F484286

General Info

Members Datasets Scaffolds Average Seq Length
874 349 1748 47

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10788699|Ga0105245_107886991
Length 52
Sequence MEKTMLWTIFVVLLVLWILGFSLHIAGGLIHLILVLAVIMLIYNLITGRRAV

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
11 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
12 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
13 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
125 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
126 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
127 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
131 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
132 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
133 3300013043 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300013064 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020071 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
161 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
169 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
236 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
239 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
247 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
275 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
278 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
281 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
282 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
347 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
349 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.22
Metatranscriptomes 7.67
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.68
Stem 0
Stem Tuber 0
Unclassified 29.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10788699 3300009098 Unclassified 988
2 SwRhRL2b_contig_395301 2162886007 Bacteria 1818
3 JGI24740J21852_10033452 3300001979 Unclassified 1632
4 JGI24740J21852_10144960 3300001979 Bacteria 590
5 JGI24743J22301_10074271 3300001991 Bacteria 712
6 JGI24035J26624_1028014 3300002126 Bacteria 608
7 Ga0006778J45830_1025931 3300003162 Unclassified 561
8 JGI25406J46586_10025828 3300003203 Bacteria 2273
9 Ga0007421J48921_111011 3300003291 Unclassified 512
10 Ga0006777J48905_1011461 3300003308 Unclassified 569
11 Ga0006777J48905_1047896 3300003308 Unclassified 562
12 JGI26145J50221_1015151 3300003371 Unclassified 711
13 JGI26143J51219_1009855 3300003502 Unclassified 524
14 JGI26141J51220_1008444 3300003503 Unclassified 663
15 Ga0007417J51691_1035384 3300003544 Unclassified 538
16 Ga0006781J51513_1020053 3300003568 Unclassified 563
17 Ga0007409J51694_1089129 3300003575 Unclassified 535
18 Ga0007416J51690_1013347 3300003577 Unclassified 629
19 Ga0007429J51699_1014090 3300003579 Unclassified 565
20 Ga0032354_1013489 3300003693 Unclassified 583
21 Ga0006780_1003689 3300003735 Unclassified 563
22 Ga0058859_11738374 3300004798 Unclassified 851
23 Ga0058861_11943615 3300004800 Unclassified 512
24 Ga0058860_10082519 3300004801 Bacteria 975
25 Ga0058862_10090948 3300004803 Bacteria 568
26 Ga0065704_10240153 3300005289 Unclassified 1017
27 Ga0065704_10292469 3300005289 Bacteria 805
28 Ga0065715_10828582 3300005293 Unclassified 599
29 Ga0065715_11024295 3300005293 Archaea 539
30 Ga0070658_10102609 3300005327 Bacteria 2365
31 Ga0070658_10351655 3300005327 Bacteria 1261
32 Ga0070658_10690946 3300005327 Archaea 885
33 Ga0070676_10007593 3300005328 Bacteria 5825
34 Ga0070676_10338051 3300005328 Unclassified 1032
35 Ga0070683_100033924 3300005329 Bacteria 4658
36 Ga0070683_100042527 3300005329 Bacteria 4184
37 Ga0070683_100193695 3300005329 Bacteria 1930
38 Ga0070683_100612114 3300005329 Bacteria 1043
39 Ga0070683_100883449 3300005329 Bacteria 857
40 Ga0070683_101288546 3300005329 Unclassified 702
41 Ga0070690_100782146 3300005330 Unclassified 739
42 Ga0070690_100833604 3300005330 Bacteria 717
43 Ga0070670_100153951 3300005331 Bacteria 1991
44 Ga0070670_100383938 3300005331 Bacteria 1238
45 Ga0068869_100347787 3300005334 Bacteria 1208
46 Ga0070666_10154392 3300005335 Bacteria 1602
47 Ga0070666_10215778 3300005335 Bacteria 1352
48 Ga0070680_100103633 3300005336 Bacteria 2363
49 Ga0070680_101599172 3300005336 Archaea 565
50 Ga0070682_100857303 3300005337 Archaea 743
51 Ga0068868_100067107 3300005338 Bacteria 2854
52 Ga0068868_100216982 3300005338 Bacteria 1600
53 Ga0068868_100286348 3300005338 Bacteria 1396
54 Ga0068868_100764069 3300005338 Bacteria 869
55 Ga0068868_101218569 3300005338 Bacteria 696
56 Ga0068868_101501360 3300005338 Unclassified 631
57 Ga0070660_100009500 3300005339 Bacteria 6843
58 Ga0070660_100098730 3300005339 Unclassified 2311
59 Ga0070689_100010315 3300005340 Bacteria 6659
60 Ga0070689_102014565 3300005340 Unclassified 528
61 Ga0070687_100224540 3300005343 Bacteria 1152
62 Ga0070687_100549461 3300005343 Archaea 786
63 Ga0070661_100113294 3300005344 Bacteria 2027
64 Ga0070661_101171133 3300005344 Bacteria 642
65 Ga0070692_10028417 3300005345 Bacteria 2779
66 Ga0070692_10617884 3300005345 Bacteria 719
67 Ga0070668_100313178 3300005347 Bacteria 1319
68 Ga0070668_101217709 3300005347 Bacteria 682
69 Ga0070669_100245828 3300005353 Unclassified 1423
70 Ga0070669_100589900 3300005353 Bacteria 930
71 Ga0070675_100047322 3300005354 Bacteria 3524
72 Ga0070675_100159519 3300005354 Unclassified 1939
73 Ga0070675_101052652 3300005354 Bacteria 748
74 Ga0070675_101799173 3300005354 Archaea 565
75 Ga0070671_100050724 3300005355 Bacteria 3451
76 Ga0070671_100150986 3300005355 Bacteria 1962
77 Ga0070671_100288355 3300005355 Bacteria 1397
78 Ga0070671_100700509 3300005355 Bacteria 878
79 Ga0070671_101447970 3300005355 Bacteria 607
80 Ga0070674_100584057 3300005356 Bacteria 942
81 Ga0070674_100790008 3300005356 Unclassified 819
82 Ga0070673_100031917 3300005364 Bacteria 3959
83 Ga0070673_100254912 3300005364 Bacteria 1531
84 Ga0070673_100516488 3300005364 Bacteria 1082
85 Ga0070673_100541123 3300005364 Unclassified 1057
86 Ga0070673_101628614 3300005364 Archaea 610
87 Ga0070673_101662129 3300005364 Bacteria 604
88 Ga0070688_100055529 3300005365 Bacteria 2484
89 Ga0070659_100175641 3300005366 Bacteria 1756
90 Ga0070667_100015006 3300005367 Bacteria 6401
91 Ga0070667_100088848 3300005367 Unclassified 2654
92 Ga0070667_100843741 3300005367 Archaea 852
93 Ga0070703_10257135 3300005406 Bacteria 711
94 Ga0070709_10070518 3300005434 Bacteria 2253
95 Ga0070709_10225046 3300005434 Bacteria 1339
96 Ga0070709_11241671 3300005434 Unclassified 600
97 Ga0070714_100070569 3300005435 Bacteria 3020
98 Ga0070714_100749272 3300005435 Unclassified 944
99 Ga0070713_100009314 3300005436 Bacteria 7020
100 Ga0070713_100011341 3300005436 Bacteria 6487
101 Ga0070713_100048364 3300005436 Unclassified 3502
102 Ga0070713_100067368 3300005436 Bacteria 3014
103 Ga0070713_100311787 3300005436 Unclassified 1451
104 Ga0070713_100637261 3300005436 Bacteria 1014
105 Ga0070713_100981853 3300005436 Archaea 814
106 Ga0070713_101212805 3300005436 Bacteria 730
107 Ga0070710_11311404 3300005437 Unclassified 539
108 Ga0070701_10039644 3300005438 Bacteria 2391
109 Ga0070701_10389101 3300005438 Bacteria 881
110 Ga0070701_10722255 3300005438 Bacteria 672
111 Ga0070711_100070948 3300005439 Bacteria 2454
112 Ga0070711_100109473 3300005439 Bacteria 2025
113 Ga0070711_100136622 3300005439 Unclassified 1833
114 Ga0070711_100201824 3300005439 Bacteria 1535
115 Ga0070711_100209804 3300005439 Unclassified 1508
116 Ga0070711_100235589 3300005439 Bacteria 1429
117 Ga0070711_100432076 3300005439 Unclassified 1075
118 Ga0070711_100588222 3300005439 Bacteria 927
119 Ga0070711_100682923 3300005439 Bacteria 863
120 Ga0070705_100030593 3300005440 Bacteria 2974
121 Ga0070705_101363272 3300005440 Bacteria 590
122 Ga0070700_100473771 3300005441 Bacteria 958
123 Ga0070700_100927551 3300005441 Bacteria 711
124 Ga0070694_100387531 3300005444 Bacteria 1091
125 Ga0070708_100000165 3300005445 Bacteria 47190
126 Ga0070708_100061130 3300005445 Unclassified 3364
127 Ga0070708_100103385 3300005445 Bacteria 2611
128 Ga0070708_100117185 3300005445 Bacteria 2453
129 Ga0070708_100170773 3300005445 Bacteria 2030
130 Ga0070708_100285815 3300005445 Unclassified 1552
131 Ga0070708_100510087 3300005445 Unclassified 1134
132 Ga0070708_100869220 3300005445 Bacteria 847
