058127 87
364 3300003544 Ga0007417J51691_1120058 Ga0007417J51691_11200582 87
365 3300003575 Ga0007409J51694_1042002 Ga0007409J51694_10420022 87
366 3300003575 Ga0007409J51694_1065768 Ga0007409J51694_10657682 87
367 3300003577 Ga0007416J51690_1069957 Ga0007416J51690_10699572 87
368 3300003773 Ga0055537_1016608 Ga0055537_10166083 87
369 3300003775 Ga0055524_1001361 Ga0055524_10013615 87
370 3300005262 Ga0065165_1078328 Ga0065165_10783282 87
371 3300005277 Ga0065716_1007397 Ga0065716_10073972 87
372 3300005289 Ga0065704_10746682 Ga0065704_107466821 87
373 3300005295 Ga0065707_10085234 Ga0065707_100852347 87
374 3300005295 Ga0065707_10371062 Ga0065707_103710622 87
375 3300005295 Ga0065707_10383819 Ga0065707_103838193 87
376 3300005328 Ga0070676_10424860 Ga0070676_104248602 87
377 3300005331 Ga0070670_101189643 Ga0070670_1011896432 87
378 3300005336 Ga0070680_101287931 Ga0070680_1012879311 87
379 3300005339 Ga0070660_100093105 Ga0070660_1000931053 87
380 3300005344 Ga0070661_100141316 Ga0070661_1001413162 87
381 3300005347 Ga0070668_102087006 Ga0070668_1020870062 87
382 3300005353 Ga0070669_101517912 Ga0070669_1015179122 87
383 3300005356 Ga0070674_100206699 Ga0070674_1002066993 87
384 3300005367 Ga0070667_100441740 Ga0070667_1004417402 87
385 3300005438 Ga0070701_10681618 Ga0070701_106816182 87
386 3300005440 Ga0070705_100816530 Ga0070705_1008165302 87
387 3300005444 Ga0070694_101579907 Ga0070694_1015799071 87
388 3300005445 Ga0070708_100605515 Ga0070708_1006055152 87
389 3300005455 Ga0070663_100754780 Ga0070663_1007547802 87
390 3300005457 Ga0070662_100705557 Ga0070662_1007055572 87
391 3300005457 Ga0070662_100770419 Ga0070662_1007704192 87
392 3300005535 Ga0070684_101158486 Ga0070684_1011584862 87
393 3300005545 Ga0070695_100330301 Ga0070695_1003303012 87
394 3300005563 Ga0068855_100028435 Ga0068855_1000284357 87
395 3300005563 Ga0068855_100175212 Ga0068855_1001752123 87
396 3300005564 Ga0070664_100310537 Ga0070664_1003105372 87
397 3300005577 Ga0068857_101162900 Ga0068857_1011629002 87
398 3300005616 Ga0068852_100266659 Ga0068852_1002666593 87
399 3300005834 Ga0068851_10529453 Ga0068851_105294532 87
400 3300005843 Ga0068860_100199592 Ga0068860_1001995923 87
401 3300006237 Ga0097621_100985980 Ga0097621_1009859801 87
402 3300006844 Ga0075428_100041332 Ga0075428_1000413323 87
403 3300006844 Ga0075428_100458552 Ga0075428_1004585523 87
404 3300006846 Ga0075430_100037028 Ga0075430_1000370283 87
405 3300006846 Ga0075430_100667062 Ga0075430_1006670622 87
406 3300006846 Ga0075430_100881657 Ga0075430_1008816572 87
407 3300006847 Ga0075431_100056553 Ga0075431_1000565534 87
408 3300006847 Ga0075431_100117444 Ga0075431_1001174442 87
409 3300006847 Ga0075431_100448398 Ga0075431_1004483983 87
410 3300006847 Ga0075431_100499780 Ga0075431_1004997803 87
411 3300006847 Ga0075431_101811414 Ga0075431_1018114141 87
412 3300006852 Ga0075433_10010092 Ga0075433_100100926 87
413 3300006852 Ga0075433_10107798 Ga0075433_101077983 87
414 3300006852 Ga0075433_10306896 Ga0075433_103068963 87
415 3300006852 Ga0075433_10419657 Ga0075433_104196572 87
416 3300006871 Ga0075434_100025061 Ga0075434_1000250616 87
417 3300006871 Ga0075434_100040503 Ga0075434_1000405034 87
418 3300006871 Ga0075434_100212084 Ga0075434_1002120843 87
419 3300006871 Ga0075434_100469779 Ga0075434_1004697792 87
420 3300006871 Ga0075434_101507269 Ga0075434_1015072692 87
421 3300006880 Ga0075429_100285419 Ga0075429_1002854192 87
422 3300006880 Ga0075429_100501130 Ga0075429_1005011303 87
423 3300006881 Ga0068865_100068899 Ga0068865_1000688992 87
424 3300006881 Ga0068865_101464430 Ga0068865_1014644301 87
425 3300006914 Ga0075436_100042122 Ga0075436_1000421224 87
426 3300006914 Ga0075436_100309664 Ga0075436_1003096643 87
427 3300006914 Ga0075436_100536705 Ga0075436_1005367052 87
428 3300007076 Ga0075435_100095664 Ga0075435_1000956643 87
429 3300007076 Ga0075435_100147909 Ga0075435_1001479093 87
430 3300009036 Ga0105244_10389660 Ga0105244_103896602 87
431 3300009093 Ga0105240_10937369 Ga0105240_109373693 87
432 3300009094 Ga0111539_10122185 Ga0111539_101221855 87
433 3300009094 Ga0111539_10237262 Ga0111539_102372622 87
