F484248

General Info

Members Datasets Scaffolds Average Seq Length
873 289 1746 259

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100122017|Ga0070682_1001220172
Length 292
Sequence MSSSAECERLLDLPGWIRPVEPQLDFTGGFPMTTATSTLLGRPVWYELMTGDVAAAETFYKNVIGWTSAPFRGAPDPYDVFKRSGDVQVAGVMHTPKGMNMPPFWSMYVAVPKLEEAVAHIKRLGGTELSGVIDVPTVGRMQMLKDPQGAAFYIIQPAPREERAETAPVVGEASWHELMTTDADAAMKFYSDVFGWQPSEAMDMGEMGKYQMFNRPSGMIGGMMNKPPQMADVPPYWAIYFLVPDINAAVERIKANGGQVLNGPMEVPGGDWIVNAMDPQGAMFSLHAKKAQ

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
251 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
252 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
258 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
259 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 3.09
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 21.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100122017 3300005337 Bacteria 1751
2 MRS1b_contig_3199878 2162886011 Unclassified 949
3 Ga0058859_11229463 3300004798 Bacteria 1041
4 Ga0058863_11934526 3300004799 Bacteria 1226
5 Ga0058861_11748004 3300004800 Bacteria 1374
6 Ga0058861_12031893 3300004800 Bacteria 1094
7 Ga0058860_10064540 3300004801 Unclassified 1164
8 Ga0058860_10090918 3300004801 Bacteria 918
9 Ga0058860_11611968 3300004801 Bacteria 1142
10 Ga0058860_12028819 3300004801 Bacteria 1216
11 Ga0058862_12539343 3300004803 Bacteria 1186
12 Ga0058862_12758636 3300004803 Unclassified 943
13 Ga0058862_12783670 3300004803 Unclassified 989
14 Ga0065714_10071074 3300005288 Bacteria 3671
15 Ga0065704_10171588 3300005289 Unclassified 1288
16 Ga0065712_10003381 3300005290 Bacteria 5639
17 Ga0065712_10010152 3300005290 Bacteria 2758
18 Ga0065712_10074252 3300005290 Unclassified 4144
19 Ga0065715_10004219 3300005293 Bacteria 6834
20 Ga0065715_10094822 3300005293 Unclassified 4232
21 Ga0065715_10102412 3300005293 Bacteria 3117
22 Ga0065715_10126090 3300005293 Bacteria 2101
23 Ga0065715_10167934 3300005293 Bacteria 1571
24 Ga0065715_10169792 3300005293 Unclassified 1556
25 Ga0065707_10092277 3300005295 Bacteria 3794
26 Ga0065707_10194570 3300005295 Bacteria 1337
27 Ga0065707_10212626 3300005295 Unclassified 1256
28 Ga0070658_10013944 3300005327 Bacteria 6452
29 Ga0070676_10019726 3300005328 Unclassified 3756
30 Ga0070676_10140219 3300005328 Unclassified 1538
31 Ga0070683_100000260 3300005329 Bacteria 36410
32 Ga0070683_100707004 3300005329 Bacteria 965
33 Ga0070690_100011445 3300005330 Bacteria 5189
34 Ga0070690_100014027 3300005330 Unclassified 4750
35 Ga0070690_100023056 3300005330 Bacteria 3814
36 Ga0070670_100001340 3300005331 Bacteria 19679
37 Ga0070670_100005713 3300005331 Bacteria 10514
38 Ga0070670_100008280 3300005331 Bacteria 8852
39 Ga0070670_100013192 3300005331 Bacteria 7078
40 Ga0070670_100016091 3300005331 Bacteria 6420
41 Ga0070670_100068105 3300005331 Bacteria 3055
42 Ga0070670_100124633 3300005331 Bacteria 2224
43 Ga0070670_100156618 3300005331 Unclassified 1973
44 Ga0070670_100163332 3300005331 Bacteria 1930
45 Ga0070670_100540427 3300005331 Bacteria 1039
46 Ga0070677_10016722 3300005333 Bacteria 2615
47 Ga0070677_10058734 3300005333 Unclassified 1580
48 Ga0068869_100020689 3300005334 Unclassified 4517
49 Ga0068869_100025458 3300005334 Bacteria 4109
50 Ga0068869_100154420 3300005334 Unclassified 1782
51 Ga0070666_10012985 3300005335 Bacteria 5273
52 Ga0070666_10064586 3300005335 Bacteria 2482
53 Ga0070666_10159512 3300005335 Unclassified 1576
54 Ga0070666_10227019 3300005335 Bacteria 1318
55 Ga0070666_10322574 3300005335 Bacteria 1102
56 Ga0070680_100441545 3300005336 Bacteria 1111
57 Ga0068868_100011659 3300005338 Bacteria 6404
58 Ga0070660_100275589 3300005339 Unclassified 1376
59 Ga0070689_100039410 3300005340 Unclassified 3617
60 Ga0070689_100245288 3300005340 Unclassified 1477
61 Ga0070689_100468948 3300005340 Bacteria 1074
62 Ga0070687_100006132 3300005343 Bacteria 4910
63 Ga0070687_100031838 3300005343 Unclassified 2590
64 Ga0070687_100050658 3300005343 Bacteria 2145
65 Ga0070661_100001252 3300005344 Bacteria 17814
66 Ga0070661_100020068 3300005344 Bacteria 4764
67 Ga0070668_100013056 3300005347 Bacteria 6187
68 Ga0070668_100136203 3300005347 Bacteria 1975
69 Ga0070668_100296484 3300005347 Bacteria 1355
70 Ga0070668_100320759 3300005347 Bacteria 1304
71 Ga0070668_100659752 3300005347 Bacteria 920
72 Ga0070669_100000399 3300005353 Bacteria 33282
73 Ga0070669_100002199 3300005353 Bacteria 14122
74 Ga0070669_100003613 3300005353 Bacteria 11161
75 Ga0070669_100017648 3300005353 Bacteria 5091
76 Ga0070669_100036098 3300005353 Bacteria 3581
77 Ga0070669_100073288 3300005353 Bacteria 2536
78 Ga0070669_100102331 3300005353 Bacteria 2163
79 Ga0070669_100307046 3300005353 Bacteria 1277
80 Ga0070675_100017161 3300005354 Bacteria 5753
81 Ga0070675_100047773 3300005354 Bacteria 3508
82 Ga0070675_100081052 3300005354 Unclassified 2706
83 Ga0070675_100124137 3300005354 Bacteria 2196
84 Ga0070675_100277332 3300005354 Unclassified 1472
85 Ga0070675_100631575 3300005354 Bacteria 973
86 Ga0070675_100647599 3300005354 Unclassified 960
87 Ga0070671_100171233 3300005355 Bacteria 1836
88 Ga0070671_100268190 3300005355 Unclassified 1451
89 Ga0070671_100462898 3300005355 Unclassified 1088
90 Ga0070674_100000133 3300005356 Bacteria 34091
91 Ga0070674_100038102 3300005356 Unclassified 3238
92 Ga0070674_100130461 3300005356 Unclassified 1873
93 Ga0070673_100007069 3300005364 Bacteria 7366
94 Ga0070673_100008782 3300005364 Bacteria 6745
95 Ga0070673_100032544 3300005364 Bacteria 3928
96 Ga0070673_100458554 3300005364 Unclassified 1147
97 Ga0070688_100087207 3300005365 Unclassified 2032
98 Ga0070688_100106534 3300005365 Unclassified 1857
99 Ga0070688_100117494 3300005365 Bacteria 1777
100 Ga0070688_100210667 3300005365 Unclassified 1364
101 Ga0070667_100004567 3300005367 Bacteria 11631
102 Ga0070703_10158118 3300005406 Unclassified 857
103 Ga0070701_10001279 3300005438 Bacteria 9244
104 Ga0070701_10043901 3300005438 Unclassified 2289
105 Ga0070701_10068895 3300005438 Bacteria 1886
106 Ga0070705_100053529 3300005440 Unclassified 2363
107 Ga0070705_100232308 3300005440 Bacteria 1284
108 Ga0070700_100015636 3300005441 Bacteria 4308
109 Ga0070700_100077549 3300005441 Unclassified 2137
110 Ga0070700_100155460 3300005441 Bacteria 1569
111 Ga0070700_100506285 3300005441 Bacteria 930
112 Ga0070694_100033846 3300005444 Unclassified 3367
113 Ga0070708_100346796 3300005445 Unclassified 1399
114 Ga0070663_100007791 3300005455 Bacteria 6545
115 Ga0070678_100026864 3300005456 Bacteria 3899
116 Ga0070678_100054028 3300005456 Bacteria 2924
117 Ga0070678_100130396 3300005456 Bacteria 1996
118 Ga0070678_100161441 3300005456 Bacteria 1816
119 Ga0070662_100011707 3300005457 Bacteria 5790
120 Ga0070662_100024347 3300005457 Unclassified 4170
121 Ga0068867_100004682 3300005459 Bacteria 9625
122 Ga0068867_100022711 3300005459 Bacteria 4487
123 Ga0068867_100058755 3300005459 Bacteria 2850
124 Ga0068867_100600452 3300005459 Bacteria 960
125 Ga0070685_10041862 3300005466 Unclassified 2611
126 Ga0070685_10260454 3300005466 Bacteria 1153
127 Ga0070698_100205261 3300005471 Bacteria 1906
128 Ga0070698_100740187 3300005471 Unclassified 926
129 Ga0070699_100000485 3300005518 Bacteria 37796
130 Ga0070699_100041522 3300005518 Bacteria 3982
131 Ga0070679_100116476 3300005530 Bacteria 2657
132 Ga0070684_100000898 3300005535 Bacteria 21069
133 Ga0070697_100165138 3300005536 Bacteria 1872
134 Ga0070672_100012392 3300005543 Bacteria 5984
135 Ga0070672_100015890 3300005543 Bacteria 5375
136 Ga0070672_100186409 3300005543 Unclassified 1731
137 Ga0070672_100412461 3300005543 Bacteria 1159
138 Ga0070686_100009424 3300005544 Bacteria 5489
139 Ga0070686_100051783 3300005544 Unclassified 2615
140 Ga0070686_100251732 3300005544 Bacteria 1290
141 Ga0070695_100417634 3300005545 Bacteria 1021
142 Ga0070696_100443868 3300005546 Unclassified 1023
143 Ga0070665_100028846 3300005548 Bacteria 5586
144 Ga0070665_100048324 3300005548 Unclassified 4272
145 Ga0070665_100444421 3300005548 Unclassified 1306
146 Ga0070704_100033061 3300005549 Unclassified 3495
147 Ga0070664_100002150 3300005564 Bacteria 15800
148 Ga0070664_100014148 3300005564 Bacteria 6508
149 Ga0070664_100312663 3300005564 Unclassified 1422
150 Ga0070664_100402932 3300005564 Unclassified 1251
151 Ga0070664_100554967 3300005564 Unclassified 1062