133 Ga0070708_102069373 3300005445 Unclassified 527
134 Ga0070663_100685987 3300005455 Bacteria 869
135 Ga0070678_100007770 3300005456 Bacteria 6378
136 Ga0070678_101196604 3300005456 Bacteria 704
137 Ga0070662_100032728 3300005457 Bacteria 3655
138 Ga0070662_100649945 3300005457 Unclassified 889
139 Ga0070662_100705909 3300005457 Unclassified 853
140 Ga0070662_101180890 3300005457 Archaea 658
141 Ga0070681_10027157 3300005458 Bacteria 5755
142 Ga0070681_10220607 3300005458 Unclassified 1811
143 Ga0070681_10441348 3300005458 Bacteria 1213
144 Ga0070681_11595543 3300005458 Unclassified 578
145 Ga0068867_100090658 3300005459 Bacteria 2320
146 Ga0068867_100707245 3300005459 Bacteria 890
147 Ga0068867_102330241 3300005459 Bacteria 509
148 Ga0070706_100002274 3300005467 Bacteria 19455
149 Ga0070706_100073748 3300005467 Archaea 3159
150 Ga0070706_100100035 3300005467 Bacteria 2693
151 Ga0070706_100104355 3300005467 Bacteria 2636
152 Ga0070706_100160014 3300005467 Unclassified 2102
153 Ga0070706_100240172 3300005467 Bacteria 1692
154 Ga0070706_100324987 3300005467 Bacteria 1434
155 Ga0070706_100552827 3300005467 Bacteria 1071
156 Ga0070706_100570327 3300005467 Bacteria 1052
157 Ga0070706_101828469 3300005467 Bacteria 552
158 Ga0070707_100012448 3300005468 Bacteria 7946
159 Ga0070707_100025103 3300005468 Bacteria 5652
160 Ga0070707_100043565 3300005468 Unclassified 4295
161 Ga0070707_100065856 3300005468 Bacteria 3481
162 Ga0070707_100216727 3300005468 Bacteria 1865
163 Ga0070707_100811295 3300005468 Unclassified 900
164 Ga0070707_101372510 3300005468 Unclassified 673
165 Ga0070707_101590358 3300005468 Bacteria 621
166 Ga0070707_101811763 3300005468 Bacteria 578
167 Ga0070707_101977053 3300005468 Unclassified 550
168 Ga0070698_100001673 3300005471 Bacteria 24737
169 Ga0070698_100001730 3300005471 Bacteria 24348
170 Ga0070698_100002662 3300005471 Bacteria 19706
171 Ga0070698_100264550 3300005471 Unclassified 1652
172 Ga0070698_100276185 3300005471 Bacteria 1612
173 Ga0070698_100569965 3300005471 Bacteria 1072
174 Ga0070698_100900035 3300005471 Unclassified 830
175 Ga0070698_101282719 3300005471 Unclassified 682
176 Ga0070699_100001358 3300005518 Bacteria 22522
177 Ga0070699_100034130 3300005518 Bacteria 4397
178 Ga0070699_100054885 3300005518 Bacteria 3450
179 Ga0070699_100582278 3300005518 Bacteria 1020
180 Ga0070699_100643405 3300005518 Bacteria 968
181 Ga0070679_100052666 3300005530 Unclassified 4052
182 Ga0070679_100526756 3300005530 Unclassified 1125
183 Ga0070684_100057638 3300005535 Bacteria 3392
184 Ga0070684_100266080 3300005535 Bacteria 1569
185 Ga0070684_100672085 3300005535 Bacteria 965
186 Ga0070684_101349908 3300005535 Unclassified 671
187 Ga0070697_100000219 3300005536 Bacteria 47258
188 Ga0070697_100003276 3300005536 Bacteria 12432
189 Ga0070697_100015720 3300005536 Bacteria 5942
190 Ga0070697_100020008 3300005536 Bacteria 5290
191 Ga0070697_100098471 3300005536 Bacteria 2427
192 Ga0070697_100151173 3300005536 Bacteria 1957
193 Ga0070697_100344259 3300005536 Bacteria 1287
194 Ga0070697_100347742 3300005536 Bacteria 1280
195 Ga0070697_100351636 3300005536 Bacteria 1273
196 Ga0070697_100405746 3300005536 Bacteria 1183
197 Ga0070697_100598940 3300005536 Bacteria 969
198 Ga0070697_100737642 3300005536 Bacteria 870
199 Ga0070697_100783068 3300005536 Bacteria 843
200 Ga0068853_100218477 3300005539 Unclassified 1740
201 Ga0068853_100224059 3300005539 Bacteria 1718
202 Ga0068853_100264502 3300005539 Bacteria 1582
203 Ga0068853_100328244 3300005539 Bacteria 1419
204 Ga0068853_100387697 3300005539 Unclassified 1306
205 Ga0068853_101447796 3300005539 Unclassified 665
206 Ga0070672_100236483 3300005543 Bacteria 1536
207 Ga0070672_100652236 3300005543 Bacteria 919
208 Ga0070695_100145684 3300005545 Bacteria 1647
209 Ga0070695_100370647 3300005545 Bacteria 1078
210 Ga0070696_100790780 3300005546 Bacteria 780
211 Ga0070696_100878288 3300005546 Archaea 743
212 Ga0070696_100942589 3300005546 Unclassified 718
213 Ga0070693_100058482 3300005547 Bacteria 2231
214 Ga0070693_100992987 3300005547 Archaea 635
215 Ga0070693_101347079 3300005547 Bacteria 553
216 Ga0070665_100048715 3300005548 Bacteria 4253
217 Ga0070665_100772678 3300005548 Bacteria 974
218 Ga0070704_100105914 3300005549 Bacteria 2130
219 Ga0070704_100280453 3300005549 Bacteria 1380
220 Ga0070704_100403295 3300005549 Bacteria 1167
221 Ga0070704_100419315 3300005549 Bacteria 1146
222 Ga0070704_101681217 3300005549 Bacteria 586
223 Ga0070704_101737927 3300005549 Unclassified 577
224 Ga0068855_100007219 3300005563 Bacteria 13483
225 Ga0068855_100031043 3300005563 Bacteria 6385
226 Ga0068855_100034578 3300005563 Bacteria 6025
227 Ga0068855_100271612 3300005563 Bacteria 1885
228 Ga0070664_100092995 3300005564 Bacteria 2612
229 Ga0070664_100209285 3300005564 Bacteria 1743
230 Ga0070664_100270438 3300005564 Unclassified 1531
231 Ga0070664_100437921 3300005564 Bacteria 1199
232 Ga0070664_101445347 3300005564 Bacteria 650
233 Ga0070664_101795710 3300005564 Archaea 582
234 Ga0070664_102018961 3300005564 Unclassified 547
235 Ga0068857_100014275 3300005577 Bacteria 6921
236 Ga0068857_100242183 3300005577 Bacteria 1652
237 Ga0068857_100312519 3300005577 Unclassified 1450
238 Ga0068857_100493563 3300005577 Bacteria 1148
239 Ga0068857_100775929 3300005577 Bacteria 914
240 Ga0068854_100100521 3300005578 Bacteria 2167
241 Ga0068854_100115433 3300005578 Bacteria 2031
242 Ga0068854_100496608 3300005578 Bacteria 1027
243 Ga0068854_100690426 3300005578 Bacteria 880
244 Ga0068854_100711285 3300005578 Unclassified 868
245 Ga0068854_101719301 3300005578 Unclassified 574
246 Ga0068856_100046176 3300005614 Unclassified 4290
247 Ga0068856_100055646 3300005614 Bacteria 3904
248 Ga0068856_100088982 3300005614 Bacteria 3070
249 Ga0068856_100307198 3300005614 Bacteria 1604
250 Ga0068856_100403833 3300005614 Bacteria 1386
251 Ga0068856_100527865 3300005614 Bacteria 1201
252 Ga0068856_100790313 3300005614 Unclassified 969
253 Ga0068856_101373411 3300005614 Bacteria 721
254 Ga0068856_102133334 3300005614 Unclassified 570
255 Ga0068856_102163758 3300005614 Bacteria 565
256 Ga0070702_100878368 3300005615 Unclassified 700
257 Ga0070702_100890509 3300005615 Bacteria 696
258 Ga0068852_100000008 3300005616 Bacteria 154351
259 Ga0068852_100003146 3300005616 Bacteria 11507
260 Ga0068852_100163920 3300005616 Bacteria 2078
261 Ga0068852_100277509 3300005616 Bacteria 1614
262 Ga0068852_100308343 3300005616 Bacteria 1534
263 Ga0068852_100424869 3300005616 Bacteria 1311
264 Ga0068852_100965098 3300005616 Unclassified 871
265 Ga0068859_100002211 3300005617 Bacteria 19739
266 Ga0068859_100012519 3300005617 Bacteria 8532
267 Ga0068859_100146671 3300005617 Bacteria 2435
268 Ga0068859_100778760 3300005617 Unclassified 1045
269 Ga0068864_100055929 3300005618 Bacteria 3409
270 Ga0068864_100245284 3300005618 Bacteria 1661
271 Ga0068864_100635582 3300005618 Bacteria 1038
272 Ga0068864_100862469 3300005618 Unclassified 893
273 Ga0068864_101067950 3300005618 Bacteria 803
274 Ga0068851_10041781 3300005834 Bacteria 2306
275 Ga0068851_10100581 3300005834 Bacteria 1534
276 Ga0068851_10117386 3300005834 Bacteria 1427
277 Ga0068863_100040891 3300005841 Bacteria 4407
278 Ga0068863_100651490 3300005841 Bacteria 1045
279 Ga0068863_100676092 3300005841 Bacteria 1025
280 Ga0068863_101862679 3300005841 Bacteria 611
281 Ga0068858_100047090 3300005842 Bacteria 3998
282 Ga0068858_100100810 3300005842 Unclassified 2693
283 Ga0068860_100260613 3300005843 Bacteria 1690
284 Ga0068860_100660486 3300005843 Bacteria 1054
285 Ga0068860_102081727 3300005843 Unclassified 589
286 Ga0068862_100031722 3300005844 Bacteria 4463
287 Ga0068862_100075057 3300005844 Bacteria 2924
288 Ga0068862_100372770 3300005844 Bacteria 1329
289 Ga0068862_100574687 3300005844 Bacteria 1079
290 Ga0081539_10000005 3300005985 Bacteria 549026
291 Ga0070717_10000654 3300006028 Bacteria 22239
292 Ga0070717_10016742 3300006028 Bacteria 5690
293 Ga0070717_10050796 3300006028 Bacteria 3410
294 Ga0070717_10066909 3300006028 Unclassified 2988
295 Ga0070717_10282459 3300006028 Unclassified 1472
296 Ga0070717_10351634 3300006028 Bacteria 1318
297 Ga0070717_10883629 3300006028 Unclassified 814
298 Ga0070717_10989390 3300006028 Unclassified 766
299 Ga0070717_11864732 3300006028 Unclassified 543