434 3300009094 Ga0111539_10300269 Ga0111539_103002692 87
435 3300009094 Ga0111539_13107567 Ga0111539_131075671 87
436 3300009147 Ga0114129_10002450 Ga0114129_1000245017 87
437 3300009147 Ga0114129_10049272 Ga0114129_100492724 87
438 3300009147 Ga0114129_10105333 Ga0114129_101053333 87
439 3300009147 Ga0114129_10226564 Ga0114129_102265644 87
440 3300009147 Ga0114129_10893646 Ga0114129_108936462 87
441 3300009148 Ga0105243_10314652 Ga0105243_103146523 87
442 3300009148 Ga0105243_11104213 Ga0105243_111042132 87
443 3300009174 Ga0105241_10088450 Ga0105241_100884503 87
444 3300009176 Ga0105242_10009643 Ga0105242_100096437 87
445 3300009545 Ga0105237_10785325 Ga0105237_107853252 87
446 3300009551 Ga0105238_10197089 Ga0105238_101970893 87
447 3300010375 Ga0105239_10136174 Ga0105239_101361742 87
448 3300012503 Ga0157313_1004665 Ga0157313_10046651 87
449 3300012510 Ga0157316_1013113 Ga0157316_10131132 87
450 3300012515 Ga0157338_1009589 Ga0157338_10095892 87
451 3300013102 Ga0157371_11021274 Ga0157371_110212742 87
452 3300013297 Ga0157378_10014338 Ga0157378_100143388 87
453 3300013306 Ga0163162_10040488 Ga0163162_100404882 87
454 3300013306 Ga0163162_10268593 Ga0163162_102685932 87
455 3300013307 Ga0157372_10991600 Ga0157372_109916003 87
456 3300013307 Ga0157372_11646209 Ga0157372_116462092 87
457 3300025245 Ga0207425_1000001 Ga0207425_10000011818 87
458 3300025245 Ga0207425_1048512 Ga0207425_10485122 87
459 3300025258 Ga0209129_1000001 Ga0209129_1000001995 87
460 3300025258 Ga0209129_1023468 Ga0209129_10234682 87
461 3300025263 Ga0209565_1005912 Ga0209565_10059123 87
462 3300025297 Ga0209758_1000166 Ga0209758_100016648 87
463 3300025299 Ga0209256_1000350 Ga0209256_10003505 87
464 3300025904 Ga0207647_10673622 Ga0207647_106736222 87
465 3300025907 Ga0207645_10351074 Ga0207645_103510742 87
466 3300025911 Ga0207654_10050086 Ga0207654_100500863 87
467 3300025917 Ga0207660_10435681 Ga0207660_104356812 87
468 3300025919 Ga0207657_10020487 Ga0207657_100204875 87
469 3300025933 Ga0207706_11379736 Ga0207706_113797363 87
470 3300025935 Ga0207709_10422916 Ga0207709_104229163 87
471 3300025937 Ga0207669_10832332 Ga0207669_108323322 87
472 3300025938 Ga0207704_10676829 Ga0207704_106768293 87
473 3300025942 Ga0207689_10898893 Ga0207689_108988932 87
474 3300025945 Ga0207679_10254290 Ga0207679_102542902 87
475 3300025949 Ga0207667_10022603 Ga0207667_100226033 87
476 3300025949 Ga0207667_10095750 Ga0207667_100957502 87
477 3300025972 Ga0207668_11877242 Ga0207668_118772422 87
478 3300025981 Ga0207640_11731464 Ga0207640_117314642 87
479 3300026067 Ga0207678_10348720 Ga0207678_103487202 87
480 3300026075 Ga0207708_11087243 Ga0207708_110872432 87
481 3300026078 Ga0207702_10837877 Ga0207702_108378771 87
482 3300026089 Ga0207648_11181972 Ga0207648_111819722 87
483 3300026142 Ga0207698_10472972 Ga0207698_104729722 87
484 3300027252 Ga0209973_1020307 Ga0209973_10203072 87
485 3300027717 Ga0209998_10039954 Ga0209998_100399542 87
486 3300027876 Ga0209974_10011054 Ga0209974_100110543 87
487 3300027907 Ga0207428_10104140 Ga0207428_101041403 87
488 3300027907 Ga0207428_10196071 Ga0207428_101960713 87
489 3300030731 Ga0316177_1067489 Ga0316177_10674892 87
490 3300030731 Ga0316177_1135869 Ga0316177_11358694 87
491 3300030732 Ga0316176_1165429 Ga0316176_11654292 87
492 3300030735 Ga0316178_1030111 Ga0316178_10301112 87
493 3300030736 Ga0316180_1173247 Ga0316180_11732473 87
494 3300030745 Ga0316182_1024771 Ga0316182_10247712 87
495 3300030745 Ga0316182_1341137 Ga0316182_13411373 87
496 3300030745 Ga0316182_1353000 Ga0316182_13530004 87
497 3300031456 Ga0307513_10311570 Ga0307513_103115703 87
498 3300031548 Ga0307408_100013052 Ga0307408_1000130521 87
499 3300031548 Ga0307408_100098769 Ga0307408_1000987693 87
500 3300031731 Ga0307405_10105091 Ga0307405_101050912 87
501 3300031731 Ga0307405_10255410 Ga0307405_102554103 87
502 3300031824 Ga0307413_10000786 Ga0307413_1000078613 87
503 3300031824 Ga0307413_10262491 Ga0307413_102624912 87
504 3300031852 Ga0307410_10024269 Ga0307410_100242693 87
505 3300031903 Ga0307407_10139205 Ga0307407_101392052 87
506 3300031911 Ga0307412_10132058 Ga0307412_101320584 87