152 Ga0068857_100011022 3300005577 Bacteria 7870
153 Ga0068857_100013100 3300005577 Bacteria 7226
154 Ga0068857_100062811 3300005577 Bacteria 3302
155 Ga0068857_100628900 3300005577 Bacteria 1016
156 Ga0068854_100145624 3300005578 Unclassified 1822
157 Ga0070702_100091927 3300005615 Bacteria 1842
158 Ga0068852_100210251 3300005616 Bacteria 1845
159 Ga0068859_100005105 3300005617 Bacteria 13335
160 Ga0068859_100009922 3300005617 Bacteria 9611
161 Ga0068859_100012595 3300005617 Bacteria 8505
162 Ga0068859_100060387 3300005617 Bacteria 3820
163 Ga0068859_100079721 3300005617 Bacteria 3315
164 Ga0068859_100237905 3300005617 Unclassified 1910
165 Ga0068864_100039642 3300005618 Unclassified 4025
166 Ga0068864_100064648 3300005618 Bacteria 3173
167 Ga0068864_100427390 3300005618 Bacteria 1263
168 Ga0068864_100511997 3300005618 Unclassified 1156
169 Ga0068861_100006364 3300005719 Bacteria 8040
170 Ga0068861_100013596 3300005719 Bacteria 5698
171 Ga0068861_100172423 3300005719 Bacteria 1794
172 Ga0068870_10000968 3300005840 Bacteria 11294
173 Ga0068870_10014039 3300005840 Bacteria 3775
174 Ga0068870_10059758 3300005840 Bacteria 2044
175 Ga0068870_10066038 3300005840 Bacteria 1959
176 Ga0068863_100000005 3300005841 Bacteria 269757
177 Ga0068863_100000867 3300005841 Bacteria 30266
178 Ga0068863_100039399 3300005841 Bacteria 4496
179 Ga0068863_100083183 3300005841 Bacteria 3033
180 Ga0068863_100158225 3300005841 Unclassified 2169
181 Ga0068863_100834985 3300005841 Bacteria 920
182 Ga0068863_100865957 3300005841 Bacteria 903
183 Ga0068858_100007931 3300005842 Bacteria 10232
184 Ga0068858_100009898 3300005842 Bacteria 9058
185 Ga0068858_100012596 3300005842 Bacteria 7971
186 Ga0068858_100048972 3300005842 Bacteria 3914
187 Ga0068858_100083127 3300005842 Bacteria 2977
188 Ga0068858_100336378 3300005842 Bacteria 1444
189 Ga0068860_100000008 3300005843 Bacteria 427367
190 Ga0068860_100021964 3300005843 Bacteria 6176
191 Ga0068860_100053433 3300005843 Bacteria 3841
192 Ga0068860_100140178 3300005843 Bacteria 2324
193 Ga0068860_100194295 3300005843 Unclassified 1965
194 Ga0068862_100001221 3300005844 Bacteria 24241
195 Ga0068862_100012814 3300005844 Bacteria 6936
196 Ga0068862_100038425 3300005844 Bacteria 4059
197 Ga0068862_100051534 3300005844 Unclassified 3520
198 Ga0068862_100100586 3300005844 Bacteria 2528
199 Ga0068862_100137218 3300005844 Bacteria 2169
200 Ga0068862_100205237 3300005844 Bacteria 1778
201 Ga0068862_100280175 3300005844 Unclassified 1528
202 Ga0068862_100517777 3300005844 Bacteria 1135
203 Ga0081455_10034132 3300005937 Bacteria 4562
204 Ga0081455_10156505 3300005937 Bacteria 1751
205 Ga0081455_10191329 3300005937 Bacteria 1540
206 Ga0075368_10005612 3300006042 Bacteria 4329
207 Ga0075364_10130065 3300006051 Bacteria 1689
208 Ga0075367_10211582 3300006178 Unclassified 1212
209 Ga0075366_10027111 3300006195 Bacteria 3360
210 Ga0075366_10129648 3300006195 Bacteria 1522
211 Ga0097621_100049978 3300006237 Bacteria 3399
212 Ga0097621_100176404 3300006237 Bacteria 1845
213 Ga0075370_10013601 3300006353 Bacteria 4330
214 Ga0068871_100043752 3300006358 Bacteria 3598
215 Ga0068871_100095480 3300006358 Unclassified 2483
216 Ga0068871_100203448 3300006358 Unclassified 1710
217 Ga0075428_100004960 3300006844 Bacteria 14782
218 Ga0075428_100009217 3300006844 Bacteria 10949
219 Ga0075428_100014803 3300006844 Bacteria 8668
220 Ga0075428_100073348 3300006844 Bacteria 3738
221 Ga0075428_100074638 3300006844 Bacteria 3704
222 Ga0075428_100144399 3300006844 Bacteria 2587
223 Ga0075428_100152385 3300006844 Unclassified 2511
224 Ga0075428_100231389 3300006844 Bacteria 1994
225 Ga0075428_100314293 3300006844 Bacteria 1684
226 Ga0075428_100477156 3300006844 Bacteria 1335
227 Ga0075430_100000381 3300006846 Bacteria 32603
228 Ga0075430_100002731 3300006846 Bacteria 14733
229 Ga0075430_100003464 3300006846 Bacteria 13207
230 Ga0075430_100027201 3300006846 Bacteria 4862
231 Ga0075430_100029136 3300006846 Bacteria 4686
232 Ga0075430_100029161 3300006846 Bacteria 4684
233 Ga0075430_100097419 3300006846 Bacteria 2457
234 Ga0075430_100165560 3300006846 Bacteria 1840
235 Ga0075430_100326305 3300006846 Unclassified 1269
236 Ga0075431_100003416 3300006847 Bacteria 15405
237 Ga0075431_100004623 3300006847 Bacteria 13514
238 Ga0075431_100007678 3300006847 Bacteria 10741
239 Ga0075431_100014566 3300006847 Bacteria 7956
240 Ga0075431_100026322 3300006847 Bacteria 5967
241 Ga0075431_100030553 3300006847 Bacteria 5550
242 Ga0075431_100040167 3300006847 Bacteria 4821
243 Ga0075431_100080952 3300006847 Bacteria 3353
244 Ga0075431_100091222 3300006847 Bacteria 3145
245 Ga0075431_100134472 3300006847 Bacteria 2549
246 Ga0075431_100210863 3300006847 Bacteria 1984
247 Ga0075431_100359785 3300006847 Unclassified 1462
248 Ga0075431_100365266 3300006847 Unclassified 1449
249 Ga0075431_100379848 3300006847 Bacteria 1417
250 Ga0075431_100514590 3300006847 Unclassified 1187
251 Ga0075431_100626470 3300006847 Unclassified 1058
252 Ga0075433_10000202 3300006852 Bacteria 33478
253 Ga0075433_10001786 3300006852 Bacteria 16117
254 Ga0075433_10003482 3300006852 Bacteria 12158
255 Ga0075433_10042323 3300006852 Bacteria 3951
256 Ga0075433_10098939 3300006852 Bacteria 2582
257 Ga0075433_10146676 3300006852 Bacteria 2098
258 Ga0075433_10162575 3300006852 Bacteria 1987
259 Ga0075433_10333096 3300006852 Bacteria 1342
260 Ga0075434_100000875 3300006871 Bacteria 24088
261 Ga0075434_100016237 3300006871 Bacteria 7156
262 Ga0075434_100030656 3300006871 Bacteria 5297
263 Ga0075434_100082095 3300006871 Unclassified 3220
264 Ga0075434_100093703 3300006871 Bacteria 3007
265 Ga0075434_100120243 3300006871 Bacteria 2641
266 Ga0075434_100544748 3300006871 Unclassified 1180
267 Ga0075429_100003511 3300006880 Bacteria 13368
268 Ga0075429_100010406 3300006880 Bacteria 8049
269 Ga0075429_100061640 3300006880 Unclassified 3268
270 Ga0075429_100072231 3300006880 Unclassified 3005
271 Ga0075429_100074273 3300006880 Unclassified 2962
272 Ga0075429_100080109 3300006880 Unclassified 2846
273 Ga0075429_100091450 3300006880 Bacteria 2654
274 Ga0075429_100104488 3300006880 Bacteria 2474
275 Ga0075429_100109643 3300006880 Bacteria 2413
276 Ga0075429_100212024 3300006880 Unclassified 1697
277 Ga0075429_100219241 3300006880 Bacteria 1667
278 Ga0068865_100004621 3300006881 Bacteria 8315
279 Ga0075436_100027966 3300006914 Bacteria 3881
280 Ga0097620_100005105 3300006931 Bacteria 13335
281 Ga0097620_100009922 3300006931 Bacteria 9611
282 Ga0097620_100012593 3300006931 Bacteria 8505
283 Ga0097620_100060387 3300006931 Bacteria 3820
284 Ga0097620_100079721 3300006931 Bacteria 3315
285 Ga0097620_100237898 3300006931 Unclassified 1910
286 Ga0075435_100004350 3300007076 Bacteria 9734
287 Ga0075435_100032944 3300007076 Bacteria 4094
288 Ga0075435_100192506 3300007076 Bacteria 1726
289 Ga0111539_10005953 3300009094 Bacteria 15750
290 Ga0111539_10007864 3300009094 Bacteria 13616
291 Ga0111539_10009385 3300009094 Bacteria 12349
292 Ga0111539_10034066 3300009094 Bacteria 6179
293 Ga0111539_10059762 3300009094 Unclassified 4519
294 Ga0111539_10074765 3300009094 Unclassified 3993
295 Ga0111539_10094768 3300009094 Unclassified 3507
296 Ga0111539_10126120 3300009094 Bacteria 2999
297 Ga0111539_10132362 3300009094 Bacteria 2920
298 Ga0111539_10134852 3300009094 Bacteria 2891
299 Ga0111539_10232020 3300009094 Bacteria 2149
300 Ga0111539_10243421 3300009094 Bacteria 2094
301 Ga0105245_10249724 3300009098 Unclassified 1723
302 Ga0105245_10721333 3300009098 Bacteria 1031
303 Ga0105247_10009735 3300009101 Bacteria 5828
304 Ga0105247_10285540 3300009101 Unclassified 1140
305 Ga0114129_10000022 3300009147 Bacteria 119291
306 Ga0114129_10003016 3300009147 Bacteria 23605
307 Ga0114129_10003432 3300009147 Bacteria 22271
308 Ga0114129_10013890 3300009147 Bacteria 11474
309 Ga0114129_10017528 3300009147 Bacteria 10197
310 Ga0114129_10028685 3300009147 Bacteria 7885
311 Ga0114129_10046369 3300009147 Bacteria 6108
312 Ga0114129_10057192 3300009147 Bacteria 5460
313 Ga0114129_10067969 3300009147 Bacteria 4969
314 Ga0114129_10074127 3300009147 Bacteria 4741
315 Ga0114129_10093312 3300009147 Unclassified 4170
316 Ga0114129_10100099 3300009147 Bacteria 4011
317 Ga0114129_10106729 3300009147 Bacteria 3868
318 Ga0114129_10188764 3300009147 Bacteria 2800
