F484180

General Info

Members Datasets Scaffolds Average Seq Length
871 459 839 245

Family's Representative Sequence

Representative Sequence 3300012497|Ga0157319_1000008|Ga0157319_1000008182
Length 276
Sequence MAAALAPAIDRRRRPADRLVAIAPTPPIQQDIPMSSTHFGFETVDETAKARRVRGVFDSVASRYDVMNDLMSMGLHRAWKRYTLAVANLKPGDRVLDIAGGTGDMARLFAKKVGERGMVVHTDINEAMLRTGRERLIDEGLVLPTNLCDAEALPYKDGSFDLVCVAFGLRNMTHKDKALAEMNRVLRPGGRLLVLEFSQVAEPLRKPYDWYSFKVLPRIGSLIAGDADSYRYLAESIRMHPPQAELKALMKSVGFGHVDVHNLTGGVVALHAGIKC

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
3 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
9 2643221570 Acidovorax sp. Root568 Isolate Unclassified
10 2643221585 Pelomonas sp. Root662 Isolate Unclassified
11 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221656 Pelomonas sp. Root405 Isolate Unclassified
17 2643221660 Methylibium sp. Root1272 Isolate Unclassified
18 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2738543013 Variovorax sp. BT01 Isolate Unclassified
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2831864461 Roseateles noduli HZ7 Isolate Nodule
23 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
24 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
25 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
26 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
27 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
28 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
29 2919150387 Rahnella aceris 1817 Isolate Unclassified
30 2927143783 Rahnella sp. 2050 Isolate Unclassified
31 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
32 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
33 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
220 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
237 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
238 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
239 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
240 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
241 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
242 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
243 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
244 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
250 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
251 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
258 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
259 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
262 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
263 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
264 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
265 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
266 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
267 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
271 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
272 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
273 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
274 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
277 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
296 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
299 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
300 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
301 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
302 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
303 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
304 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
305 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
306 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
307 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
308 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
309 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
310 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
311 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
312 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
313 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
314 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
315 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
316 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
317 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
318 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
319 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
320 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
321 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
322 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
323 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
324 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
325 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
326 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
327 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
328 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
329 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
330 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
331 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
332 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
333 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
334 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
335 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
342 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
351 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
362 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
366 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
375 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
376 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
377 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
378 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
379 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
380 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
381 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
382 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
385 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
386 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
387 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
388 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
389 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
390 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
391 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
402 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
403 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
406 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
407 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
408 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
409 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
410 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
411 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
412 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
413 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
414 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
415 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
416 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
417 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
418 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
419 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
420 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
424 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
425 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
426 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
427 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
428 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
429 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
430 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
435 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
451 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
452 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
453 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
454 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
455 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
456 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
457 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
458 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
459 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0.11
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.19
Nodule 0.46
Rhizoplane 3.67
Rhizosphere 71.53
Stem 0
Stem Tuber 0
Unclassified 8.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2970801 2162886007 Bacteria 1215
2 JGI25162J39368_1000116 3300002737 Bacteria 87942
3 JGI25150J39212_1003355 3300002774 Bacteria 3763
4 JGI25153J46596_10007422 3300003215 Bacteria 5397
5 JGI25153J46596_10007578 3300003215 Bacteria 5312
6 rootL2_10000310 3300003322 Bacteria 31146
7 rootH1_10233163 3300003323 Bacteria 2209
8 Ga0055539_1000431 3300003752 Bacteria 14924
9 Ga0055539_1007041 3300003752 Bacteria 1429
10 Ga0055533_1000053 3300003756 Bacteria 199478
11 Ga0055525_1000904 3300003759 Bacteria 8472
12 Ga0055526_1000968 3300003771 Bacteria 21218
13 Ga0055526_1001006 3300003771 Bacteria 20690
14 Ga0055524_1000999 3300003775 Bacteria 17654
15 Ga0055534_1001237 3300003784 Bacteria 10584
16 Ga0055540_1011662 3300003792 Bacteria 2814
17 Ga0055531_10000007 3300003794 Bacteria 225289
18 Ga0055531_10003852 3300003794 Bacteria 9390
19 Ga0055531_10019372 3300003794 Bacteria 2755
20 Ga0055531_10045285 3300003794 Bacteria 1223
21 Ga0055543_1001427 3300004625 Bacteria 9496
22 Ga0055543_1034367 3300004625 Bacteria 874
23 Ga0065165_1000101 3300005262 Bacteria 141486
24 Ga0065165_1000248 3300005262 Bacteria 93216
25 Ga0065704_10000497 3300005289 Bacteria 19639
26 Ga0065704_10129202 3300005289 Bacteria 1651
27 Ga0065707_10001158 3300005295 Bacteria 8594
28 Ga0070658_10083243 3300005327 Bacteria 2630
29 Ga0070658_10096192 3300005327 Bacteria 2445
30 Ga0070658_10312642 3300005327 Bacteria 1341
31 Ga0070676_10006495 3300005328 Bacteria 6246
32 Ga0070676_10006926 3300005328 Bacteria 6071
33 Ga0070676_10037254 3300005328 Bacteria 2805
34 Ga0070683_100076771 3300005329 Bacteria 3123
35 Ga0070683_100332058 3300005329 Bacteria 1447
36 Ga0070677_10009652 3300005333 Bacteria 3278
37 Ga0070677_10044355 3300005333 Bacteria 1769
38 Ga0068869_100005147 3300005334 Bacteria 8201
39 Ga0068869_100392569 3300005334 Bacteria 1139
40 Ga0070666_10246702 3300005335 Bacteria 1264
41 Ga0070680_100071876 3300005336 Bacteria 2843
42 Ga0070682_100267722 3300005337 Bacteria 1240
43 Ga0068868_100012109 3300005338 Bacteria 6298
44 Ga0068868_100025002 3300005338 Bacteria 4537
45 Ga0068868_100028442 3300005338 Bacteria 4274
46 Ga0070660_100049846 3300005339 Bacteria 3220
47 Ga0070660_100301603 3300005339 Bacteria 1313
48 Ga0070660_100317437 3300005339 Bacteria 1279
49 Ga0070660_100610211 3300005339 Bacteria 913
50 Ga0070661_100022742 3300005344 Bacteria 4489
51 Ga0070661_100450930 3300005344 Bacteria 1023
52 Ga0070668_100040154 3300005347 Bacteria 3580
53 Ga0070668_100243705 3300005347 Bacteria 1490
54 Ga0070669_100063844 3300005353 Bacteria 2711
55 Ga0070675_100007192 3300005354 Bacteria 8577
56 Ga0070675_100026729 3300005354 Bacteria 4631
57 Ga0070675_100161539 3300005354 Bacteria 1927
58 Ga0070675_100172546 3300005354 Bacteria 1866
59 Ga0070675_100324667 3300005354 Bacteria 1360
60 Ga0070671_100013893 3300005355 Bacteria 6495
61 Ga0070671_100027654 3300005355 Bacteria 4669
62 Ga0070671_100098197 3300005355 Bacteria 2456
63 Ga0070671_100162338 3300005355 Bacteria 1889
64 Ga0070671_100199894 3300005355 Bacteria 1695
65 Ga0070671_100403812 3300005355 Bacteria 1169
66 Ga0070674_100207170 3300005356 Bacteria 1518
67 Ga0070673_100093533 3300005364 Bacteria 2462
68 Ga0070673_100193550 3300005364 Bacteria 1748
69 Ga0070659_100027006 3300005366 Bacteria 4420
70 Ga0070659_100062436 3300005366 Bacteria 2945
71 Ga0070659_100088337 3300005366 Bacteria 2482
72 Ga0070667_100660309 3300005367 Bacteria 966
73 Ga0070714_100097912 3300005435 Bacteria 2580
74 Ga0070705_100310254 3300005440 Bacteria 1134
75 Ga0070663_100028153 3300005455 Bacteria 3822
76 Ga0070663_100188316 3300005455 Bacteria 1605