507 3300031911 Ga0307412_10142178 Ga0307412_101421783 87
508 3300031911 Ga0307412_10323070 Ga0307412_103230702 87
509 3300031995 Ga0307409_100001420 Ga0307409_1000014209 87
510 3300032002 Ga0307416_100005028 Ga0307416_1000050289 87
511 3300032002 Ga0307416_100213961 Ga0307416_1002139613 87
512 3300032004 Ga0307414_10001899 Ga0307414_100018999 87
513 3300032004 Ga0307414_11478608 Ga0307414_114786081 87
514 3300032005 Ga0307411_10043757 Ga0307411_100437574 87
515 3300032005 Ga0307411_10074236 Ga0307411_100742363 87
516 3300032126 Ga0307415_100016768 Ga0307415_1000167687 87
517 3300032126 Ga0307415_100469458 Ga0307415_1004694582 87
518 3300035083 Ga0373926_0062845 Ga0373926_0062845_902_1165 87
519 3300035112 Ga0373932_0015782 Ga0373932_0015782_1001_1264 87
520 3300035170 Ga0373943_0176766 Ga0373943_0176766_594_857 87
521 3300036401 Ga0373937_0207565 Ga0373937_0207565_1314_1577 87
522 3300037068 Ga0373925_0340038 Ga0373925_0340038_607_870 87
523 3300037312 Ga0395899_0042641 Ga0395899_0042641_2889_3152 87
524 3300037312 Ga0395899_0557547 Ga0395899_0557547_420_698 87
525 3300037312 Ga0395899_0626258 Ga0395899_0626258_376_660 87
526 3300037418 Ga0395900_0000343 Ga0395900_0000343_32990_33286 87
527 3300037418 Ga0395900_0014151 Ga0395900_0014151_1305_1583 87
528 3300037418 Ga0395900_0028034 Ga0395900_0028034_2379_2642 87
529 3300037418 Ga0395900_0072494 Ga0395900_0072494_892_1176 87
530 3300037418 Ga0395900_0131889 Ga0395900_0131889_517_801 87
531 3300037466 Ga0395898_0050228 Ga0395898_0050228_2061_2324 87
532 3300037466 Ga0395898_0111616 Ga0395898_0111616_412_690 87
533 3300037471 Ga0395905_0011743 Ga0395905_0011743_2189_2461 87
534 3300037471 Ga0395905_0034540 Ga0395905_0034540_1409_1687 87
535 3300038443 Ga0395901_0000033 Ga0395901_0000033_31633_31929 87
536 3300038443 Ga0395901_0024025 Ga0395901_0024025_3595_3858 87
537 3300038443 Ga0395901_1235360 Ga0395901_1235360_75_359 87
538 3300038443 Ga0395901_1380681 Ga0395901_1380681_74_352 87
539 3300038443 Ga0395901_1826976 Ga0395901_1826976_232_522 87
540 3300039447 Ga0436361_0329036 Ga0436361_0329036_508_780 87
541 3300041413 Ga0439465_0196117 Ga0439465_0196117_351_629 87
542 3300041999 Ga0439433_0021264 Ga0439433_0021264_366_629 87
543 3300042005 Ga0439448_0001668 Ga0439448_0001668_668_961 87
544 3300042005 Ga0439448_0017001 Ga0439448_0017001_1834_2130 87
545 3300042008 Ga0439450_005262 Ga0439450_005262_1746_2042 87
546 3300042008 Ga0439450_039712 Ga0439450_039712_239_532 87
547 3300042012 Ga0439455_0004502 Ga0439455_0004502_1948_2244 87
548 3300042012 Ga0439455_0014952 Ga0439455_0014952_162_455 87
549 3300042115 Ga0450911_015461 Ga0450911_015461_700_996 87
550 3300042121 Ga0450919_022120 Ga0450919_022120_242_523 87
551 3300042157 Ga0439458_0141351 Ga0439458_0141351_206_499 87
552 3300042435 Ga0439434_0042555 Ga0439434_0042555_636_899 87
553 3300042461 Ga0439460_0137148 Ga0439460_0137148_79_342 87
554 3300044656 Ga0466969_0115966 Ga0466969_0115966_839_1135 87
555 3300044683 Ga0466965_0006865 Ga0466965_0006865_4713_5009 87
556 3300044683 Ga0466965_0037658 Ga0466965_0037658_1952_2224 87
557 3300044684 Ga0466966_0048702 Ga0466966_0048702_1023_1319 87
558 3300044693 Ga0466961_0036223 Ga0466961_0036223_1073_1369 87
559 3300044694 Ga0466963_0337507 Ga0466963_0337507_422_700 87
560 3300044706 Ga0466964_0025958 Ga0466964_0025958_333_629 87
561 3300044706 Ga0466964_0050572 Ga0466964_0050572_222_500 87
562 3300044719 Ga0466971_0144368 Ga0466971_0144368_484_780 87
563 3300044765 Ga0466970_0306533 Ga0466970_0306533_424_720 87
564 3300044842 Ga0466957_0005776 Ga0466957_0005776_6002_6298 87
565 3300044842 Ga0466957_0035160 Ga0466957_0035160_2566_2838 87
566 3300045049 Ga0466959_0037085 Ga0466959_0037085_3224_3520 87
567 3300045836 Ga0466958_0087841 Ga0466958_0087841_1609_1908 87
568 3300045836 Ga0466958_0187611 Ga0466958_0187611_948_1226 87
569 3300045836 Ga0466958_0281819 Ga0466958_0281819_635_931 87
570 3300046452 Ga0495617_000136 Ga0495617_000136_41886_42158 87
571 3300046452 Ga0495617_071844 Ga0495617_071844_53_325 87
572 3300046455 Ga0495603_0005092 Ga0495603_0005092_1676_1948 87
573 3300046455 Ga0495603_0025584 Ga0495603_0025584_1338_1610 87