300 Ga0070715_10164863 3300006163 Bacteria 1098
301 Ga0070715_10574300 3300006163 Unclassified 657
302 Ga0070716_100116162 3300006173 Bacteria 1667
303 Ga0070716_100123538 3300006173 Bacteria 1625
304 Ga0070716_100709091 3300006173 Unclassified 770
305 Ga0070712_100026279 3300006175 Bacteria 3876
306 Ga0070712_100694790 3300006175 Unclassified 867
307 Ga0070712_100917212 3300006175 Unclassified 756
308 Ga0070712_101298192 3300006175 Bacteria 634
309 Ga0070712_101914303 3300006175 Archaea 519
310 Ga0075427_10032311 3300006194 Unclassified 862
311 Ga0097621_100087101 3300006237 Bacteria 2607
312 Ga0097621_100397308 3300006237 Bacteria 1234
313 Ga0097621_100637273 3300006237 Unclassified 977
314 Ga0068871_100020786 3300006358 Bacteria 5034
315 Ga0068871_101327345 3300006358 Bacteria 677
316 Ga0068871_101647896 3300006358 Bacteria 608
317 Ga0068871_101899275 3300006358 Archaea 566
318 Ga0075428_100014049 3300006844 Bacteria 8912
319 Ga0075428_100041269 3300006844 Bacteria 5075
320 Ga0075428_100067879 3300006844 Bacteria 3902
321 Ga0075428_100276966 3300006844 Bacteria 1805
322 Ga0075428_101200565 3300006844 Bacteria 800
323 Ga0075428_102010936 3300006844 Unclassified 599
324 Ga0075430_100096652 3300006846 Bacteria 2469
325 Ga0075430_100410805 3300006846 Unclassified 1117
326 Ga0075430_100464106 3300006846 Bacteria 1045
327 Ga0075430_101524088 3300006846 Unclassified 549
328 Ga0075431_100007021 3300006847 Bacteria 11188
329 Ga0075431_100043829 3300006847 Bacteria 4614
330 Ga0075431_100063317 3300006847 Bacteria 3816
331 Ga0075431_100182175 3300006847 Bacteria 2155
332 Ga0075431_100223998 3300006847 Bacteria 1918
333 Ga0075431_101532891 3300006847 Unclassified 625
334 Ga0075431_101993056 3300006847 Unclassified 536
335 Ga0075433_10004217 3300006852 Bacteria 11160
336 Ga0075433_10031481 3300006852 Bacteria 4535
337 Ga0075433_10194966 3300006852 Bacteria 1802
338 Ga0075433_10245561 3300006852 Bacteria 1589
339 Ga0075433_10943875 3300006852 Bacteria 752
340 Ga0075433_11515615 3300006852 Bacteria 579
341 Ga0075434_100000304 3300006871 Bacteria 34893
342 Ga0075434_100013627 3300006871 Bacteria 7749
343 Ga0075434_100070362 3300006871 Bacteria 3490
344 Ga0075434_100159146 3300006871 Bacteria 2278
345 Ga0075434_100165148 3300006871 Unclassified 2234
346 Ga0075434_100628337 3300006871 Bacteria 1093
347 Ga0075434_100910615 3300006871 Bacteria 894
348 Ga0075434_101616431 3300006871 Bacteria 656
349 Ga0075434_102337088 3300006871 Unclassified 537
350 Ga0075429_100008555 3300006880 Bacteria 8902
351 Ga0075429_100042515 3300006880 Bacteria 3955
352 Ga0075429_100052760 3300006880 Bacteria 3538
353 Ga0068865_100021387 3300006881 Bacteria 4204
354 Ga0075436_100009467 3300006914 Bacteria 6660
355 Ga0075436_100146597 3300006914 Bacteria 1660
356 Ga0075436_100637309 3300006914 Bacteria 787
357 Ga0075436_101366170 3300006914 Bacteria 537
358 Ga0075436_101557693 3300006914 Unclassified 502
359 Ga0097620_100002211 3300006931 Bacteria 19739
360 Ga0097620_100012519 3300006931 Bacteria 8532
361 Ga0097620_100146674 3300006931 Bacteria 2435
362 Ga0097620_100778774 3300006931 Unclassified 1045
363 Ga0075435_100000230 3300007076 Bacteria 34205
364 Ga0075435_100078529 3300007076 Bacteria 2707
365 Ga0075435_100134824 3300007076 Bacteria 2068
366 Ga0075435_100459405 3300007076 Bacteria 1098
367 Ga0075435_100867396 3300007076 Unclassified 787
368 Ga0075435_101861705 3300007076 Unclassified 528
369 Ga0099794_10239356 3300007265 Unclassified 935
370 Ga0099795_10237108 3300007788 Unclassified 782
371 Ga0105240_10000038 3300009093 Bacteria 270341
372 Ga0105240_10018687 3300009093 Bacteria 9287
373 Ga0105240_10057979 3300009093 Bacteria 4835
374 Ga0105240_10073636 3300009093 Bacteria 4217
375 Ga0105240_10219712 3300009093 Unclassified 2215
376 Ga0105240_10282702 3300009093 Bacteria 1905
377 Ga0105240_10313696 3300009093 Bacteria 1790
378 Ga0105240_11565624 3300009093 Unclassified 690
379 Ga0111539_11347527 3300009094 Bacteria 828
380 Ga0105245_10471384 3300009098 Bacteria 1267
381 Ga0105245_12005751 3300009098 Unclassified 632
382 Ga0105247_10531190 3300009101 Unclassified 862
383 Ga0105247_10642249 3300009101 Bacteria 792
384 Ga0114129_10001343 3300009147 Bacteria 32969
385 Ga0114129_10009680 3300009147 Bacteria 13752
386 Ga0114129_10069051 3300009147 Bacteria 4926
387 Ga0114129_10182027 3300009147 Bacteria 2859
388 Ga0114129_10643738 3300009147 Bacteria 1369
389 Ga0114129_10971483 3300009147 Bacteria 1071
390 Ga0105241_10021578 3300009174 Bacteria 4763
391 Ga0105241_10216363 3300009174 Bacteria 1608
392 Ga0105241_10289891 3300009174 Bacteria 1401
393 Ga0105241_10489006 3300009174 Bacteria 1095
394 Ga0105241_11744490 3300009174 Unclassified 606
395 Ga0105242_10273304 3300009176 Bacteria 1532
396 Ga0105248_10019891 3300009177 Bacteria 7434
397 Ga0105248_10997062 3300009177 Bacteria 946
398 Ga0105248_11332406 3300009177 Archaea 812
399 Ga0105248_11787350 3300009177 Bacteria 697
400 Ga0105248_12691224 3300009177 Bacteria 567
401 Ga0105237_10030600 3300009545 Bacteria 5467
402 Ga0105237_10178762 3300009545 Bacteria 2122
403 Ga0105237_10292507 3300009545 Bacteria 1631
404 Ga0105237_10486773 3300009545 Unclassified 1240
405 Ga0105237_10572840 3300009545 Unclassified 1136
406 Ga0105237_10624608 3300009545 Bacteria 1084
407 Ga0105237_12206131 3300009545 Unclassified 560
408 Ga0105237_12430995 3300009545 Unclassified 534
409 Ga0105238_10004141 3300009551 Bacteria 14387
410 Ga0105238_10040853 3300009551 Bacteria 4699
411 Ga0105238_10116578 3300009551 Bacteria 2650
412 Ga0105238_10196014 3300009551 Unclassified 1996
413 Ga0105238_10251660 3300009551 Unclassified 1745
414 Ga0105238_10452480 3300009551 Bacteria 1281
415 Ga0105249_10345461 3300009553 Archaea 1506
416 Ga0105249_10426749 3300009553 Bacteria 1360
417 Ga0130087_1040717 3300009828 Unclassified 560
418 Ga0130086_1031957 3300009829 Unclassified 560
419 Ga0130084_1006315 3300009835 Bacteria 525
420 Ga0130084_1075912 3300009835 Unclassified 560
421 Ga0130085_1114286 3300009850 Unclassified 560
422 Ga0105239_10088467 3300010375 Bacteria 3415
423 Ga0105239_10094759 3300010375 Unclassified 3297
424 Ga0105239_10142351 3300010375 Bacteria 2673
425 Ga0105239_10594071 3300010375 Bacteria 1262
426 Ga0105239_10917747 3300010375 Unclassified 1005
427 Ga0105239_12144903 3300010375 Unclassified 649
428 Ga0105239_12505116 3300010375 Bacteria 601
429 Ga0105246_10054588 3300011119 Bacteria 2754
430 Ga0157329_1005480 3300012491 Unclassified 862
431 Ga0157315_1028669 3300012508 Unclassified 639
432 Ga0157326_1000938 3300012513 Bacteria 3344
433 Ga0154018_100706 3300013043 Bacteria 598
434 Ga0154019_128937 3300013044 Bacteria 584
435 Ga0154014_109584 3300013052 Unclassified 987
436 Ga0154014_114343 3300013052 Unclassified 566
437 Ga0154012_127131 3300013059 Unclassified 568
438 Ga0154013_109613 3300013064 Bacteria 528
439 Ga0157373_10493995 3300013100 Unclassified 884
440 Ga0157373_10712148 3300013100 Unclassified 736
441 Ga0157373_11178806 3300013100 Unclassified 577
442 Ga0157373_11541552 3300013100 Unclassified 508
443 Ga0157371_10784779 3300013102 Unclassified 717
444 Ga0157370_10000255 3300013104 Bacteria 67703
445 Ga0157369_10000058 3300013105 Bacteria 154342
446 Ga0157369_10042194 3300013105 Bacteria 4977
447 Ga0157369_10095207 3300013105 Unclassified 3178
448 Ga0157369_10114520 3300013105 Bacteria 2864
449 Ga0157369_10138697 3300013105 Bacteria 2574
450 Ga0157369_10139606 3300013105 Bacteria 2565
451 Ga0157369_10749509 3300013105 Archaea 1005
452 Ga0157374_10006747 3300013296 Bacteria 9756
453 Ga0157374_10061363 3300013296 Bacteria 3521
454 Ga0157374_10120122 3300013296 Bacteria 2535
455 Ga0157374_10137138 3300013296 Bacteria 2373
456 Ga0157374_10175767 3300013296 Bacteria 2090
457 Ga0157374_10197809 3300013296 Bacteria 1968
458 Ga0157374_10341413 3300013296 Unclassified 1487
459 Ga0157374_10577185 3300013296 Bacteria 1133
460 Ga0157374_10985838 3300013296 Unclassified 862
461 Ga0157374_11399640 3300013296 Bacteria 722
462 Ga0157374_12668882 3300013296 Unclassified 527
463 Ga0157378_10049764 3300013297 Bacteria 3729
464 Ga0157378_10062689 3300013297 Bacteria 3320
465 Ga0157378_10170441 3300013297 Bacteria 2041
466 Ga0157378_10374049 3300013297 Bacteria 1397
467 Ga0157378_12350147 3300013297 Unclassified 585