319 Ga0114129_10228245 3300009147 Bacteria 2508
320 Ga0114129_10422479 3300009147 Bacteria 1753
321 Ga0114129_10428859 3300009147 Bacteria 1737
322 Ga0114129_10665167 3300009147 Bacteria 1343
323 Ga0114129_10696160 3300009147 Bacteria 1306
324 Ga0114129_10701113 3300009147 Bacteria 1301
325 Ga0114129_11075208 3300009147 Bacteria 1009
326 Ga0105248_10008525 3300009177 Bacteria 11255
327 Ga0105248_10011617 3300009177 Bacteria 9701
328 Ga0105248_10011763 3300009177 Bacteria 9653
329 Ga0105248_10026048 3300009177 Bacteria 6506
330 Ga0105248_10051068 3300009177 Bacteria 4640
331 Ga0105248_10083496 3300009177 Bacteria 3593
332 Ga0105248_10130990 3300009177 Bacteria 2830
333 Ga0105248_10264336 3300009177 Bacteria 1937
334 Ga0105248_10544546 3300009177 Bacteria 1309
335 Ga0105248_10633814 3300009177 Bacteria 1206
336 Ga0105248_10712024 3300009177 Bacteria 1133
337 Ga0105248_10775390 3300009177 Bacteria 1082
338 Ga0105237_10135419 3300009545 Unclassified 2458
339 Ga0105249_10002178 3300009553 Bacteria 16974
340 Ga0105249_10033902 3300009553 Unclassified 4624
341 Ga0105249_10086394 3300009553 Bacteria 2925
342 Ga0105249_10194900 3300009553 Unclassified 1979
343 Ga0105249_10328074 3300009553 Bacteria 1543
344 Ga0105249_10405995 3300009553 Bacteria 1394
345 Ga0105249_10460113 3300009553 Bacteria 1312
346 Ga0105239_10055042 3300010375 Bacteria 4364
347 Ga0105246_10151349 3300011119 Unclassified 1757
348 Ga0105246_10170480 3300011119 Unclassified 1666
349 Ga0157369_10393377 3300013105 Bacteria 1438
350 Ga0157374_10014200 3300013296 Bacteria 6964
351 Ga0163162_10057350 3300013306 Bacteria 3923
352 Ga0157372_10744242 3300013307 Bacteria 1140
353 Ga0157375_10004391 3300013308 Bacteria 12242
354 Ga0157375_10215352 3300013308 Bacteria 2078
355 Ga0157375_10459444 3300013308 Bacteria 1439
356 Ga0157375_10704525 3300013308 Unclassified 1163
357 Ga0163163_10012072 3300014325 Bacteria 7859
358 Ga0163163_10040189 3300014325 Unclassified 4567
359 Ga0163163_10153205 3300014325 Bacteria 2348
360 Ga0157380_10012655 3300014326 Bacteria 6124
361 Ga0157380_10053866 3300014326 Unclassified 3191
362 Ga0157380_10124633 3300014326 Unclassified 2188
363 Ga0157380_10129036 3300014326 Bacteria 2154
364 Ga0157380_10158026 3300014326 Bacteria 1967
365 Ga0157380_10210677 3300014326 Bacteria 1731
366 Ga0157380_10265621 3300014326 Bacteria 1561
367 Ga0157380_10360187 3300014326 Bacteria 1364
368 Ga0157377_10008902 3300014745 Bacteria 4911
369 Ga0157377_10031373 3300014745 Bacteria 2887
370 Ga0157379_10016566 3300014968 Bacteria 6481
371 Ga0157379_10017284 3300014968 Bacteria 6354
372 Ga0157379_10073242 3300014968 Unclassified 3065
373 Ga0157376_10028990 3300014969 Bacteria 4406
374 Ga0163161_10087470 3300017792 Unclassified 2302
375 Ga0163161_10116583 3300017792 Bacteria 2002
376 Ga0206356_10432168 3300020070 Unclassified 933
377 Ga0213872_10116995 3300021361 Bacteria 1180
378 Ga0224712_10197880 3300022467 Unclassified 912
379 Ga0207697_10001648 3300025315 Bacteria 12069
380 Ga0207697_10010073 3300025315 Unclassified 4059
381 Ga0207697_10015174 3300025315 Bacteria 3186
382 Ga0207697_10093832 3300025315 Bacteria 1273
383 Ga0207682_10008517 3300025893 Unclassified 4052
384 Ga0207682_10021451 3300025893 Bacteria 2541
385 Ga0207642_10154808 3300025899 Unclassified 1224
386 Ga0207710_10006846 3300025900 Bacteria 4851
387 Ga0207688_10013358 3300025901 Bacteria 4461
388 Ga0207688_10058421 3300025901 Unclassified 2170
389 Ga0207680_10021614 3300025903 Unclassified 3484
390 Ga0207680_10025785 3300025903 Bacteria 3247
391 Ga0207680_10118406 3300025903 Bacteria 1729
392 Ga0207680_10196220 3300025903 Bacteria 1373
393 Ga0207680_10265102 3300025903 Bacteria 1190
394 Ga0207647_10136441 3300025904 Bacteria 1440
395 Ga0207645_10003388 3300025907 Bacteria 12118
396 Ga0207645_10040789 3300025907 Bacteria 2973
397 Ga0207645_10137629 3300025907 Unclassified 1590
398 Ga0207643_10002413 3300025908 Bacteria 10115
399 Ga0207684_10178354 3300025910 Bacteria 1832
400 Ga0207707_10041639 3300025912 Bacteria 4011
401 Ga0207662_10011372 3300025918 Bacteria 4933
402 Ga0207662_10022232 3300025918 Bacteria 3633
403 Ga0207662_10215739 3300025918 Bacteria 1247
404 Ga0207657_10216614 3300025919 Bacteria 1535
405 Ga0207649_10004162 3300025920 Bacteria 7879
406 Ga0207652_10276834 3300025921 Bacteria 1514
407 Ga0207646_10112952 3300025922 Bacteria 2438
408 Ga0207681_10009018 3300025923 Bacteria 6094
409 Ga0207681_10024466 3300025923 Bacteria 3876
410 Ga0207681_10041155 3300025923 Bacteria 3079
411 Ga0207681_10041333 3300025923 Unclassified 3073
412 Ga0207681_10105521 3300025923 Unclassified 2040
413 Ga0207681_10228473 3300025923 Bacteria 1443
414 Ga0207650_10009691 3300025925 Bacteria 6585
415 Ga0207650_10025629 3300025925 Unclassified 4201
416 Ga0207650_10085355 3300025925 Unclassified 2402
417 Ga0207650_10120578 3300025925 Unclassified 2041
418 Ga0207650_10149901 3300025925 Bacteria 1840
419 Ga0207650_10170112 3300025925 Unclassified 1731
420 Ga0207650_10207765 3300025925 Bacteria 1571
421 Ga0207650_10464442 3300025925 Bacteria 1055
422 Ga0207659_10057797 3300025926 Unclassified 2783
423 Ga0207659_10255952 3300025926 Unclassified 1422
424 Ga0207659_10296426 3300025926 Bacteria 1327
425 Ga0207644_10030834 3300025931 Bacteria 3732
426 Ga0207644_10163895 3300025931 Unclassified 1730
427 Ga0207644_10180956 3300025931 Bacteria 1652
428 Ga0207690_10373539 3300025932 Bacteria 1132
429 Ga0207706_10006664 3300025933 Bacteria 10678
430 Ga0207706_10057575 3300025933 Bacteria 3424
431 Ga0207706_10084872 3300025933 Unclassified 2784
432 Ga0207706_10229777 3300025933 Bacteria 1623
433 Ga0207706_10428455 3300025933 Bacteria 1146
434 Ga0207706_10504749 3300025933 Bacteria 1044
435 Ga0207686_10033165 3300025934 Bacteria 3080
436 Ga0207670_10009343 3300025936 Bacteria 5593
437 Ga0207670_10021772 3300025936 Bacteria 3960
438 Ga0207670_10110882 3300025936 Bacteria 1977
439 Ga0207670_10149820 3300025936 Unclassified 1730
440 Ga0207670_10470744 3300025936 Unclassified 1016
441 Ga0207670_10717644 3300025936 Bacteria 829
442 Ga0207669_10004070 3300025937 Bacteria 6404
443 Ga0207669_10128460 3300025937 Unclassified 1736
444 Ga0207669_10230104 3300025937 Bacteria 1367
445 Ga0207669_10289904 3300025937 Unclassified 1239
446 Ga0207704_10039222 3300025938 Unclassified 2755
447 Ga0207704_10044350 3300025938 Bacteria 2634
448 Ga0207704_10106645 3300025938 Bacteria 1882
449 Ga0207691_10005619 3300025940 Bacteria 12118
450 Ga0207691_10027372 3300025940 Bacteria 5344
451 Ga0207691_10043702 3300025940 Bacteria 4128
452 Ga0207691_10090897 3300025940 Unclassified 2736
453 Ga0207691_10099066 3300025940 Bacteria 2603
454 Ga0207691_10292231 3300025940 Bacteria 1401
455 Ga0207691_10307917 3300025940 Unclassified 1360
456 Ga0207711_10027516 3300025941 Bacteria 4776
457 Ga0207711_10052589 3300025941 Bacteria 3491
458 Ga0207711_10074932 3300025941 Bacteria 2944
459 Ga0207711_10084800 3300025941 Bacteria 2774
460 Ga0207689_10003959 3300025942 Bacteria 13486
461 Ga0207689_10032589 3300025942 Bacteria 4333
462 Ga0207689_10057367 3300025942 Unclassified 3204
463 Ga0207689_10095679 3300025942 Bacteria 2439
464 Ga0207661_10002490 3300025944 Bacteria 12676
465 Ga0207679_10004135 3300025945 Bacteria 9014
466 Ga0207679_10027193 3300025945 Bacteria 3954
467 Ga0207679_10040304 3300025945 Bacteria 3342
468 Ga0207679_10511831 3300025945 Unclassified 1072
469 Ga0207679_10515363 3300025945 Unclassified 1069
470 Ga0207667_10194720 3300025949 Bacteria 2080
471 Ga0207651_10010174 3300025960 Bacteria 5198
472 Ga0207651_10013855 3300025960 Bacteria 4632
473 Ga0207651_10032756 3300025960 Bacteria 3343
474 Ga0207651_10077103 3300025960 Unclassified 2385
475 Ga0207651_10091539 3300025960 Bacteria 2227
476 Ga0207651_10419135 3300025960 Bacteria 1143
477 Ga0207712_10022462 3300025961 Unclassified 4154
478 Ga0207712_10041146 3300025961 Bacteria 3175
479 Ga0207712_10617526 3300025961 Bacteria 939
480 Ga0207668_10040164 3300025972 Bacteria 3155
481 Ga0207658_10009565 3300025986 Bacteria 6579
482 Ga0207658_10066652 3300025986 Bacteria 2709
483 Ga0207658_10373534 3300025986 Unclassified 1247
484 Ga0207677_10040009 3300026023 Bacteria 3087
485 Ga0207677_10628803 3300026023 Unclassified 945
486 Ga0207703_10006715 3300026035 Bacteria 9182
487 Ga0207703_10068704 3300026035 Bacteria 2920
488 Ga0207703_10070905 3300026035 Bacteria 2877