574 3300046457 Ga0495590_0024568 Ga0495590_0024568_1030_1326 87
575 3300046459 Ga0495629_0001542 Ga0495629_0001542_7444_7716 87
576 3300046459 Ga0495629_0021310 Ga0495629_0021310_1475_1747 87
577 3300046459 Ga0495629_0152798 Ga0495629_0152798_1273_1545 87
578 3300046463 Ga0495653_0038844 Ga0495653_0038844_2200_2484 87
579 3300046463 Ga0495653_0059962 Ga0495653_0059962_1047_1319 87
580 3300046472 Ga0495580_0043058 Ga0495580_0043058_1125_1409 87
581 3300046472 Ga0495580_0600533 Ga0495580_0600533_383_655 87
582 3300046473 Ga0495582_0012022 Ga0495582_0012022_1444_1716 87
583 3300046473 Ga0495582_0052614 Ga0495582_0052614_1918_2202 87
584 3300046474 Ga0495605_0000237 Ga0495605_0000237_40564_40860 87
585 3300046474 Ga0495605_0162545 Ga0495605_0162545_392_664 87
586 3300046491 Ga0495584_0000021 Ga0495584_0000021_107711_107983 87
587 3300046491 Ga0495584_0004887 Ga0495584_0004887_1376_1648 87
588 3300046491 Ga0495584_0006086 Ga0495584_0006086_2570_2842 87
589 3300046491 Ga0495584_0008826 Ga0495584_0008826_4637_4936 87
590 3300046491 Ga0495584_0059005 Ga0495584_0059005_925_1197 87
591 3300046491 Ga0495584_0086487 Ga0495584_0086487_916_1188 87
592 3300046491 Ga0495584_0222473 Ga0495584_0222473_630_938 87
593 3300046491 Ga0495584_0329487 Ga0495584_0329487_296_568 87
594 3300046492 Ga0495585_0000005 Ga0495585_0000005_74665_74937 87
595 3300046492 Ga0495585_0001467 Ga0495585_0001467_3033_3332 87
596 3300046492 Ga0495585_0012965 Ga0495585_0012965_4570_4869 87
597 3300046492 Ga0495585_0020200 Ga0495585_0020200_2742_3014 87
598 3300046492 Ga0495585_0034439 Ga0495585_0034439_1146_1418 87
599 3300046492 Ga0495585_0215273 Ga0495585_0215273_314_586 87
600 3300046492 Ga0495585_0543016 Ga0495585_0543016_171_443 87
601 3300046499 Ga0495594_0001115 Ga0495594_0001115_7050_7322 87
602 3300046499 Ga0495594_0001246 Ga0495594_0001246_10533_10817 87
603 3300046499 Ga0495594_0008633 Ga0495594_0008633_882_1181 87
604 3300046499 Ga0495594_0036691 Ga0495594_0036691_1165_1437 87
605 3300046499 Ga0495594_0051830 Ga0495594_0051830_1692_1964 87
606 3300046499 Ga0495594_0063605 Ga0495594_0063605_1325_1597 87
607 3300046499 Ga0495594_0153478 Ga0495594_0153478_824_1096 87
608 3300046500 Ga0495596_0001726 Ga0495596_0001726_4793_5065 87
609 3300046500 Ga0495596_0004831 Ga0495596_0004831_3575_3847 87
610 3300046500 Ga0495596_0010803 Ga0495596_0010803_52_324 87
611 3300046500 Ga0495596_0015531 Ga0495596_0015531_1744_2043 87
612 3300046500 Ga0495596_0031926 Ga0495596_0031926_848_1147 87
613 3300046500 Ga0495596_0169181 Ga0495596_0169181_551_823 87
614 3300046501 Ga0495607_0000552 Ga0495607_0000552_32615_32887 87
615 3300046501 Ga0495607_0005228 Ga0495607_0005228_3378_3650 87
616 3300046501 Ga0495607_0005541 Ga0495607_0005541_1573_1869 87
617 3300046501 Ga0495607_0021061 Ga0495607_0021061_557_829 87
618 3300046501 Ga0495607_0422569 Ga0495607_0422569_235_534 87
619 3300046506 Ga0495583_0000060 Ga0495583_0000060_153831_154103 87
620 3300046506 Ga0495583_0001589 Ga0495583_0001589_5709_6017 87
621 3300046506 Ga0495583_0028812 Ga0495583_0028812_2141_2413 87
622 3300046506 Ga0495583_0121994 Ga0495583_0121994_337_609 87
623 3300046507 Ga0495606_0000068 Ga0495606_0000068_158583_158855 87
624 3300046507 Ga0495606_0001419 Ga0495606_0001419_13740_14012 87
625 3300046507 Ga0495606_0006056 Ga0495606_0006056_1992_2255 87
626 3300046507 Ga0495606_0025398 Ga0495606_0025398_1194_1466 87
627 3300046507 Ga0495606_0365622 Ga0495606_0365622_370_672 87
628 3300046513 Ga0495616_0007652 Ga0495616_0007652_1046_1348 87
629 3300046513 Ga0495616_0008642 Ga0495616_0008642_1028_1300 87
630 3300046513 Ga0495616_0030110 Ga0495616_0030110_556_828 87
631 3300046513 Ga0495616_0052318 Ga0495616_0052318_1305_1577 87
632 3300046513 Ga0495616_0052592 Ga0495616_0052592_1124_1396 87
633 3300046517 Ga0495630_0978335 Ga0495630_0978335_278_550 87
634 3300046518 Ga0495631_0000794 Ga0495631_0000794_3009_3308 87
635 3300046518 Ga0495631_0002897 Ga0495631_0002897_4960_5259 87
636 3300046518 Ga0495631_0029997 Ga0495631_0029997_1685_1957 87
637 3300046518 Ga0495631_0040735 Ga0495631_0040735_749_1021 87
638 3300046518 Ga0495631_0112521 Ga0495631_0112521_133_405 87