468 Ga0157378_12483411 3300013297 Unclassified 570
469 Ga0157378_12842405 3300013297 Unclassified 537
470 Ga0157378_13065935 3300013297 Bacteria 519
471 Ga0163162_10208021 3300013306 Archaea 2086
472 Ga0163162_10240445 3300013306 Unclassified 1941
473 Ga0163162_10250091 3300013306 Unclassified 1905
474 Ga0163162_11549193 3300013306 Bacteria 755
475 Ga0163162_11789539 3300013306 Bacteria 702
476 Ga0163162_13037030 3300013306 Bacteria 539
477 Ga0157372_10000152 3300013307 Bacteria 75768
478 Ga0157372_10009647 3300013307 Bacteria 10260
479 Ga0157372_10057953 3300013307 Unclassified 4330
480 Ga0157372_10138167 3300013307 Bacteria 2807
481 Ga0157372_10190041 3300013307 Bacteria 2378
482 Ga0157372_10283235 3300013307 Bacteria 1927
483 Ga0157372_10295038 3300013307 Bacteria 1885
484 Ga0157372_10797637 3300013307 Bacteria 1097
485 Ga0157372_10853334 3300013307 Archaea 1057
486 Ga0157372_11158275 3300013307 Unclassified 894
487 Ga0157375_10059872 3300013308 Unclassified 3774
488 Ga0157375_10316599 3300013308 Bacteria 1725
489 Ga0157375_10422469 3300013308 Unclassified 1499
490 Ga0157375_11140647 3300013308 Unclassified 913
491 Ga0157375_11802113 3300013308 Bacteria 726
492 Ga0157375_12739990 3300013308 Archaea 589
493 Ga0157375_13358242 3300013308 Unclassified 533
494 Ga0163163_10223250 3300014325 Bacteria 1933
495 Ga0163163_10312314 3300014325 Bacteria 1625
496 Ga0157380_11104803 3300014326 Bacteria 832
497 Ga0182008_10032006 3300014497 Bacteria 2644
498 Ga0157377_11385999 3300014745 Bacteria 554
499 Ga0157379_10030790 3300014968 Bacteria 4778
500 Ga0157379_12173128 3300014968 Unclassified 551
501 Ga0157376_10006532 3300014969 Bacteria 8247
502 Ga0157376_10926100 3300014969 Unclassified 891
503 Ga0157376_12699806 3300014969 Bacteria 536
504 Ga0182006_1217037 3300015261 Archaea 631
505 Ga0182007_10018453 3300015262 Bacteria 2527
506 Ga0182007_10147805 3300015262 Bacteria 797
507 Ga0163161_10587676 3300017792 Unclassified 917
508 Ga0163161_10805524 3300017792 Unclassified 790
509 Ga0197907_11356164 3300020069 Bacteria 568
510 Ga0206356_11585638 3300020070 Unclassified 523
511 Ga0206356_11677691 3300020070 Bacteria 567
512 Ga0206348_107277 3300020071 Unclassified 515
513 Ga0206349_1157187 3300020075 Unclassified 572
514 Ga0206349_1165044 3300020075 Unclassified 1050
515 Ga0206355_1443982 3300020076 Unclassified 622
516 Ga0206355_1464752 3300020076 Bacteria 1364
517 Ga0206351_10849067 3300020077 Unclassified 1031
518 Ga0206352_10021389 3300020078 Unclassified 588
519 Ga0206352_10044252 3300020078 Bacteria 2273
520 Ga0206352_10939830 3300020078 Bacteria 1525
521 Ga0206350_10524235 3300020080 Bacteria 548
522 Ga0206354_10141684 3300020081 Bacteria 566
523 Ga0206354_10543221 3300020081 Unclassified 1008
524 Ga0206353_11960987 3300020082 Bacteria 1049
525 Ga0154015_1233964 3300020610 Bacteria 751
526 Ga0154015_1370905 3300020610 Unclassified 1432
527 Ga0224712_10070995 3300022467 Unclassified 1414
528 Ga0224712_10108138 3300022467 Bacteria 1189
529 Ga0224712_10220734 3300022467 Bacteria 867
530 Ga0224712_10355692 3300022467 Bacteria 693
531 Ga0224712_10522023 3300022467 Unclassified 575
532 Ga0224569_100117 3300022732 Bacteria 5667
533 Ga0224571_100463 3300022734 Unclassified 2239
534 Ga0207697_10243714 3300025315 Bacteria 794
535 Ga0207656_10016898 3300025321 Bacteria 2848
536 Ga0207656_10022320 3300025321 Bacteria 2538
537 Ga0207656_10513185 3300025321 Unclassified 609
538 Ga0207710_10353971 3300025900 Bacteria 748
539 Ga0207710_10468248 3300025900 Unclassified 652
540 Ga0207699_10415786 3300025906 Bacteria 960
541 Ga0207699_11486384 3300025906 Unclassified 501
542 Ga0207705_10642171 3300025909 Unclassified 825
543 Ga0207684_10000758 3300025910 Bacteria 37643
544 Ga0207684_10000948 3300025910 Bacteria 32649
545 Ga0207684_10001189 3300025910 Bacteria 29100
546 Ga0207684_10159518 3300025910 Archaea 1942
547 Ga0207684_10232647 3300025910 Bacteria 1590
548 Ga0207684_10262978 3300025910 Bacteria 1489
549 Ga0207684_10503359 3300025910 Bacteria 1038
550 Ga0207654_10000182 3300025911 Bacteria 38819
551 Ga0207654_10368626 3300025911 Bacteria 992
552 Ga0207707_10004308 3300025912 Bacteria 12597
553 Ga0207707_10726478 3300025912 Unclassified 832
554 Ga0207695_10000070 3300025913 Bacteria 318111
555 Ga0207695_10002289 3300025913 Bacteria 28601
556 Ga0207695_10006912 3300025913 Bacteria 14587
557 Ga0207695_10028063 3300025913 Bacteria 6251
558 Ga0207695_10130953 3300025913 Bacteria 2466
559 Ga0207695_10460684 3300025913 Bacteria 1154
560 Ga0207671_10000178 3300025914 Bacteria 96763
561 Ga0207671_10679895 3300025914 Unclassified 819
562 Ga0207671_11155642 3300025914 Unclassified 607
563 Ga0207671_11218314 3300025914 Unclassified 588
564 Ga0207693_10001222 3300025915 Bacteria 22910
565 Ga0207693_10710155 3300025915 Unclassified 778
566 Ga0207663_10021598 3300025916 Bacteria 3666
567 Ga0207663_10055409 3300025916 Bacteria 2488
568 Ga0207663_10225623 3300025916 Bacteria 1366
569 Ga0207662_10613381 3300025918 Bacteria 758
570 Ga0207657_10003660 3300025919 Bacteria 16362
571 Ga0207649_10010297 3300025920 Bacteria 5132
572 Ga0207649_10366928 3300025920 Bacteria 1070
573 Ga0207652_10041751 3300025921 Unclassified 3901
574 Ga0207646_10002093 3300025922 Bacteria 23946
575 Ga0207646_10003151 3300025922 Bacteria 18896
576 Ga0207646_10026554 3300025922 Bacteria 5283
577 Ga0207646_10028675 3300025922 Bacteria 5065
578 Ga0207646_10080436 3300025922 Unclassified 2913
579 Ga0207646_10216455 3300025922 Bacteria 1730
580 Ga0207646_10458361 3300025922 Bacteria 1150
581 Ga0207681_10177877 3300025923 Bacteria 1618
582 Ga0207681_10535780 3300025923 Bacteria 962
583 Ga0207694_10000116 3300025924 Bacteria 84418
584 Ga0207694_10011182 3300025924 Bacteria 6774
585 Ga0207694_10086107 3300025924 Bacteria 2474
586 Ga0207694_10169276 3300025924 Bacteria 1768
587 Ga0207694_11349730 3300025924 Unclassified 603
588 Ga0207659_11186993 3300025926 Bacteria 656
589 Ga0207700_10052038 3300025928 Bacteria 3060
590 Ga0207700_10075976 3300025928 Bacteria 2605
591 Ga0207700_10082905 3300025928 Bacteria 2509
592 Ga0207700_10127042 3300025928 Unclassified 2076
593 Ga0207700_10676937 3300025928 Unclassified 920
594 Ga0207700_10747420 3300025928 Bacteria 874
595 Ga0207664_10032109 3300025929 Bacteria 4023
596 Ga0207664_11228865 3300025929 Unclassified 668
597 Ga0207644_10613369 3300025931 Unclassified 904
598 Ga0207644_11535000 3300025931 Bacteria 559
599 Ga0207706_10081977 3300025933 Bacteria 2835
600 Ga0207686_10000745 3300025934 Bacteria 20123
601 Ga0207709_11457481 3300025935 Bacteria 567
602 Ga0207670_10743448 3300025936 Bacteria 814
603 Ga0207665_10098463 3300025939 Unclassified 2037
604 Ga0207665_10104574 3300025939 Bacteria 1982
605 Ga0207665_10807304 3300025939 Bacteria 741
606 Ga0207665_11635539 3300025939 Bacteria 510
607 Ga0207691_10314827 3300025940 Bacteria 1342
608 Ga0207711_11599248 3300025941 Bacteria 595
609 Ga0207661_10067381 3300025944 Bacteria 2911
610 Ga0207661_10134767 3300025944 Bacteria 2120
611 Ga0207661_10326061 3300025944 Bacteria 1381
612 Ga0207661_12067319 3300025944 Unclassified 516
613 Ga0207679_11415854 3300025945 Unclassified 638
614 Ga0207667_10009898 3300025949 Bacteria 11183
615 Ga0207667_10012501 3300025949 Bacteria 9773
616 Ga0207667_10069951 3300025949 Bacteria 3653
617 Ga0207667_10078261 3300025949 Bacteria 3427
618 Ga0207667_10959413 3300025949 Bacteria 844
619 Ga0207651_10089991 3300025960 Bacteria 2242
620 Ga0207651_10372689 3300025960 Unclassified 1208
621 Ga0207651_10605884 3300025960 Unclassified 958
622 Ga0207712_10534957 3300025961 Bacteria 1006
623 Ga0207640_10078781 3300025981 Bacteria 2244
624 Ga0207640_10124959 3300025981 Unclassified 1851
625 Ga0207640_11558227 3300025981 Bacteria 595
626 Ga0207658_10389258 3300025986 Bacteria 1223
627 Ga0207677_10964790 3300026023 Bacteria 771
628 Ga0207677_11125614 3300026023 Bacteria 716
629 Ga0207703_10037894 3300026035 Bacteria 3844
630 Ga0207703_10862102 3300026035 Bacteria 866
631 Ga0207639_10000574 3300026041 Bacteria 25301
632 Ga0207639_10061882 3300026041 Bacteria 2893
633 Ga0207639_12251569 3300026041 Unclassified 506
634 Ga0207678_11475155 3300026067 Bacteria 601
635 Ga0207708_10082487 3300026075 Unclassified 2472
636 Ga0207702_10003394 3300026078 Bacteria 14586