77 Ga0070678_100090868 3300005456 Bacteria 2342
78 Ga0070662_100005330 3300005457 Bacteria 8217
79 Ga0070662_100013586 3300005457 Bacteria 5420
80 Ga0070662_100272547 3300005457 Bacteria 1367
81 Ga0070662_100383280 3300005457 Bacteria 1158
82 Ga0070662_100600127 3300005457 Bacteria 926
83 Ga0068867_100006378 3300005459 Bacteria 8337
84 Ga0068867_100014086 3300005459 Bacteria 5664
85 Ga0068867_100029474 3300005459 Bacteria 3954
86 Ga0068867_100292722 3300005459 Bacteria 1339
87 Ga0070706_100037499 3300005467 Bacteria 4477
88 Ga0070706_100186751 3300005467 Bacteria 1937
89 Ga0070707_100175509 3300005468 Bacteria 2089
90 Ga0070698_100340322 3300005471 Bacteria 1432
91 Ga0070699_100029409 3300005518 Bacteria 4737
92 Ga0070699_100612276 3300005518 Bacteria 993
93 Ga0070679_100018762 3300005530 Bacteria 6715
94 Ga0070684_100080387 3300005535 Bacteria 2883
95 Ga0068853_100182902 3300005539 Bacteria 1901
96 Ga0068853_100311735 3300005539 Bacteria 1457
97 Ga0070672_100004996 3300005543 Bacteria 8737
98 Ga0070672_100050827 3300005543 Bacteria 3230
99 Ga0070672_100452725 3300005543 Bacteria 1106
100 Ga0070695_100058360 3300005545 Bacteria 2495
101 Ga0070695_100105044 3300005545 Bacteria 1908
102 Ga0070693_100036952 3300005547 Bacteria 2720
103 Ga0070693_100041815 3300005547 Bacteria 2580
104 Ga0070665_100013839 3300005548 Bacteria 8114
105 Ga0070704_100084717 3300005549 Bacteria 2344
106 Ga0068855_100001666 3300005563 Bacteria 27785
107 Ga0068855_100060304 3300005563 Bacteria 4437
108 Ga0070664_100087852 3300005564 Bacteria 2688
109 Ga0070664_100523731 3300005564 Bacteria 1094
110 Ga0068857_100011579 3300005577 Bacteria 7673
111 Ga0068857_100014155 3300005577 Bacteria 6947
112 Ga0068857_100131344 3300005577 Bacteria 2259
113 Ga0068857_100190736 3300005577 Bacteria 1867
114 Ga0068854_100032592 3300005578 Bacteria 3627
115 Ga0068854_100111998 3300005578 Bacteria 2060
116 Ga0068854_100336745 3300005578 Bacteria 1231
117 Ga0070702_100026472 3300005615 Bacteria 3116
118 Ga0068852_100007330 3300005616 Bacteria 8047
119 Ga0068852_100078758 3300005616 Bacteria 2916
120 Ga0068859_100428221 3300005617 Bacteria 1420
121 Ga0068864_100047443 3300005618 Bacteria 3689
122 Ga0068864_100075435 3300005618 Bacteria 2944
123 Ga0068864_100083214 3300005618 Bacteria 2810
124 Ga0068864_100411348 3300005618 Bacteria 1287
125 Ga0068866_10111336 3300005718 Bacteria 1528
126 Ga0068861_100015862 3300005719 Bacteria 5319
127 Ga0068861_100016866 3300005719 Bacteria 5175
128 Ga0068861_100027593 3300005719 Bacteria 4138
129 Ga0068851_10017778 3300005834 Bacteria 3421
130 Ga0068851_10027355 3300005834 Bacteria 2811
131 Ga0068851_10027907 3300005834 Bacteria 2785
132 Ga0068870_10004536 3300005840 Bacteria 5983
133 Ga0068870_10203407 3300005840 Bacteria 1202
134 Ga0068870_10316003 3300005840 Bacteria 991
135 Ga0068858_100047944 3300005842 Bacteria 3959
136 Ga0068860_100038773 3300005843 Bacteria 4558
137 Ga0068860_100175972 3300005843 Bacteria 2068
138 Ga0068862_100007493 3300005844 Bacteria 9044
139 Ga0068862_100010025 3300005844 Bacteria 7826
140 Ga0075365_10010595 3300006038 Bacteria 5380
141 Ga0075365_10011756 3300006038 Bacteria 5162
142 Ga0075365_10057991 3300006038 Bacteria 2577
143 Ga0075365_10129439 3300006038 Bacteria 1746
144 Ga0075368_10009568 3300006042 Bacteria 3486
145 Ga0075368_10011904 3300006042 Bacteria 3174
146 Ga0075363_100001576 3300006048 Bacteria 8763
147 Ga0075363_100073123 3300006048 Bacteria 1865
148 Ga0075364_10003493 3300006051 Bacteria 8947
149 Ga0075364_10056862 3300006051 Bacteria 2562
150 Ga0075432_10000664 3300006058 Bacteria 10541
151 Ga0075362_10001003 3300006177 Bacteria 8652
152 Ga0075362_10003169 3300006177 Bacteria 5687
153 Ga0075362_10036688 3300006177 Bacteria 2145
154 Ga0075367_10001551 3300006178 Bacteria 9934
155 Ga0075367_10036117 3300006178 Bacteria 2863
156 Ga0075367_10073721 3300006178 Bacteria 2057
157 Ga0075369_10020411 3300006186 Bacteria 2714
158 Ga0075366_10000468 3300006195 Bacteria 18771
159 Ga0075366_10054153 3300006195 Bacteria 2383
160 Ga0075366_10054888 3300006195 Bacteria 2366
161 Ga0075366_10088851 3300006195 Bacteria 1850
162 Ga0075366_10133564 3300006195 Bacteria 1498
163 Ga0075366_10227281 3300006195 Bacteria 1137
164 Ga0097621_100009602 3300006237 Bacteria 7032
165 Ga0097621_100167233 3300006237 Bacteria 1894
166 Ga0075370_10000108 3300006353 Bacteria 26683
167 Ga0075370_10000350 3300006353 Bacteria 16757
168 Ga0075370_10011293 3300006353 Bacteria 4690
169 Ga0075370_10018852 3300006353 Bacteria 3747
170 Ga0075370_10018907 3300006353 Bacteria 3742
171 Ga0075370_10024698 3300006353 Bacteria 3321
172 Ga0068871_100011636 3300006358 Bacteria 6460
173 Ga0075428_100045856 3300006844 Bacteria 4803
174 Ga0075428_100097261 3300006844 Bacteria 3209
175 Ga0075430_100012192 3300006846 Bacteria 7320
176 Ga0075430_100041086 3300006846 Bacteria 3914
177 Ga0075431_100002923 3300006847 Bacteria 16541
178 Ga0075431_100030939 3300006847 Bacteria 5513
179 Ga0075431_100044445 3300006847 Bacteria 4582
180 Ga0075434_100107882 3300006871 Bacteria 2795
181 Ga0075429_100003081 3300006880 Bacteria 14139
182 Ga0075429_100128970 3300006880 Bacteria 2212
183 Ga0068865_100031426 3300006881 Bacteria 3541
184 Ga0068865_100084377 3300006881 Bacteria 2289
185 Ga0097620_100428181 3300006931 Bacteria 1420
186 Ga0099823_1000075 3300006944 Bacteria 48013
187 Ga0105250_10000004 3300009092 Bacteria 438653
188 Ga0105240_10281860 3300009093 Bacteria 1909
189 Ga0105240_10932554 3300009093 Bacteria 932
190 Ga0111539_10174509 3300009094 Bacteria 2511
191 Ga0105245_10011588 3300009098 Bacteria 7682
192 Ga0105245_10023648 3300009098 Bacteria 5394
193 Ga0105245_10111571 3300009098 Bacteria 2543
194 Ga0105245_10664617 3300009098 Bacteria 1073
195 Ga0105243_10012663 3300009148 Bacteria 6372
196 Ga0105243_10025933 3300009148 Bacteria 4484
197 Ga0105243_10044521 3300009148 Bacteria 3482
198 Ga0105243_10397397 3300009148 Bacteria 1279
199 Ga0105241_10078048 3300009174 Bacteria 2587
200 Ga0105242_10009898 3300009176 Bacteria 7303
201 Ga0105242_10563802 3300009176 Bacteria 1094
202 Ga0105242_10571267 3300009176 Bacteria 1087
203 Ga0105242_11120328 3300009176 Bacteria 802
204 Ga0105248_10002698 3300009177 Bacteria 19716
205 Ga0105248_10014653 3300009177 Bacteria 8628
206 Ga0105248_10131168 3300009177 Bacteria 2828
207 Ga0105237_10023104 3300009545 Bacteria 6376
208 Ga0105238_10070932 3300009551 Bacteria 3482
209 Ga0105249_10061695 3300009553 Bacteria 3441
210 Ga0099796_10013861 3300010159 Bacteria 2314
211 Ga0105239_10654159 3300010375 Bacteria 1200
212 Ga0157319_1000008 3300012497 Bacteria 315600
213 Ga0157373_10121303 3300013100 Bacteria 1837
214 Ga0157371_10312940 3300013102 Bacteria 1138
215 Ga0157369_10072223 3300013105 Bacteria 3704
216 Ga0157374_10012925 3300013296 Bacteria 7274
217 Ga0157374_10048033 3300013296 Bacteria 3959
218 Ga0157374_10087753 3300013296 Bacteria 2962
219 Ga0157378_10149245 3300013297 Bacteria 2177
220 Ga0157372_10023923 3300013307 Bacteria 6628
221 Ga0157372_10080912 3300013307 Bacteria 3676
222 Ga0157372_10947375 3300013307 Bacteria 998
223 Ga0157375_10016951 3300013308 Bacteria 6564
224 Ga0157375_10028320 3300013308 Bacteria 5250
225 Ga0157375_10183738 3300013308 Bacteria 2243
226 Ga0157375_10957849 3300013308 Bacteria 997
227 Ga0157380_10079544 3300014326 Bacteria 2677
228 Ga0157380_10725396 3300014326 Bacteria 1002
229 Ga0157380_10969088 3300014326 Bacteria 882
230 Ga0157379_10000729 3300014968 Bacteria 26640
231 Ga0157379_10036452 3300014968 Bacteria 4385
232 Ga0157379_10121245 3300014968 Bacteria 2352
233 Ga0157376_10028980 3300014969 Bacteria 4407
234 Ga0157376_10862522 3300014969 Bacteria 921
235 Ga0213872_10000093 3300021361 Bacteria 83513
236 Ga0213872_10000339 3300021361 Bacteria 39618
237 Ga0213872_10000508 3300021361 Bacteria 30750
238 Ga0213872_10003642 3300021361 Bacteria 8445
239 Ga0213872_10062011 3300021361 Bacteria 1690
240 Ga0213872_10145770 3300021361 Bacteria 1037
241 Ga0209674_100039 3300025226 Bacteria 402292
242 Ga0209563_100013 3300025230 Bacteria 941463
243 Ga0209563_100080 3300025230 Bacteria 199504
244 Ga0207427_101227 3300025231 Bacteria 9906
245 Ga0207425_1000540 3300025245 Bacteria 22766
246 Ga0209026_1019054 3300025250 Bacteria 1079
247 Ga0209677_100086 3300025253 Bacteria 112759
248 Ga0209677_101082 3300025253 Bacteria 12847
249 Ga0209759_1003908 3300025256 Bacteria 5748
250 Ga0209759_1006233 3300025256 Bacteria 4043
251 Ga0209759_1012837 3300025256 Bacteria 2299
252 Ga0209129_1000027 3300025258 Bacteria 409587
253 Ga0209673_1007822 3300025273 Bacteria 4847
254 Ga0209673_1023535 3300025273 Bacteria 2094
255 Ga0209130_1005108 3300025284 Bacteria 4675
256 Ga0209675_1003613 3300025291 Bacteria 7266
257 Ga0209676_1011901 3300025292 Bacteria 3465
258 Ga0209025_1080447 3300025294 Bacteria 1109
259 Ga0209564_1000008 3300025295 Bacteria 953227
260 Ga0209564_1000139 3300025295 Bacteria 180328
261 Ga0209758_1000052 3300025297 Bacteria 338962
262 Ga0209758_1000146 3300025297 Bacteria 169246
263 Ga0209050_1000165 3300025298 Bacteria 152109
264 Ga0209050_1003503 3300025298 Bacteria 11501
265 Ga0209050_1007646 3300025298 Bacteria 5988
266 Ga0209256_1000450 3300025299 Bacteria 62771
267 Ga0209256_1002818 3300025299 Bacteria 13287
268 Ga0209051_1000960 3300025303 Bacteria 28324
269 Ga0209051_1001306 3300025303 Bacteria 21908
270 Ga0209051_1001911 3300025303 Bacteria 16199
271 Ga0209051_1003358 3300025303 Bacteria 10539
272 Ga0209051_1017387 3300025303 Bacteria 3215
273 Ga0209051_1029773 3300025303 Bacteria 2130
274 Ga0209051_1031375 3300025303 Bacteria 2046
275 Ga0209257_1000021 3300025304 Bacteria 771986
276 Ga0209257_1002089 3300025304 Bacteria 21013
277 Ga0209257_1003471 3300025304 Bacteria 13465
278 Ga0209257_1008791 3300025304 Bacteria 5608
279 Ga0209257_1015805 3300025304 Bacteria 3105
280 Ga0209257_1022940 3300025304 Bacteria 2210
281 Ga0207656_10015553 3300025321 Bacteria 2947
282 Ga0207696_1000056 3300025711 Bacteria 251959
283 Ga0207682_10006671 3300025893 Bacteria 4638
284 Ga0207642_10076128 3300025899 Bacteria 1614
285 Ga0207680_10152913 3300025903 Bacteria 1540
286 Ga0207680_10296234 3300025903 Bacteria 1127
287 Ga0207680_10334783 3300025903 Bacteria 1061
288 Ga0207699_10011916 3300025906 Bacteria 4407
289 Ga0207645_10003365 3300025907 Bacteria 12167
290 Ga0207645_10017173 3300025907 Bacteria 4778
291 Ga0207645_10020521 3300025907 Bacteria 4324
292 Ga0207645_10042506 3300025907 Bacteria 2908
293 Ga0207645_10098862 3300025907 Bacteria 1881
294 Ga0207643_10013594 3300025908 Bacteria 4410
295 Ga0207643_10072199 3300025908 Bacteria 1988
296 Ga0207643_10206318 3300025908 Bacteria 1198
297 Ga0207705_10019660 3300025909 Bacteria 4829
298 Ga0207705_10031396 3300025909 Bacteria 3792
299 Ga0207705_10127325 3300025909 Bacteria 1893
300 Ga0207684_10032013 3300025910 Bacteria 4473
301 Ga0207684_10108651 3300025910 Bacteria 2373
302 Ga0207695_10032446 3300025913 Bacteria 5714
303 Ga0207695_10062546 3300025913 Bacteria 3842
304 Ga0207695_10108859 3300025913 Bacteria 2754
305 Ga0207671_10029878 3300025914 Bacteria 4067
306 Ga0207660_10022584 3300025917 Bacteria 4240
307 Ga0207662_10170728 3300025918 Bacteria 1394
308 Ga0207657_10028179 3300025919 Bacteria 5129
309 Ga0207657_10056950 3300025919 Bacteria 3371
310 Ga0207649_10137159 3300025920 Bacteria 1669
311 Ga0207646_10073049 3300025922 Bacteria 3064
312 Ga0207681_10008706 3300025923 Bacteria 6198
313 Ga0207681_10056233 3300025923 Bacteria 2683
314 Ga0207694_10085822 3300025924 Bacteria 2478
315 Ga0207650_10020768 3300025925 Bacteria 4636
316 Ga0207659_10002055 3300025926 Bacteria 11945
317 Ga0207659_10086804 3300025926 Bacteria 2327
318 Ga0207659_10212084 3300025926 Bacteria 1553
319 Ga0207659_10290240 3300025926 Bacteria 1340
320 Ga0207687_10051425 3300025927 Bacteria 2872
321 Ga0207687_10098633 3300025927 Bacteria 2145
322 Ga0207687_10127772 3300025927 Bacteria 1911
323 Ga0207687_10772859 3300025927 Bacteria 818
324 Ga0207664_10069180 3300025929 Bacteria 2838
325 Ga0207644_10000130 3300025931 Bacteria 54417
326 Ga0207644_10055786 3300025931 Bacteria 2849
327 Ga0207644_10089739 3300025931 Bacteria 2288
328 Ga0207644_10166814 3300025931 Bacteria 1716
329 Ga0207690_10091070 3300025932 Bacteria 2155
330 Ga0207690_10210446 3300025932 Bacteria 1482