639 3300046519 Ga0495632_0001532 Ga0495632_0001532_1811_2083 87
640 3300046519 Ga0495632_0005151 Ga0495632_0005151_5864_6136 87
641 3300046519 Ga0495632_0063202 Ga0495632_0063202_695_979 87
642 3300046519 Ga0495632_0123117 Ga0495632_0123117_615_887 87
643 3300046519 Ga0495632_0204060 Ga0495632_0204060_516_812 87
644 3300046520 Ga0495637_0001439 Ga0495637_0001439_2582_2881 87
645 3300046520 Ga0495637_0147508 Ga0495637_0147508_576_848 87
646 3300046520 Ga0495637_0220673 Ga0495637_0220673_267_539 87
647 3300046522 Ga0495643_0000411 Ga0495643_0000411_41279_41551 87
648 3300046522 Ga0495643_0002022 Ga0495643_0002022_2119_2418 87
649 3300046522 Ga0495643_0006330 Ga0495643_0006330_35_331 87
650 3300046522 Ga0495643_0007639 Ga0495643_0007639_4867_5163 87
651 3300046522 Ga0495643_0022214 Ga0495643_0022214_1455_1727 87
652 3300046522 Ga0495643_0118899 Ga0495643_0118899_559_831 87
653 3300046522 Ga0495643_0331733 Ga0495643_0331733_313_615 87
654 3300046523 Ga0495644_0001232 Ga0495644_0001232_1207_1479 87
655 3300046523 Ga0495644_0039826 Ga0495644_0039826_1160_1432 87
656 3300046524 Ga0495648_0000076 Ga0495648_0000076_54500_54772 87
657 3300046524 Ga0495648_0050158 Ga0495648_0050158_470_766 87
658 3300046526 Ga0495666_0002872 Ga0495666_0002872_2264_2548 87
659 3300046526 Ga0495666_0032240 Ga0495666_0032240_15_287 87
660 3300046526 Ga0495666_0089262 Ga0495666_0089262_364_636 87
661 3300046526 Ga0495666_0092058 Ga0495666_0092058_1109_1381 87
662 3300046528 Ga0495642_0009867 Ga0495642_0009867_677_949 87
663 3300046528 Ga0495642_0012001 Ga0495642_0012001_2546_2818 87
664 3300046528 Ga0495642_0043363 Ga0495642_0043363_1102_1401 87
665 3300046528 Ga0495642_0059845 Ga0495642_0059845_421_723 87
666 3300046530 Ga0495654_0069756 Ga0495654_0069756_990_1262 87
667 3300046530 Ga0495654_0116543 Ga0495654_0116543_395_667 87
668 3300046531 Ga0495665_0045193 Ga0495665_0045193_1120_1392 87
669 3300046535 Ga0495586_0016407 Ga0495586_0016407_1417_1701 87
670 3300046535 Ga0495586_0027395 Ga0495586_0027395_1351_1623 87
671 3300046535 Ga0495586_0028846 Ga0495586_0028846_2267_2539 87
672 3300046535 Ga0495586_0226760 Ga0495586_0226760_407_679 87
673 3300046536 Ga0495587_0057286 Ga0495587_0057286_683_967 87
674 3300046536 Ga0495587_0074097 Ga0495587_0074097_1653_1937 87
675 3300046537 Ga0495598_0049206 Ga0495598_0049206_917_1180 87
676 3300046538 Ga0495609_0000039 Ga0495609_0000039_88614_88916 87
677 3300046538 Ga0495609_0007261 Ga0495609_0007261_807_1079 87
678 3300046538 Ga0495609_0045721 Ga0495609_0045721_805_1077 87
679 3300046542 Ga0495597_0000808 Ga0495597_0000808_5936_6235 87
680 3300046542 Ga0495597_0010399 Ga0495597_0010399_2327_2599 87
681 3300046542 Ga0495597_0044333 Ga0495597_0044333_1085_1357 87
682 3300046542 Ga0495597_0049435 Ga0495597_0049435_1234_1506 87
683 3300046542 Ga0495597_0081444 Ga0495597_0081444_1100_1372 87
684 3300046542 Ga0495597_0192952 Ga0495597_0192952_116_388 87
685 3300046542 Ga0495597_0310778 Ga0495597_0310778_268_564 87
686 3300046557 Ga0495622_0007685 Ga0495622_0007685_2276_2548 87
687 3300046557 Ga0495622_0120436 Ga0495622_0120436_839_1111 87
688 3300046557 Ga0495622_0120835 Ga0495622_0120835_693_965 87
689 3300046558 Ga0495633_0004458 Ga0495633_0004458_2891_3163 87
690 3300046558 Ga0495633_0013226 Ga0495633_0013226_3054_3326 87
691 3300046558 Ga0495633_0125818 Ga0495633_0125818_473_745 87
692 3300046558 Ga0495633_0311792 Ga0495633_0311792_174_482 87
693 3300046558 Ga0495633_0429892 Ga0495633_0429892_136_408 87
694 3300046615 Ga0495656_0055968 Ga0495656_0055968_507_779 87
695 3300046615 Ga0495656_0144795 Ga0495656_0144795_152_415 87
696 3300046615 Ga0495656_0173899 Ga0495656_0173899_75_347 87
697 3300046615 Ga0495656_0698157 Ga0495656_0698157_230_502 87
698 3300046616 Ga0495668_0000493 Ga0495668_0000493_13353_13652 87
699 3300046616 Ga0495668_0018090 Ga0495668_0018090_3029_3337 87
700 3300046616 Ga0495668_0039812 Ga0495668_0039812_1431_1703 87
701 3300046616 Ga0495668_0123190 Ga0495668_0123190_385_657 87
702 3300046616 Ga0495668_0525150 Ga0495668_0525150_267_569 87
703 3300046642 Ga0495634_0062148 Ga0495634_0062148_1271_1555 87
704 3300046648 Ga0495611_0000546 Ga0495611_0000546_15395_15694 87