637 Ga0207702_10072341 3300026078 Bacteria 2971
638 Ga0207702_10137004 3300026078 Bacteria 2210
639 Ga0207702_10434187 3300026078 Bacteria 1272
640 Ga0207702_10480070 3300026078 Bacteria 1209
641 Ga0207702_10495769 3300026078 Bacteria 1190
642 Ga0207702_11218344 3300026078 Unclassified 747
643 Ga0207641_11069516 3300026088 Bacteria 805
644 Ga0207641_12067304 3300026088 Bacteria 571
645 Ga0207676_10473981 3300026095 Bacteria 1184
646 Ga0207676_10685298 3300026095 Bacteria 992
647 Ga0207674_10002044 3300026116 Bacteria 25613
648 Ga0207674_10016756 3300026116 Bacteria 8009
649 Ga0207674_10087783 3300026116 Unclassified 3103
650 Ga0207674_10224768 3300026116 Bacteria 1826
651 Ga0207674_10492020 3300026116 Unclassified 1185
652 Ga0207674_10736545 3300026116 Bacteria 951
653 Ga0207675_100212274 3300026118 Bacteria 1862
654 Ga0207675_100871572 3300026118 Bacteria 916
655 Ga0207683_10010475 3300026121 Bacteria 7909
656 Ga0207698_10000010 3300026142 Bacteria 270583
657 Ga0207698_10000117 3300026142 Bacteria 49372
658 Ga0207698_10008353 3300026142 Bacteria 6542
659 Ga0207698_10135665 3300026142 Bacteria 2111
660 Ga0207698_10260493 3300026142 Bacteria 1593
661 Ga0207698_10382572 3300026142 Unclassified 1339
662 Ga0209969_1033890 3300027360 Bacteria 784
663 Ga0209981_1024974 3300027378 Unclassified 864
664 Ga0209995_1014855 3300027471 Bacteria 1277
665 Ga0209968_1054395 3300027526 Unclassified 699
666 Ga0209970_1001987 3300027614 Bacteria 3518
667 Ga0209983_1000297 3300027665 Bacteria 10341
668 Ga0209588_1109721 3300027671 Unclassified 886
669 Ga0209971_1000689 3300027682 Bacteria 8736
670 Ga0209966_1037933 3300027695 Unclassified 996
671 Ga0209998_10002102 3300027717 Bacteria 4642
672 Ga0209974_10000120 3300027876 Bacteria 23113
673 Ga0207428_10895276 3300027907 Bacteria 627
674 Ga0268266_11238151 3300028379 Bacteria 721
675 Ga0268266_12240242 3300028379 Unclassified 518
676 Ga0268265_10087861 3300028380 Bacteria 2475
677 Ga0268265_11411345 3300028380 Unclassified 698
678 Ga0268264_10768348 3300028381 Bacteria 961
679 Ga0265334_10117108 3300028573 Bacteria 954
680 Ga0265334_10330985 3300028573 Unclassified 521
681 Ga0265318_10013740 3300028577 Bacteria 3411
682 Ga0265318_10386948 3300028577 Bacteria 511
683 Ga0265336_10007623 3300028666 Bacteria 3842
684 Ga0265338_10002480 3300028800 Bacteria 27570
685 Ga0265338_10017555 3300028800 Bacteria 7706
686 Ga0265338_10034712 3300028800 Bacteria 4868
687 Ga0265338_10068878 3300028800 Bacteria 3045
688 Ga0265338_10087076 3300028800 Bacteria 2596
689 Ga0265338_10264784 3300028800 Bacteria 1262
690 Ga0265324_10336594 3300029957 Bacteria 514
691 Ga0265762_1114631 3300030760 Unclassified 611
692 Ga0265762_1116318 3300030760 Unclassified 607
693 Ga0265775_101275 3300030762 Bacteria 1177
694 Ga0265777_101075 3300030877 Unclassified 1406
695 Ga0265777_111595 3300030877 Bacteria 657
696 Ga0265776_100839 3300030880 Unclassified 1190
697 Ga0265776_101285 3300030880 Unclassified 1045
698 Ga0265776_101287 3300030880 Bacteria 1044
699 Ga0265779_101520 3300031043 Bacteria 1037
700 Ga0265779_104131 3300031043 Unclassified 764
701 Ga0265760_10007195 3300031090 Unclassified 3189
702 Ga0265760_10088490 3300031090 Unclassified 967
703 Ga0265330_10000081 3300031235 Bacteria 80150
704 Ga0265330_10005662 3300031235 Bacteria 6213
705 Ga0265330_10029828 3300031235 Bacteria 2451
706 Ga0265330_10225785 3300031235 Unclassified 790
707 Ga0265328_10000441 3300031239 Bacteria 19406
708 Ga0265320_10035610 3300031240 Unclassified 2522
709 Ga0265325_10000107 3300031241 Bacteria 58325
710 Ga0265325_10004913 3300031241 Bacteria 8343
711 Ga0265325_10011630 3300031241 Bacteria 5054
712 Ga0265329_10019134 3300031242 Unclassified 2329
713 Ga0265329_10115391 3300031242 Bacteria 860
714 Ga0265340_10000962 3300031247 Bacteria 16409
715 Ga0265340_10004693 3300031247 Bacteria 7601
716 Ga0265339_10006961 3300031249 Bacteria 7353
717 Ga0265339_10041306 3300031249 Bacteria 2561
718 Ga0265339_10289552 3300031249 Bacteria 783
719 Ga0265331_10154580 3300031250 Bacteria 1041
720 Ga0265327_10164953 3300031251 Unclassified 1021
721 Ga0265316_10001669 3300031344 Bacteria 23621
722 Ga0265316_10008092 3300031344 Bacteria 9799
723 Ga0265316_10088113 3300031344 Bacteria 2371
724 Ga0265316_10270011 3300031344 Unclassified 1245
725 Ga0265316_10305713 3300031344 Unclassified 1158
726 Ga0265313_10000769 3300031595 Bacteria 32597
727 Ga0265313_10032553 3300031595 Unclassified 2660
728 Ga0265313_10106035 3300031595 Bacteria 1241
729 Ga0265314_10000052 3300031711 Bacteria 187634
730 Ga0265342_10000641 3300031712 Bacteria 36650
731 Ga0265342_10001202 3300031712 Bacteria 24563
732 Ga0265342_10109415 3300031712 Bacteria 1565
733 Ga0373926_0195520 3300035083 Unclassified 778
734 Ga0373944_0036218 3300035089 Bacteria 1507
735 Ga0373936_0607683 3300035113 Unclassified 514
736 Ga0373945_0036594 3300035116 Bacteria 1759
737 Ga0373943_0097742 3300035170 Bacteria 1530
738 Ga0373946_0005482 3300035171 Bacteria 4578
739 Ga0373931_0165018 3300035691 Unclassified 1301
740 Ga0373935_0063214 3300035692 Bacteria 2372
741 Ga0373935_0776349 3300035692 Bacteria 707
742 Ga0373927_0122421 3300035695 Bacteria 1698
743 Ga0373927_0172219 3300035695 Unclassified 1419
744 Ga0373947_0175366 3300035725 Unclassified 1393
745 Ga0373937_0720908 3300036401 Bacteria 944
746 Ga0265778_009710 3300036457 Unclassified 1087
747 Ga0265778_029474 3300036457 Unclassified 705
748 Ga0265778_038284 3300036457 Bacteria 635
749 Ga0265778_047396 3300036457 Unclassified 583
750 Ga0265778_052779 3300036457 Unclassified 559
751 Ga0373925_0182869 3300037068 Unclassified 1660
752 Ga0395900_0012798 3300037418 Bacteria 8576
753 Ga0395905_0636275 3300037471 Unclassified 969
754 Ga0395901_0040728 3300038443 Bacteria 4812
755 Ga0395901_0829136 3300038443 Bacteria 912
756 Ga0242419_020853 3300038698 Unclassified 548
757 Ga0242420_071205 3300038996 Unclassified 707
758 Ga0436363_1582801 3300039450 Unclassified 522
759 Ga0451793_0301317 3300041452 Unclassified 608
760 Ga0451849_1297299 3300041505 Unclassified 541
761 Ga0439448_0052285 3300042005 Unclassified 1339
762 Ga0439451_013289 3300042009 Unclassified 1664
763 Ga0439454_068109 3300042011 Unclassified 627
764 Ga0450908_104597 3300042184 Unclassified 520
765 Ga0439460_0380043 3300042461 Unclassified 500
766 Ga0451577_0031292 3300042876 Bacteria 4802
767 Ga0453683_1077281 3300044673 Unclassified 535
768 Ga0453683_1134230 3300044673 Bacteria 522
769 Ga0453684_0027118 3300044712 Bacteria 8232
770 Ga0451576_0112395 3300045051 Bacteria 2835
771 Ga0495629_0141884 3300046459 Unclassified 1671
772 Ga0495651_0272451 3300046462 Bacteria 1147
773 Ga0495653_0476878 3300046463 Unclassified 781
774 Ga0495580_0076290 3300046472 Unclassified 2338
775 Ga0495580_0125371 3300046472 Bacteria 1782
776 Ga0495582_0135623 3300046473 Bacteria 1392
777 Ga0495585_0408813 3300046492 Unclassified 653
778 Ga0495618_0812643 3300046514 Bacteria 544
779 Ga0495630_0183621 3300046517 Bacteria 1595
780 Ga0495642_0241307 3300046528 Bacteria 790
781 Ga0495665_0328240 3300046531 Bacteria 781
782 Ga0495598_0057201 3300046537 Unclassified 1193
783 Ga0495633_0487492 3300046558 Unclassified 556
784 Ga0495657_0389841 3300046675 Bacteria 821
785 Ga0495623_0611984 3300046679 Bacteria 565
786 Ga0495669_0140172 3300046684 Unclassified 1141
787 Ga0495613_0379051 3300046689 Bacteria 968
788 Ga0495589_0593092 3300046794 Unclassified 505
789 Ga0495600_0466772 3300046809 Bacteria 779
790 Ga0495636_0554761 3300047318 Unclassified 559
791 Ga0495674_0208117 3300047319 Bacteria 1621
792 Ga0495602_0292606 3300048088 Bacteria 1195
793 Ga0495602_0502855 3300048088 Unclassified 847
794 Ga0495602_0586665 3300048088 Unclassified 768
795 Ga0495615_0319042 3300048090 Unclassified 507
796 Ga0496100_0050807 3300048903 Bacteria 2688
797 Ga0496100_0541430 3300048903 Unclassified 900
798 Ga0496100_1652646 3300048903 Unclassified 506
799 Ga0496101_0275384 3300048904 Unclassified 1314
800 Ga0496102_0966414 3300048905 Unclassified 773
801 Ga0496104_0411752 3300048907 Bacteria 1264
802 Ga0496104_0700938 3300048907 Bacteria 920
803 Ga0496104_0822837 3300048907 Unclassified 834
804 Ga0496105_0742485 3300048908 Unclassified 750
805 Ga0496106_0421564 3300048909 Bacteria 1072