489 Ga0207703_10329503 3300026035 Bacteria 1400
490 Ga0207703_10480732 3300026035 Bacteria 1164
491 Ga0207678_10008867 3300026067 Bacteria 8856
492 Ga0207708_10006488 3300026075 Bacteria 8666
493 Ga0207708_10025427 3300026075 Bacteria 4478
494 Ga0207708_10034925 3300026075 Bacteria 3825
495 Ga0207708_10036468 3300026075 Bacteria 3743
496 Ga0207708_10193915 3300026075 Bacteria 1618
497 Ga0207702_10150743 3300026078 Bacteria 2115
498 Ga0207702_10614272 3300026078 Bacteria 1067
499 Ga0207702_11120401 3300026078 Bacteria 781
500 Ga0207641_10000198 3300026088 Bacteria 81646
501 Ga0207641_10000259 3300026088 Bacteria 67298
502 Ga0207641_10051564 3300026088 Bacteria 3485
503 Ga0207641_10058303 3300026088 Bacteria 3286
504 Ga0207641_10070828 3300026088 Bacteria 2997
505 Ga0207648_10000246 3300026089 Bacteria 58501
506 Ga0207648_10017826 3300026089 Bacteria 6443
507 Ga0207648_10165985 3300026089 Unclassified 1951
508 Ga0207648_10229136 3300026089 Bacteria 1652
509 Ga0207676_10010909 3300026095 Bacteria 6482
510 Ga0207676_10035502 3300026095 Bacteria 3784
511 Ga0207676_10434658 3300026095 Bacteria 1234
512 Ga0207674_10030346 3300026116 Bacteria 5684
513 Ga0207674_10093971 3300026116 Bacteria 2986
514 Ga0207674_10252094 3300026116 Bacteria 1712
515 Ga0207674_10536165 3300026116 Unclassified 1131
516 Ga0207675_100001075 3300026118 Bacteria 27143
517 Ga0207675_100027442 3300026118 Bacteria 5303
518 Ga0207675_100082957 3300026118 Bacteria 3006
519 Ga0207675_100132571 3300026118 Bacteria 2363
520 Ga0207675_100194483 3300026118 Unclassified 1947
521 Ga0207675_100241277 3300026118 Bacteria 1746
522 Ga0207675_100341765 3300026118 Bacteria 1465
523 Ga0207683_10003979 3300026121 Bacteria 12810
524 Ga0207683_10006075 3300026121 Bacteria 10341
525 Ga0207683_10027139 3300026121 Bacteria 4949
526 Ga0207683_10127770 3300026121 Bacteria 2285
527 Ga0207698_10040220 3300026142 Bacteria 3471
528 Ga0207698_10535965 3300026142 Bacteria 1145
529 Ga0210000_1017153 3300027462 Bacteria 1097
530 Ga0209971_1007621 3300027682 Bacteria 2568
531 Ga0209813_10019325 3300027866 Bacteria 1892
532 Ga0209974_10014860 3300027876 Bacteria 2585
533 Ga0209974_10015823 3300027876 Bacteria 2505
534 Ga0209974_10104232 3300027876 Bacteria 993
535 Ga0207428_10003486 3300027907 Bacteria 15254
536 Ga0207428_10005664 3300027907 Bacteria 11604
537 Ga0207428_10009483 3300027907 Bacteria 8717
538 Ga0207428_10024378 3300027907 Bacteria 5079
539 Ga0207428_10039646 3300027907 Unclassified 3825
540 Ga0207428_10092849 3300027907 Unclassified 2342
541 Ga0207428_10139122 3300027907 Bacteria 1854
542 Ga0207428_10276750 3300027907 Bacteria 1247
543 Ga0268266_10006015 3300028379 Bacteria 11195
544 Ga0268266_10696669 3300028379 Bacteria 979
545 Ga0268265_10001488 3300028380 Bacteria 19626
546 Ga0268265_10031270 3300028380 Bacteria 3843
547 Ga0268265_10079108 3300028380 Bacteria 2588
548 Ga0268265_10079933 3300028380 Bacteria 2577
549 Ga0268265_10115558 3300028380 Unclassified 2200
550 Ga0268265_10267468 3300028380 Bacteria 1523
551 Ga0268265_10513505 3300028380 Bacteria 1131
552 Ga0268264_10000588 3300028381 Bacteria 44134
553 Ga0268264_10026990 3300028381 Bacteria 4691
554 Ga0268264_10043169 3300028381 Bacteria 3735
555 Ga0268264_10118510 3300028381 Bacteria 2330
556 Ga0307513_10011871 3300031456 Bacteria 10792
557 Ga0307408_100008140 3300031548 Bacteria 6927
558 Ga0307408_100025388 3300031548 Bacteria 4059
559 Ga0307408_100057087 3300031548 Bacteria 2833
560 Ga0307408_100122298 3300031548 Bacteria 2018
561 Ga0307408_100356642 3300031548 Unclassified 1242
562 Ga0307405_10018703 3300031731 Unclassified 3829
563 Ga0307405_10019998 3300031731 Bacteria 3731
564 Ga0307405_10296649 3300031731 Unclassified 1224
565 Ga0307405_10613795 3300031731 Bacteria 889
566 Ga0307413_10012181 3300031824 Unclassified 4270
567 Ga0307410_10041729 3300031852 Bacteria 3027
568 Ga0307410_10321541 3300031852 Unclassified 1228
569 Ga0307410_10424445 3300031852 Bacteria 1079
570 Ga0307410_10518800 3300031852 Unclassified 983
571 Ga0307406_10146209 3300031901 Bacteria 1680
572 Ga0307407_10010767 3300031903 Bacteria 4326
573 Ga0307407_10012301 3300031903 Unclassified 4108
574 Ga0307412_10018836 3300031911 Bacteria 4165
575 Ga0307412_10137366 3300031911 Bacteria 1785
576 Ga0307412_10329362 3300031911 Bacteria 1218
577 Ga0307412_10333543 3300031911 Unclassified 1211
578 Ga0307412_10336223 3300031911 Bacteria 1207
579 Ga0307409_100022631 3300031995 Unclassified 4335
580 Ga0307409_100065980 3300031995 Bacteria 2851
581 Ga0307409_100289646 3300031995 Bacteria 1518
582 Ga0307416_100015969 3300032002 Bacteria 5203
583 Ga0307416_100021724 3300032002 Unclassified 4614
584 Ga0307416_100029729 3300032002 Bacteria 4087
585 Ga0307416_100055276 3300032002 Bacteria 3196
586 Ga0307416_100374730 3300032002 Bacteria 1451
587 Ga0307416_100392854 3300032002 Bacteria 1422
588 Ga0307416_100399580 3300032002 Bacteria 1411
589 Ga0307416_100563096 3300032002 Bacteria 1215
590 Ga0307414_10038982 3300032004 Unclassified 3196
591 Ga0307414_10123129 3300032004 Bacteria 1998
592 Ga0307414_10480891 3300032004 Unclassified 1095
593 Ga0307411_10031137 3300032005 Bacteria 3278
594 Ga0307411_10034924 3300032005 Unclassified 3133
595 Ga0307411_10041035 3300032005 Bacteria 2941
596 Ga0307411_10058672 3300032005 Bacteria 2548
597 Ga0307411_10068882 3300032005 Bacteria 2387
598 Ga0307415_100008598 3300032126 Bacteria 5669
599 Ga0307415_100011264 3300032126 Bacteria 5110
600 Ga0307415_100278900 3300032126 Bacteria 1373
601 Ga0373960_0017586 3300035121 Bacteria 1854
602 Ga0373955_0343741 3300035172 Unclassified 903
603 Ga0373961_0000297 3300035241 Bacteria 22207
604 Ga0373962_0061062 3300035242 Unclassified 1107
605 Ga0373931_0171100 3300035691 Bacteria 1280
606 Ga0373933_0335936 3300035724 Bacteria 980
607 Ga0373937_0051107 3300036401 Unclassified 3789
608 Ga0373925_0746146 3300037068 Bacteria 807
609 Ga0395899_0422937 3300037312 Bacteria 877
610 Ga0395900_0049548 3300037418 Bacteria 4328
611 Ga0395900_0340172 3300037418 Bacteria 1476
612 Ga0395898_0211834 3300037466 Bacteria 1848
613 Ga0395898_0621401 3300037466 Unclassified 1023
614 Ga0395905_0059052 3300037471 Bacteria 3586
615 Ga0395905_0084219 3300037471 Bacteria 2979
616 Ga0395901_0177997 3300038443 Bacteria 2230
617 Ga0395901_0400049 3300038443 Bacteria 1411
618 Ga0436365_1614654 3300039437 Bacteria 6289
619 Ga0436361_0942135 3300039447 Bacteria 2901
620 Ga0439433_0005167 3300041999 Bacteria 2805
621 Ga0439433_0031053 3300041999 Bacteria 1222
622 Ga0439450_016156 3300042008 Bacteria 1539
623 Ga0439451_035945 3300042009 Bacteria 996
624 Ga0439435_0003900 3300042436 Bacteria 3158
625 Ga0439435_0013465 3300042436 Bacteria 2000
626 Ga0439435_0051849 3300042436 Bacteria 1177
627 Ga0439435_0065028 3300042436 Bacteria 1069
628 Ga0439435_0066706 3300042436 Bacteria 1058
629 Ga0439435_0109146 3300042436 Bacteria 857
630 Ga0439444_0023359 3300042437 Bacteria 1109
631 Ga0439444_0045118 3300042437 Bacteria 879
632 Ga0439464_0002455 3300042439 Bacteria 4560
633 Ga0439464_0050234 3300042439 Bacteria 1204
634 Ga0439460_0009321 3300042461 Bacteria 2492
635 Ga0439460_0057246 3300042461 Bacteria 1182
636 Ga0439460_0077691 3300042461 Bacteria 1038
637 Ga0451577_0056963 3300042876 Bacteria 3485
638 Ga0451577_0076842 3300042876 Bacteria 2977
639 Ga0451577_0767595 3300042876 Bacteria 872
640 Ga0453684_0786377 3300044712 Bacteria 1027
641 Ga0451576_0043858 3300045051 Unclassified 4717
642 Ga0451576_0048477 3300045051 Unclassified 4461
643 Ga0451576_0146119 3300045051 Unclassified 2465
644 Ga0451576_0517300 3300045051 Unclassified 1254
645 Ga0495603_0269556 3300046455 Bacteria 979
646 Ga0495642_0014741 3300046528 Bacteria 3032
647 Ga0495598_0008216 3300046537 Unclassified 2422
648 Ga0495668_0124076 3300046616 Bacteria 1413
649 Ga0495625_0223882 3300046660 Bacteria 1231
650 Ga0495613_0005490 3300046689 Bacteria 9527
651 Ga0495636_0044302 3300047318 Bacteria 1852
652 Ga0495674_0101914 3300047319 Bacteria 2442
653 Ga0495672_0001520 3300047320 Bacteria 22733
654 Ga0495672_0249622 3300047320 Bacteria 862
655 Ga0496102_0137055 3300048905 Bacteria 2294
656 Ga0496103_0366014 3300048906 Bacteria 927
657 Ga0496104_0005034 3300048907 Bacteria 11527
658 Ga0496104_0013360 3300048907 Bacteria 7399
659 Ga0496104_0033034 3300048907 Bacteria 4817