705 3300046648 Ga0495611_0013556 Ga0495611_0013556_1794_2066 87
706 3300046648 Ga0495611_0013763 Ga0495611_0013763_973_1245 87
707 3300046648 Ga0495611_0030470 Ga0495611_0030470_551_823 87
708 3300046648 Ga0495611_0035363 Ga0495611_0035363_1564_1836 87
709 3300046660 Ga0495625_0145443 Ga0495625_0145443_693_965 87
710 3300046663 Ga0495635_0024257 Ga0495635_0024257_1711_1983 87
711 3300046664 Ga0495659_0000054 Ga0495659_0000054_19207_19479 87
712 3300046665 Ga0495661_0000094 Ga0495661_0000094_18653_18955 87
713 3300046665 Ga0495661_0000638 Ga0495661_0000638_6041_6337 87
714 3300046665 Ga0495661_0003699 Ga0495661_0003699_4145_4417 87
715 3300046665 Ga0495661_0009088 Ga0495661_0009088_4960_5256 87
716 3300046665 Ga0495661_0010487 Ga0495661_0010487_4547_4846 87
717 3300046665 Ga0495661_0085948 Ga0495661_0085948_367_639 87
718 3300046665 Ga0495661_0091910 Ga0495661_0091910_635_943 87
719 3300046665 Ga0495661_0150872 Ga0495661_0150872_171_443 87
720 3300046665 Ga0495661_0310725 Ga0495661_0310725_20_292 87
721 3300046674 Ga0495588_0000110 Ga0495588_0000110_19044_19322 87
722 3300046674 Ga0495588_0008482 Ga0495588_0008482_3420_3692 87
723 3300046674 Ga0495588_0013683 Ga0495588_0013683_3385_3657 87
724 3300046674 Ga0495588_0077333 Ga0495588_0077333_103_375 87
725 3300046674 Ga0495588_0207780 Ga0495588_0207780_305_604 87
726 3300046683 Ga0495658_1057741 Ga0495658_1057741_240_503 87
727 3300046684 Ga0495669_0000041 Ga0495669_0000041_43330_43602 87
728 3300046684 Ga0495669_0003144 Ga0495669_0003144_1369_1668 87
729 3300046684 Ga0495669_0042156 Ga0495669_0042156_512_784 87
730 3300046691 Ga0495670_0014196 Ga0495670_0014196_1028_1300 87
731 3300046691 Ga0495670_0071938 Ga0495670_0071938_1059_1331 87
732 3300046691 Ga0495670_0183320 Ga0495670_0183320_77_376 87
733 3300046691 Ga0495670_0200145 Ga0495670_0200145_674_946 87
734 3300046691 Ga0495670_0227746 Ga0495670_0227746_510_773 87
735 3300046691 Ga0495670_0365424 Ga0495670_0365424_29_301 87
736 3300046691 Ga0495670_0398366 Ga0495670_0398366_340_612 87
737 3300046692 Ga0495671_0000314 Ga0495671_0000314_3649_3921 87
738 3300046692 Ga0495671_0000796 Ga0495671_0000796_16643_16951 87
739 3300046692 Ga0495671_0567247 Ga0495671_0567247_32_304 87
740 3300046694 Ga0495649_0000049 Ga0495649_0000049_18313_18612 87
741 3300046694 Ga0495649_0002757 Ga0495649_0002757_4425_4697 87
742 3300046694 Ga0495649_0016666 Ga0495649_0016666_762_1034 87
743 3300046694 Ga0495649_0210152 Ga0495649_0210152_553_825 87
744 3300046694 Ga0495649_0243215 Ga0495649_0243215_254_550 87
745 3300046794 Ga0495589_0000019 Ga0495589_0000019_90385_90687 87
746 3300046794 Ga0495589_0005107 Ga0495589_0005107_3886_4158 87
747 3300046794 Ga0495589_0040875 Ga0495589_0040875_16_312 87
748 3300046794 Ga0495589_0045988 Ga0495589_0045988_600_872 87
749 3300046794 Ga0495589_0070221 Ga0495589_0070221_678_950 87
750 3300046809 Ga0495600_0730771 Ga0495600_0730771_290_562 87
751 3300046810 Ga0495660_0000245 Ga0495660_0000245_28171_28467 87
752 3300046810 Ga0495660_0011872 Ga0495660_0011872_1503_1802 87
753 3300046810 Ga0495660_0036706 Ga0495660_0036706_385_657 87
754 3300047315 Ga0495581_0007820 Ga0495581_0007820_4238_4510 87
755 3300047315 Ga0495581_0077960 Ga0495581_0077960_270_542 87
756 3300047315 Ga0495581_0090888 Ga0495581_0090888_1407_1679 87
757 3300047315 Ga0495581_0422355 Ga0495581_0422355_73_345 87
758 3300047317 Ga0495604_0020138 Ga0495604_0020138_2822_3094 87
759 3300047317 Ga0495604_0128224 Ga0495604_0128224_691_975 87
760 3300047318 Ga0495636_0003923 Ga0495636_0003923_4669_4941 87
761 3300047318 Ga0495636_0416534 Ga0495636_0416534_258_530 87
762 3300047319 Ga0495674_0015849 Ga0495674_0015849_5708_5980 87
763 3300047320 Ga0495672_0005588 Ga0495672_0005588_4152_4448 87
764 3300047320 Ga0495672_0034309 Ga0495672_0034309_2845_3117 87
765 3300047321 Ga0495676_0065088 Ga0495676_0065088_312_584 87
766 3300047322 Ga0495680_0010535 Ga0495680_0010535_6651_6923 87
767 3300047322 Ga0495680_0270071 Ga0495680_0270071_869_1141 87
768 3300047323 Ga0495683_0007061 Ga0495683_0007061_3056_3328 87
769 3300047323 Ga0495683_0007206 Ga0495683_0007206_2997_3296 87