806 Ga0496107_0036170 3300048910 Bacteria 3541
807 Ga0496107_0269710 3300048910 Bacteria 1267
808 Ga0496108_1547030 3300048911 Bacteria 550
809 Ga0496109_0094679 3300048912 Bacteria 2765
810 Ga0496110_0364946 3300048913 Bacteria 1316
811 Ga0496110_0417272 3300048913 Bacteria 1224
812 Ga0496111_0263149 3300048914 Bacteria 1280
813 Ga0496112_0011991 3300048915 Bacteria 7947
814 Ga0496112_0042949 3300048915 Bacteria 4424
815 Ga0496113_0186155 3300048916 Bacteria 1647
816 Ga0496114_0034464 3300048917 Bacteria 4177
817 Ga0496115_0021441 3300048918 Bacteria 4992
818 Ga0496115_0478194 3300048918 Bacteria 1003
819 Ga0501031_0948121 3300049568 Unclassified 550
820 Ga0501040_0081887 3300049576 Bacteria 2237
821 Ga0501041_0214367 3300049577 Bacteria 1208
822 Ga0501048_0944852 3300049582 Bacteria 620
823 Ga0501071_0420062 3300049587 Bacteria 1022
824 Ga0501071_1297986 3300049587 Bacteria 562
825 Ga0501072_1380168 3300049588 Bacteria 545
826 Ga0501074_0744452 3300049590 Bacteria 691
827 Ga0501075_0267443 3300049591 Archaea 1303
828 Ga0501075_0724237 3300049591 Unclassified 757
829 Ga0501076_0119496 3300049592 Bacteria 2134
830 Ga0501076_0159885 3300049592 Unclassified 1835
831 Ga0501076_0183966 3300049592 Archaea 1704
832 Ga0501079_0370259 3300049741 Bacteria 1123
833 Ga0501080_0693071 3300049742 Bacteria 899
834 Ga0501080_0850438 3300049742 Bacteria 798
835 Ga0501081_0467116 3300049743 Bacteria 938
836 Ga0501081_1428979 3300049743 Unclassified 525
837 Ga0501045_0412636 3300049824 Unclassified 1005
838 nmdc:mga05p37_17267_c1 3300050507 Bacteria 8705
839 nmdc:mga05p37_367733_c1 3300050507 Bacteria 1689
840 nmdc:mga05p37_578204_c1 3300050507 Bacteria 1273
841 nmdc:mga05p37_61918_c1 3300050507 Bacteria 4606
842 nmdc:mga05p37_755556_c1 3300050507 Bacteria 1071
843 nmdc:mga09592_125297_c1 3300050508 Bacteria 2208
844 nmdc:mga09592_1272175_c1 3300050508 Bacteria 606
845 nmdc:mga09592_163592_c1 3300050508 Bacteria 1923
846 nmdc:mga09592_184931_c1 3300050508 Bacteria 1803
847 nmdc:mga09592_208196_c1 3300050508 Bacteria 1694
848 nmdc:mga0qj67_1203784_c1 3300050509 Bacteria 589
849 nmdc:mga0qj67_206132_c1 3300050509 Bacteria 1597
850 nmdc:mga0qj67_567008_c1 3300050509 Unclassified 910
851 nmdc:mga0qj67_63549_c1 3300050509 Bacteria 2935
852 nmdc:mga06r32_106239_c1 3300050510 Bacteria 2758
853 nmdc:mga06r32_1148575_c1 3300050510 Unclassified 724
854 nmdc:mga06r32_13454_c1 3300050510 Bacteria 7411
855 nmdc:mga06r32_1984478_c1 3300050510 Unclassified 516
856 nmdc:mga06r32_51719_c1 3300050510 Bacteria 3932
857 nmdc:mga06r32_683745_c1 3300050510 Bacteria 993
858 nmdc:mga06r32_79564_c1 3300050510 Bacteria 3188
859 nmdc:mga0n895_1557913_c1 3300050512 Bacteria 626
860 nmdc:mga0n895_285491_c1 3300050512 Bacteria 1673
861 nmdc:mga0n895_88169_c1 3300050512 Bacteria 3102
862 nmdc:mga0n895_89364_c1 3300050512 Bacteria 3081
863 nmdc:mga0rr50_1723069_c1 3300050513 Unclassified 528
864 nmdc:mga0rr50_216214_c1 3300050513 Bacteria 1581
865 nmdc:mga0rr50_67529_c1 3300050513 Bacteria 2716
866 nmdc:mga0rr50_768250_c1 3300050513 Unclassified 822
867 nmdc:mga08x19_313236_c1 3300050514 Bacteria 1091
868 nmdc:mga08x19_990057_c1 3300050514 Unclassified 597
869 nmdc:mga0a205_199917_c1 3300050515 Bacteria 1889
870 nmdc:mga0a205_78035_c1 3300050515 Bacteria 3199
871 Ga0500655_023306 3300053133 Unclassified 1168
872 Ga0587130_027164 3300059631 Bacteria 645
873 Ga0530510_1262191 3300061734 Bacteria 566
874 8057104003 8057101203 Bacteria 5034064
875 Ga0105245_10788699
876 SwRhRL2b_contig_395301
877 JGI24740J21852_10033452
878 JGI24740J21852_10144960
879 JGI24743J22301_10074271
880 JGI24035J26624_1028014
881 Ga0006778J45830_1025931
882 JGI25406J46586_10025828
883 Ga0007421J48921_111011
884 Ga0006777J48905_1011461
885 Ga0006777J48905_1047896
886 JGI26145J50221_1015151
887 JGI26143J51219_1009855
888 JGI26141J51220_1008444
889 Ga0007417J51691_1035384
890 Ga0006781J51513_1020053
891 Ga0007409J51694_1089129
892 Ga0007416J51690_1013347
893 Ga0007429J51699_1014090
894 Ga0032354_1013489
895 Ga0006780_1003689
896 Ga0058859_11738374
897 Ga0058861_11943615
898 Ga0058860_10082519
899 Ga0058862_10090948
900 Ga0065704_10240153
901 Ga0065704_10292469
902 Ga0065715_10828582
903 Ga0065715_11024295
904 Ga0070658_10102609
905 Ga0070658_10351655
906 Ga0070658_10690946
907 Ga0070676_10007593
908 Ga0070676_10338051
909 Ga0070683_100033924
910 Ga0070683_100042527
911 Ga0070683_100193695
912 Ga0070683_100612114
913 Ga0070683_100883449
914 Ga0070683_101288546
915 Ga0070690_100782146
916 Ga0070690_100833604
917 Ga0070670_100153951
918 Ga0070670_100383938
919 Ga0068869_100347787
920 Ga0070666_10154392
921 Ga0070666_10215778
922 Ga0070680_100103633
923 Ga0070680_101599172
924 Ga0070682_100857303
925 Ga0068868_100067107
926 Ga0068868_100216982
927 Ga0068868_100286348
928 Ga0068868_100764069
929 Ga0068868_101218569
930 Ga0068868_101501360
931 Ga0070660_100009500
932 Ga0070660_100098730
933 Ga0070689_100010315
934 Ga0070689_102014565
935 Ga0070687_100224540
936 Ga0070687_100549461
937 Ga0070661_100113294
938 Ga0070661_101171133
939 Ga0070692_10028417
940 Ga0070692_10617884
941 Ga0070668_100313178
942 Ga0070668_101217709
943 Ga0070669_100245828
944 Ga0070669_100589900
945 Ga0070675_100047322
946 Ga0070675_100159519
947 Ga0070675_101052652
948 Ga0070675_101799173
949 Ga0070671_100050724
950 Ga0070671_100150986
951 Ga0070671_100288355
952 Ga0070671_100700509
953 Ga0070671_101447970
954 Ga0070674_100584057
955 Ga0070674_100790008
956 Ga0070673_100031917
957 Ga0070673_100254912
958 Ga0070673_100516488
959 Ga0070673_100541123
960 Ga0070673_101628614
961 Ga0070673_101662129
962 Ga0070688_100055529
963 Ga0070659_100175641
964 Ga0070667_100015006
965 Ga0070667_100088848
966 Ga0070667_100843741
967 Ga0070703_10257135
968 Ga0070709_10070518
969 Ga0070709_10225046
970 Ga0070709_11241671
971 Ga0070714_100070569
972 Ga0070714_100749272
973 Ga0070713_100009314
974 Ga0070713_100011341
975 Ga0070713_100048364
976 Ga0070713_100067368
977 Ga0070713_100311787
978 Ga0070713_100637261
979 Ga0070713_100981853
980 Ga0070713_101212805
981 Ga0070710_11311404
982 Ga0070701_10039644
983 Ga0070701_10389101
984 Ga0070701_10722255
985 Ga0070711_100070948
986 Ga0070711_100109473
987 Ga0070711_100136622
988 Ga0070711_100201824
989 Ga0070711_100209804
990 Ga0070711_100235589
991 Ga0070711_100432076
992 Ga0070711_100588222
993 Ga0070711_100682923
994 Ga0070705_100030593
995 Ga0070705_101363272
996 Ga0070700_100473771
997 Ga0070700_100927551
998 Ga0070694_100387531
999 Ga0070708_100000165
1000 Ga0070708_100061130
1001 Ga0070708_100103385
1002 Ga0070708_100117185
1003 Ga0070708_100170773
1004 Ga0070708_100285815
1005 Ga0070708_100510087
1006 Ga0070708_100869220
1007 Ga0070708_102069373
1008 Ga0070663_100685987
1009 Ga0070678_100007770
1010 Ga0070678_101196604
1011 Ga0070662_100032728
1012 Ga0070662_100649945
1013 Ga0070662_100705909
1014 Ga0070662_101180890
1015 Ga0070681_10027157
1016 Ga0070681_10220607
1017 Ga0070681_10441348
1018 Ga0070681_11595543
1019 Ga0068867_100090658
1020 Ga0068867_100707245
1021 Ga0068867_102330241
1022 Ga0070706_100002274
1023 Ga0070706_100073748
1024 Ga0070706_100100035
1025 Ga0070706_100104355
1026 Ga0070706_100160014
1027 Ga0070706_100240172
1028 Ga0070706_100324987
1029 Ga0070706_100552827
1030 Ga0070706_100570327
1031 Ga0070706_101828469
1032 Ga0070707_100012448
1033 Ga0070707_100025103
1034 Ga0070707_100043565
1035 Ga0070707_100065856
1036 Ga0070707_100216727
1037 Ga0070707_100811295
1038 Ga0070707_101372510
1039 Ga0070707_101590358
1040 Ga0070707_101811763
1041 Ga0070707_101977053
1042 Ga0070698_100001673
1043 Ga0070698_100001730
1044 Ga0070698_100002662
1045 Ga0070698_100264550
1046 Ga0070698_100276185
1047 Ga0070698_100569965
1048 Ga0070698_100900035
1049 Ga0070698_101282719
1050 Ga0070699_100001358
1051 Ga0070699_100034130
1052 Ga0070699_100054885
1053 Ga0070699_100582278
1054 Ga0070699_100643405
1055 Ga0070679_100052666
1056 Ga0070679_100526756
1057 Ga0070684_100057638
1058 Ga0070684_100266080
1059 Ga0070684_100672085
1060 Ga0070684_101349908
1061 Ga0070697_100000219
1062 Ga0070697_100003276
1063 Ga0070697_100015720
1064 Ga0070697_100020008
1065 Ga0070697_100098471
1066 Ga0070697_100151173
1067 Ga0070697_100344259
1068 Ga0070697_100347742
1069 Ga0070697_100351636
1070 Ga0070697_100405746
1071 Ga0070697_100598940