331 Ga0207690_10231906 3300025932 Bacteria 1418
332 Ga0207706_10006516 3300025933 Bacteria 10827
333 Ga0207706_10012430 3300025933 Bacteria 7758
334 Ga0207706_10052927 3300025933 Bacteria 3584
335 Ga0207706_10175376 3300025933 Bacteria 1883
336 Ga0207706_10395719 3300025933 Bacteria 1198
337 Ga0207686_10008348 3300025934 Bacteria 5590
338 Ga0207686_10013174 3300025934 Bacteria 4570
339 Ga0207686_10655153 3300025934 Bacteria 831
340 Ga0207686_10686202 3300025934 Bacteria 813
341 Ga0207709_10293772 3300025935 Bacteria 1205
342 Ga0207669_10037308 3300025937 Bacteria 2787
343 Ga0207704_10029131 3300025938 Bacteria 3074
344 Ga0207704_10080820 3300025938 Bacteria 2100
345 Ga0207691_10007829 3300025940 Bacteria 10293
346 Ga0207691_10010432 3300025940 Bacteria 8913
347 Ga0207691_10140544 3300025940 Bacteria 2128
348 Ga0207691_10204670 3300025940 Bacteria 1716
349 Ga0207691_10279656 3300025940 Bacteria 1436
350 Ga0207711_10002256 3300025941 Bacteria 17295
351 Ga0207711_10005210 3300025941 Bacteria 11014
352 Ga0207711_10018486 3300025941 Bacteria 5796
353 Ga0207711_10080376 3300025941 Bacteria 2847
354 Ga0207689_10001818 3300025942 Bacteria 20157
355 Ga0207689_10007166 3300025942 Bacteria 9803
356 Ga0207689_10036462 3300025942 Bacteria 4082
357 Ga0207661_10242244 3300025944 Bacteria 1600
358 Ga0207679_10150484 3300025945 Bacteria 1893
359 Ga0207667_10156804 3300025949 Bacteria 2342
360 Ga0207651_10099340 3300025960 Bacteria 2155
361 Ga0207651_10165931 3300025960 Bacteria 1736
362 Ga0207712_10116224 3300025961 Bacteria 2015
363 Ga0207712_10159131 3300025961 Bacteria 1753
364 Ga0207668_10073256 3300025972 Bacteria 2454
365 Ga0207640_10354970 3300025981 Bacteria 1179
366 Ga0207640_10385132 3300025981 Bacteria 1137
367 Ga0207640_10405351 3300025981 Bacteria 1111
368 Ga0207677_10004871 3300026023 Bacteria 7243
369 Ga0207677_10193732 3300026023 Bacteria 1610
370 Ga0207639_10057980 3300026041 Bacteria 2976
371 Ga0207639_10063590 3300026041 Bacteria 2858
372 Ga0207639_10854018 3300026041 Bacteria 850
373 Ga0207678_10000893 3300026067 Bacteria 27375
374 Ga0207678_10052208 3300026067 Bacteria 3527
375 Ga0207678_10193534 3300026067 Bacteria 1738
376 Ga0207678_10305128 3300026067 Bacteria 1368
377 Ga0207708_10006241 3300026075 Bacteria 8829
378 Ga0207702_10096506 3300026078 Bacteria 2600
379 Ga0207702_10209824 3300026078 Bacteria 1810
380 Ga0207641_10043137 3300026088 Bacteria 3786
381 Ga0207648_10001919 3300026089 Bacteria 22717
382 Ga0207648_10010004 3300026089 Bacteria 9022
383 Ga0207648_10022574 3300026089 Bacteria 5649
384 Ga0207648_10233624 3300026089 Bacteria 1636
385 Ga0207676_10202777 3300026095 Bacteria 1754
386 Ga0207676_10225067 3300026095 Bacteria 1673
387 Ga0207674_10002708 3300026116 Bacteria 22119
388 Ga0207674_10023986 3300026116 Bacteria 6524
389 Ga0207674_10037550 3300026116 Bacteria 5036
390 Ga0207675_100000180 3300026118 Bacteria 56974
391 Ga0207675_100004669 3300026118 Bacteria 13191
392 Ga0207675_100007765 3300026118 Bacteria 10122
393 Ga0207675_100222807 3300026118 Bacteria 1817
394 Ga0207683_10118253 3300026121 Bacteria 2377
395 Ga0207683_10156334 3300026121 Bacteria 2060
396 Ga0207683_10161002 3300026121 Bacteria 2029
397 Ga0207698_10006282 3300026142 Bacteria 7393
398 Ga0209389_1000249 3300027296 Bacteria 34712
399 Ga0209371_1021935 3300027312 Bacteria 1538
400 Ga0209996_1003340 3300027395 Bacteria 2014
401 Ga0209996_1022132 3300027395 Bacteria 898
402 Ga0209984_1012034 3300027424 Bacteria 1125
403 Ga0209995_1019473 3300027471 Bacteria 1120
404 Ga0209968_1003253 3300027526 Bacteria 2438
405 Ga0209982_1004919 3300027552 Bacteria 1925
406 Ga0209982_1029463 3300027552 Bacteria 861
407 Ga0209970_1000108 3300027614 Bacteria 11841
408 Ga0210002_1000559 3300027617 Bacteria 5039
409 Ga0209983_1000495 3300027665 Bacteria 8476
410 Ga0209971_1000131 3300027682 Bacteria 22195
411 Ga0209966_1000231 3300027695 Bacteria 21187
412 Ga0209998_10000211 3300027717 Bacteria 20199
413 Ga0209974_10001553 3300027876 Bacteria 8345
414 Ga0209974_10002942 3300027876 Bacteria 6177
415 Ga0209974_10035157 3300027876 Bacteria 1664
416 Ga0268266_10506353 3300028379 Bacteria 1153
417 Ga0268265_10103724 3300028380 Bacteria 2303
418 Ga0268265_10243263 3300028380 Bacteria 1589
419 Ga0268264_10040974 3300028381 Bacteria 3828
420 Ga0268264_10077487 3300028381 Bacteria 2832
421 Ga0265334_10000020 3300028573 Bacteria 133852
422 Ga0265334_10056560 3300028573 Bacteria 1489
423 Ga0265336_10000014 3300028666 Bacteria 241247
424 Ga0307517_10116350 3300028786 Bacteria 2002
425 Ga0307515_10000472 3300028794 Bacteria 96172
426 Ga0307515_10001966 3300028794 Bacteria 45520
427 Ga0307515_10009632 3300028794 Bacteria 18642
428 Ga0307515_10013614 3300028794 Bacteria 15169
429 Ga0307515_10014298 3300028794 Bacteria 14737
430 Ga0307515_10026472 3300028794 Bacteria 9982
431 Ga0307515_10102753 3300028794 Bacteria 3434
432 Ga0307515_10323601 3300028794 Bacteria 1206
433 Ga0307515_10356691 3300028794 Bacteria 1106
434 Ga0265324_10006580 3300029957 Bacteria 4814
435 Ga0268256_1024691 3300030500 Bacteria 1538
436 Ga0307511_10053633 3300030521 Bacteria 3192
437 Ga0316177_1136770 3300030731 Bacteria 6811
438 Ga0316181_1026598 3300030744 Bacteria 2756
439 Ga0265330_10000046 3300031235 Bacteria 108853
440 Ga0265330_10015352 3300031235 Bacteria 3544
441 Ga0265332_10000028 3300031238 Bacteria 184029
442 Ga0265328_10032372 3300031239 Bacteria 1941
443 Ga0265325_10009170 3300031241 Bacteria 5794
444 Ga0265329_10045902 3300031242 Bacteria 1396
445 Ga0265327_10000002 3300031251 Bacteria 856593
446 Ga0265327_10000500 3300031251 Bacteria 68037
447 Ga0265327_10000916 3300031251 Bacteria 43238
448 Ga0265327_10006214 3300031251 Bacteria 9629
449 Ga0265316_10000225 3300031344 Bacteria 65532
450 Ga0307513_10000838 3300031456 Bacteria 44960
451 Ga0307513_10083483 3300031456 Bacteria 3285
452 Ga0307513_10109471 3300031456 Bacteria 2760
453 Ga0307513_10118564 3300031456 Bacteria 2620
454 Ga0307509_10000978 3300031507 Bacteria 48968
455 Ga0307509_10034507 3300031507 Bacteria 5559
456 Ga0307509_10140560 3300031507 Bacteria 2351
457 Ga0307509_10267678 3300031507 Bacteria 1479
458 Ga0307408_100000023 3300031548 Bacteria 295931
459 Ga0307408_100027684 3300031548 Bacteria 3909
460 Ga0307408_100337361 3300031548 Bacteria 1275
461 Ga0265313_10000148 3300031595 Bacteria 73384
462 Ga0265313_10084038 3300031595 Bacteria 1441
463 Ga0307508_10000404 3300031616 Bacteria 51734
464 Ga0307514_10009282 3300031649 Bacteria 8285
465 Ga0316575_10010424 3300031665 Bacteria 3416
466 Ga0316579_10005735 3300031691 Bacteria 5029
467 Ga0265314_10000054 3300031711 Bacteria 184029
468 Ga0265314_10001039 3300031711 Bacteria 32357
469 Ga0316576_10003481 3300031727 Bacteria 9239
470 Ga0316576_10014142 3300031727 Bacteria 5326
471 Ga0316576_10015838 3300031727 Bacteria 5073
472 Ga0316576_10202953 3300031727 Bacteria 1493
473 Ga0316576_10260442 3300031727 Bacteria 1301
474 Ga0316578_10016657 3300031728 Bacteria 3983
475 Ga0316578_10039269 3300031728 Bacteria 2734
476 Ga0316578_10119612 3300031728 Bacteria 1583
477 Ga0316578_10170422 3300031728 Bacteria 1312
478 Ga0307516_10000190 3300031730 Bacteria 79464
479 Ga0307516_10001586 3300031730 Bacteria 31257
480 Ga0307516_10001919 3300031730 Bacteria 28473
481 Ga0307516_10002741 3300031730 Bacteria 23228
482 Ga0307405_10282062 3300031731 Bacteria 1251
483 Ga0307410_10108924 3300031852 Bacteria 2001
484 Ga0316585_10002582 3300032137 Bacteria 4900
485 Ga0316593_10098971 3300032168 Bacteria 1033
486 Ga0307507_10008591 3300033179 Bacteria 14027
487 Ga0307510_10225541 3300033180 Bacteria 1381
488 Ga0373948_0001870 3300034817 Bacteria 3010
489 Ga0373959_0002670 3300034820 Bacteria 2830
490 Ga0373928_0070628 3300035084 Bacteria 863
491 Ga0373949_0020409 3300035090 Bacteria 1516
492 Ga0373951_0006594 3300035091 Bacteria 2652
493 Ga0373952_0046530 3300035092 Bacteria 1020
494 Ga0373945_0112569 3300035116 Bacteria 1075
495 Ga0373956_0119610 3300035119 Bacteria 1230
496 Ga0373943_0082234 3300035170 Bacteria 1653
497 Ga0373946_0099075 3300035171 Bacteria 1304
498 Ga0373962_0001639 3300035242 Bacteria 5317
499 Ga0316574_0015641 3300035398 Bacteria 4405
500 Ga0316574_0043236 3300035398 Bacteria 2783
501 Ga0316574_0059311 3300035398 Bacteria 2399
502 Ga0373931_0000260 3300035691 Bacteria 22370
503 Ga0373931_0028974 3300035691 Bacteria 2839
504 Ga0373935_0065291 3300035692 Bacteria 2335
505 Ga0373935_0615488 3300035692 Bacteria 795
506 Ga0373927_0060638 3300035695 Bacteria 2448
507 Ga0373933_0223940 3300035724 Bacteria 1207
508 Ga0373937_0027943 3300036401 Bacteria 5103
509 Ga0373937_0087637 3300036401 Bacteria 2881
510 Ga0373937_0226235 3300036401 Bacteria 1761
511 Ga0316582_0017329 3300036647 Bacteria 4166
512 Ga0316582_0036645 3300036647 Bacteria 3036
513 Ga0316582_0073926 3300036647 Bacteria 2212
514 Ga0316582_0098789 3300036647 Bacteria 1931
515 Ga0316582_0104622 3300036647 Bacteria 1878
516 Ga0316584_0002067 3300036712 Bacteria 12562
517 Ga0316584_0022483 3300036712 Bacteria 4600
518 Ga0316584_0031702 3300036712 Bacteria 3908
519 Ga0316584_0122487 3300036712 Bacteria 1943
520 Ga0373925_0011748 3300037068 Bacteria 6335
521 Ga0395900_0000050 3300037418 Bacteria 224616
522 Ga0395900_0057423 3300037418 Bacteria 4007
523 Ga0395900_0109551 3300037418 Bacteria 2837
524 Ga0395898_0018211 3300037466 Bacteria 7164
525 Ga0395898_0045803 3300037466 Bacteria 4298
526 Ga0395905_0001984 3300037471 Bacteria 23384
527 Ga0395905_0021036 3300037471 Bacteria 6177
528 Ga0395905_0054913 3300037471 Bacteria 3727
529 Ga0395905_0074130 3300037471 Bacteria 3189
530 Ga0395905_0083715 3300037471 Bacteria 2988
531 Ga0395905_0216943 3300037471 Bacteria 1791
532 Ga0395905_0932681 3300037471 Bacteria 771
533 Ga0316581_0001404 3300037588 Bacteria 5390
534 Ga0316581_0061952 3300037588 Bacteria 1148
535 Ga0395901_0005935 3300038443 Bacteria 12368
536 Ga0400490_53799 3300038726 Bacteria 5451
537 Ga0400483_116466 3300039062 Bacteria 2991
538 Ga0400483_153861 3300039062 Bacteria 1239
539 Ga0400483_169795 3300039062 Bacteria 1587
540 Ga0400483_261695 3300039062 Bacteria 4592
541 Ga0436361_0067190 3300039447 Bacteria 38460
542 Ga0436361_0289802 3300039447 Bacteria 31851
543 Ga0436361_0468389 3300039447 Bacteria 14150
544 Ga0436361_0487065 3300039447 Bacteria 63556
545 Ga0436361_0523658 3300039447 Bacteria 15267
546 Ga0436361_0793974 3300039447 Bacteria 3498
547 Ga0436361_1187211 3300039447 Bacteria 1956
548 Ga0439461_0006640 3300041410 Bacteria 2021
549 Ga0451789_1169945 3300041443 Bacteria 2373
550 Ga0451795_0862134 3300041456 Bacteria 1556
551 Ga0451800_0159027 3300041459 Bacteria 5820
552 Ga0451807_0815480 3300041486 Bacteria 2399
553 Ga0451841_0507876 3300041498 Bacteria 1791
554 Ga0451841_0721882 3300041498 Bacteria 2389
555 Ga0451849_0043210 3300041505 Bacteria 2036
556 Ga0451843_1622809 3300041509 Bacteria 1021
557 Ga0451855_0114897 3300041511 Bacteria 976
558 Ga0451855_1766368 3300041511 Bacteria 1905
559 Ga0451853_0386608 3300041512 Bacteria 1355
560 Ga0451853_1984386 3300041512 Bacteria 1287
561 Ga0451853_3443936 3300041512 Bacteria 1901
562 Ga0439433_0035997 3300041999 Bacteria 1143
563 Ga0439437_003217 3300042000 Bacteria 1760
564 Ga0439437_010466 3300042000 Bacteria 1055
565 Ga0439455_0014352 3300042012 Bacteria 1807
566 Ga0439462_0021267 3300042015 Bacteria 1694
567 Ga0450915_002431 3300042119 Bacteria 976
568 Ga0450917_000643 3300042120 Bacteria 2588
569 Ga0450888_000372 3300042126 Bacteria 4255
570 Ga0450890_000265 3300042127 Bacteria 7730
571 Ga0450891_000172 3300042129 Bacteria 6204
572 Ga0450892_000369 3300042130 Bacteria 5357
573 Ga0450896_018074 3300042133 Bacteria 1020
574 Ga0450898_023118 3300042134 Bacteria 1104
575 Ga0450889_000724 3300042144 Bacteria 3546
576 Ga0439434_0044632 3300042435 Bacteria 1366
577 Ga0439444_0011246 3300042437 Bacteria 1446
578 Ga0439459_0042217 3300042438 Bacteria 973
579 Ga0450916_000410 3300042530 Bacteria 3654
580 Ga0450893_0001970 3300042532 Bacteria 3192
581 Ga0451577_0006813 3300042876 Bacteria 11324
582 Ga0451577_0008542 3300042876 Bacteria 9962
583 Ga0451577_0011170 3300042876 Bacteria 8518
584 Ga0451577_0065013 3300042876 Bacteria 3253
585 Ga0451577_0083129 3300042876 Bacteria 2856