660 Ga0496104_0264633 3300048907 Bacteria 1632
661 Ga0496104_0559162 3300048907 Bacteria 1055
662 Ga0496105_0022305 3300048908 Bacteria 5128
663 Ga0496105_0090782 3300048908 Bacteria 2523
664 Ga0496106_0035091 3300048909 Bacteria 3749
665 Ga0496108_0018786 3300048911 Bacteria 5666
666 Ga0496108_0827344 3300048911 Bacteria 798
667 Ga0496109_0001054 3300048912 Bacteria 22785
668 Ga0496109_0034897 3300048912 Bacteria 4534
669 Ga0496109_0252495 3300048912 Unclassified 1661
670 Ga0496109_0542849 3300048912 Unclassified 1097
671 Ga0496110_0002072 3300048913 Bacteria 14946
672 Ga0496110_0003883 3300048913 Bacteria 11500
673 Ga0496111_0064665 3300048914 Bacteria 2654
674 Ga0496111_0321780 3300048914 Unclassified 1145
675 Ga0496112_0003061 3300048915 Bacteria 13692
676 Ga0496112_0005221 3300048915 Bacteria 11180
677 Ga0496112_0058506 3300048915 Bacteria 3796
678 Ga0496113_0074500 3300048916 Unclassified 2588
679 Ga0496113_0094299 3300048916 Bacteria 2312
680 Ga0496114_0465612 3300048917 Unclassified 1119
681 Ga0496115_0122921 3300048918 Bacteria 2136
682 Ga0496117_0185733 3300048920 Bacteria 1190
683 Ga0496118_0016401 3300048921 Bacteria 6799
684 Ga0496121_0000243 3300048924 Bacteria 116698
685 Ga0501299_022347 3300049522 Unclassified 1166
686 Ga0501032_0278000 3300049569 Unclassified 1084
687 Ga0501032_0293391 3300049569 Bacteria 1052
688 Ga0501034_0039253 3300049571 Bacteria 4795
689 Ga0501036_0156950 3300049572 Unclassified 1919
690 Ga0501036_0218330 3300049572 Bacteria 1601
691 Ga0501036_0279380 3300049572 Bacteria 1398
692 Ga0501036_0351264 3300049572 Unclassified 1231
693 Ga0501038_0157232 3300049574 Bacteria 1850
694 Ga0501038_0424801 3300049574 Bacteria 1025
695 Ga0501040_0020560 3300049576 Bacteria 4401
696 Ga0501040_0155555 3300049576 Bacteria 1614
697 Ga0501041_0010636 3300049577 Bacteria 5426
698 Ga0501041_0011231 3300049577 Bacteria 5291
699 Ga0501041_0162503 3300049577 Bacteria 1396
700 Ga0501041_0289185 3300049577 Bacteria 1032
701 Ga0501042_0063830 3300049578 Bacteria 2632
702 Ga0501042_0085180 3300049578 Bacteria 2266
703 Ga0501042_0195223 3300049578 Bacteria 1460
704 Ga0501042_0212026 3300049578 Bacteria 1397
705 Ga0501043_0106457 3300049579 Bacteria 2203
706 Ga0501043_0343542 3300049579 Bacteria 1135
707 Ga0501046_0035947 3300049580 Bacteria 3989
708 Ga0501047_0052331 3300049581 Bacteria 3947
709 Ga0501048_0033566 3300049582 Bacteria 3707
710 Ga0501048_0224436 3300049582 Bacteria 1333
711 Ga0501068_0332508 3300049584 Bacteria 975
712 Ga0501069_0214318 3300049585 Bacteria 1118
713 Ga0501071_0013769 3300049587 Bacteria 5517
714 Ga0501071_0107076 3300049587 Unclassified 2064
715 Ga0501071_0119398 3300049587 Bacteria 1954
716 Ga0501071_0191228 3300049587 Bacteria 1535
717 Ga0501072_0032275 3300049588 Bacteria 4102
718 Ga0501072_0042098 3300049588 Bacteria 3588
719 Ga0501072_0091050 3300049588 Bacteria 2421
720 Ga0501072_0103309 3300049588 Bacteria 2265
721 Ga0501072_0335317 3300049588 Bacteria 1201
722 Ga0501074_0105851 3300049590 Unclassified 2014
723 Ga0501074_0270389 3300049590 Bacteria 1208
724 Ga0501075_0019019 3300049591 Bacteria 4981
725 Ga0501075_0081685 3300049591 Bacteria 2447
726 Ga0501075_0163142 3300049591 Bacteria 1700
727 Ga0501075_0427074 3300049591 Bacteria 1010
728 Ga0501075_0488749 3300049591 Bacteria 939
729 Ga0501076_0005097 3300049592 Bacteria 9406
730 Ga0501076_0047976 3300049592 Bacteria 3376
731 Ga0501076_0130401 3300049592 Bacteria 2039
732 Ga0501076_0165266 3300049592 Bacteria 1804
733 Ga0501076_0288425 3300049592 Bacteria 1345
734 Ga0501077_0393637 3300049593 Bacteria 885
735 Ga0501217_079764 3300049661 Unclassified 904
736 Ga0501235_031445 3300049669 Unclassified 1199
737 Ga0501247_011556 3300049677 Unclassified 1066
738 Ga0501245_011486 3300049708 Unclassified 1290
739 Ga0501079_0052049 3300049741 Bacteria 3162
740 Ga0501079_0202364 3300049741 Unclassified 1551
741 Ga0501079_0211818 3300049741 Unclassified 1514
742 Ga0501080_0212064 3300049742 Bacteria 1775
743 Ga0501080_0432865 3300049742 Bacteria 1181
744 Ga0501080_0856980 3300049742 Bacteria 794
745 Ga0501081_0209315 3300049743 Bacteria 1416
746 Ga0501081_0331772 3300049743 Unclassified 1119
747 Ga0501272_004728 3300049769 Bacteria 1421
748 Ga0501274_010984 3300049771 Unclassified 841
749 Ga0501283_025443 3300049779 Unclassified 969
750 Ga0501044_0027646 3300049823 Bacteria 5990
751 Ga0501045_0020019 3300049824 Bacteria 4777
752 Ga0501045_0024508 3300049824 Bacteria 4333
753 Ga0501045_0031413 3300049824 Bacteria 3847
754 Ga0501045_0061736 3300049824 Bacteria 2750
755 nmdc:mga03683_12926_c1 3300050489 Bacteria 3061
756 nmdc:mga03n38_133976_c1 3300050490 Bacteria 1231
757 nmdc:mga00v17_19639_c1 3300050491 Bacteria 3862
758 nmdc:mga0yw44_156896_c1 3300050492 Bacteria 1488
759 nmdc:mga0yw44_30218_c1 3300050492 Bacteria 3136
760 nmdc:mga0k408_320004_c1 3300050493 Bacteria 926
761 nmdc:mga0k408_76872_c1 3300050493 Unclassified 1952
762 nmdc:mga06z11_246932_c1 3300050494 Bacteria 1050
763 nmdc:mga06z11_32907_c1 3300050494 Bacteria 2532
764 nmdc:mga04h51_20370_c1 3300050495 Bacteria 1979
765 nmdc:mga07m45_49442_c1 3300050496 Bacteria 2008
766 nmdc:mga05p37_107342_c1 3300050507 Bacteria 3435
767 nmdc:mga05p37_1074_c1 3300050507 Bacteria 31305
768 nmdc:mga05p37_129618_c1 3300050507 Bacteria 3095
769 nmdc:mga05p37_161143_c1 3300050507 Bacteria 2740
770 nmdc:mga05p37_170381_c1 3300050507 Bacteria 2655
771 nmdc:mga05p37_191001_c1 3300050507 Bacteria 2486
772 nmdc:mga05p37_227632_c2 3300050507 Bacteria 1998
773 nmdc:mga05p37_232050_c1 3300050507 Unclassified 2223
774 nmdc:mga05p37_24240_c1 3300050507 Bacteria 7372
775 nmdc:mga05p37_254208_c1 3300050507 Bacteria 2106
776 nmdc:mga05p37_2653_c1 3300050507 Bacteria 20833
777 nmdc:mga05p37_27424_c1 3300050507 Bacteria 6933
778 nmdc:mga05p37_321996_c1 3300050507 Bacteria 1829
779 nmdc:mga05p37_403023_c1 3300050507 Bacteria 1597
780 nmdc:mga05p37_467662_c1 3300050507 Bacteria 1456
781 nmdc:mga05p37_483921_c1 3300050507 Bacteria 1425
782 nmdc:mga05p37_486290_c1 3300050507 Bacteria 1420
783 nmdc:mga05p37_4973_c1 3300050507 Bacteria 15580
784 nmdc:mga05p37_551536_c1 3300050507 Bacteria 1312
785 nmdc:mga05p37_82607_c1 3300050507 Bacteria 3959
786 nmdc:mga05p37_83_c1 3300050507 Bacteria 83944
787 nmdc:mga05p37_869737_c1 3300050507 Bacteria 976
788 nmdc:mga05p37_876_c1 3300050507 Bacteria 33908
789 nmdc:mga09592_101092_c1 3300050508 Bacteria 2470
790 nmdc:mga09592_13552_c1 3300050508 Bacteria 6658
791 nmdc:mga09592_15786_c1 3300050508 Bacteria 6170
792 nmdc:mga09592_242959_c1 3300050508 Bacteria 1560
793 nmdc:mga09592_36829_c1 3300050508 Bacteria 4100
794 nmdc:mga09592_41866_c1 3300050508 Bacteria 3853
795 nmdc:mga09592_42919_c1 3300050508 Bacteria 3804
796 nmdc:mga09592_46796_c1 3300050508 Unclassified 3644
797 nmdc:mga09592_58391_c1 3300050508 Bacteria 3262
798 nmdc:mga09592_7978_c1 3300050508 Bacteria 8604
799 nmdc:mga09592_90410_c1 3300050508 Bacteria 2615
800 nmdc:mga0qj67_10922_c1 3300050509 Bacteria 6795
801 nmdc:mga0qj67_116243_c1 3300050509 Bacteria 2161
802 nmdc:mga0qj67_16467_c1 3300050509 Bacteria 5608
803 nmdc:mga0qj67_17069_c1 3300050509 Bacteria 5515
804 nmdc:mga0qj67_203387_c1 3300050509 Bacteria 1609
805 nmdc:mga0qj67_230269_c1 3300050509 Bacteria 1504
806 nmdc:mga0qj67_35275_c1 3300050509 Bacteria 2159
807 nmdc:mga0qj67_56085_c1 3300050509 Unclassified 3123
808 nmdc:mga0qj67_57490_c1 3300050509 Bacteria 3083
809 nmdc:mga06r32_121634_c1 3300050510 Bacteria 2575
810 nmdc:mga06r32_160477_c1 3300050510 Unclassified 2230
811 nmdc:mga06r32_186599_c1 3300050510 Bacteria 2061
812 nmdc:mga06r32_20103_c1 3300050510 Bacteria 6141
813 nmdc:mga06r32_243033_c1 3300050510 Bacteria 1787
814 nmdc:mga06r32_279435_c1 3300050510 Bacteria 1657
815 nmdc:mga06r32_4267_c1 3300050510 Bacteria 12799
816 nmdc:mga06r32_4360_c1 3300050510 Bacteria 12657
817 nmdc:mga06r32_442461_c1 3300050510 Bacteria 1280
818 nmdc:mga06r32_52513_c1 3300050510 Unclassified 3904
819 nmdc:mga06r32_6742_c1 3300050510 Bacteria 10321
820 nmdc:mga06r32_785317_c1 3300050510 Bacteria 914
821 nmdc:mga08y16_100479_c1 3300050511 Bacteria 3012
822 nmdc:mga08y16_111173_c1 3300050511 Bacteria 2852
823 nmdc:mga08y16_1121_c1 3300050511 Bacteria 26404
824 nmdc:mga08y16_125171_c1 3300050511 Bacteria 2674
825 nmdc:mga08y16_206959_c1 3300050511 Unclassified 2032