1072 Ga0070697_100737642
1073 Ga0070697_100783068
1074 Ga0068853_100218477
1075 Ga0068853_100224059
1076 Ga0068853_100264502
1077 Ga0068853_100328244
1078 Ga0068853_100387697
1079 Ga0068853_101447796
1080 Ga0070672_100236483
1081 Ga0070672_100652236
1082 Ga0070695_100145684
1083 Ga0070695_100370647
1084 Ga0070696_100790780
1085 Ga0070696_100878288
1086 Ga0070696_100942589
1087 Ga0070693_100058482
1088 Ga0070693_100992987
1089 Ga0070693_101347079
1090 Ga0070665_100048715
1091 Ga0070665_100772678
1092 Ga0070704_100105914
1093 Ga0070704_100280453
1094 Ga0070704_100403295
1095 Ga0070704_100419315
1096 Ga0070704_101681217
1097 Ga0070704_101737927
1098 Ga0068855_100007219
1099 Ga0068855_100031043
1100 Ga0068855_100034578
1101 Ga0068855_100271612
1102 Ga0070664_100092995
1103 Ga0070664_100209285
1104 Ga0070664_100270438
1105 Ga0070664_100437921
1106 Ga0070664_101445347
1107 Ga0070664_101795710
1108 Ga0070664_102018961
1109 Ga0068857_100014275
1110 Ga0068857_100242183
1111 Ga0068857_100312519
1112 Ga0068857_100493563
1113 Ga0068857_100775929
1114 Ga0068854_100100521
1115 Ga0068854_100115433
1116 Ga0068854_100496608
1117 Ga0068854_100690426
1118 Ga0068854_100711285
1119 Ga0068854_101719301
1120 Ga0068856_100046176
1121 Ga0068856_100055646
1122 Ga0068856_100088982
1123 Ga0068856_100307198
1124 Ga0068856_100403833
1125 Ga0068856_100527865
1126 Ga0068856_100790313
1127 Ga0068856_101373411
1128 Ga0068856_102133334
1129 Ga0068856_102163758
1130 Ga0070702_100878368
1131 Ga0070702_100890509
1132 Ga0068852_100000008
1133 Ga0068852_100003146
1134 Ga0068852_100163920
1135 Ga0068852_100277509
1136 Ga0068852_100308343
1137 Ga0068852_100424869
1138 Ga0068852_100965098
1139 Ga0068859_100002211
1140 Ga0068859_100012519
1141 Ga0068859_100146671
1142 Ga0068859_100778760
1143 Ga0068864_100055929
1144 Ga0068864_100245284
1145 Ga0068864_100635582
1146 Ga0068864_100862469
1147 Ga0068864_101067950
1148 Ga0068851_10041781
1149 Ga0068851_10100581
1150 Ga0068851_10117386
1151 Ga0068863_100040891
1152 Ga0068863_100651490
1153 Ga0068863_100676092
1154 Ga0068863_101862679
1155 Ga0068858_100047090
1156 Ga0068858_100100810
1157 Ga0068860_100260613
1158 Ga0068860_100660486
1159 Ga0068860_102081727
1160 Ga0068862_100031722
1161 Ga0068862_100075057
1162 Ga0068862_100372770
1163 Ga0068862_100574687
1164 Ga0081539_10000005
1165 Ga0070717_10000654
1166 Ga0070717_10016742
1167 Ga0070717_10050796
1168 Ga0070717_10066909
1169 Ga0070717_10282459
1170 Ga0070717_10351634
1171 Ga0070717_10883629
1172 Ga0070717_10989390
1173 Ga0070717_11864732
1174 Ga0070715_10164863
1175 Ga0070715_10574300
1176 Ga0070716_100116162
1177 Ga0070716_100123538
1178 Ga0070716_100709091
1179 Ga0070712_100026279
1180 Ga0070712_100694790
1181 Ga0070712_100917212
1182 Ga0070712_101298192
1183 Ga0070712_101914303
1184 Ga0075427_10032311
1185 Ga0097621_100087101
1186 Ga0097621_100397308
1187 Ga0097621_100637273
1188 Ga0068871_100020786
1189 Ga0068871_101327345
1190 Ga0068871_101647896
1191 Ga0068871_101899275
1192 Ga0075428_100014049
1193 Ga0075428_100041269
1194 Ga0075428_100067879
1195 Ga0075428_100276966
1196 Ga0075428_101200565
1197 Ga0075428_102010936
1198 Ga0075430_100096652
1199 Ga0075430_100410805
1200 Ga0075430_100464106
1201 Ga0075430_101524088
1202 Ga0075431_100007021
1203 Ga0075431_100043829
1204 Ga0075431_100063317
1205 Ga0075431_100182175
1206 Ga0075431_100223998
1207 Ga0075431_101532891
1208 Ga0075431_101993056
1209 Ga0075433_10004217
1210 Ga0075433_10031481
1211 Ga0075433_10194966
1212 Ga0075433_10245561
1213 Ga0075433_10943875
1214 Ga0075433_11515615
1215 Ga0075434_100000304
1216 Ga0075434_100013627
1217 Ga0075434_100070362
1218 Ga0075434_100159146
1219 Ga0075434_100165148
1220 Ga0075434_100628337
1221 Ga0075434_100910615
1222 Ga0075434_101616431
1223 Ga0075434_102337088
1224 Ga0075429_100008555
1225 Ga0075429_100042515
1226 Ga0075429_100052760
1227 Ga0068865_100021387
1228 Ga0075436_100009467
1229 Ga0075436_100146597
1230 Ga0075436_100637309
1231 Ga0075436_101366170
1232 Ga0075436_101557693
1233 Ga0097620_100002211
1234 Ga0097620_100012519
1235 Ga0097620_100146674
1236 Ga0097620_100778774
1237 Ga0075435_100000230
1238 Ga0075435_100078529
1239 Ga0075435_100134824
1240 Ga0075435_100459405
1241 Ga0075435_100867396
1242 Ga0075435_101861705
1243 Ga0099794_10239356
1244 Ga0099795_10237108
1245 Ga0105240_10000038
1246 Ga0105240_10018687
1247 Ga0105240_10057979
1248 Ga0105240_10073636
1249 Ga0105240_10219712
1250 Ga0105240_10282702
1251 Ga0105240_10313696
1252 Ga0105240_11565624
1253 Ga0111539_11347527
1254 Ga0105245_10471384
1255 Ga0105245_12005751
1256 Ga0105247_10531190
1257 Ga0105247_10642249
1258 Ga0114129_10001343
1259 Ga0114129_10009680
1260 Ga0114129_10069051
1261 Ga0114129_10182027
1262 Ga0114129_10643738
1263 Ga0114129_10971483
1264 Ga0105241_10021578
1265 Ga0105241_10216363
1266 Ga0105241_10289891
1267 Ga0105241_10489006
1268 Ga0105241_11744490
1269 Ga0105242_10273304
1270 Ga0105248_10019891
1271 Ga0105248_10997062
1272 Ga0105248_11332406
1273 Ga0105248_11787350
1274 Ga0105248_12691224
1275 Ga0105237_10030600
1276 Ga0105237_10178762
1277 Ga0105237_10292507
1278 Ga0105237_10486773
1279 Ga0105237_10572840
1280 Ga0105237_10624608
1281 Ga0105237_12206131
1282 Ga0105237_12430995
1283 Ga0105238_10004141
1284 Ga0105238_10040853
1285 Ga0105238_10116578
1286 Ga0105238_10196014
1287 Ga0105238_10251660
1288 Ga0105238_10452480
1289 Ga0105249_10345461
1290 Ga0105249_10426749
1291 Ga0130087_1040717
1292 Ga0130086_1031957
1293 Ga0130084_1006315
1294 Ga0130084_1075912
1295 Ga0130085_1114286
1296 Ga0105239_10088467
1297 Ga0105239_10094759
1298 Ga0105239_10142351
1299 Ga0105239_10594071
1300 Ga0105239_10917747
1301 Ga0105239_12144903
1302 Ga0105239_12505116
1303 Ga0105246_10054588
1304 Ga0157329_1005480
1305 Ga0157315_1028669
1306 Ga0157326_1000938
1307 Ga0154018_100706
1308 Ga0154019_128937
1309 Ga0154014_109584
1310 Ga0154014_114343
1311 Ga0154012_127131
1312 Ga0154013_109613
1313 Ga0157373_10493995
1314 Ga0157373_10712148
1315 Ga0157373_11178806
1316 Ga0157373_11541552
1317 Ga0157371_10784779
1318 Ga0157370_10000255
1319 Ga0157369_10000058
1320 Ga0157369_10042194
1321 Ga0157369_10095207
1322 Ga0157369_10114520
1323 Ga0157369_10138697
1324 Ga0157369_10139606
1325 Ga0157369_10749509
1326 Ga0157374_10006747
1327 Ga0157374_10061363
1328 Ga0157374_10120122
1329 Ga0157374_10137138
1330 Ga0157374_10175767
1331 Ga0157374_10197809
1332 Ga0157374_10341413
1333 Ga0157374_10577185
1334 Ga0157374_10985838
1335 Ga0157374_11399640
1336 Ga0157374_12668882
1337 Ga0157378_10049764
1338 Ga0157378_10062689
1339 Ga0157378_10170441
1340 Ga0157378_10374049
1341 Ga0157378_12350147
1342 Ga0157378_12483411
1343 Ga0157378_12842405
1344 Ga0157378_13065935
1345 Ga0163162_10208021
1346 Ga0163162_10240445
1347 Ga0163162_10250091
1348 Ga0163162_11549193
1349 Ga0163162_11789539
1350 Ga0163162_13037030
1351 Ga0157372_10000152
1352 Ga0157372_10009647
1353 Ga0157372_10057953
1354 Ga0157372_10138167
1355 Ga0157372_10190041
1356 Ga0157372_10283235
1357 Ga0157372_10295038
1358 Ga0157372_10797637
1359 Ga0157372_10853334
1360 Ga0157372_11158275
1361 Ga0157375_10059872
1362 Ga0157375_10316599
1363 Ga0157375_10422469
1364 Ga0157375_11140647
1365 Ga0157375_11802113
1366 Ga0157375_12739990
1367 Ga0157375_13358242
1368 Ga0163163_10223250
1369 Ga0163163_10312314
1370 Ga0157380_11104803
1371 Ga0182008_10032006
1372 Ga0157377_11385999
1373 Ga0157379_10030790
1374 Ga0157379_12173128
1375 Ga0157376_10006532
1376 Ga0157376_10926100
1377 Ga0157376_12699806
1378 Ga0182006_1217037
1379 Ga0182007_10018453
1380 Ga0182007_10147805
1381 Ga0163161_10587676
1382 Ga0163161_10805524
1383 Ga0197907_11356164
1384 Ga0206356_11585638
1385 Ga0206356_11677691
1386 Ga0206348_107277
1387 Ga0206349_1157187
1388 Ga0206349_1165044
1389 Ga0206355_1443982
1390 Ga0206355_1464752
1391 Ga0206351_10849067
1392 Ga0206352_10021389
1393 Ga0206352_10044252
1394 Ga0206352_10939830
1395 Ga0206350_10524235
1396 Ga0206354_10141684
1397 Ga0206354_10543221
1398 Ga0206353_11960987
1399 Ga0154015_1233964
1400 Ga0154015_1370905
1401 Ga0224712_10070995
1402 Ga0224712_10108138
1403 Ga0224712_10220734
1404 Ga0224712_10355692
1405 Ga0224712_10522023
1406 Ga0224569_100117
1407 Ga0224571_100463
1408 Ga0207697_10243714
1409 Ga0207656_10016898
1410 Ga0207656_10022320