586 Ga0451577_0448281 3300042876 Bacteria 1172
587 Ga0466969_0002013 3300044656 Bacteria 10849
588 Ga0466969_0008421 3300044656 Bacteria 5469
589 Ga0466969_0041626 3300044656 Bacteria 2297
590 Ga0466972_0035699 3300044658 Bacteria 2433
591 Ga0466965_0011163 3300044683 Bacteria 4205
592 Ga0466965_0029198 3300044683 Bacteria 2682
593 Ga0466965_0107718 3300044683 Bacteria 1430
594 Ga0466966_0010218 3300044684 Bacteria 6226
595 Ga0466966_0021661 3300044684 Bacteria 4219
596 Ga0466966_0023898 3300044684 Bacteria 3999
597 Ga0466966_0048250 3300044684 Bacteria 2712
598 Ga0466966_0113306 3300044684 Bacteria 1670
599 Ga0466961_0002200 3300044693 Bacteria 12137
600 Ga0466961_0033437 3300044693 Bacteria 3303
601 Ga0466961_0051535 3300044693 Bacteria 2628
602 Ga0466961_0071277 3300044693 Bacteria 2205
603 Ga0466963_0073113 3300044694 Bacteria 2311
604 Ga0466963_0108794 3300044694 Bacteria 1901
605 Ga0466964_0007954 3300044706 Bacteria 3969
606 Ga0453684_0000891 3300044712 Bacteria 99637
607 Ga0453684_0013441 3300044712 Bacteria 13293
608 Ga0453684_0079940 3300044712 Bacteria 4085
609 Ga0453684_0194566 3300044712 Bacteria 2369
610 Ga0453684_0209467 3300044712 Bacteria 2267
611 Ga0453684_0271033 3300044712 Bacteria 1940
612 Ga0453684_0390796 3300044712 Bacteria 1560
613 Ga0466971_0032473 3300044719 Bacteria 2339
614 Ga0466971_0260961 3300044719 Bacteria 826
615 Ga0466968_0117575 3300044735 Bacteria 1201
616 Ga0466970_0014719 3300044765 Bacteria 4019
617 Ga0466970_0019679 3300044765 Bacteria 3501
618 Ga0466970_0028610 3300044765 Bacteria 2930
619 Ga0466970_0054537 3300044765 Bacteria 2135
620 Ga0466957_0019735 3300044842 Bacteria 3966
621 Ga0466957_0068719 3300044842 Bacteria 2187
622 Ga0466957_0320190 3300044842 Bacteria 1046
623 Ga0466957_0436436 3300044842 Bacteria 900
624 Ga0466960_0087023 3300044901 Bacteria 1585
625 Ga0466959_0000027 3300045049 Bacteria 114262
626 Ga0466959_0003256 3300045049 Bacteria 10576
627 Ga0466959_0005465 3300045049 Bacteria 8705
628 Ga0466959_0014466 3300045049 Bacteria 5734
629 Ga0466959_0032734 3300045049 Bacteria 3848
630 Ga0451576_0032100 3300045051 Bacteria 5596
631 Ga0451576_0054395 3300045051 Bacteria 4191
632 Ga0451576_0104294 3300045051 Bacteria 2949
633 Ga0451576_0234542 3300045051 Bacteria 1916
634 Ga0466958_0033144 3300045836 Bacteria 3076
635 Ga0466967_0179837 3300045976 Bacteria 1994
636 Ga0466967_0353636 3300045976 Bacteria 1422
637 Ga0495617_135186 3300046452 Bacteria 789
638 Ga0495590_0064940 3300046457 Bacteria 1277
639 Ga0495650_0006230 3300046471 Bacteria 7478
640 Ga0495650_0019004 3300046471 Bacteria 3398
641 Ga0495583_0000418 3300046506 Bacteria 64708
642 Ga0495606_0007392 3300046507 Bacteria 9850
643 Ga0495610_0074407 3300046512 Bacteria 1576
644 Ga0495620_0043096 3300046515 Bacteria 1968
645 Ga0495628_0097515 3300046516 Bacteria 2271
646 Ga0495632_0002445 3300046519 Bacteria 14134
647 Ga0495632_0011605 3300046519 Bacteria 5132
648 Ga0495632_0083743 3300046519 Bacteria 1518
649 Ga0495643_0039998 3300046522 Bacteria 2562
650 Ga0495643_0180498 3300046522 Bacteria 1026
651 Ga0495648_0096955 3300046524 Bacteria 1637
652 Ga0495652_0223422 3300046529 Bacteria 1414
653 Ga0495586_0063537 3300046535 Bacteria 2011
654 Ga0495621_0149453 3300046539 Bacteria 918
655 Ga0495597_0002628 3300046542 Bacteria 11179
656 Ga0495597_0026800 3300046542 Bacteria 2647
657 Ga0495668_0011498 3300046616 Bacteria 5300
658 Ga0495668_0164594 3300046616 Bacteria 1215
659 Ga0495625_0001715 3300046660 Bacteria 25497
660 Ga0495625_0009435 3300046660 Bacteria 8165
661 Ga0495625_0019481 3300046660 Bacteria 5262
662 Ga0495625_0120764 3300046660 Bacteria 1783
663 Ga0495658_0142213 3300046683 Bacteria 1468
664 Ga0495670_0014940 3300046691 Bacteria 3822
665 Ga0495649_0000190 3300046694 Bacteria 53998
666 Ga0495649_0000800 3300046694 Bacteria 25336
667 Ga0495589_0007457 3300046794 Bacteria 5733
668 Ga0495687_001857 3300047443 Bacteria 18408
669 Ga0495686_0006525 3300047472 Bacteria 8909
670 Ga0495686_0057069 3300047472 Bacteria 2438
671 Ga0496101_0050543 3300048904 Bacteria 2993
672 Ga0496101_0480860 3300048904 Bacteria 981
673 Ga0496102_0050044 3300048905 Bacteria 3804
674 Ga0496104_0154554 3300048907 Bacteria 2202
675 Ga0496104_0300495 3300048907 Bacteria 1517
676 Ga0496105_0080052 3300048908 Bacteria 2698
677 Ga0496105_0469671 3300048908 Bacteria 991
678 Ga0496106_0010561 3300048909 Bacteria 6819
679 Ga0496107_0074769 3300048910 Bacteria 2465
680 Ga0496108_0039727 3300048911 Bacteria 3921
681 Ga0496108_0180959 3300048911 Bacteria 1826
682 Ga0496108_0248772 3300048911 Bacteria 1546
683 Ga0496108_0274243 3300048911 Bacteria 1468
684 Ga0496109_0066126 3300048912 Bacteria 3310
685 Ga0496109_0108502 3300048912 Bacteria 2580
686 Ga0496109_0204329 3300048912 Bacteria 1857
687 Ga0496109_0411156 3300048912 Bacteria 1278
688 Ga0496109_0532072 3300048912 Bacteria 1109
689 Ga0496110_0060393 3300048913 Bacteria 3343
690 Ga0496110_0112931 3300048913 Bacteria 2443
691 Ga0496111_0044391 3300048914 Bacteria 3195
692 Ga0496112_0036230 3300048915 Bacteria 4811
693 Ga0496113_0017705 3300048916 Bacteria 4953
694 Ga0496113_0063308 3300048916 Bacteria 2795
695 Ga0496114_0026475 3300048917 Bacteria 4748
696 Ga0496114_0147788 3300048917 Bacteria 2038
697 Ga0496115_0142416 3300048918 Bacteria 1978
698 Ga0496117_0000085 3300048920 Bacteria 213887
699 Ga0496122_0052463 3300048925 Bacteria 3086
700 Ga0496124_0000138 3300048927 Bacteria 150311
701 Ga0496124_0006369 3300048927 Bacteria 12875
702 Ga0496125_0011386 3300048928 Bacteria 8902
703 Ga0496125_0012796 3300048928 Bacteria 8295
704 Ga0496126_0045349 3300048929 Bacteria 4041
705 Ga0496126_0207546 3300048929 Bacteria 1651
706 Ga0501291_003045 3300049514 Bacteria 2064
707 Ga0501294_002448 3300049517 Bacteria 1758
708 Ga0501298_012118 3300049521 Bacteria 1507
709 Ga0501298_031299 3300049521 Bacteria 1045
710 Ga0501300_003243 3300049523 Bacteria 2427
711 Ga0501303_008263 3300049526 Bacteria 943
712 Ga0501032_0032467 3300049569 Bacteria 3578
713 Ga0501034_0076879 3300049571 Bacteria 3345
714 Ga0501034_0110846 3300049571 Bacteria 2735
715 Ga0501036_0006094 3300049572 Bacteria 9784
716 Ga0501037_0068934 3300049573 Bacteria 2575
717 Ga0501037_0078713 3300049573 Bacteria 2392
718 Ga0501039_0192315 3300049575 Bacteria 1604
719 Ga0501041_0186085 3300049577 Bacteria 1300
720 Ga0501043_0000057 3300049579 Bacteria 103997
721 Ga0501046_0000075 3300049580 Bacteria 104000
722 Ga0501046_0113370 3300049580 Bacteria 2070
723 Ga0501047_0000081 3300049581 Bacteria 122697
724 Ga0501047_0152540 3300049581 Bacteria 2186
725 Ga0501048_0001541 3300049582 Bacteria 17500
726 Ga0501048_0002402 3300049582 Bacteria 14287
727 Ga0501069_0098540 3300049585 Bacteria 1658
728 Ga0501071_0202865 3300049587 Bacteria 1490
729 Ga0501072_0088589 3300049588 Bacteria 2456
730 Ga0501072_0104170 3300049588 Bacteria 2256
731 Ga0501073_0129806 3300049589 Bacteria 1747
732 Ga0501074_0107221 3300049590 Bacteria 2000
733 Ga0501075_0040136 3300049591 Bacteria 3504
734 Ga0501076_0060774 3300049592 Bacteria 3007
735 Ga0501076_0069483 3300049592 Bacteria 2814
736 Ga0501198_000019 3300049649 Bacteria 83282
737 Ga0501206_003348 3300049653 Bacteria 2037
738 Ga0501211_001454 3300049658 Bacteria 2531
739 Ga0501217_005212 3300049661 Bacteria 2709
740 Ga0501222_000055 3300049662 Bacteria 42112
741 Ga0501222_003040 3300049662 Bacteria 2306
742 Ga0501227_005676 3300049665 Bacteria 2674
743 Ga0501233_006530 3300049668 Bacteria 2193
744 Ga0501235_014796 3300049669 Bacteria 1719
745 Ga0501249_020722 3300049679 Bacteria 1431
746 Ga0501252_011662 3300049682 Bacteria 1054
747 Ga0501253_007968 3300049683 Bacteria 1503
748 Ga0501258_000573 3300049687 Bacteria 2579
749 Ga0501221_001517 3300049704 Bacteria 3842
750 Ga0501079_0156538 3300049741 Bacteria 1776
751 Ga0501080_0185109 3300049742 Bacteria 1915
752 Ga0501081_0134729 3300049743 Bacteria 1767
753 Ga0501081_0261315 3300049743 Bacteria 1265
754 Ga0501232_002654 3300049757 Bacteria 1572
755 Ga0501262_001172 3300049759 Bacteria 2971
756 Ga0501262_001821 3300049759 Bacteria 2392
757 Ga0501264_003691 3300049761 Bacteria 1393
758 Ga0501265_001469 3300049762 Bacteria 2654
759 Ga0501265_005476 3300049762 Bacteria 1464
760 Ga0501269_002119 3300049766 Bacteria 2483
761 Ga0501270_005045 3300049767 Bacteria 1515
762 Ga0501272_001810 3300049769 Bacteria 2079
763 Ga0501035_0103197 3300049822 Bacteria 2501
764 Ga0501044_0229639 3300049823 Bacteria 1804
765 Ga0501045_0004857 3300049824 Bacteria 9302
766 Ga0501045_0228984 3300049824 Bacteria 1383
767 nmdc:mga03683_45721_c1 3300050489 Bacteria 1813
768 nmdc:mga03683_7493_c1 3300050489 Bacteria 3791
769 nmdc:mga03n38_27067_c1 3300050490 Bacteria 2374
770 nmdc:mga03n38_61427_c1 3300050490 Bacteria 1711
771 nmdc:mga03n38_9432_c1 3300050490 Bacteria 3552
772 nmdc:mga00v17_2803_c1 3300050491 Bacteria 8956
773 nmdc:mga00v17_391104_c1 3300050491 Bacteria 904
774 nmdc:mga0yw44_112497_c1 3300050492 Bacteria 1746
775 nmdc:mga0yw44_16241_c1 3300050492 Bacteria 4017
776 nmdc:mga0k408_138_c1 3300050493 Bacteria 36717
777 nmdc:mga0k408_1503_c1 3300050493 Bacteria 12602
778 nmdc:mga0k408_17436_c1 3300050493 Bacteria 4002
779 nmdc:mga0k408_225617_c1 3300050493 Bacteria 1118
780 nmdc:mga0k408_278272_c1 3300050493 Bacteria 999
781 nmdc:mga0k408_28998_c1 3300050493 Bacteria 3148
782 nmdc:mga0k408_29319_c1 3300050493 Bacteria 3131
783 nmdc:mga0k408_391_c1 3300050493 Bacteria 24032
784 nmdc:mga0k408_39510_c1 3300050493 Bacteria 2712
785 nmdc:mga0k408_45856_c1 3300050493 Bacteria 1615
786 nmdc:mga0k408_4715_c1 3300050493 Bacteria 6796
787 nmdc:mga0k408_48568_c1 3300050493 Bacteria 2455
788 nmdc:mga0k408_576_c1 3300050493 Bacteria 20303
789 nmdc:mga0k408_70079_c1 3300050493 Bacteria 2046
790 nmdc:mga0k408_8073_c1 3300050493 Bacteria 5642
791 nmdc:mga0k408_99455_c1 3300050493 Bacteria 1714
792 nmdc:mga06z11_19649_c1 3300050494 Bacteria 3110
793 nmdc:mga06z11_3638_c1 3300050494 Bacteria 5982
794 nmdc:mga06z11_61362_c1 3300050494 Bacteria 1961
795 nmdc:mga04h51_26992_c1 3300050495 Bacteria 1780
796 nmdc:mga07m45_1014_c1 3300050496 Bacteria 12410
797 nmdc:mga07m45_10764_c1 3300050496 Bacteria 4788
798 nmdc:mga07m45_18749_c1 3300050496 Bacteria 3742
799 nmdc:mga07m45_25133_c1 3300050496 Bacteria 3265
800 nmdc:mga07m45_27982_c1 3300050496 Bacteria 3110
801 nmdc:mga07m45_4479_c1 3300050496 Bacteria 6834
802 nmdc:mga07m45_45267_c1 3300050496 Bacteria 2471
803 nmdc:mga07m45_47048_c1 3300050496 Bacteria 2425
804 nmdc:mga07m45_47676_c1 3300050496 Bacteria 2409
805 nmdc:mga07m45_84631_c1 3300050496 Bacteria 1813
806 nmdc:mga05p37_170801_c1 3300050507 Bacteria 2651
807 nmdc:mga09592_25399_c1 3300050508 Bacteria 4903
808 nmdc:mga09592_277117_c1 3300050508 Bacteria 1455
809 nmdc:mga09592_390009_c1 3300050508 Bacteria 1204
810 nmdc:mga0qj67_143761_c1 3300050509 Bacteria 1471
811 nmdc:mga0qj67_145158_c1 3300050509 Bacteria 1924
812 nmdc:mga0qj67_151419_c1 3300050509 Bacteria 1882
813 nmdc:mga0qj67_23042_c1 3300050509 Bacteria 4786
814 nmdc:mga0qj67_38364_c1 3300050509 Bacteria 3758
815 nmdc:mga06r32_20794_c1 3300050510 Bacteria 6047
816 nmdc:mga06r32_240838_c1 3300050510 Bacteria 1797
817 nmdc:mga06r32_49789_c1 3300050510 Bacteria 4008
818 nmdc:mga06r32_79528_c1 3300050510 Bacteria 3189
819 nmdc:mga0n895_303551_c1 3300050512 Bacteria 1618
820 nmdc:mga0rr50_216183_c1 3300050513 Bacteria 1581
821 nmdc:mga0sz30_14739_c1 3300050516 Bacteria 3082
822 Ga0500578_0001946 3300053086 Bacteria 18890
823 Ga0500578_0368828 3300053086 Bacteria 835
824 Ga0500583_0053617 3300053092 Bacteria 1881
825 Ga0500651_0153797 3300053093 Bacteria 1379
826 Ga0500617_050552 3300053124 Bacteria 1855
827 Ga0500658_0000910 3300053134 Bacteria 12105
828 Ga0500568_0001825 3300053139 Bacteria 13115
829 Ga0500568_0006034 3300053139 Bacteria 6151
830 Ga0500568_0006270 3300053139 Bacteria 5998
831 Ga0500590_015680 3300053148 Bacteria 3912
832 Ga0500622_0000002 3300053156 Bacteria 646442
833 Ga0500622_0000124 3300053156 Bacteria 81245
834 Ga0500622_0002040 3300053156 Bacteria 15063
835 Ga0500622_0085555 3300053156 Bacteria 1572
836 Ga0500636_0011155 3300053177 Bacteria 5257
837 Ga0466962_0003926 3300061719 Bacteria 7114
838 Ga0466962_0026079 3300061719 Bacteria 2806
839 Ga0530510_0048089 3300061734 Bacteria 3083