826 nmdc:mga08y16_223798_c1 3300050511 Unclassified 1947
827 nmdc:mga08y16_2471_c1 3300050511 Bacteria 18972
828 nmdc:mga08y16_30792_c1 3300050511 Bacteria 5644
829 nmdc:mga08y16_7060_c1 3300050511 Bacteria 11789
830 nmdc:mga08y16_7865_c1 3300050511 Bacteria 11162
831 nmdc:mga0n895_251662_c1 3300050512 Unclassified 1793
832 nmdc:mga0n895_4356_c1 3300050512 Bacteria 11605
833 nmdc:mga0n895_48219_c1 3300050512 Bacteria 4168
834 nmdc:mga0n895_5029_c1 3300050512 Bacteria 10971
835 nmdc:mga0n895_5070_c1 3300050512 Bacteria 10936
836 nmdc:mga0n895_68276_c1 3300050512 Bacteria 3522
837 nmdc:mga0n895_768996_c1 3300050512 Bacteria 955
838 nmdc:mga0rr50_6819_c1 3300050513 Bacteria 6999
839 nmdc:mga08x19_73783_c1 3300050514 Bacteria 2228
840 nmdc:mga0a205_15411_c1 3300050515 Bacteria 7143
841 nmdc:mga0a205_16830_c1 3300050515 Bacteria 6847
842 nmdc:mga0a205_17912_c1 3300050515 Bacteria 6648
843 nmdc:mga0a205_29612_c1 3300050515 Bacteria 5240
844 nmdc:mga0a205_34306_c1 3300050515 Bacteria 4870
845 nmdc:mga0a205_43676_c1 3300050515 Bacteria 4320
846 nmdc:mga0a205_4439_c1 3300050515 Bacteria 12597
847 nmdc:mga0a205_50427_c2 3300050515 Bacteria 2602
848 nmdc:mga0a205_538788_c1 3300050515 Unclassified 1023
849 nmdc:mga0a205_606472_c1 3300050515 Unclassified 948
850 nmdc:mga0a205_76_c1 3300050515 Bacteria 54611
851 nmdc:mga0a205_96540_c1 3300050515 Unclassified 2854
852 nmdc:mga0sz30_29885_c1 3300050516 Bacteria 2248
853 Ga0495601_0075013 3300053077 Bacteria 2165
854 Ga0500588_0008931 3300053146 Bacteria 2362
855 Ga0501084_0067656 3300054114 Bacteria 2990
856 Ga0501084_0468328 3300054114 Unclassified 1065
857 Ga0501084_0580879 3300054114 Bacteria 947
858 Ga0590071_000030 3300059421 Bacteria 37230
859 Ga0590071_001388 3300059421 Bacteria 6417
860 Ga0590071_006653 3300059421 Bacteria 2745
861 Ga0590074_002044 3300059423 Unclassified 3306
862 Ga0590074_005177 3300059423 Unclassified 2156
863 Ga0590075_000351 3300059424 Bacteria 12827
864 Ga0590075_001856 3300059424 Bacteria 5132
865 Ga0590075_003200 3300059424 Bacteria 3895
866 Ga0590075_004308 3300059424 Unclassified 3367
867 Ga0590075_050806 3300059424 Bacteria 1064
868 Ga0590077_000390 3300059426 Bacteria 12365
869 Ga0590077_001322 3300059426 Bacteria 5851
870 Ga0587091_042773 3300059511 Bacteria 900
871 Ga0501082_0269423 3300060353 Bacteria 1482
872 Ga0530510_0006822 3300061734 Bacteria 7956
873 Ga0530510_0180631 3300061734 Bacteria 1565
874 Ga0070682_100122017
875 MRS1b_contig_3199878
876 Ga0058859_11229463
877 Ga0058863_11934526
878 Ga0058861_11748004
879 Ga0058861_12031893
880 Ga0058860_10064540
881 Ga0058860_10090918
882 Ga0058860_11611968
883 Ga0058860_12028819
884 Ga0058862_12539343
885 Ga0058862_12758636
886 Ga0058862_12783670
887 Ga0065714_10071074
888 Ga0065704_10171588
889 Ga0065712_10003381
890 Ga0065712_10010152
891 Ga0065712_10074252
892 Ga0065715_10004219
893 Ga0065715_10094822
894 Ga0065715_10102412
895 Ga0065715_10126090
896 Ga0065715_10167934
897 Ga0065715_10169792
898 Ga0065707_10092277
899 Ga0065707_10194570
900 Ga0065707_10212626
901 Ga0070658_10013944
902 Ga0070676_10019726
903 Ga0070676_10140219
904 Ga0070683_100000260
905 Ga0070683_100707004
906 Ga0070690_100011445
907 Ga0070690_100014027
908 Ga0070690_100023056
909 Ga0070670_100001340
910 Ga0070670_100005713
911 Ga0070670_100008280
912 Ga0070670_100013192
913 Ga0070670_100016091
914 Ga0070670_100068105
915 Ga0070670_100124633
916 Ga0070670_100156618
917 Ga0070670_100163332
918 Ga0070670_100540427
919 Ga0070677_10016722
920 Ga0070677_10058734
921 Ga0068869_100020689
922 Ga0068869_100025458
923 Ga0068869_100154420
924 Ga0070666_10012985
925 Ga0070666_10064586
926 Ga0070666_10159512
927 Ga0070666_10227019
928 Ga0070666_10322574
929 Ga0070680_100441545
930 Ga0068868_100011659
931 Ga0070660_100275589
932 Ga0070689_100039410
933 Ga0070689_100245288
934 Ga0070689_100468948
935 Ga0070687_100006132
936 Ga0070687_100031838
937 Ga0070687_100050658
938 Ga0070661_100001252
939 Ga0070661_100020068
940 Ga0070668_100013056
941 Ga0070668_100136203
942 Ga0070668_100296484
943 Ga0070668_100320759
944 Ga0070668_100659752
945 Ga0070669_100000399
946 Ga0070669_100002199
947 Ga0070669_100003613
948 Ga0070669_100017648
949 Ga0070669_100036098
950 Ga0070669_100073288
951 Ga0070669_100102331
952 Ga0070669_100307046
953 Ga0070675_100017161
954 Ga0070675_100047773
955 Ga0070675_100081052
956 Ga0070675_100124137
957 Ga0070675_100277332
958 Ga0070675_100631575
959 Ga0070675_100647599
960 Ga0070671_100171233
961 Ga0070671_100268190
962 Ga0070671_100462898
963 Ga0070674_100000133
964 Ga0070674_100038102
965 Ga0070674_100130461
966 Ga0070673_100007069
967 Ga0070673_100008782
968 Ga0070673_100032544
969 Ga0070673_100458554
970 Ga0070688_100087207
971 Ga0070688_100106534
972 Ga0070688_100117494
973 Ga0070688_100210667
974 Ga0070667_100004567
975 Ga0070703_10158118
976 Ga0070701_10001279
977 Ga0070701_10043901
978 Ga0070701_10068895
979 Ga0070705_100053529
980 Ga0070705_100232308
981 Ga0070700_100015636
982 Ga0070700_100077549
983 Ga0070700_100155460
984 Ga0070700_100506285
985 Ga0070694_100033846
986 Ga0070708_100346796
987 Ga0070663_100007791
988 Ga0070678_100026864
989 Ga0070678_100054028
990 Ga0070678_100130396
991 Ga0070678_100161441
992 Ga0070662_100011707
993 Ga0070662_100024347
994 Ga0068867_100004682
995 Ga0068867_100022711
996 Ga0068867_100058755
997 Ga0068867_100600452
998 Ga0070685_10041862
999 Ga0070685_10260454
1000 Ga0070698_100205261
1001 Ga0070698_100740187
1002 Ga0070699_100000485
1003 Ga0070699_100041522
1004 Ga0070679_100116476
1005 Ga0070684_100000898
1006 Ga0070697_100165138
1007 Ga0070672_100012392
1008 Ga0070672_100015890
1009 Ga0070672_100186409
1010 Ga0070672_100412461
1011 Ga0070686_100009424
1012 Ga0070686_100051783
1013 Ga0070686_100251732
1014 Ga0070695_100417634
1015 Ga0070696_100443868
1016 Ga0070665_100028846
1017 Ga0070665_100048324
1018 Ga0070665_100444421
1019 Ga0070704_100033061
1020 Ga0070664_100002150
1021 Ga0070664_100014148
1022 Ga0070664_100312663
1023 Ga0070664_100402932
1024 Ga0070664_100554967
1025 Ga0068857_100011022
1026 Ga0068857_100013100
1027 Ga0068857_100062811
1028 Ga0068857_100628900
1029 Ga0068854_100145624
1030 Ga0070702_100091927
1031 Ga0068852_100210251
1032 Ga0068859_100005105
1033 Ga0068859_100009922
1034 Ga0068859_100012595
1035 Ga0068859_100060387
1036 Ga0068859_100079721
1037 Ga0068859_100237905
1038 Ga0068864_100039642
1039 Ga0068864_100064648
1040 Ga0068864_100427390
1041 Ga0068864_100511997
1042 Ga0068861_100006364
1043 Ga0068861_100013596
1044 Ga0068861_100172423
1045 Ga0068870_10000968
1046 Ga0068870_10014039
1047 Ga0068870_10059758
1048 Ga0068870_10066038
1049 Ga0068863_100000005
1050 Ga0068863_100000867
1051 Ga0068863_100039399
1052 Ga0068863_100083183
1053 Ga0068863_100158225
1054 Ga0068863_100834985
1055 Ga0068863_100865957
1056 Ga0068858_100007931
1057 Ga0068858_100009898
1058 Ga0068858_100012596
1059 Ga0068858_100048972
1060 Ga0068858_100083127
1061 Ga0068858_100336378
1062 Ga0068860_100000008
1063 Ga0068860_100021964
1064 Ga0068860_100053433
1065 Ga0068860_100140178
1066 Ga0068860_100194295
1067 Ga0068862_100001221
1068 Ga0068862_100012814
1069 Ga0068862_100038425
1070 Ga0068862_100051534
1071 Ga0068862_100100586
1072 Ga0068862_100137218
1073 Ga0068862_100205237
1074 Ga0068862_100280175
1075 Ga0068862_100517777
1076 Ga0081455_10034132
1077 Ga0081455_10156505
1078 Ga0081455_10191329
1079 Ga0075368_10005612
1080 Ga0075364_10130065
1081 Ga0075367_10211582
1082 Ga0075366_10027111
1083 Ga0075366_10129648
1084 Ga0097621_100049978
1085 Ga0097621_100176404
1086 Ga0075370_10013601
1087 Ga0068871_100043752
1088 Ga0068871_100095480
1089 Ga0068871_100203448
1090 Ga0075428_100004960
1091 Ga0075428_100009217
1092 Ga0075428_100014803
1093 Ga0075428_100073348
1094 Ga0075428_100074638
1095 Ga0075428_100144399
1096 Ga0075428_100152385
1097 Ga0075428_100231389
1098 Ga0075428_100314293
1099 Ga0075428_100477156
1100 Ga0075430_100000381
1101 Ga0075430_100002731
1102 Ga0075430_100003464
1103 Ga0075430_100027201
1104 Ga0075430_100029136
1105 Ga0075430_100029161
1106 Ga0075430_100097419
1107 Ga0075430_100165560
1108 Ga0075430_100326305
1109 Ga0075431_100003416
1110 Ga0075431_100004623
1111 Ga0075431_100007678
1112 Ga0075431_100014566
1113 Ga0075431_100026322
1114 Ga0075431_100030553
1115 Ga0075431_100040167
1116 Ga0075431_100080952
1117 Ga0075431_100091222