1411 Ga0207656_10513185
1412 Ga0207710_10353971
1413 Ga0207710_10468248
1414 Ga0207699_10415786
1415 Ga0207699_11486384
1416 Ga0207705_10642171
1417 Ga0207684_10000758
1418 Ga0207684_10000948
1419 Ga0207684_10001189
1420 Ga0207684_10159518
1421 Ga0207684_10232647
1422 Ga0207684_10262978
1423 Ga0207684_10503359
1424 Ga0207654_10000182
1425 Ga0207654_10368626
1426 Ga0207707_10004308
1427 Ga0207707_10726478
1428 Ga0207695_10000070
1429 Ga0207695_10002289
1430 Ga0207695_10006912
1431 Ga0207695_10028063
1432 Ga0207695_10130953
1433 Ga0207695_10460684
1434 Ga0207671_10000178
1435 Ga0207671_10679895
1436 Ga0207671_11155642
1437 Ga0207671_11218314
1438 Ga0207693_10001222
1439 Ga0207693_10710155
1440 Ga0207663_10021598
1441 Ga0207663_10055409
1442 Ga0207663_10225623
1443 Ga0207662_10613381
1444 Ga0207657_10003660
1445 Ga0207649_10010297
1446 Ga0207649_10366928
1447 Ga0207652_10041751
1448 Ga0207646_10002093
1449 Ga0207646_10003151
1450 Ga0207646_10026554
1451 Ga0207646_10028675
1452 Ga0207646_10080436
1453 Ga0207646_10216455
1454 Ga0207646_10458361
1455 Ga0207681_10177877
1456 Ga0207681_10535780
1457 Ga0207694_10000116
1458 Ga0207694_10011182
1459 Ga0207694_10086107
1460 Ga0207694_10169276
1461 Ga0207694_11349730
1462 Ga0207659_11186993
1463 Ga0207700_10052038
1464 Ga0207700_10075976
1465 Ga0207700_10082905
1466 Ga0207700_10127042
1467 Ga0207700_10676937
1468 Ga0207700_10747420
1469 Ga0207664_10032109
1470 Ga0207664_11228865
1471 Ga0207644_10613369
1472 Ga0207644_11535000
1473 Ga0207706_10081977
1474 Ga0207686_10000745
1475 Ga0207709_11457481
1476 Ga0207670_10743448
1477 Ga0207665_10098463
1478 Ga0207665_10104574
1479 Ga0207665_10807304
1480 Ga0207665_11635539
1481 Ga0207691_10314827
1482 Ga0207711_11599248
1483 Ga0207661_10067381
1484 Ga0207661_10134767
1485 Ga0207661_10326061
1486 Ga0207661_12067319
1487 Ga0207679_11415854
1488 Ga0207667_10009898
1489 Ga0207667_10012501
1490 Ga0207667_10069951
1491 Ga0207667_10078261
1492 Ga0207667_10959413
1493 Ga0207651_10089991
1494 Ga0207651_10372689
1495 Ga0207651_10605884
1496 Ga0207712_10534957
1497 Ga0207640_10078781
1498 Ga0207640_10124959
1499 Ga0207640_11558227
1500 Ga0207658_10389258
1501 Ga0207677_10964790
1502 Ga0207677_11125614
1503 Ga0207703_10037894
1504 Ga0207703_10862102
1505 Ga0207639_10000574
1506 Ga0207639_10061882
1507 Ga0207639_12251569
1508 Ga0207678_11475155
1509 Ga0207708_10082487
1510 Ga0207702_10003394
1511 Ga0207702_10072341
1512 Ga0207702_10137004
1513 Ga0207702_10434187
1514 Ga0207702_10480070
1515 Ga0207702_10495769
1516 Ga0207702_11218344
1517 Ga0207641_11069516
1518 Ga0207641_12067304
1519 Ga0207676_10473981
1520 Ga0207676_10685298
1521 Ga0207674_10002044
1522 Ga0207674_10016756
1523 Ga0207674_10087783
1524 Ga0207674_10224768
1525 Ga0207674_10492020
1526 Ga0207674_10736545
1527 Ga0207675_100212274
1528 Ga0207675_100871572
1529 Ga0207683_10010475
1530 Ga0207698_10000010
1531 Ga0207698_10000117
1532 Ga0207698_10008353
1533 Ga0207698_10135665
1534 Ga0207698_10260493
1535 Ga0207698_10382572
1536 Ga0209969_1033890
1537 Ga0209981_1024974
1538 Ga0209995_1014855
1539 Ga0209968_1054395
1540 Ga0209970_1001987
1541 Ga0209983_1000297
1542 Ga0209588_1109721
1543 Ga0209971_1000689
1544 Ga0209966_1037933
1545 Ga0209998_10002102
1546 Ga0209974_10000120
1547 Ga0207428_10895276
1548 Ga0268266_11238151
1549 Ga0268266_12240242
1550 Ga0268265_10087861
1551 Ga0268265_11411345
1552 Ga0268264_10768348
1553 Ga0265334_10117108
1554 Ga0265334_10330985
1555 Ga0265318_10013740
1556 Ga0265318_10386948
1557 Ga0265336_10007623
1558 Ga0265338_10002480
1559 Ga0265338_10017555
1560 Ga0265338_10034712
1561 Ga0265338_10068878
1562 Ga0265338_10087076
1563 Ga0265338_10264784
1564 Ga0265324_10336594
1565 Ga0265762_1114631
1566 Ga0265762_1116318
1567 Ga0265775_101275
1568 Ga0265777_101075
1569 Ga0265777_111595
1570 Ga0265776_100839
1571 Ga0265776_101285
1572 Ga0265776_101287
1573 Ga0265779_101520
1574 Ga0265779_104131
1575 Ga0265760_10007195
1576 Ga0265760_10088490
1577 Ga0265330_10000081
1578 Ga0265330_10005662
1579 Ga0265330_10029828
1580 Ga0265330_10225785
1581 Ga0265328_10000441
1582 Ga0265320_10035610
1583 Ga0265325_10000107
1584 Ga0265325_10004913
1585 Ga0265325_10011630
1586 Ga0265329_10019134
1587 Ga0265329_10115391
1588 Ga0265340_10000962
1589 Ga0265340_10004693
1590 Ga0265339_10006961
1591 Ga0265339_10041306
1592 Ga0265339_10289552
1593 Ga0265331_10154580
1594 Ga0265327_10164953
1595 Ga0265316_10001669
1596 Ga0265316_10008092
1597 Ga0265316_10088113
1598 Ga0265316_10270011
1599 Ga0265316_10305713
1600 Ga0265313_10000769
1601 Ga0265313_10032553
1602 Ga0265313_10106035
1603 Ga0265314_10000052
1604 Ga0265342_10000641
1605 Ga0265342_10001202
1606 Ga0265342_10109415
1607 Ga0373926_0195520
1608 Ga0373944_0036218
1609 Ga0373936_0607683
1610 Ga0373945_0036594
1611 Ga0373943_0097742
1612 Ga0373946_0005482
1613 Ga0373931_0165018
1614 Ga0373935_0063214
1615 Ga0373935_0776349
1616 Ga0373927_0122421
1617 Ga0373927_0172219
1618 Ga0373947_0175366
1619 Ga0373937_0720908
1620 Ga0265778_009710
1621 Ga0265778_029474
1622 Ga0265778_038284
1623 Ga0265778_047396
1624 Ga0265778_052779
1625 Ga0373925_0182869
1626 Ga0395900_0012798
1627 Ga0395905_0636275
1628 Ga0395901_0040728
1629 Ga0395901_0829136
1630 Ga0242419_020853
1631 Ga0242420_071205
1632 Ga0436363_1582801
1633 Ga0451793_0301317
1634 Ga0451849_1297299
1635 Ga0439448_0052285
1636 Ga0439451_013289
1637 Ga0439454_068109
1638 Ga0450908_104597
1639 Ga0439460_0380043
1640 Ga0451577_0031292
1641 Ga0453683_1077281
1642 Ga0453683_1134230
1643 Ga0453684_0027118
1644 Ga0451576_0112395
1645 Ga0495629_0141884
1646 Ga0495651_0272451
1647 Ga0495653_0476878
1648 Ga0495580_0076290
1649 Ga0495580_0125371
1650 Ga0495582_0135623
1651 Ga0495585_0408813
1652 Ga0495618_0812643
1653 Ga0495630_0183621
1654 Ga0495642_0241307
1655 Ga0495665_0328240
1656 Ga0495598_0057201
1657 Ga0495633_0487492
1658 Ga0495657_0389841
1659 Ga0495623_0611984
1660 Ga0495669_0140172
1661 Ga0495613_0379051
1662 Ga0495589_0593092
1663 Ga0495600_0466772
1664 Ga0495636_0554761
1665 Ga0495674_0208117
1666 Ga0495602_0292606
1667 Ga0495602_0502855
1668 Ga0495602_0586665
1669 Ga0495615_0319042
1670 Ga0496100_0050807
1671 Ga0496100_0541430
1672 Ga0496100_1652646
1673 Ga0496101_0275384
1674 Ga0496102_0966414
1675 Ga0496104_0411752
1676 Ga0496104_0700938
1677 Ga0496104_0822837
1678 Ga0496105_0742485
1679 Ga0496106_0421564
1680 Ga0496107_0036170
1681 Ga0496107_0269710
1682 Ga0496108_1547030
1683 Ga0496109_0094679
1684 Ga0496110_0364946
1685 Ga0496110_0417272
1686 Ga0496111_0263149
1687 Ga0496112_0011991
1688 Ga0496112_0042949
1689 Ga0496113_0186155
1690 Ga0496114_0034464
1691 Ga0496115_0021441
1692 Ga0496115_0478194
1693 Ga0501031_0948121
1694 Ga0501040_0081887
1695 Ga0501041_0214367
1696 Ga0501048_0944852
1697 Ga0501071_0420062
1698 Ga0501071_1297986
1699 Ga0501072_1380168
1700 Ga0501074_0744452
1701 Ga0501075_0267443
1702 Ga0501075_0724237
1703 Ga0501076_0119496
1704 Ga0501076_0159885
1705 Ga0501076_0183966
1706 Ga0501079_0370259
1707 Ga0501080_0693071
1708 Ga0501080_0850438
1709 Ga0501081_0467116
1710 Ga0501081_1428979
1711 Ga0501045_0412636
1712 nmdc:mga05p37_17267_c1
1713 nmdc:mga05p37_367733_c1
1714 nmdc:mga05p37_578204_c1
1715 nmdc:mga05p37_61918_c1
1716 nmdc:mga05p37_755556_c1
1717 nmdc:mga09592_125297_c1
1718 nmdc:mga09592_1272175_c1
1719 nmdc:mga09592_163592_c1
1720 nmdc:mga09592_184931_c1
1721 nmdc:mga09592_208196_c1
1722 nmdc:mga0qj67_1203784_c1
1723 nmdc:mga0qj67_206132_c1
1724 nmdc:mga0qj67_567008_c1
1725 nmdc:mga0qj67_63549_c1
1726 nmdc:mga06r32_106239_c1
1727 nmdc:mga06r32_1148575_c1
1728 nmdc:mga06r32_13454_c1
1729 nmdc:mga06r32_1984478_c1
1730 nmdc:mga06r32_51719_c1
1731 nmdc:mga06r32_683745_c1
1732 nmdc:mga06r32_79564_c1
1733 nmdc:mga0n895_1557913_c1
1734 nmdc:mga0n895_285491_c1
1735 nmdc:mga0n895_88169_c1
1736 nmdc:mga0n895_89364_c1
1737 nmdc:mga0rr50_1723069_c1
1738 nmdc:mga0rr50_216214_c1
1739 nmdc:mga0rr50_67529_c1
1740 nmdc:mga0rr50_768250_c1
1741 nmdc:mga08x19_313236_c1
1742 nmdc:mga08x19_990057_c1
1743 nmdc:mga0a205_199917_c1
1744 nmdc:mga0a205_78035_c1
1745 Ga0500655_023306
1746 Ga0587130_027164
1747 Ga0530510_1262191
1748 8057104003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18919

DUF5670

Family of unknown function (DUF5670)

5

47

0.99

Map