770 3300047323 Ga0495683_0012690 Ga0495683_0012690_2662_2934 87
771 3300047323 Ga0495683_0035195 Ga0495683_0035195_2220_2516 87
772 3300047323 Ga0495683_0078302 Ga0495683_0078302_771_1043 87
773 3300047323 Ga0495683_0376248 Ga0495683_0376248_270_542 87
774 3300047443 Ga0495687_000059 Ga0495687_000059_88614_88916 87
775 3300047443 Ga0495687_001460 Ga0495687_001460_4167_4463 87
776 3300047444 Ga0495675_0014947 Ga0495675_0014947_3206_3490 87
777 3300047444 Ga0495675_0033154 Ga0495675_0033154_1296_1568 87
778 3300047445 Ga0495677_0000006 Ga0495677_0000006_110315_110617 87
779 3300047445 Ga0495677_0000667 Ga0495677_0000667_162_458 87
780 3300047445 Ga0495677_0001645 Ga0495677_0001645_8340_8612 87
781 3300047445 Ga0495677_0002047 Ga0495677_0002047_7218_7490 87
782 3300047445 Ga0495677_0003240 Ga0495677_0003240_608_880 87
783 3300047445 Ga0495677_0020023 Ga0495677_0020023_540_812 87
784 3300047445 Ga0495677_0029222 Ga0495677_0029222_772_1080 87
785 3300047445 Ga0495677_0035926 Ga0495677_0035926_104_403 87
786 3300047446 Ga0495679_015954 Ga0495679_015954_254_526 87
787 3300047446 Ga0495679_055495 Ga0495679_055495_226_498 87
788 3300047447 Ga0495685_058589 Ga0495685_058589_231_503 87
789 3300047470 Ga0495681_0004532 Ga0495681_0004532_3009_3308 87
790 3300047470 Ga0495681_0005786 Ga0495681_0005786_5890_6162 87
791 3300047470 Ga0495681_0052139 Ga0495681_0052139_814_1086 87
792 3300047470 Ga0495681_0071547 Ga0495681_0071547_524_796 87
793 3300047470 Ga0495681_0179624 Ga0495681_0179624_378_650 87
794 3300047472 Ga0495686_0150041 Ga0495686_0150041_854_1150 87
795 3300047472 Ga0495686_0735421 Ga0495686_0735421_72_371 87
796 3300047673 Ga0495593_0011331 Ga0495593_0011331_1818_2090 87
797 3300047673 Ga0495593_0600215 Ga0495593_0600215_95_367 87
798 3300048088 Ga0495602_0042409 Ga0495602_0042409_592_876 87
799 3300048089 Ga0495614_0002399 Ga0495614_0002399_6638_6910 87
800 3300048089 Ga0495614_0014899 Ga0495614_0014899_172_444 87
801 3300048089 Ga0495614_0088806 Ga0495614_0088806_270_542 87
802 3300048091 Ga0495626_0000103 Ga0495626_0000103_12469_12765 87
803 3300048091 Ga0495626_0000494 Ga0495626_0000494_35017_35319 87
804 3300048091 Ga0495626_0000711 Ga0495626_0000711_22198_22470 87
805 3300048091 Ga0495626_0001658 Ga0495626_0001658_14112_14411 87
806 3300048091 Ga0495626_0001661 Ga0495626_0001661_9008_9307 87
807 3300048091 Ga0495626_0011706 Ga0495626_0011706_2082_2354 87
808 3300048091 Ga0495626_0057416 Ga0495626_0057416_941_1213 87
809 3300048091 Ga0495626_0098694 Ga0495626_0098694_815_1087 87
810 3300048091 Ga0495626_0154940 Ga0495626_0154940_529_801 87
811 3300048091 Ga0495626_0210110 Ga0495626_0210110_453_725 87
812 3300048903 Ga0496100_0071042 Ga0496100_0071042_2000_2278 87
813 3300048904 Ga0496101_0119277 Ga0496101_0119277_529_807 87
814 3300048905 Ga0496102_0314305 Ga0496102_0314305_1063_1335 87
815 3300048905 Ga0496102_1081108 Ga0496102_1081108_43_327 87
816 3300048906 Ga0496103_0403362 Ga0496103_0403362_517_801 87
817 3300048909 Ga0496106_0516771 Ga0496106_0516771_489_767 87
818 3300048910 Ga0496107_0005997 Ga0496107_0005997_5409_5693 87
819 3300048916 Ga0496113_0587872 Ga0496113_0587872_299_562 87
820 3300048918 Ga0496115_0253476 Ga0496115_0253476_1135_1407 87
821 3300048927 Ga0496124_0065837 Ga0496124_0065837_1677_1973 87
822 3300049128 Ga0501308_042493 Ga0501308_042493_53_349 87
823 3300049459 Ga0495678_000104 Ga0495678_000104_70392_70691 87
824 3300049459 Ga0495678_003393 Ga0495678_003393_5018_5290 87
825 3300049514 Ga0501291_033852 Ga0501291_033852_277_540 87
826 3300049515 Ga0501292_012174 Ga0501292_012174_930_1193 87
827 3300049522 Ga0501299_053153 Ga0501299_053153_23_286 87
828 3300049539 Ga0501323_035947 Ga0501323_035947_293_565 87
829 3300049575 Ga0501039_0473772 Ga0501039_0473772_436_699 87
830 3300049590 Ga0501074_0548293 Ga0501074_0548293_55_318 87
831 3300049591 Ga0501075_0903534 Ga0501075_0903534_103_366 87
832 3300049660 Ga0501216_041735 Ga0501216_041735_31_294 87
833 3300049667 Ga0501230_041549 Ga0501230_041549_354_617 87
834 3300049669 Ga0501235_122519 Ga0501235_122519_150_422 87
835 3300049669 Ga0501235_185550 Ga0501235_185550_165_428 87
836 3300049679 Ga0501249_041483 Ga0501249_041483_162_443 87