1118 Ga0075431_100134472
1119 Ga0075431_100210863
1120 Ga0075431_100359785
1121 Ga0075431_100365266
1122 Ga0075431_100379848
1123 Ga0075431_100514590
1124 Ga0075431_100626470
1125 Ga0075433_10000202
1126 Ga0075433_10001786
1127 Ga0075433_10003482
1128 Ga0075433_10042323
1129 Ga0075433_10098939
1130 Ga0075433_10146676
1131 Ga0075433_10162575
1132 Ga0075433_10333096
1133 Ga0075434_100000875
1134 Ga0075434_100016237
1135 Ga0075434_100030656
1136 Ga0075434_100082095
1137 Ga0075434_100093703
1138 Ga0075434_100120243
1139 Ga0075434_100544748
1140 Ga0075429_100003511
1141 Ga0075429_100010406
1142 Ga0075429_100061640
1143 Ga0075429_100072231
1144 Ga0075429_100074273
1145 Ga0075429_100080109
1146 Ga0075429_100091450
1147 Ga0075429_100104488
1148 Ga0075429_100109643
1149 Ga0075429_100212024
1150 Ga0075429_100219241
1151 Ga0068865_100004621
1152 Ga0075436_100027966
1153 Ga0097620_100005105
1154 Ga0097620_100009922
1155 Ga0097620_100012593
1156 Ga0097620_100060387
1157 Ga0097620_100079721
1158 Ga0097620_100237898
1159 Ga0075435_100004350
1160 Ga0075435_100032944
1161 Ga0075435_100192506
1162 Ga0111539_10005953
1163 Ga0111539_10007864
1164 Ga0111539_10009385
1165 Ga0111539_10034066
1166 Ga0111539_10059762
1167 Ga0111539_10074765
1168 Ga0111539_10094768
1169 Ga0111539_10126120
1170 Ga0111539_10132362
1171 Ga0111539_10134852
1172 Ga0111539_10232020
1173 Ga0111539_10243421
1174 Ga0105245_10249724
1175 Ga0105245_10721333
1176 Ga0105247_10009735
1177 Ga0105247_10285540
1178 Ga0114129_10000022
1179 Ga0114129_10003016
1180 Ga0114129_10003432
1181 Ga0114129_10013890
1182 Ga0114129_10017528
1183 Ga0114129_10028685
1184 Ga0114129_10046369
1185 Ga0114129_10057192
1186 Ga0114129_10067969
1187 Ga0114129_10074127
1188 Ga0114129_10093312
1189 Ga0114129_10100099
1190 Ga0114129_10106729
1191 Ga0114129_10188764
1192 Ga0114129_10228245
1193 Ga0114129_10422479
1194 Ga0114129_10428859
1195 Ga0114129_10665167
1196 Ga0114129_10696160
1197 Ga0114129_10701113
1198 Ga0114129_11075208
1199 Ga0105248_10008525
1200 Ga0105248_10011617
1201 Ga0105248_10011763
1202 Ga0105248_10026048
1203 Ga0105248_10051068
1204 Ga0105248_10083496
1205 Ga0105248_10130990
1206 Ga0105248_10264336
1207 Ga0105248_10544546
1208 Ga0105248_10633814
1209 Ga0105248_10712024
1210 Ga0105248_10775390
1211 Ga0105237_10135419
1212 Ga0105249_10002178
1213 Ga0105249_10033902
1214 Ga0105249_10086394
1215 Ga0105249_10194900
1216 Ga0105249_10328074
1217 Ga0105249_10405995
1218 Ga0105249_10460113
1219 Ga0105239_10055042
1220 Ga0105246_10151349
1221 Ga0105246_10170480
1222 Ga0157369_10393377
1223 Ga0157374_10014200
1224 Ga0163162_10057350
1225 Ga0157372_10744242
1226 Ga0157375_10004391
1227 Ga0157375_10215352
1228 Ga0157375_10459444
1229 Ga0157375_10704525
1230 Ga0163163_10012072
1231 Ga0163163_10040189
1232 Ga0163163_10153205
1233 Ga0157380_10012655
1234 Ga0157380_10053866
1235 Ga0157380_10124633
1236 Ga0157380_10129036
1237 Ga0157380_10158026
1238 Ga0157380_10210677
1239 Ga0157380_10265621
1240 Ga0157380_10360187
1241 Ga0157377_10008902
1242 Ga0157377_10031373
1243 Ga0157379_10016566
1244 Ga0157379_10017284
1245 Ga0157379_10073242
1246 Ga0157376_10028990
1247 Ga0163161_10087470
1248 Ga0163161_10116583
1249 Ga0206356_10432168
1250 Ga0213872_10116995
1251 Ga0224712_10197880
1252 Ga0207697_10001648
1253 Ga0207697_10010073
1254 Ga0207697_10015174
1255 Ga0207697_10093832
1256 Ga0207682_10008517
1257 Ga0207682_10021451
1258 Ga0207642_10154808
1259 Ga0207710_10006846
1260 Ga0207688_10013358
1261 Ga0207688_10058421
1262 Ga0207680_10021614
1263 Ga0207680_10025785
1264 Ga0207680_10118406
1265 Ga0207680_10196220
1266 Ga0207680_10265102
1267 Ga0207647_10136441
1268 Ga0207645_10003388
1269 Ga0207645_10040789
1270 Ga0207645_10137629
1271 Ga0207643_10002413
1272 Ga0207684_10178354
1273 Ga0207707_10041639
1274 Ga0207662_10011372
1275 Ga0207662_10022232
1276 Ga0207662_10215739
1277 Ga0207657_10216614
1278 Ga0207649_10004162
1279 Ga0207652_10276834
1280 Ga0207646_10112952
1281 Ga0207681_10009018
1282 Ga0207681_10024466
1283 Ga0207681_10041155
1284 Ga0207681_10041333
1285 Ga0207681_10105521
1286 Ga0207681_10228473
1287 Ga0207650_10009691
1288 Ga0207650_10025629
1289 Ga0207650_10085355
1290 Ga0207650_10120578
1291 Ga0207650_10149901
1292 Ga0207650_10170112
1293 Ga0207650_10207765
1294 Ga0207650_10464442
1295 Ga0207659_10057797
1296 Ga0207659_10255952
1297 Ga0207659_10296426
1298 Ga0207644_10030834
1299 Ga0207644_10163895
1300 Ga0207644_10180956
1301 Ga0207690_10373539
1302 Ga0207706_10006664
1303 Ga0207706_10057575
1304 Ga0207706_10084872
1305 Ga0207706_10229777
1306 Ga0207706_10428455
1307 Ga0207706_10504749
1308 Ga0207686_10033165
1309 Ga0207670_10009343
1310 Ga0207670_10021772
1311 Ga0207670_10110882
1312 Ga0207670_10149820
1313 Ga0207670_10470744
1314 Ga0207670_10717644
1315 Ga0207669_10004070
1316 Ga0207669_10128460
1317 Ga0207669_10230104
1318 Ga0207669_10289904
1319 Ga0207704_10039222
1320 Ga0207704_10044350
1321 Ga0207704_10106645
1322 Ga0207691_10005619
1323 Ga0207691_10027372
1324 Ga0207691_10043702
1325 Ga0207691_10090897
1326 Ga0207691_10099066
1327 Ga0207691_10292231
1328 Ga0207691_10307917
1329 Ga0207711_10027516
1330 Ga0207711_10052589
1331 Ga0207711_10074932
1332 Ga0207711_10084800
1333 Ga0207689_10003959
1334 Ga0207689_10032589
1335 Ga0207689_10057367
1336 Ga0207689_10095679
1337 Ga0207661_10002490
1338 Ga0207679_10004135
1339 Ga0207679_10027193
1340 Ga0207679_10040304
1341 Ga0207679_10511831
1342 Ga0207679_10515363
1343 Ga0207667_10194720
1344 Ga0207651_10010174
1345 Ga0207651_10013855
1346 Ga0207651_10032756
1347 Ga0207651_10077103
1348 Ga0207651_10091539
1349 Ga0207651_10419135
1350 Ga0207712_10022462
1351 Ga0207712_10041146
1352 Ga0207712_10617526
1353 Ga0207668_10040164
1354 Ga0207658_10009565
1355 Ga0207658_10066652
1356 Ga0207658_10373534
1357 Ga0207677_10040009
1358 Ga0207677_10628803
1359 Ga0207703_10006715
1360 Ga0207703_10068704
1361 Ga0207703_10070905
1362 Ga0207703_10329503
1363 Ga0207703_10480732
1364 Ga0207678_10008867
1365 Ga0207708_10006488
1366 Ga0207708_10025427
1367 Ga0207708_10034925
1368 Ga0207708_10036468
1369 Ga0207708_10193915
1370 Ga0207702_10150743
1371 Ga0207702_10614272
1372 Ga0207702_11120401
1373 Ga0207641_10000198
1374 Ga0207641_10000259
1375 Ga0207641_10051564
1376 Ga0207641_10058303
1377 Ga0207641_10070828
1378 Ga0207648_10000246
1379 Ga0207648_10017826
1380 Ga0207648_10165985
1381 Ga0207648_10229136
1382 Ga0207676_10010909
1383 Ga0207676_10035502
1384 Ga0207676_10434658
1385 Ga0207674_10030346
1386 Ga0207674_10093971
1387 Ga0207674_10252094
1388 Ga0207674_10536165
1389 Ga0207675_100001075
1390 Ga0207675_100027442
1391 Ga0207675_100082957
1392 Ga0207675_100132571
1393 Ga0207675_100194483
1394 Ga0207675_100241277
1395 Ga0207675_100341765
1396 Ga0207683_10003979
1397 Ga0207683_10006075
1398 Ga0207683_10027139
1399 Ga0207683_10127770
1400 Ga0207698_10040220
1401 Ga0207698_10535965
1402 Ga0210000_1017153
1403 Ga0209971_1007621
1404 Ga0209813_10019325
1405 Ga0209974_10014860
1406 Ga0209974_10015823
1407 Ga0209974_10104232
1408 Ga0207428_10003486
1409 Ga0207428_10005664
1410 Ga0207428_10009483
1411 Ga0207428_10024378
1412 Ga0207428_10039646
1413 Ga0207428_10092849
1414 Ga0207428_10139122
1415 Ga0207428_10276750
1416 Ga0268266_10006015
1417 Ga0268266_10696669
1418 Ga0268265_10001488
1419 Ga0268265_10031270
1420 Ga0268265_10079108
1421 Ga0268265_10079933
1422 Ga0268265_10115558
1423 Ga0268265_10267468
1424 Ga0268265_10513505
1425 Ga0268264_10000588
1426 Ga0268264_10026990
1427 Ga0268264_10043169
1428 Ga0268264_10118510
1429 Ga0307513_10011871
1430 Ga0307408_100008140
1431 Ga0307408_100025388
1432 Ga0307408_100057087
1433 Ga0307408_100122298
1434 Ga0307408_100356642
1435 Ga0307405_10018703
1436 Ga0307405_10019998
1437 Ga0307405_10296649
1438 Ga0307405_10613795
1439 Ga0307413_10012181
1440 Ga0307410_10041729
1441 Ga0307410_10321541
1442 Ga0307410_10424445
1443 Ga0307410_10518800
1444 Ga0307406_10146209
1445 Ga0307407_10010767
1446 Ga0307407_10012301
1447 Ga0307412_10018836
1448 Ga0307412_10137366
1449 Ga0307412_10329362
1450 Ga0307412_10333543
1451 Ga0307412_10336223
1452 Ga0307409_100022631
1453 Ga0307409_100065980
1454 Ga0307409_100289646
1455 Ga0307416_100015969
1456 Ga0307416_100021724
1457 Ga0307416_100029729
1458 Ga0307416_100055276
1459 Ga0307416_100374730
1460 Ga0307416_100392854
1461 Ga0307416_100399580