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0932681 Ga0395905_0932681_12_653 210
2 3300041511 Ga0451855_0114897 Ga0451855_0114897_200_841 210
3 3300042134 Ga0450898_023118 Ga0450898_023118_449_1090 210
4 3300046452 Ga0495617_135186 Ga0495617_135186_69_773 231
5 iso_pu_bacteria 2585428057 2587728282 239
6 iso_pu_bacteria 2585428058 2587734512 239
7 iso_pu_bacteria 2585428062 2587754222 239
8 iso_pu_bacteria 2588253510 2588294999 239
9 iso_pu_bacteria 2643221544 2643744999 239
10 iso_pu_bacteria 2643221585 2643937251 239
11 iso_pu_bacteria 2643221592 2643971153 239
12 iso_pu_bacteria 2643221625 2644142081 239
13 iso_pu_bacteria 2643221639 2644222759 239
14 iso_pu_bacteria 2643221646 2644260680 239
15 iso_pu_bacteria 2643221648 2644276306 239
16 iso_pu_bacteria 2643221656 2644318416 239
17 iso_pu_bacteria 2643221660 2644338167 239
18 iso_pu_bacteria 2738541337 2739058944 239
19 iso_pu_bacteria 2738543013 2739248293 239
20 iso_pu_bacteria 2831864461 2831869221 239
21 iso_pu_bacteria 2842718218 2842718742 239
22 iso_pu_bacteria 2886848708 2886849788 239
23 iso_pu_bacteria 2894023352 2894024358 239
24 iso_pu_bacteria 2928115317 2928120682 239
25 iso_pu_bacteria 2939631187 2939634175 239
26 3300005354 Ga0070675_100161539 Ga0070675_1001615392 240
27 3300005455 Ga0070663_100188316 Ga0070663_1001883162 240
28 3300005616 Ga0068852_100078758 Ga0068852_1000787582 240
29 3300025926 Ga0207659_10212084 Ga0207659_102120842 240
30 3300025933 Ga0207706_10052927 Ga0207706_100529274 240
31 3300025940 Ga0207691_10279656 Ga0207691_102796562 240
32 3300026067 Ga0207678_10305128 Ga0207678_103051282 240
33 iso_pu_bacteria 2846033681 2846035002 240
34 iso_pu_bacteria 2846037992 2846040680 240
35 iso_pu_bacteria 2998344455 2998345777 240
36 3300002737 JGI25162J39368_1000116 JGI25162J39368_100011619 241
37 3300031251 Ga0265327_10000002 Ga0265327_10000002134 241
38 3300031665 Ga0316575_10010424 Ga0316575_100104243 241
39 3300031691 Ga0316579_10005735 Ga0316579_100057353 241
40 3300031727 Ga0316576_10003481 Ga0316576_100034819 241
41 3300031727 Ga0316576_10014142 Ga0316576_100141423 241
42 3300031727 Ga0316576_10202953 Ga0316576_102029532 241
43 3300031727 Ga0316576_10260442 Ga0316576_102604422 241
44 3300031728 Ga0316578_10016657 Ga0316578_100166573 241
45 3300031728 Ga0316578_10039269 Ga0316578_100392693 241
46 3300031728 Ga0316578_10119612 Ga0316578_101196122 241
47 3300031728 Ga0316578_10170422 Ga0316578_101704222 241
48 3300032137 Ga0316585_10002582 Ga0316585_100025825 241
49 3300032168 Ga0316593_10098971 Ga0316593_100989712 241
50 3300035398 Ga0316574_0015641 Ga0316574_0015641_1606_2352 241
51 3300035398 Ga0316574_0043236 Ga0316574_0043236_1332_2081 241
52 3300035398 Ga0316574_0059311 Ga0316574_0059311_1400_2149 241
53 3300036647 Ga0316582_0036645 Ga0316582_0036645_2107_2853 241
54 3300036647 Ga0316582_0073926 Ga0316582_0073926_782_1528 241
55 3300036647 Ga0316582_0098789 Ga0316582_0098789_971_1720 241
56 3300036647 Ga0316582_0104622 Ga0316582_0104622_403_1149 241
57 3300036712 Ga0316584_0002067 Ga0316584_0002067_6931_7677 241
58 3300036712 Ga0316584_0022483 Ga0316584_0022483_3791_4540 241
59 3300036712 Ga0316584_0031702 Ga0316584_0031702_2830_3576 241
60 3300036712 Ga0316584_0122487 Ga0316584_0122487_1033_1779 241
61 3300037588 Ga0316581_0001404 Ga0316581_0001404_2608_3354 241
62 3300037588 Ga0316581_0061952 Ga0316581_0061952_321_1067 241
63 3300046794 Ga0495589_0007457 Ga0495589_0007457_3496_4221 241
64 3300048920 Ga0496117_0000085 Ga0496117_0000085_185362_186114 241
65 3300049569 Ga0501032_0032467 Ga0501032_0032467_2527_3264 241
66 3300049572 Ga0501036_0006094 Ga0501036_0006094_475_1212 241
67 3300049573 Ga0501037_0078713 Ga0501037_0078713_1517_2254 241
68 3300049575 Ga0501039_0192315 Ga0501039_0192315_545_1282 241
69 3300049577 Ga0501041_0186085 Ga0501041_0186085_257_994 241
70 3300049580 Ga0501046_0113370 Ga0501046_0113370_578_1315 241
71 3300049582 Ga0501048_0002402 Ga0501048_0002402_390_1127 241
72 3300049585 Ga0501069_0098540 Ga0501069_0098540_393_1130 241
73 3300049587 Ga0501071_0202865 Ga0501071_0202865_306_1043 241
74 3300049588 Ga0501072_0088589 Ga0501072_0088589_811_1548 241
75 3300049588 Ga0501072_0104170 Ga0501072_0104170_372_1112 241
76 3300049589 Ga0501073_0129806 Ga0501073_0129806_329_1066 241
77 3300049590 Ga0501074_0107221 Ga0501074_0107221_387_1124 241
78 3300049591 Ga0501075_0040136 Ga0501075_0040136_455_1192 241
79 3300049592 Ga0501076_0060774 Ga0501076_0060774_1264_2004 241
80 3300049592 Ga0501076_0069483 Ga0501076_0069483_134_871 241
81 3300049741 Ga0501079_0156538 Ga0501079_0156538_93_833 241
82 3300049742 Ga0501080_0185109 Ga0501080_0185109_877_1614 241
83 3300049743 Ga0501081_0134729 Ga0501081_0134729_474_1211 241
84 3300049743 Ga0501081_0261315 Ga0501081_0261315_343_1083 241
85 3300049822 Ga0501035_0103197 Ga0501035_0103197_923_1660 241
86 3300049824 Ga0501045_0228984 Ga0501045_0228984_295_1032 241
87 3300061734 Ga0530510_0048089 Ga0530510_0048089_558_1295 241
88 iso_pu_bacteria 2585427591 2585829077 241
89 iso_pu_bacteria 2585427592 2585833849 241
90 iso_pu_bacteria 2667528173 2671110839 241
91 iso_pu_bacteria 2904474040 2904478699 241
92 iso_pu_bacteria 2919150387 2919154807 241
93 iso_pu_bacteria 2927143783 2927148391 241
94 3300005356 Ga0070674_100207170 Ga0070674_1002071701 242
95 3300005364 Ga0070673_100193550 Ga0070673_1001935502 242
96 3300005456 Ga0070678_100090868 Ga0070678_1000908683 242
97 3300025937 Ga0207669_10037308 Ga0207669_100373083 242
98 3300025960 Ga0207651_10165931 Ga0207651_101659312 242
99 3300026121 Ga0207683_10161002 Ga0207683_101610022 242
100 3300028379 Ga0268266_10506353 Ga0268266_105063532 242
101 3300037418 Ga0395900_0109551 Ga0395900_0109551_1475_2227 242
102 3300039062 Ga0400483_116466 Ga0400483_116466_148_909 242
103 3300039062 Ga0400483_153861 Ga0400483_153861_158_919 242
104 3300049571 Ga0501034_0076879 Ga0501034_0076879_774_1502 242
105 3300053139 Ga0500568_0006034 Ga0500568_0006034_790_1548 242
106 iso_pu_bacteria 2643221570 2643867785 242
107 iso_pu_bacteria 2816332133 2816470487 242
108 2162886007 SwRhRL2b_contig_2970801 SwRhRL2b_0219.00004240 243
109 3300002774 JGI25150J39212_1003355 JGI25150J39212_10033552 243
110 3300003215 JGI25153J46596_10007422 JGI25153J46596_100074222 243
111 3300003215 JGI25153J46596_10007578 JGI25153J46596_100075787 243
112 3300003322 rootL2_10000310 rootL2_1000031024 243
113 3300003323 rootH1_10233163 rootH1_102331632 243
114 3300003752 Ga0055539_1000431 Ga0055539_10004318 243
115 3300003752 Ga0055539_1007041 Ga0055539_10070412 243
116 3300003756 Ga0055533_1000053 Ga0055533_1000053144 243
117 3300003759 Ga0055525_1000904 Ga0055525_10009045 243
118 3300003771 Ga0055526_1000968 Ga0055526_10009686 243
119 3300003771 Ga0055526_1001006 Ga0055526_10010068 243
120 3300003775 Ga0055524_1000999 Ga0055524_10009998 243
121 3300003784 Ga0055534_1001237 Ga0055534_10012374 243
122 3300003792 Ga0055540_1011662 Ga0055540_10116623 243
123 3300003794 Ga0055531_10000007 Ga0055531_10000007112 243
124 3300003794 Ga0055531_10003852 Ga0055531_100038527 243
125 3300003794 Ga0055531_10019372 Ga0055531_100193723 243
126 3300003794 Ga0055531_10045285 Ga0055531_100452852 243
127 3300004625 Ga0055543_1001427 Ga0055543_10014274 243
128 3300004625 Ga0055543_1034367 Ga0055543_10343671 243
129 3300005262 Ga0065165_1000101 Ga0065165_10001017 243
130 3300005262 Ga0065165_1000248 Ga0065165_10002485 243
131 3300005289 Ga0065704_10000497 Ga0065704_100004979 243
132 3300005289 Ga0065704_10129202 Ga0065704_101292021 243
133 3300005295 Ga0065707_10001158 Ga0065707_100011584 243
134 3300005327 Ga0070658_10083243 Ga0070658_100832432 243
135 3300005327 Ga0070658_10096192 Ga0070658_100961922 243
136 3300005327 Ga0070658_10312642 Ga0070658_103126422 243
137 3300005328 Ga0070676_10006495 Ga0070676_100064953 243
138 3300005328 Ga0070676_10006926 Ga0070676_100069263 243
139 3300005328 Ga0070676_10037254 Ga0070676_100372543 243
140 3300005329 Ga0070683_100076771 Ga0070683_1000767712 243
141 3300005329 Ga0070683_100332058 Ga0070683_1003320582 243
142 3300005333 Ga0070677_10009652 Ga0070677_100096523 243
143 3300005333 Ga0070677_10044355 Ga0070677_100443553 243
144 3300005334 Ga0068869_100005147 Ga0068869_1000051474 243
145 3300005334 Ga0068869_100392569 Ga0068869_1003925692 243
146 3300005335 Ga0070666_10246702 Ga0070666_102467022 243
147 3300005336 Ga0070680_100071876 Ga0070680_1000718763 243
148 3300005337 Ga0070682_100267722 Ga0070682_1002677222 243
149 3300005338 Ga0068868_100012109 Ga0068868_1000121094 243
150 3300005338 Ga0068868_100025002 Ga0068868_1000250022 243
151 3300005338 Ga0068868_100028442 Ga0068868_1000284426 243
152 3300005339 Ga0070660_100049846 Ga0070660_1000498462 243
153 3300005339 Ga0070660_100301603 Ga0070660_1003016032 243
154 3300005339 Ga0070660_100317437 Ga0070660_1003174372 243
155 3300005339 Ga0070660_100610211 Ga0070660_1006102111 243
156 3300005344 Ga0070661_100022742 Ga0070661_1000227423 243
157 3300005344 Ga0070661_100450930 Ga0070661_1004509301 243
158 3300005347 Ga0070668_100040154 Ga0070668_1000401543 243
159 3300005347 Ga0070668_100243705 Ga0070668_1002437052 243
160 3300005353 Ga0070669_100063844 Ga0070669_1000638442 243
161 3300005354 Ga0070675_100007192 Ga0070675_1000071923 243
162 3300005354 Ga0070675_100026729 Ga0070675_1000267292 243
163 3300005354 Ga0070675_100172546 Ga0070675_1001725463 243
164 3300005354 Ga0070675_100324667 Ga0070675_1003246672 243
165 3300005355 Ga0070671_100013893 Ga0070671_1000138934 243
166 3300005355 Ga0070671_100027654 Ga0070671_1000276545 243
167 3300005355 Ga0070671_100098197 Ga0070671_1000981973 243
168 3300005355 Ga0070671_100162338 Ga0070671_1001623383 243
169 3300005355 Ga0070671_100199894 Ga0070671_1001998941 243
170 3300005355 Ga0070671_100403812 Ga0070671_1004038122 243
171 3300005364 Ga0070673_100093533 Ga0070673_1000935332 243
172 3300005366 Ga0070659_100027006 Ga0070659_1000270063 243
173 3300005366 Ga0070659_100062436 Ga0070659_1000624363 243
174 3300005366 Ga0070659_100088337 Ga0070659_1000883372 243
175 3300005367 Ga0070667_100660309 Ga0070667_1006603091 243
176 3300005435 Ga0070714_100097912 Ga0070714_1000979123 243
177 3300005440 Ga0070705_100310254 Ga0070705_1003102541 243
178 3300005455 Ga0070663_100028153 Ga0070663_1000281534 243
179 3300005457 Ga0070662_100005330 Ga0070662_1000053304 243
180 3300005457 Ga0070662_100013586 Ga0070662_1000135864 243
181 3300005457 Ga0070662_100272547 Ga0070662_1002725472 243
182 3300005457 Ga0070662_100383280 Ga0070662_1003832802 243
183 3300005457 Ga0070662_100600127 Ga0070662_1006001271 243
184 3300005459 Ga0068867_100006378 Ga0068867_1000063783 243
185 3300005459 Ga0068867_100014086 Ga0068867_1000140863 243
186 3300005459 Ga0068867_100029474 Ga0068867_1000294744 243
187 3300005459 Ga0068867_100292722 Ga0068867_1002927222 243
188 3300005467 Ga0070706_100037499 Ga0070706_1000374994 243
189 3300005467 Ga0070706_100186751 Ga0070706_1001867512 243
190 3300005468 Ga0070707_100175509 Ga0070707_1001755092 243
191 3300005471 Ga0070698_100340322 Ga0070698_1003403222 243
192 3300005518 Ga0070699_100029409 Ga0070699_1000294094 243
193 3300005518 Ga0070699_100612276 Ga0070699_1006122761 243
194 3300005530 Ga0070679_100018762 Ga0070679_1000187627 243
195 3300005535 Ga0070684_100080387 Ga0070684_1000803872 243
196 3300005539 Ga0068853_100182902 Ga0068853_1001829022 243
197 3300005539 Ga0068853_100311735 Ga0068853_1003117352 243
198 3300005543 Ga0070672_100004996 Ga0070672_1000049962 243
199 3300005543 Ga0070672_100050827 Ga0070672_1000508273 243
200 3300005543 Ga0070672_100452725 Ga0070672_1004527252 243
201 3300005545 Ga0070695_100058360 Ga0070695_1000583604 243
202 3300005545 Ga0070695_100105044 Ga0070695_1001050443 243
203 3300005547 Ga0070693_100036952 Ga0070693_1000369523 243
204 3300005547 Ga0070693_100041815 Ga0070693_1000418153 243
205 3300005548 Ga0070665_100013839 Ga0070665_1000138391 243
206 3300005549 Ga0070704_100084717 Ga0070704_1000847171 243
207 3300005563 Ga0068855_100001666 Ga0068855_10000166619 243
208 3300005563 Ga0068855_100060304 Ga0068855_1000603042 243
209 3300005564 Ga0070664_100087852 Ga0070664_1000878522 243
210 3300005564 Ga0070664_100523731 Ga0070664_1005237312 243
211 3300005577 Ga0068857_100011579 Ga0068857_1000115794 243
212 3300005577 Ga0068857_100014155 Ga0068857_1000141556 243
213 3300005577 Ga0068857_100131344 Ga0068857_1001313442 243
214 3300005577 Ga0068857_100190736 Ga0068857_1001907363 243
215 3300005578 Ga0068854_100032592 Ga0068854_1000325923 243
216 3300005578 Ga0068854_100111998 Ga0068854_1001119983 243
217 3300005578 Ga0068854_100336745 Ga0068854_1003367452 243
218 3300005615 Ga0070702_100026472 Ga0070702_1000264722 243
219 3300005616 Ga0068852_100007330 Ga0068852_1000073304 243
220 3300005617 Ga0068859_100428221 Ga0068859_1004282212 243
221 3300005618 Ga0068864_100047443 Ga0068864_1000474434 243
222 3300005618 Ga0068864_100075435 Ga0068864_1000754352 243
223 3300005618 Ga0068864_100083214 Ga0068864_1000832141 243
224 3300005618 Ga0068864_100411348 Ga0068864_1004113481 243
225 3300005718 Ga0068866_10111336 Ga0068866_101113362 243
226 3300005719 Ga0068861_100015862 Ga0068861_1000158622 243
227 3300005719 Ga0068861_100016866 Ga0068861_1000168664 243
228 3300005719 Ga0068861_100027593 Ga0068861_1000275932 243
229 3300005834 Ga0068851_10017778 Ga0068851_100177782 243
230 3300005834 Ga0068851_10027355 Ga0068851_100273552 243
231 3300005834 Ga0068851_10027907 Ga0068851_100279072 243
232 3300005840 Ga0068870_10004536 Ga0068870_100045364 243
233 3300005840 Ga0068870_10203407 Ga0068870_102034072 243
234 3300005840 Ga0068870_10316003 Ga0068870_103160031 243
235 3300005842 Ga0068858_100047944 Ga0068858_1000479443 243
236 3300005843 Ga0068860_100038773 Ga0068860_1000387732 243