837 3300049680 Ga0501250_097281 Ga0501250_097281_116_379 87
838 3300049686 Ga0501257_174061 Ga0501257_174061_233_505 87
839 3300049743 Ga0501081_0715051 Ga0501081_0715051_13_294 87
840 3300049761 Ga0501264_004047 Ga0501264_004047_898_1161 87
841 3300049763 Ga0501266_037682 Ga0501266_037682_253_516 87
842 3300049765 Ga0501268_106392 Ga0501268_106392_269_532 87
843 3300049775 Ga0501279_013648 Ga0501279_013648_519_791 87
844 3300049775 Ga0501279_055350 Ga0501279_055350_301_564 87
845 3300049822 Ga0501035_0000652 Ga0501035_0000652_21425_21721 87
846 3300049823 Ga0501044_0314037 Ga0501044_0314037_153_449 87
847 3300049823 Ga0501044_0429750 Ga0501044_0429750_209_481 87
848 3300050507 nmdc:mga05p37_14950_c1 nmdc:mga05p37_14950_c1_7592_7870 87
849 3300050507 nmdc:mga05p37_1649784_c1 nmdc:mga05p37_1649784_c1_166_429 87
850 3300050507 nmdc:mga05p37_411053_c1 nmdc:mga05p37_411053_c1_363_626 87
851 3300050508 nmdc:mga09592_374167_c1 nmdc:mga09592_374167_c1_665_928 87
852 3300050509 nmdc:mga0qj67_63662_c1 nmdc:mga0qj67_63662_c1_1130_1393 87
853 3300050510 nmdc:mga06r32_142015_c1 nmdc:mga06r32_142015_c1_1555_1818 87
854 3300050510 nmdc:mga06r32_1933774_c1 nmdc:mga06r32_1933774_c1_97_360 87
855 3300050510 nmdc:mga06r32_474902_c1 nmdc:mga06r32_474902_c1_613_876 87
856 3300050510 nmdc:mga06r32_94743_c1 nmdc:mga06r32_94743_c1_886_1149 87
857 3300050511 nmdc:mga08y16_349636_c1 nmdc:mga08y16_349636_c1_444_707 87
858 3300050511 nmdc:mga08y16_902080_c1 nmdc:mga08y16_902080_c1_446_709 87
859 3300050512 nmdc:mga0n895_1263821_c1 nmdc:mga0n895_1263821_c1_96_359 87
860 3300050512 nmdc:mga0n895_130130_c1 nmdc:mga0n895_130130_c1_1662_1925 87
861 3300050512 nmdc:mga0n895_449961_c1 nmdc:mga0n895_449961_c1_116_394 87
862 3300050512 nmdc:mga0n895_45644_c1 nmdc:mga0n895_45644_c1_2681_2944 87
863 3300050513 nmdc:mga0rr50_129386_c1 nmdc:mga0rr50_129386_c1_222_485 87
864 3300050513 nmdc:mga0rr50_317653_c1 nmdc:mga0rr50_317653_c1_380_658 87
865 3300050514 nmdc:mga08x19_131057_c1 nmdc:mga08x19_131057_c1_440_703 87
866 3300050514 nmdc:mga08x19_901988_c1 nmdc:mga08x19_901988_c1_141_419 87
867 3300050515 nmdc:mga0a205_27400_c1 nmdc:mga0a205_27400_c1_2368_2646 87
868 3300050515 nmdc:mga0a205_8501_c1 nmdc:mga0a205_8501_c1_6279_6542 87
869 3300059421 Ga0590071_052039 Ga0590071_052039_276_539 87
870 3300059641 Ga0587068_065168 Ga0587068_065168_14_310 87
871 3300059647 Ga0587079_100248 Ga0587079_100248_42_320 87
872 3300061719 Ga0466962_0026811 Ga0466962_0026811_2029_2325 87
873 3300061734 Ga0530510_0217449 Ga0530510_0217449_295_576 87
874 3300061734 Ga0530510_0837822 Ga0530510_0837822_373_636 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

14

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dxe-assembly2.cif.gz_J 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col 0.9335 8 81
1f80-assembly1.cif.gz_F holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.9206 11 79
6lvu-assembly2.cif.gz_B crystal structure of apo acyl carrier protein from thermotoga maritima 0.9133 8 83
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.9104 10 83
5h9g-assembly2.cif.gz_B apo-acp from helicobacter pylori 0.9088 9 83
ID Description Score Start End Superfamily
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9227 12 85 1.10.1200.10
1f80F00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9206 11 79 1.10.1200.10
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9127 9 87 1.10.1200.10
2cgqA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9078 12 84 1.10.1200.10
1f80D00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9055 10 79 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A2G0QG68-F1-model_v4 Acyl carrier protein (ACP) 0.977 7 86 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A5C6CS83-F1-model_v4 Acyl carrier protein 0.9768 12 87
AF-A0A430HST8-F1-model_v4 Acyl carrier protein 0.9751 7 86
AF-A0A0D0K8Q1-F1-model_v4 Acyl carrier protein (ACP) 0.9742 12 86 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A5C4NLN9-F1-model_v4 Acyl carrier protein 0.9736 7 84

Feature Viewer

pLDDT pTM Quality
86.56 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map