1462 Ga0307416_100563096
1463 Ga0307414_10038982
1464 Ga0307414_10123129
1465 Ga0307414_10480891
1466 Ga0307411_10031137
1467 Ga0307411_10034924
1468 Ga0307411_10041035
1469 Ga0307411_10058672
1470 Ga0307411_10068882
1471 Ga0307415_100008598
1472 Ga0307415_100011264
1473 Ga0307415_100278900
1474 Ga0373960_0017586
1475 Ga0373955_0343741
1476 Ga0373961_0000297
1477 Ga0373962_0061062
1478 Ga0373931_0171100
1479 Ga0373933_0335936
1480 Ga0373937_0051107
1481 Ga0373925_0746146
1482 Ga0395899_0422937
1483 Ga0395900_0049548
1484 Ga0395900_0340172
1485 Ga0395898_0211834
1486 Ga0395898_0621401
1487 Ga0395905_0059052
1488 Ga0395905_0084219
1489 Ga0395901_0177997
1490 Ga0395901_0400049
1491 Ga0436365_1614654
1492 Ga0436361_0942135
1493 Ga0439433_0005167
1494 Ga0439433_0031053
1495 Ga0439450_016156
1496 Ga0439451_035945
1497 Ga0439435_0003900
1498 Ga0439435_0013465
1499 Ga0439435_0051849
1500 Ga0439435_0065028
1501 Ga0439435_0066706
1502 Ga0439435_0109146
1503 Ga0439444_0023359
1504 Ga0439444_0045118
1505 Ga0439464_0002455
1506 Ga0439464_0050234
1507 Ga0439460_0009321
1508 Ga0439460_0057246
1509 Ga0439460_0077691
1510 Ga0451577_0056963
1511 Ga0451577_0076842
1512 Ga0451577_0767595
1513 Ga0453684_0786377
1514 Ga0451576_0043858
1515 Ga0451576_0048477
1516 Ga0451576_0146119
1517 Ga0451576_0517300
1518 Ga0495603_0269556
1519 Ga0495642_0014741
1520 Ga0495598_0008216
1521 Ga0495668_0124076
1522 Ga0495625_0223882
1523 Ga0495613_0005490
1524 Ga0495636_0044302
1525 Ga0495674_0101914
1526 Ga0495672_0001520
1527 Ga0495672_0249622
1528 Ga0496102_0137055
1529 Ga0496103_0366014
1530 Ga0496104_0005034
1531 Ga0496104_0013360
1532 Ga0496104_0033034
1533 Ga0496104_0264633
1534 Ga0496104_0559162
1535 Ga0496105_0022305
1536 Ga0496105_0090782
1537 Ga0496106_0035091
1538 Ga0496108_0018786
1539 Ga0496108_0827344
1540 Ga0496109_0001054
1541 Ga0496109_0034897
1542 Ga0496109_0252495
1543 Ga0496109_0542849
1544 Ga0496110_0002072
1545 Ga0496110_0003883
1546 Ga0496111_0064665
1547 Ga0496111_0321780
1548 Ga0496112_0003061
1549 Ga0496112_0005221
1550 Ga0496112_0058506
1551 Ga0496113_0074500
1552 Ga0496113_0094299
1553 Ga0496114_0465612
1554 Ga0496115_0122921
1555 Ga0496117_0185733
1556 Ga0496118_0016401
1557 Ga0496121_0000243
1558 Ga0501299_022347
1559 Ga0501032_0278000
1560 Ga0501032_0293391
1561 Ga0501034_0039253
1562 Ga0501036_0156950
1563 Ga0501036_0218330
1564 Ga0501036_0279380
1565 Ga0501036_0351264
1566 Ga0501038_0157232
1567 Ga0501038_0424801
1568 Ga0501040_0020560
1569 Ga0501040_0155555
1570 Ga0501041_0010636
1571 Ga0501041_0011231
1572 Ga0501041_0162503
1573 Ga0501041_0289185
1574 Ga0501042_0063830
1575 Ga0501042_0085180
1576 Ga0501042_0195223
1577 Ga0501042_0212026
1578 Ga0501043_0106457
1579 Ga0501043_0343542
1580 Ga0501046_0035947
1581 Ga0501047_0052331
1582 Ga0501048_0033566
1583 Ga0501048_0224436
1584 Ga0501068_0332508
1585 Ga0501069_0214318
1586 Ga0501071_0013769
1587 Ga0501071_0107076
1588 Ga0501071_0119398
1589 Ga0501071_0191228
1590 Ga0501072_0032275
1591 Ga0501072_0042098
1592 Ga0501072_0091050
1593 Ga0501072_0103309
1594 Ga0501072_0335317
1595 Ga0501074_0105851
1596 Ga0501074_0270389
1597 Ga0501075_0019019
1598 Ga0501075_0081685
1599 Ga0501075_0163142
1600 Ga0501075_0427074
1601 Ga0501075_0488749
1602 Ga0501076_0005097
1603 Ga0501076_0047976
1604 Ga0501076_0130401
1605 Ga0501076_0165266
1606 Ga0501076_0288425
1607 Ga0501077_0393637
1608 Ga0501217_079764
1609 Ga0501235_031445
1610 Ga0501247_011556
1611 Ga0501245_011486
1612 Ga0501079_0052049
1613 Ga0501079_0202364
1614 Ga0501079_0211818
1615 Ga0501080_0212064
1616 Ga0501080_0432865
1617 Ga0501080_0856980
1618 Ga0501081_0209315
1619 Ga0501081_0331772
1620 Ga0501272_004728
1621 Ga0501274_010984
1622 Ga0501283_025443
1623 Ga0501044_0027646
1624 Ga0501045_0020019
1625 Ga0501045_0024508
1626 Ga0501045_0031413
1627 Ga0501045_0061736
1628 nmdc:mga03683_12926_c1
1629 nmdc:mga03n38_133976_c1
1630 nmdc:mga00v17_19639_c1
1631 nmdc:mga0yw44_156896_c1
1632 nmdc:mga0yw44_30218_c1
1633 nmdc:mga0k408_320004_c1
1634 nmdc:mga0k408_76872_c1
1635 nmdc:mga06z11_246932_c1
1636 nmdc:mga06z11_32907_c1
1637 nmdc:mga04h51_20370_c1
1638 nmdc:mga07m45_49442_c1
1639 nmdc:mga05p37_107342_c1
1640 nmdc:mga05p37_1074_c1
1641 nmdc:mga05p37_129618_c1
1642 nmdc:mga05p37_161143_c1
1643 nmdc:mga05p37_170381_c1
1644 nmdc:mga05p37_191001_c1
1645 nmdc:mga05p37_227632_c2
1646 nmdc:mga05p37_232050_c1
1647 nmdc:mga05p37_24240_c1
1648 nmdc:mga05p37_254208_c1
1649 nmdc:mga05p37_2653_c1
1650 nmdc:mga05p37_27424_c1
1651 nmdc:mga05p37_321996_c1
1652 nmdc:mga05p37_403023_c1
1653 nmdc:mga05p37_467662_c1
1654 nmdc:mga05p37_483921_c1
1655 nmdc:mga05p37_486290_c1
1656 nmdc:mga05p37_4973_c1
1657 nmdc:mga05p37_551536_c1
1658 nmdc:mga05p37_82607_c1
1659 nmdc:mga05p37_83_c1
1660 nmdc:mga05p37_869737_c1
1661 nmdc:mga05p37_876_c1
1662 nmdc:mga09592_101092_c1
1663 nmdc:mga09592_13552_c1
1664 nmdc:mga09592_15786_c1
1665 nmdc:mga09592_242959_c1
1666 nmdc:mga09592_36829_c1
1667 nmdc:mga09592_41866_c1
1668 nmdc:mga09592_42919_c1
1669 nmdc:mga09592_46796_c1
1670 nmdc:mga09592_58391_c1
1671 nmdc:mga09592_7978_c1
1672 nmdc:mga09592_90410_c1
1673 nmdc:mga0qj67_10922_c1
1674 nmdc:mga0qj67_116243_c1
1675 nmdc:mga0qj67_16467_c1
1676 nmdc:mga0qj67_17069_c1
1677 nmdc:mga0qj67_203387_c1
1678 nmdc:mga0qj67_230269_c1
1679 nmdc:mga0qj67_35275_c1
1680 nmdc:mga0qj67_56085_c1
1681 nmdc:mga0qj67_57490_c1
1682 nmdc:mga06r32_121634_c1
1683 nmdc:mga06r32_160477_c1
1684 nmdc:mga06r32_186599_c1
1685 nmdc:mga06r32_20103_c1
1686 nmdc:mga06r32_243033_c1
1687 nmdc:mga06r32_279435_c1
1688 nmdc:mga06r32_4267_c1
1689 nmdc:mga06r32_4360_c1
1690 nmdc:mga06r32_442461_c1
1691 nmdc:mga06r32_52513_c1
1692 nmdc:mga06r32_6742_c1
1693 nmdc:mga06r32_785317_c1
1694 nmdc:mga08y16_100479_c1
1695 nmdc:mga08y16_111173_c1
1696 nmdc:mga08y16_1121_c1
1697 nmdc:mga08y16_125171_c1
1698 nmdc:mga08y16_206959_c1
1699 nmdc:mga08y16_223798_c1
1700 nmdc:mga08y16_2471_c1
1701 nmdc:mga08y16_30792_c1
1702 nmdc:mga08y16_7060_c1
1703 nmdc:mga08y16_7865_c1
1704 nmdc:mga0n895_251662_c1
1705 nmdc:mga0n895_4356_c1
1706 nmdc:mga0n895_48219_c1
1707 nmdc:mga0n895_5029_c1
1708 nmdc:mga0n895_5070_c1
1709 nmdc:mga0n895_68276_c1
1710 nmdc:mga0n895_768996_c1
1711 nmdc:mga0rr50_6819_c1
1712 nmdc:mga08x19_73783_c1
1713 nmdc:mga0a205_15411_c1
1714 nmdc:mga0a205_16830_c1
1715 nmdc:mga0a205_17912_c1
1716 nmdc:mga0a205_29612_c1
1717 nmdc:mga0a205_34306_c1
1718 nmdc:mga0a205_43676_c1
1719 nmdc:mga0a205_4439_c1
1720 nmdc:mga0a205_50427_c2
1721 nmdc:mga0a205_538788_c1
1722 nmdc:mga0a205_606472_c1
1723 nmdc:mga0a205_76_c1
1724 nmdc:mga0a205_96540_c1
1725 nmdc:mga0sz30_29885_c1
1726 Ga0495601_0075013
1727 Ga0500588_0008931
1728 Ga0501084_0067656
1729 Ga0501084_0468328
1730 Ga0501084_0580879
1731 Ga0590071_000030
1732 Ga0590071_001388
1733 Ga0590071_006653
1734 Ga0590074_002044
1735 Ga0590074_005177
1736 Ga0590075_000351
1737 Ga0590075_001856
1738 Ga0590075_003200
1739 Ga0590075_004308
1740 Ga0590075_050806
1741 Ga0590077_000390
1742 Ga0590077_001322
1743 Ga0587091_042773
1744 Ga0501082_0269423
1745 Ga0530510_0006822
1746 Ga0530510_0180631

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

174

211

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

42

154

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

173

286

0.85

PF18029

Glyoxalase_6

Glyoxalase-like domain

46

155

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9082 2 243
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8376 2 243
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.7883 121 243
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.7714 125 243
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7667 123 243
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8951 190 243 3.30.720.110
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8674 123 242 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8645 113 242 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8579 121 240 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.852 121 243 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V8IG39-F1-model_v4 Glyoxalase 0.9882 1 243
AF-A0A7Y4VZB3-F1-model_v4 VOC family protein 0.9846 1 241
AF-A0A2V8IG39-F1-model_v4 Glyoxalase 0.9842 1 243
AF-A0A7Y4VZB3-F1-model_v4 VOC family protein 0.9647 1 241
AF-A0A6B1FMV3-F1-model_v4 VOC family protein 0.9579 1 243

Map