237 3300005843 Ga0068860_100175972 Ga0068860_1001759722 243
238 3300005844 Ga0068862_100007493 Ga0068862_1000074934 243
239 3300005844 Ga0068862_100010025 Ga0068862_1000100254 243
240 3300006038 Ga0075365_10010595 Ga0075365_100105954 243
241 3300006038 Ga0075365_10011756 Ga0075365_100117563 243
242 3300006038 Ga0075365_10057991 Ga0075365_100579913 243
243 3300006038 Ga0075365_10129439 Ga0075365_101294391 243
244 3300006042 Ga0075368_10009568 Ga0075368_100095683 243
245 3300006042 Ga0075368_10011904 Ga0075368_100119042 243
246 3300006048 Ga0075363_100001576 Ga0075363_1000015765 243
247 3300006048 Ga0075363_100073123 Ga0075363_1000731232 243
248 3300006051 Ga0075364_10003493 Ga0075364_100034931 243
249 3300006051 Ga0075364_10056862 Ga0075364_100568622 243
250 3300006058 Ga0075432_10000664 Ga0075432_1000066410 243
251 3300006177 Ga0075362_10001003 Ga0075362_100010036 243
252 3300006177 Ga0075362_10003169 Ga0075362_100031694 243
253 3300006177 Ga0075362_10036688 Ga0075362_100366882 243
254 3300006178 Ga0075367_10001551 Ga0075367_100015513 243
255 3300006178 Ga0075367_10036117 Ga0075367_100361173 243
256 3300006178 Ga0075367_10073721 Ga0075367_100737212 243
257 3300006186 Ga0075369_10020411 Ga0075369_100204113 243
258 3300006195 Ga0075366_10000468 Ga0075366_100004689 243
259 3300006195 Ga0075366_10054153 Ga0075366_100541532 243
260 3300006195 Ga0075366_10054888 Ga0075366_100548882 243
261 3300006195 Ga0075366_10088851 Ga0075366_100888512 243
262 3300006195 Ga0075366_10133564 Ga0075366_101335642 243
263 3300006195 Ga0075366_10227281 Ga0075366_102272812 243
264 3300006237 Ga0097621_100009602 Ga0097621_1000096023 243
265 3300006237 Ga0097621_100167233 Ga0097621_1001672332 243
266 3300006353 Ga0075370_10000108 Ga0075370_1000010825 243
267 3300006353 Ga0075370_10000350 Ga0075370_100003509 243
268 3300006353 Ga0075370_10011293 Ga0075370_100112935 243
269 3300006353 Ga0075370_10018852 Ga0075370_100188523 243
270 3300006353 Ga0075370_10018907 Ga0075370_100189074 243
271 3300006353 Ga0075370_10024698 Ga0075370_100246984 243
272 3300006358 Ga0068871_100011636 Ga0068871_1000116366 243
273 3300006844 Ga0075428_100045856 Ga0075428_1000458562 243
274 3300006844 Ga0075428_100097261 Ga0075428_1000972613 243
275 3300006846 Ga0075430_100012192 Ga0075430_1000121925 243
276 3300006846 Ga0075430_100041086 Ga0075430_1000410864 243
277 3300006847 Ga0075431_100002923 Ga0075431_1000029234 243
278 3300006847 Ga0075431_100030939 Ga0075431_1000309393 243
279 3300006847 Ga0075431_100044445 Ga0075431_1000444452 243
280 3300006871 Ga0075434_100107882 Ga0075434_1001078824 243
281 3300006880 Ga0075429_100003081 Ga0075429_1000030813 243
282 3300006880 Ga0075429_100128970 Ga0075429_1001289703 243
283 3300006881 Ga0068865_100031426 Ga0068865_1000314264 243
284 3300006881 Ga0068865_100084377 Ga0068865_1000843773 243
285 3300006931 Ga0097620_100428181 Ga0097620_1004281812 243
286 3300006944 Ga0099823_1000075 Ga0099823_10000752 243
287 3300009092 Ga0105250_10000004 Ga0105250_1000000412 243
288 3300009093 Ga0105240_10281860 Ga0105240_102818603 243
289 3300009093 Ga0105240_10932554 Ga0105240_109325541 243
290 3300009094 Ga0111539_10174509 Ga0111539_101745092 243
291 3300009098 Ga0105245_10011588 Ga0105245_100115883 243
292 3300009098 Ga0105245_10023648 Ga0105245_100236484 243
293 3300009098 Ga0105245_10111571 Ga0105245_101115712 243
294 3300009098 Ga0105245_10664617 Ga0105245_106646172 243
295 3300009148 Ga0105243_10012663 Ga0105243_100126635 243
296 3300009148 Ga0105243_10025933 Ga0105243_100259334 243
297 3300009148 Ga0105243_10044521 Ga0105243_100445213 243
298 3300009148 Ga0105243_10397397 Ga0105243_103973972 243
299 3300009174 Ga0105241_10078048 Ga0105241_100780483 243
300 3300009176 Ga0105242_10009898 Ga0105242_100098986 243
301 3300009176 Ga0105242_10563802 Ga0105242_105638021 243
302 3300009176 Ga0105242_10571267 Ga0105242_105712672 243
303 3300009176 Ga0105242_11120328 Ga0105242_111203281 243
304 3300009177 Ga0105248_10002698 Ga0105248_1000269812 243
305 3300009177 Ga0105248_10014653 Ga0105248_100146535 243
306 3300009177 Ga0105248_10131168 Ga0105248_101311682 243
307 3300009545 Ga0105237_10023104 Ga0105237_100231043 243
308 3300009551 Ga0105238_10070932 Ga0105238_100709323 243
309 3300009553 Ga0105249_10061695 Ga0105249_100616952 243
310 3300010159 Ga0099796_10013861 Ga0099796_100138613 243
311 3300010375 Ga0105239_10654159 Ga0105239_106541591 243
312 3300012497 Ga0157319_1000008 Ga0157319_1000008182 243
313 3300013100 Ga0157373_10121303 Ga0157373_101213033 243
314 3300013102 Ga0157371_10312940 Ga0157371_103129402 243
315 3300013105 Ga0157369_10072223 Ga0157369_100722232 243
316 3300013296 Ga0157374_10012925 Ga0157374_100129253 243
317 3300013296 Ga0157374_10048033 Ga0157374_100480333 243
318 3300013296 Ga0157374_10087753 Ga0157374_100877533 243
319 3300013297 Ga0157378_10149245 Ga0157378_101492453 243
320 3300013307 Ga0157372_10023923 Ga0157372_100239233 243
321 3300013307 Ga0157372_10080912 Ga0157372_100809123 243
322 3300013307 Ga0157372_10947375 Ga0157372_109473752 243
323 3300013308 Ga0157375_10016951 Ga0157375_100169513 243
324 3300013308 Ga0157375_10028320 Ga0157375_100283206 243
325 3300013308 Ga0157375_10183738 Ga0157375_101837382 243
326 3300013308 Ga0157375_10957849 Ga0157375_109578491 243
327 3300014326 Ga0157380_10079544 Ga0157380_100795442 243
328 3300014326 Ga0157380_10725396 Ga0157380_107253961 243
329 3300014326 Ga0157380_10969088 Ga0157380_109690881 243
330 3300014968 Ga0157379_10000729 Ga0157379_1000072918 243
331 3300014968 Ga0157379_10036452 Ga0157379_100364523 243
332 3300014968 Ga0157379_10121245 Ga0157379_101212452 243
333 3300014969 Ga0157376_10028980 Ga0157376_100289803 243
334 3300014969 Ga0157376_10862522 Ga0157376_108625221 243
335 3300021361 Ga0213872_10000093 Ga0213872_1000009357 243
336 3300021361 Ga0213872_10000339 Ga0213872_100003398 243
337 3300021361 Ga0213872_10000508 Ga0213872_100005088 243
338 3300021361 Ga0213872_10003642 Ga0213872_100036428 243
339 3300021361 Ga0213872_10062011 Ga0213872_100620112 243
340 3300021361 Ga0213872_10145770 Ga0213872_101457702 243
341 3300025226 Ga0209674_100039 Ga0209674_10003950 243
342 3300025230 Ga0209563_100013 Ga0209563_100013502 243
343 3300025230 Ga0209563_100080 Ga0209563_10008050 243
344 3300025231 Ga0207427_101227 Ga0207427_1012274 243
345 3300025245 Ga0207425_1000540 Ga0207425_100054017 243
346 3300025250 Ga0209026_1019054 Ga0209026_10190542 243
347 3300025253 Ga0209677_100086 Ga0209677_10008650 243
348 3300025253 Ga0209677_101082 Ga0209677_10108212 243
349 3300025256 Ga0209759_1003908 Ga0209759_10039085 243
350 3300025256 Ga0209759_1006233 Ga0209759_10062336 243
351 3300025256 Ga0209759_1012837 Ga0209759_10128374 243
352 3300025258 Ga0209129_1000027 Ga0209129_1000027108 243
353 3300025273 Ga0209673_1007822 Ga0209673_10078223 243
354 3300025273 Ga0209673_1023535 Ga0209673_10235353 243
355 3300025284 Ga0209130_1005108 Ga0209130_10051082 243
356 3300025291 Ga0209675_1003613 Ga0209675_10036134 243
357 3300025292 Ga0209676_1011901 Ga0209676_10119013 243
358 3300025294 Ga0209025_1080447 Ga0209025_10804471 243
359 3300025295 Ga0209564_1000008 Ga0209564_1000008556 243
360 3300025295 Ga0209564_1000139 Ga0209564_100013999 243
361 3300025297 Ga0209758_1000052 Ga0209758_100005212 243
362 3300025297 Ga0209758_1000146 Ga0209758_100014677 243
363 3300025298 Ga0209050_1000165 Ga0209050_1000165108 243
364 3300025298 Ga0209050_1003503 Ga0209050_10035033 243
365 3300025298 Ga0209050_1007646 Ga0209050_10076464 243
366 3300025299 Ga0209256_1000450 Ga0209256_100045036 243
367 3300025299 Ga0209256_1002818 Ga0209256_100281810 243
368 3300025303 Ga0209051_1000960 Ga0209051_10009606 243
369 3300025303 Ga0209051_1001306 Ga0209051_100130616 243
370 3300025303 Ga0209051_1001911 Ga0209051_10019118 243
371 3300025303 Ga0209051_1003358 Ga0209051_10033582 243
372 3300025303 Ga0209051_1017387 Ga0209051_10173872 243
373 3300025303 Ga0209051_1029773 Ga0209051_10297732 243
374 3300025303 Ga0209051_1031375 Ga0209051_10313753 243
375 3300025304 Ga0209257_1000021 Ga0209257_1000021116 243
376 3300025304 Ga0209257_1002089 Ga0209257_10020898 243
377 3300025304 Ga0209257_1003471 Ga0209257_10034718 243
378 3300025304 Ga0209257_1008791 Ga0209257_10087913 243
379 3300025304 Ga0209257_1015805 Ga0209257_10158054 243
380 3300025304 Ga0209257_1022940 Ga0209257_10229403 243
381 3300025321 Ga0207656_10015553 Ga0207656_100155532 243
382 3300025711 Ga0207696_1000056 Ga0207696_100005612 243
383 3300025893 Ga0207682_10006671 Ga0207682_100066713 243
384 3300025899 Ga0207642_10076128 Ga0207642_100761282 243
385 3300025903 Ga0207680_10152913 Ga0207680_101529133 243
386 3300025903 Ga0207680_10296234 Ga0207680_102962342 243
387 3300025903 Ga0207680_10334783 Ga0207680_103347832 243
388 3300025906 Ga0207699_10011916 Ga0207699_100119163 243
389 3300025907 Ga0207645_10003365 Ga0207645_100033654 243
390 3300025907 Ga0207645_10017173 Ga0207645_100171736 243
391 3300025907 Ga0207645_10020521 Ga0207645_100205213 243
392 3300025907 Ga0207645_10042506 Ga0207645_100425063 243
393 3300025907 Ga0207645_10098862 Ga0207645_100988623 243
394 3300025908 Ga0207643_10013594 Ga0207643_100135945 243
395 3300025908 Ga0207643_10072199 Ga0207643_100721993 243
396 3300025908 Ga0207643_10206318 Ga0207643_102063182 243
397 3300025909 Ga0207705_10019660 Ga0207705_100196606 243
398 3300025909 Ga0207705_10031396 Ga0207705_100313963 243
399 3300025909 Ga0207705_10127325 Ga0207705_101273252 243
400 3300025910 Ga0207684_10032013 Ga0207684_100320133 243
401 3300025910 Ga0207684_10108651 Ga0207684_101086512 243
402 3300025913 Ga0207695_10032446 Ga0207695_100324462 243
403 3300025913 Ga0207695_10062546 Ga0207695_100625462 243
404 3300025913 Ga0207695_10108859 Ga0207695_101088592 243
405 3300025914 Ga0207671_10029878 Ga0207671_100298783 243
406 3300025917 Ga0207660_10022584 Ga0207660_100225843 243
407 3300025918 Ga0207662_10170728 Ga0207662_101707282 243
408 3300025919 Ga0207657_10028179 Ga0207657_100281794 243
409 3300025919 Ga0207657_10056950 Ga0207657_100569502 243
410 3300025920 Ga0207649_10137159 Ga0207649_101371592 243
411 3300025922 Ga0207646_10073049 Ga0207646_100730492 243
412 3300025923 Ga0207681_10008706 Ga0207681_100087064 243
413 3300025923 Ga0207681_10056233 Ga0207681_100562332 243
414 3300025924 Ga0207694_10085822 Ga0207694_100858223 243
415 3300025925 Ga0207650_10020768 Ga0207650_100207684 243
416 3300025926 Ga0207659_10002055 Ga0207659_100020559 243
417 3300025926 Ga0207659_10086804 Ga0207659_100868044 243
418 3300025926 Ga0207659_10290240 Ga0207659_102902401 243
419 3300025927 Ga0207687_10051425 Ga0207687_100514253 243
420 3300025927 Ga0207687_10098633 Ga0207687_100986333 243
421 3300025927 Ga0207687_10127772 Ga0207687_101277723 243
422 3300025927 Ga0207687_10772859 Ga0207687_107728591 243
423 3300025929 Ga0207664_10069180 Ga0207664_100691803 243
424 3300025931 Ga0207644_10000130 Ga0207644_1000013030 243
425 3300025931 Ga0207644_10055786 Ga0207644_100557863 243
426 3300025931 Ga0207644_10089739 Ga0207644_100897394 243
427 3300025931 Ga0207644_10166814 Ga0207644_101668141 243
428 3300025932 Ga0207690_10091070 Ga0207690_100910702 243
429 3300025932 Ga0207690_10210446 Ga0207690_102104462 243
430 3300025932 Ga0207690_10231906 Ga0207690_102319062 243
431 3300025933 Ga0207706_10006516 Ga0207706_100065165 243
432 3300025933 Ga0207706_10012430 Ga0207706_100124306 243
433 3300025933 Ga0207706_10175376 Ga0207706_101753762 243
434 3300025933 Ga0207706_10395719 Ga0207706_103957192 243
435 3300025934 Ga0207686_10008348 Ga0207686_100083485 243
436 3300025934 Ga0207686_10013174 Ga0207686_100131743 243
437 3300025934 Ga0207686_10655153 Ga0207686_106551531 243
438 3300025934 Ga0207686_10686202 Ga0207686_106862021 243
439 3300025935 Ga0207709_10293772 Ga0207709_102937721 243
440 3300025938 Ga0207704_10029131 Ga0207704_100291313 243
441 3300025938 Ga0207704_10080820 Ga0207704_100808202 243
442 3300025940 Ga0207691_10007829 Ga0207691_1000782910 243
443 3300025940 Ga0207691_10010432 Ga0207691_100104323 243
444 3300025940 Ga0207691_10140544 Ga0207691_101405442 243
445 3300025940 Ga0207691_10204670 Ga0207691_102046702 243
446 3300025941 Ga0207711_10002256 Ga0207711_1000225612 243
447 3300025941 Ga0207711_10005210 Ga0207711_100052103 243
448 3300025941 Ga0207711_10018486 Ga0207711_100184863 243
449 3300025941 Ga0207711_10080376 Ga0207711_100803761 243
450 3300025942 Ga0207689_10001818 Ga0207689_1000181815 243
451 3300025942 Ga0207689_10007166 Ga0207689_100071663 243
452 3300025942 Ga0207689_10036462 Ga0207689_100364622 243
453 3300025944 Ga0207661_10242244 Ga0207661_102422442 243
454 3300025945 Ga0207679_10150484 Ga0207679_101504842 243
455 3300025949 Ga0207667_10156804 Ga0207667_101568043 243
456 3300025960 Ga0207651_10099340 Ga0207651_100993403 243
457 3300025961 Ga0207712_10116224 Ga0207712_101162241 243
458 3300025961 Ga0207712_10159131 Ga0207712_101591312 243
459 3300025972 Ga0207668_10073256 Ga0207668_100732562 243
460 3300025981 Ga0207640_10354970 Ga0207640_103549701 243
461 3300025981 Ga0207640_10385132 Ga0207640_103851322 243
462 3300025981 Ga0207640_10405351 Ga0207640_104053512 243
463 3300026023 Ga0207677_10004871 Ga0207677_100048714 243
464 3300026023 Ga0207677_10193732 Ga0207677_101937322 243
465 3300026041 Ga0207639_10057980 Ga0207639_100579803 243
466 3300026041 Ga0207639_10063590 Ga0207639_100635903 243
467 3300026041 Ga0207639_10854018 Ga0207639_108540181 243
468 3300026067 Ga0207678_10000893 Ga0207678_1000089323 243
469 3300026067 Ga0207678_10052208 Ga0207678_100522082 243
470 3300026067 Ga0207678_10193534 Ga0207678_101935343 243
471 3300026075 Ga0207708_10006241 Ga0207708_100062418 243
472 3300026078 Ga0207702_10096506 Ga0207702_100965062 243
473 3300026078 Ga0207702_10209824 Ga0207702_102098242 243
474 3300026088 Ga0207641_10043137 Ga0207641_100431373 243
475 3300026089 Ga0207648_10001919 Ga0207648_100019194 243
476 3300026089 Ga0207648_10010004 Ga0207648_100100043 243
477 3300026089 Ga0207648_10022574 Ga0207648_100225743 243
478 3300026089 Ga0207648_10233624 Ga0207648_102336242 243
479 3300026095 Ga0207676_10202777 Ga0207676_102027772 243
480 3300026095 Ga0207676_10225067 Ga0207676_102250672 243
481 3300026116 Ga0207674_10002708 Ga0207674_1000270817 243
482 3300026116 Ga0207674_10023986 Ga0207674_100239864 243
483 3300026116 Ga0207674_10037550 Ga0207674_100375505 243
484 3300026118 Ga0207675_100000180 Ga0207675_10000018055 243
485 3300026118 Ga0207675_100004669 Ga0207675_1000046694 243
486 3300026118 Ga0207675_100007765 Ga0207675_1000077656 243
487 3300026118 Ga0207675_100222807 Ga0207675_1002228072 243
488 3300026121 Ga0207683_10118253 Ga0207683_101182532 243
489 3300026121 Ga0207683_10156334 Ga0207683_101563342 243
490 3300026142 Ga0207698_10006282 Ga0207698_100062822 243
491 3300027296 Ga0209389_1000249 Ga0209389_10002492 243
492 3300027312 Ga0209371_1021935 Ga0209371_10219352 243
493 3300027395 Ga0209996_1003340 Ga0209996_10033403 243
494 3300027395 Ga0209996_1022132 Ga0209996_10221321 243
495 3300027424 Ga0209984_1012034 Ga0209984_10120342 243
496 3300027471 Ga0209995_1019473 Ga0209995_10194731 243
497 3300027526 Ga0209968_1003253 Ga0209968_10032533 243
498 3300027552 Ga0209982_1004919 Ga0209982_10049192 243
499 3300027552 Ga0209982_1029463 Ga0209982_10294631 243
500 3300027614 Ga0209970_1000108 Ga0209970_10001085 243
501 3300027617 Ga0210002_1000559 Ga0210002_10005595 243
502 3300027665 Ga0209983_1000495 Ga0209983_10004956 243
503 3300027682 Ga0209971_1000131 Ga0209971_10001318 243
504 3300027695 Ga0209966_1000231 Ga0209966_100023114 243
505 3300027717 Ga0209998_10000211 Ga0209998_100002118 243
506 3300027876 Ga0209974_10001553 Ga0209974_100015539 243
507 3300027876 Ga0209974_10002942 Ga0209974_100029424 243
508 3300027876 Ga0209974_10035157 Ga0209974_100351572 243
509 3300028380 Ga0268265_10103724 Ga0268265_101037242 243
510 3300028380 Ga0268265_10243263 Ga0268265_102432632 243
511 3300028381 Ga0268264_10040974 Ga0268264_100409744 243
512 3300028381 Ga0268264_10077487 Ga0268264_100774872 243
513 3300028573 Ga0265334_10000020 Ga0265334_1000002084 243
514 3300028573 Ga0265334_10056560 Ga0265334_100565602 243
515 3300028666 Ga0265336_10000014 Ga0265336_1000001480 243
516 3300028786 Ga0307517_10116350 Ga0307517_101163502 243
517 3300028794 Ga0307515_10000472 Ga0307515_1000047276 243
518 3300028794 Ga0307515_10001966 Ga0307515_1000196628 243
519 3300028794 Ga0307515_10009632 Ga0307515_100096328 243
520 3300028794 Ga0307515_10013614 Ga0307515_100136148 243
521 3300028794 Ga0307515_10014298 Ga0307515_100142984 243
522 3300028794 Ga0307515_10026472 Ga0307515_100264723 243
523 3300028794 Ga0307515_10102753 Ga0307515_101027534 243
524 3300028794 Ga0307515_10323601 Ga0307515_103236012 243
525 3300028794 Ga0307515_10356691 Ga0307515_103566912 243
526 3300029957 Ga0265324_10006580 Ga0265324_100065804 243
527 3300030500 Ga0268256_1024691 Ga0268256_10246912 243
528 3300030521 Ga0307511_10053633 Ga0307511_100536335 243
529 3300030731 Ga0316177_1136770 Ga0316177_11367705 243
530 3300030744 Ga0316181_1026598 Ga0316181_10265982 243
531 3300031235 Ga0265330_10000046 Ga0265330_1000004625 243
532 3300031235 Ga0265330_10015352 Ga0265330_100153522 243
533 3300031238 Ga0265332_10000028 Ga0265332_1000002887 243
534 3300031239 Ga0265328_10032372 Ga0265328_100323722 243
535 3300031241 Ga0265325_10009170 Ga0265325_100091705 243
536 3300031242 Ga0265329_10045902 Ga0265329_100459023 243
537 3300031251 Ga0265327_10000500 Ga0265327_1000050051 243
538 3300031251 Ga0265327_10000916 Ga0265327_1000091634 243
539 3300031251 Ga0265327_10006214 Ga0265327_100062146 243
540 3300031344 Ga0265316_10000225 Ga0265316_1000022542 243
541 3300031456 Ga0307513_10000838 Ga0307513_100008388 243
542 3300031456 Ga0307513_10083483 Ga0307513_100834832 243
543 3300031456 Ga0307513_10109471 Ga0307513_101094712 243
544 3300031456 Ga0307513_10118564 Ga0307513_101185642 243
545 3300031507 Ga0307509_10000978 Ga0307509_100009789 243
546 3300031507 Ga0307509_10034507 Ga0307509_100345076 243
547 3300031507 Ga0307509_10140560 Ga0307509_101405603 243
548 3300031507 Ga0307509_10267678 Ga0307509_102676782 243
549 3300031548 Ga0307408_100000023 Ga0307408_100000023101 243
550 3300031548 Ga0307408_100027684 Ga0307408_1000276843 243
551 3300031548 Ga0307408_100337361 Ga0307408_1003373612 243
552 3300031595 Ga0265313_10000148 Ga0265313_1000014812 243
553 3300031595 Ga0265313_10084038 Ga0265313_100840381 243
554 3300031616 Ga0307508_10000404 Ga0307508_100004046 243
555 3300031649 Ga0307514_10009282 Ga0307514_100092824 243
556 3300031711 Ga0265314_10000054 Ga0265314_1000005487 243
557 3300031711 Ga0265314_10001039 Ga0265314_1000103927 243
558 3300031727 Ga0316576_10015838 Ga0316576_100158384 243
559 3300031730 Ga0307516_10000190 Ga0307516_1000019013 243
560 3300031730 Ga0307516_10001586 Ga0307516_1000158619 243
561 3300031730 Ga0307516_10001919 Ga0307516_100019194 243
562 3300031730 Ga0307516_10002741 Ga0307516_1000274113 243
563 3300031731 Ga0307405_10282062 Ga0307405_102820622 243
564 3300031852 Ga0307410_10108924 Ga0307410_101089243 243
565 3300033179 Ga0307507_10008591 Ga0307507_100085917 243
566 3300033180 Ga0307510_10225541 Ga0307510_102255411 243
567 3300034817 Ga0373948_0001870 Ga0373948_0001870_260_991 243
568 3300034820 Ga0373959_0002670 Ga0373959_0002670_1358_2089 243
569 3300035084 Ga0373928_0070628 Ga0373928_0070628_12_743 243
570 3300035090 Ga0373949_0020409 Ga0373949_0020409_464_1201 243
571 3300035091 Ga0373951_0006594 Ga0373951_0006594_1037_1768 243
572 3300035092 Ga0373952_0046530 Ga0373952_0046530_18_755 243
573 3300035116 Ga0373945_0112569 Ga0373945_0112569_248_982 243
574 3300035119 Ga0373956_0119610 Ga0373956_0119610_148_882 243
575 3300035170 Ga0373943_0082234 Ga0373943_0082234_126_860 243
576 3300035171 Ga0373946_0099075 Ga0373946_0099075_490_1224 243
577 3300035242 Ga0373962_0001639 Ga0373962_0001639_3095_3826 243
578 3300035691 Ga0373931_0000260 Ga0373931_0000260_3613_4344 243
579 3300035691 Ga0373931_0028974 Ga0373931_0028974_1308_2045 243
580 3300035692 Ga0373935_0065291 Ga0373935_0065291_1431_2165 243
581 3300035692 Ga0373935_0615488 Ga0373935_0615488_31_762 243
582 3300035695 Ga0373927_0060638 Ga0373927_0060638_1535_2269 243
583 3300035724 Ga0373933_0223940 Ga0373933_0223940_401_1135 243
584 3300036401 Ga0373937_0027943 Ga0373937_0027943_1408_2142 243
585 3300036401 Ga0373937_0087637 Ga0373937_0087637_1950_2681 243
586 3300036401 Ga0373937_0226235 Ga0373937_0226235_821_1591 243
587 3300036647 Ga0316582_0017329 Ga0316582_0017329_1880_2671 243
588 3300037068 Ga0373925_0011748 Ga0373925_0011748_3578_4312 243
589 3300037418 Ga0395900_0000050 Ga0395900_0000050_116696_117427 243
590 3300037418 Ga0395900_0057423 Ga0395900_0057423_44_775 243
591 3300037466 Ga0395898_0018211 Ga0395898_0018211_2024_2755 243
592 3300037466 Ga0395898_0045803 Ga0395898_0045803_584_1315 243
593 3300037471 Ga0395905_0001984 Ga0395905_0001984_10876_11607 243
594 3300037471 Ga0395905_0021036 Ga0395905_0021036_1845_2576 243
595 3300037471 Ga0395905_0054913 Ga0395905_0054913_1587_2318 243
596 3300037471 Ga0395905_0074130 Ga0395905_0074130_210_941 243
597 3300037471 Ga0395905_0083715 Ga0395905_0083715_444_1175 243
598 3300037471 Ga0395905_0216943 Ga0395905_0216943_418_1149 243
599 3300038443 Ga0395901_0005935 Ga0395901_0005935_4097_4828 243
600 3300038726 Ga0400490_53799 Ga0400490_53799_1391_2128 243
601 3300039062 Ga0400483_169795 Ga0400483_169795_602_1339 243
602 3300039062 Ga0400483_261695 Ga0400483_261695_86_838 243
603 3300039447 Ga0436361_0067190 Ga0436361_0067190_14021_14755 243
604 3300039447 Ga0436361_0289802 Ga0436361_0289802_6232_6963 243
605 3300039447 Ga0436361_0468389 Ga0436361_0468389_7381_8112 243
606 3300039447 Ga0436361_0487065 Ga0436361_0487065_58537_59268 243
607 3300039447 Ga0436361_0523658 Ga0436361_0523658_1314_2045 243
608 3300039447 Ga0436361_0793974 Ga0436361_0793974_1842_2573 243
609 3300039447 Ga0436361_1187211 Ga0436361_1187211_379_1110 243
610 3300041410 Ga0439461_0006640 Ga0439461_0006640_610_1341 243
611 3300041443 Ga0451789_1169945 Ga0451789_1169945_798_1529 243
612 3300041456 Ga0451795_0862134 Ga0451795_0862134_814_1545 243
613 3300041459 Ga0451800_0159027 Ga0451800_0159027_1286_2017 243
614 3300041486 Ga0451807_0815480 Ga0451807_0815480_1273_2004 243
615 3300041498 Ga0451841_0507876 Ga0451841_0507876_479_1210 243
616 3300041498 Ga0451841_0721882 Ga0451841_0721882_666_1436 243
617 3300041505 Ga0451849_0043210 Ga0451849_0043210_461_1231 243
618 3300041509 Ga0451843_1622809 Ga0451843_1622809_144_875 243
619 3300041511 Ga0451855_1766368 Ga0451855_1766368_1114_1845 243
620 3300041512 Ga0451853_0386608 Ga0451853_0386608_60_791 243
621 3300041512 Ga0451853_1984386 Ga0451853_1984386_83_814 243
622 3300041512 Ga0451853_3443936 Ga0451853_3443936_363_1133 243
623 3300041999 Ga0439433_0035997 Ga0439433_0035997_277_1008 243
624 3300042000 Ga0439437_003217 Ga0439437_003217_478_1209 243
625 3300042000 Ga0439437_010466 Ga0439437_010466_276_1007 243
626 3300042012 Ga0439455_0014352 Ga0439455_0014352_409_1140 243
627 3300042015 Ga0439462_0021267 Ga0439462_0021267_609_1340 243
628 3300042119 Ga0450915_002431 Ga0450915_002431_205_936 243
629 3300042120 Ga0450917_000643 Ga0450917_000643_527_1258 243
630 3300042126 Ga0450888_000372 Ga0450888_000372_1444_2175 243
631 3300042127 Ga0450890_000265 Ga0450890_000265_2340_3170 243
632 3300042129 Ga0450891_000172 Ga0450891_000172_523_1254 243
633 3300042130 Ga0450892_000369 Ga0450892_000369_3564_4295 243
634 3300042133 Ga0450896_018074 Ga0450896_018074_133_912 243
635 3300042144 Ga0450889_000724 Ga0450889_000724_1798_2529 243
636 3300042435 Ga0439434_0044632 Ga0439434_0044632_94_825 243
637 3300042437 Ga0439444_0011246 Ga0439444_0011246_37_816 243
638 3300042438 Ga0439459_0042217 Ga0439459_0042217_70_900 243
639 3300042530 Ga0450916_000410 Ga0450916_000410_1410_2141 243
640 3300042532 Ga0450893_0001970 Ga0450893_0001970_2184_2915 243
641 3300042876 Ga0451577_0006813 Ga0451577_0006813_7280_8011 243
642 3300042876 Ga0451577_0008542 Ga0451577_0008542_3450_4238 243
643 3300042876 Ga0451577_0011170 Ga0451577_0011170_1080_1811 243
644 3300042876 Ga0451577_0065013 Ga0451577_0065013_890_1621 243
645 3300042876 Ga0451577_0083129 Ga0451577_0083129_735_1523 243
646 3300042876 Ga0451577_0448281 Ga0451577_0448281_82_813 243
647 3300044656 Ga0466969_0002013 Ga0466969_0002013_4761_5492 243
648 3300044656 Ga0466969_0008421 Ga0466969_0008421_1799_2530 243
649 3300044656 Ga0466969_0041626 Ga0466969_0041626_793_1524 243
650 3300044658 Ga0466972_0035699 Ga0466972_0035699_882_1613 243
651 3300044683 Ga0466965_0011163 Ga0466965_0011163_827_1558 243
652 3300044683 Ga0466965_0029198 Ga0466965_0029198_1052_1783 243
653 3300044683 Ga0466965_0107718 Ga0466965_0107718_41_772 243
654 3300044684 Ga0466966_0010218 Ga0466966_0010218_4273_5004 243
655 3300044684 Ga0466966_0021661 Ga0466966_0021661_1820_2551 243
656 3300044684 Ga0466966_0023898 Ga0466966_0023898_1198_1929 243
657 3300044684 Ga0466966_0048250 Ga0466966_0048250_433_1164 243
658 3300044684 Ga0466966_0113306 Ga0466966_0113306_414_1145 243
659 3300044693 Ga0466961_0002200 Ga0466961_0002200_875_1606 243
660 3300044693 Ga0466961_0033437 Ga0466961_0033437_2497_3228 243
661 3300044693 Ga0466961_0051535 Ga0466961_0051535_1875_2606 243
662 3300044693 Ga0466961_0071277 Ga0466961_0071277_265_996 243
663 3300044694 Ga0466963_0073113 Ga0466963_0073113_645_1376 243
664 3300044694 Ga0466963_0108794 Ga0466963_0108794_172_903 243
665 3300044706 Ga0466964_0007954 Ga0466964_0007954_1593_2324 243
666 3300044712 Ga0453684_0000891 Ga0453684_0000891_4968_5699 243
667 3300044712 Ga0453684_0013441 Ga0453684_0013441_2278_3009 243
668 3300044712 Ga0453684_0079940 Ga0453684_0079940_2405_3136 243
669 3300044712 Ga0453684_0194566 Ga0453684_0194566_1029_1772 243
670 3300044712 Ga0453684_0209467 Ga0453684_0209467_1203_1934 243
671 3300044712 Ga0453684_0271033 Ga0453684_0271033_308_1039 243
672 3300044712 Ga0453684_0390796 Ga0453684_0390796_633_1364 243
673 3300044719 Ga0466971_0032473 Ga0466971_0032473_1374_2105 243
674 3300044719 Ga0466971_0260961 Ga0466971_0260961_20_751 243
675 3300044735 Ga0466968_0117575 Ga0466968_0117575_366_1097 243
676 3300044765 Ga0466970_0014719 Ga0466970_0014719_1661_2392 243
677 3300044765 Ga0466970_0019679 Ga0466970_0019679_628_1359 243
678 3300044765 Ga0466970_0028610 Ga0466970_0028610_1255_1986 243
679 3300044765 Ga0466970_0054537 Ga0466970_0054537_509_1240 243
680 3300044842 Ga0466957_0019735 Ga0466957_0019735_2236_2967 243
681 3300044842 Ga0466957_0068719 Ga0466957_0068719_499_1230 243
682 3300044842 Ga0466957_0320190 Ga0466957_0320190_247_978 243
683 3300044842 Ga0466957_0436436 Ga0466957_0436436_119_850 243
684 3300044901 Ga0466960_0087023 Ga0466960_0087023_426_1157 243
685 3300045049 Ga0466959_0000027 Ga0466959_0000027_42826_43557 243
686 3300045049 Ga0466959_0003256 Ga0466959_0003256_4365_5096 243
687 3300045049 Ga0466959_0005465 Ga0466959_0005465_3468_4199 243
688 3300045049 Ga0466959_0014466 Ga0466959_0014466_3025_3756 243
689 3300045049 Ga0466959_0032734 Ga0466959_0032734_2077_2808 243
690 3300045051 Ga0451576_0032100 Ga0451576_0032100_2297_3028 243
691 3300045051 Ga0451576_0054395 Ga0451576_0054395_2280_3011 243
692 3300045051 Ga0451576_0104294 Ga0451576_0104294_1240_1983 243
693 3300045051 Ga0451576_0234542 Ga0451576_0234542_645_1382 243
694 3300045836 Ga0466958_0033144 Ga0466958_0033144_1471_2202 243
695 3300045976 Ga0466967_0179837 Ga0466967_0179837_1198_1929 243
696 3300045976 Ga0466967_0353636 Ga0466967_0353636_146_877 243
697 3300046457 Ga0495590_0064940 Ga0495590_0064940_346_1077 243
698 3300046471 Ga0495650_0006230 Ga0495650_0006230_5555_6286 243
699 3300046471 Ga0495650_0019004 Ga0495650_0019004_786_1517 243
700 3300046506 Ga0495583_0000418 Ga0495583_0000418_56980_57711 243
701 3300046507 Ga0495606_0007392 Ga0495606_0007392_819_1550 243
702 3300046512 Ga0495610_0074407 Ga0495610_0074407_447_1178 243
703 3300046515 Ga0495620_0043096 Ga0495620_0043096_997_1728 243
704 3300046516 Ga0495628_0097515 Ga0495628_0097515_1500_2234 243
705 3300046519 Ga0495632_0002445 Ga0495632_0002445_2699_3430 243
706 3300046519 Ga0495632_0011605 Ga0495632_0011605_4120_4851 243
707 3300046519 Ga0495632_0083743 Ga0495632_0083743_361_1092 243
708 3300046522 Ga0495643_0039998 Ga0495643_0039998_221_952 243
709 3300046522 Ga0495643_0180498 Ga0495643_0180498_107_838 243
710 3300046524 Ga0495648_0096955 Ga0495648_0096955_88_819 243
711 3300046529 Ga0495652_0223422 Ga0495652_0223422_591_1322 243
712 3300046535 Ga0495586_0063537 Ga0495586_0063537_391_1122 243
713 3300046539 Ga0495621_0149453 Ga0495621_0149453_164_895 243
714 3300046542 Ga0495597_0002628 Ga0495597_0002628_3896_4627 243
715 3300046542 Ga0495597_0026800 Ga0495597_0026800_954_1685 243
716 3300046616 Ga0495668_0011498 Ga0495668_0011498_2109_2840 243
717 3300046616 Ga0495668_0164594 Ga0495668_0164594_138_869 243
718 3300046660 Ga0495625_0001715 Ga0495625_0001715_1562_2293 243
719 3300046660 Ga0495625_0009435 Ga0495625_0009435_4713_5444 243
720 3300046660 Ga0495625_0019481 Ga0495625_0019481_2705_3436 243
721 3300046660 Ga0495625_0120764 Ga0495625_0120764_880_1611 243
722 3300046683 Ga0495658_0142213 Ga0495658_0142213_56_802 243
723 3300046691 Ga0495670_0014940 Ga0495670_0014940_2571_3302 243
724 3300046694 Ga0495649_0000190 Ga0495649_0000190_29065_29796 243
725 3300046694 Ga0495649_0000800 Ga0495649_0000800_2387_3118 243
726 3300047443 Ga0495687_001857 Ga0495687_001857_1861_2592 243
727 3300047472 Ga0495686_0006525 Ga0495686_0006525_1588_2319 243
728 3300047472 Ga0495686_0057069 Ga0495686_0057069_1048_1779 243
729 3300048904 Ga0496101_0050543 Ga0496101_0050543_627_1364 243
730 3300048904 Ga0496101_0480860 Ga0496101_0480860_229_960 243
731 3300048905 Ga0496102_0050044 Ga0496102_0050044_669_1406 243
732 3300048907 Ga0496104_0154554 Ga0496104_0154554_500_1237 243
733 3300048907 Ga0496104_0300495 Ga0496104_0300495_186_917 243
734 3300048908 Ga0496105_0080052 Ga0496105_0080052_542_1279 243
735 3300048908 Ga0496105_0469671 Ga0496105_0469671_154_885 243
736 3300048909 Ga0496106_0010561 Ga0496106_0010561_5594_6331 243
737 3300048910 Ga0496107_0074769 Ga0496107_0074769_908_1645 243
738 3300048911 Ga0496108_0039727 Ga0496108_0039727_486_1217 243
739 3300048911 Ga0496108_0180959 Ga0496108_0180959_692_1423 243
740 3300048911 Ga0496108_0248772 Ga0496108_0248772_184_915 243
741 3300048911 Ga0496108_0274243 Ga0496108_0274243_379_1110 243
742 3300048912 Ga0496109_0066126 Ga0496109_0066126_2231_2962 243
743 3300048912 Ga0496109_0108502 Ga0496109_0108502_588_1319 243
744 3300048912 Ga0496109_0204329 Ga0496109_0204329_914_1651 243
745 3300048912 Ga0496109_0411156 Ga0496109_0411156_492_1223 243
746 3300048912 Ga0496109_0532072 Ga0496109_0532072_226_957 243
747 3300048913 Ga0496110_0060393 Ga0496110_0060393_695_1432 243
748 3300048913 Ga0496110_0112931 Ga0496110_0112931_1287_2018 243
749 3300048914 Ga0496111_0044391 Ga0496111_0044391_2055_2792 243
750 3300048915 Ga0496112_0036230 Ga0496112_0036230_721_1452 243
751 3300048916 Ga0496113_0017705 Ga0496113_0017705_3802_4533 243
752 3300048916 Ga0496113_0063308 Ga0496113_0063308_1036_1773 243
753 3300048917 Ga0496114_0026475 Ga0496114_0026475_3451_4188 243
754 3300048917 Ga0496114_0147788 Ga0496114_0147788_496_1227 243
755 3300048918 Ga0496115_0142416 Ga0496115_0142416_283_1020 243
756 3300048925 Ga0496122_0052463 Ga0496122_0052463_508_1239 243
757 3300048927 Ga0496124_0000138 Ga0496124_0000138_31231_31962 243
758 3300048927 Ga0496124_0006369 Ga0496124_0006369_5333_6064 243
759 3300048928 Ga0496125_0011386 Ga0496125_0011386_2286_3017 243
760 3300048928 Ga0496125_0012796 Ga0496125_0012796_111_842 243
761 3300048929 Ga0496126_0045349 Ga0496126_0045349_836_1567 243
762 3300048929 Ga0496126_0207546 Ga0496126_0207546_31_762 243
763 3300049514 Ga0501291_003045 Ga0501291_003045_699_1430 243
764 3300049517 Ga0501294_002448 Ga0501294_002448_343_1074 243
765 3300049521 Ga0501298_012118 Ga0501298_012118_248_979 243
766 3300049521 Ga0501298_031299 Ga0501298_031299_249_980 243
767 3300049523 Ga0501300_003243 Ga0501300_003243_630_1361 243
768 3300049526 Ga0501303_008263 Ga0501303_008263_48_779 243
769 3300049571 Ga0501034_0110846 Ga0501034_0110846_658_1389 243
770 3300049573 Ga0501037_0068934 Ga0501037_0068934_483_1214 243
771 3300049579 Ga0501043_0000057 Ga0501043_0000057_50413_51144 243
772 3300049580 Ga0501046_0000075 Ga0501046_0000075_50413_51144 243
773 3300049581 Ga0501047_0000081 Ga0501047_0000081_50413_51144 243
774 3300049581 Ga0501047_0152540 Ga0501047_0152540_254_985 243
775 3300049582 Ga0501048_0001541 Ga0501048_0001541_1396_2127 243
776 3300049649 Ga0501198_000019 Ga0501198_000019_10669_11400 243
777 3300049653 Ga0501206_003348 Ga0501206_003348_50_781 243
778 3300049658 Ga0501211_001454 Ga0501211_001454_518_1249 243
779 3300049661 Ga0501217_005212 Ga0501217_005212_610_1341 243
780 3300049662 Ga0501222_000055 Ga0501222_000055_4319_5050 243
781 3300049662 Ga0501222_003040 Ga0501222_003040_80_811 243
782 3300049665 Ga0501227_005676 Ga0501227_005676_419_1150 243
783 3300049668 Ga0501233_006530 Ga0501233_006530_699_1430 243
784 3300049669 Ga0501235_014796 Ga0501235_014796_970_1701 243
785 3300049679 Ga0501249_020722 Ga0501249_020722_667_1398 243
786 3300049682 Ga0501252_011662 Ga0501252_011662_272_1003 243
787 3300049683 Ga0501253_007968 Ga0501253_007968_643_1374 243
788 3300049687 Ga0501258_000573 Ga0501258_000573_567_1298 243
789 3300049704 Ga0501221_001517 Ga0501221_001517_1080_1811 243
790 3300049757 Ga0501232_002654 Ga0501232_002654_354_1085 243
791 3300049759 Ga0501262_001172 Ga0501262_001172_813_1544 243
792 3300049759 Ga0501262_001821 Ga0501262_001821_656_1387 243
793 3300049761 Ga0501264_003691 Ga0501264_003691_105_836 243
794 3300049762 Ga0501265_001469 Ga0501265_001469_481_1212 243
795 3300049762 Ga0501265_005476 Ga0501265_005476_285_1016 243
796 3300049766 Ga0501269_002119 Ga0501269_002119_808_1539 243
797 3300049767 Ga0501270_005045 Ga0501270_005045_362_1093 243
798 3300049769 Ga0501272_001810 Ga0501272_001810_1039_1770 243
799 3300049823 Ga0501044_0229639 Ga0501044_0229639_593_1324 243
800 3300049824 Ga0501045_0004857 Ga0501045_0004857_7095_7826 243
801 3300050489 nmdc:mga03683_45721_c1 nmdc:mga03683_45721_c1_962_1693 243
802 3300050489 nmdc:mga03683_7493_c1 nmdc:mga03683_7493_c1_1770_2501 243
803 3300050490 nmdc:mga03n38_27067_c1 nmdc:mga03n38_27067_c1_1188_1919 243
804 3300050490 nmdc:mga03n38_61427_c1 nmdc:mga03n38_61427_c1_485_1216 243
805 3300050490 nmdc:mga03n38_9432_c1 nmdc:mga03n38_9432_c1_846_1577 243
806 3300050491 nmdc:mga00v17_2803_c1 nmdc:mga00v17_2803_c1_261_1037 243
807 3300050491 nmdc:mga00v17_391104_c1 nmdc:mga00v17_391104_c1_43_774 243
808 3300050492 nmdc:mga0yw44_112497_c1 nmdc:mga0yw44_112497_c1_746_1522 243
809 3300050492 nmdc:mga0yw44_16241_c1 nmdc:mga0yw44_16241_c1_2284_3015 243
810 3300050493 nmdc:mga0k408_138_c1 nmdc:mga0k408_138_c1_27847_28578 243
811 3300050493 nmdc:mga0k408_1503_c1 nmdc:mga0k408_1503_c1_9203_9934 243
812 3300050493 nmdc:mga0k408_17436_c1 nmdc:mga0k408_17436_c1_2081_2812 243
813 3300050493 nmdc:mga0k408_225617_c1 nmdc:mga0k408_225617_c1_189_920 243
814 3300050493 nmdc:mga0k408_278272_c1 nmdc:mga0k408_278272_c1_231_962 243
815 3300050493 nmdc:mga0k408_28998_c1 nmdc:mga0k408_28998_c1_1158_1889 243
816 3300050493 nmdc:mga0k408_29319_c1 nmdc:mga0k408_29319_c1_377_1207 243
817 3300050493 nmdc:mga0k408_391_c1 nmdc:mga0k408_391_c1_2845_3576 243
818 3300050493 nmdc:mga0k408_39510_c1 nmdc:mga0k408_39510_c1_1317_2048 243
819 3300050493 nmdc:mga0k408_45856_c1 nmdc:mga0k408_45856_c1_847_1578 243
820 3300050493 nmdc:mga0k408_4715_c1 nmdc:mga0k408_4715_c1_1875_2636 243
821 3300050493 nmdc:mga0k408_48568_c1 nmdc:mga0k408_48568_c1_362_1156 243
822 3300050493 nmdc:mga0k408_576_c1 nmdc:mga0k408_576_c1_4757_5488 243
823 3300050493 nmdc:mga0k408_70079_c1 nmdc:mga0k408_70079_c1_385_1119 243
824 3300050493 nmdc:mga0k408_8073_c1 nmdc:mga0k408_8073_c1_577_1308 243
825 3300050493 nmdc:mga0k408_99455_c1 nmdc:mga0k408_99455_c1_30_761 243
826 3300050494 nmdc:mga06z11_19649_c1 nmdc:mga06z11_19649_c1_555_1286 243
827 3300050494 nmdc:mga06z11_3638_c1 nmdc:mga06z11_3638_c1_2734_3465 243
828 3300050494 nmdc:mga06z11_61362_c1 nmdc:mga06z11_61362_c1_536_1267 243
829 3300050495 nmdc:mga04h51_26992_c1 nmdc:mga04h51_26992_c1_275_1006 243
830 3300050496 nmdc:mga07m45_1014_c1 nmdc:mga07m45_1014_c1_4224_4955 243
831 3300050496 nmdc:mga07m45_10764_c1 nmdc:mga07m45_10764_c1_2485_3216 243
832 3300050496 nmdc:mga07m45_18749_c1 nmdc:mga07m45_18749_c1_1480_2211 243
833 3300050496 nmdc:mga07m45_25133_c1 nmdc:mga07m45_25133_c1_1455_2186 243
834 3300050496 nmdc:mga07m45_27982_c1 nmdc:mga07m45_27982_c1_1091_1921 243
835 3300050496 nmdc:mga07m45_4479_c1 nmdc:mga07m45_4479_c1_1193_1924 243
836 3300050496 nmdc:mga07m45_45267_c1 nmdc:mga07m45_45267_c1_952_1683 243
837 3300050496 nmdc:mga07m45_47048_c1 nmdc:mga07m45_47048_c1_437_1168 243
838 3300050496 nmdc:mga07m45_47676_c1 nmdc:mga07m45_47676_c1_1403_2134 243
839 3300050496 nmdc:mga07m45_84631_c1 nmdc:mga07m45_84631_c1_286_1017 243
840 3300050507 nmdc:mga05p37_170801_c1 nmdc:mga05p37_170801_c1_81_860 243
841 3300050508 nmdc:mga09592_25399_c1 nmdc:mga09592_25399_c1_1611_2342 243
842 3300050508 nmdc:mga09592_277117_c1 nmdc:mga09592_277117_c1_542_1321 243
843 3300050508 nmdc:mga09592_390009_c1 nmdc:mga09592_390009_c1_420_1154 243
844 3300050509 nmdc:mga0qj67_143761_c1 nmdc:mga0qj67_143761_c1_137_868 243
845 3300050509 nmdc:mga0qj67_145158_c1 nmdc:mga0qj67_145158_c1_494_1273 243
846 3300050509 nmdc:mga0qj67_151419_c1 nmdc:mga0qj67_151419_c1_549_1322 243
847 3300050509 nmdc:mga0qj67_23042_c1 nmdc:mga0qj67_23042_c1_1635_2414 243
848 3300050509 nmdc:mga0qj67_38364_c1 nmdc:mga0qj67_38364_c1_124_858 243
849 3300050510 nmdc:mga06r32_20794_c1 nmdc:mga06r32_20794_c1_2177_2911 243
850 3300050510 nmdc:mga06r32_240838_c1 nmdc:mga06r32_240838_c1_833_1612 243
851 3300050510 nmdc:mga06r32_49789_c1 nmdc:mga06r32_49789_c1_105_884 243
852 3300050510 nmdc:mga06r32_79528_c1 nmdc:mga06r32_79528_c1_1162_1941 243
853 3300050512 nmdc:mga0n895_303551_c1 nmdc:mga0n895_303551_c1_173_910 243
854 3300050513 nmdc:mga0rr50_216183_c1 nmdc:mga0rr50_216183_c1_419_1156 243
855 3300050516 nmdc:mga0sz30_14739_c1 nmdc:mga0sz30_14739_c1_952_1683 243
856 3300053086 Ga0500578_0001946 Ga0500578_0001946_3645_4376 243
857 3300053086 Ga0500578_0368828 Ga0500578_0368828_80_811 243
858 3300053092 Ga0500583_0053617 Ga0500583_0053617_998_1729 243
859 3300053093 Ga0500651_0153797 Ga0500651_0153797_110_841 243
860 3300053124 Ga0500617_050552 Ga0500617_050552_714_1529 243
861 3300053134 Ga0500658_0000910 Ga0500658_0000910_11239_11970 243
862 3300053139 Ga0500568_0001825 Ga0500568_0001825_10085_10816 243
863 3300053139 Ga0500568_0006270 Ga0500568_0006270_3560_4291 243
864 3300053148 Ga0500590_015680 Ga0500590_015680_977_1708 243
865 3300053156 Ga0500622_0000002 Ga0500622_0000002_463383_464138 243
866 3300053156 Ga0500622_0000124 Ga0500622_0000124_40907_41638 243
867 3300053156 Ga0500622_0002040 Ga0500622_0002040_6695_7459 243
868 3300053156 Ga0500622_0085555 Ga0500622_0085555_556_1287 243
869 3300053177 Ga0500636_0011155 Ga0500636_0011155_3311_4042 243
870 3300061719 Ga0466962_0003926 Ga0466962_0003926_1270_2001 243
871 3300061719 Ga0466962_0026079 Ga0466962_0026079_1713_2444 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

45

275

0.97

PF13649

Methyltransf_25

Methyltransferase domain

95

190

0.97

PF08241

Methyltransf_11

Methyltransferase domain

96

194

0.96

PF13847

Methyltransf_31

Methyltransferase domain

89

237

0.91

PF08242

Methyltransf_12

Methyltransferase domain

96

192

0.87

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

78

206

0.86

PF07021

MetW

Methionine biosynthesis protein MetW

80

199

0.79

PF13489

Methyltransf_23

Methyltransferase domain

71

260

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9148 27 243
5wwq-assembly1.cif.gz_A crystal structure of human nsun6 0.8768 47 163
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.8485 44 235
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8438 27 243
8i9y-assembly1.cif.gz_CP cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - ytm1-2 0.8396 45 163
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.989 27 243 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9669 27 243 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9573 35 105 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9572 27 243 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9538 28 243 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2U2N2G9-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9913 2 243 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A6A5KTX5-F1-model_v4 deleted 0.989 3 242
AF-A0A7X1TTZ2-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9861 2 242 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A2U2N2G9-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9832 2 243 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A0D8Y6T8-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.983 2 242 GO:0008425
GO:0031314
GO:0032259

Feature Viewer

pLDDT pTM Quality
85.91 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map