F484132

General Info

Members Datasets Scaffolds Average Seq Length
869 391 1738 508

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0054694|Ga0501038_0054694_1496_3016
Length 506
Sequence MTVIKAADLIESVADALQYISYYHPMDYIKALGEAYEAEQGPAAKDAIAQILTNSRMCAEGHRPICQDTGIVNVFVKWGMDCRLDDTSRPLQDIVDEGVRRAYLHPENRLRASVLRDPAFSRQNTKDNTPCVLTVEMVPGNKVTVDVAAKGGGSENKSKFKMMNPSDSIVDWVLEMIPQMGAGWCPPGMLGIGIGGTAEKAVALAKESLMEPIDMGPLKARGPQNDIEALRIEIFDKVNALGIGAQGLGGLSTILDVKILDWPCHAAGKPVAMIPNCAATRHAHFTLDGSGPTYLDPPNLDEWPDVNWTPDKAAIRVDLDALTPELVQSWKQGDRLLLNGKMLTGRDAAHKRIQDMLAKGEQLPVEFKGRVIYYVGPVDPVGEEVVGPAGPTTATRMDKFTRMMLEQGLLAMVGKAERGPMAVEAIRDHQSAYLMAVGGAAYLVARAIKGSKVVGFEDLGMEAIYEFEVKDFPVTVAVDSEGNNVHHLAPLVWKEKIAKEGLLEKA

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
213 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
225 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
228 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
229 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
314 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
315 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
316 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
343 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
344 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
345 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
346 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
347 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
353 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
354 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
355 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
356 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
357 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
358 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
364 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
365 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
366 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
367 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
368 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
369 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
370 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
371 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
372 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
373 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
374 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
375 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
376 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
377 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
378 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
379 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
380 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
381 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
382 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
383 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
384 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
385 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
386 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
387 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
388 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
389 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
390 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
391 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0
Isolates 3.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.74
Nodule 0
Rhizoplane 2.07
Rhizosphere 78.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0054694 3300049574 Bacteria 3432
2 SwRhRL2b_contig_1676211 2162886007 Bacteria 9384
3 SwRhRL2b_contig_2205719 2162886007 Bacteria 4966
4 JGI24736J21556_1001131 3300001904 Bacteria 4891
5 JGI24741J21665_1000273 3300001915 Bacteria 15469
6 JGI24741J21665_1006209 3300001915 Bacteria 2423
7 JGI24752J21851_1000148 3300001976 Bacteria 9539
8 JGI24740J21852_10004672 3300001979 Bacteria 5870
9 JGI24739J22299_10027214 3300001989 Bacteria 2001
10 JGI24739J22299_10030387 3300001989 Bacteria 1873
11 JGI24737J22298_10000602 3300001990 Bacteria 12666
12 JGI24737J22298_10005143 3300001990 Bacteria 4529
13 JGI24735J21928_10002161 3300002067 Bacteria 6904
14 JGI24735J21928_10004848 3300002067 Bacteria 4490
15 JGI24735J21928_10017651 3300002067 Bacteria 2206
16 JGI24750J21931_1000219 3300002070 Bacteria 9756
17 JGI24748J21848_1000033 3300002074 Bacteria 78443
18 JGI24738J21930_10001556 3300002075 Bacteria 6330
19 JGI24738J21930_10005865 3300002075 Bacteria 2918
20 JGI24034J26672_10000032 3300002239 Bacteria 89175
21 JGI24751J29686_10000294 3300002459 Bacteria 18901
22 JGI24751J29686_10000300 3300002459 Bacteria 18715
23 JGI25165J46597_1000112 3300003214 Bacteria 147097
24 JGI25165J46597_1000208 3300003214 Bacteria 84386
25 JGI25153J46596_10000021 3300003215 Bacteria 252651
26 Ga0055525_1000012 3300003759 Bacteria 486564
27 Ga0055542_1000094 3300003762 Bacteria 119899
28 Ga0055529_1000045 3300003763 Bacteria 209617
29 Ga0055530_10000012 3300003791 Bacteria 164829
30 Ga0055531_10000683 3300003794 Bacteria 28960
31 Ga0055531_10008207 3300003794 Bacteria 5558
32 Ga0065704_10001118 3300005289 Bacteria 24231
33 Ga0065704_10070157 3300005289 Bacteria 211668
34 Ga0065704_10072849 3300005289 Bacteria 7928
35 Ga0065704_10084202 3300005289 Bacteria 3365
36 Ga0065707_10090686 3300005295 Bacteria 4088
37 Ga0065707_10109048 3300005295 Bacteria 2484
38 Ga0065707_10117965 3300005295 Bacteria 2198
39 Ga0070658_10000458 3300005327 Bacteria 35479
40 Ga0070658_10000836 3300005327 Bacteria 26337
41 Ga0070658_10004043 3300005327 Bacteria 12018
42 Ga0070658_10006558 3300005327 Bacteria 9442
43 Ga0070658_10007863 3300005327 Bacteria 8590
44 Ga0070658_10020858 3300005327 Bacteria 5250
45 Ga0070683_100095632 3300005329 Bacteria 2793
46 Ga0070683_100114256 3300005329 Bacteria 2548
47 Ga0070690_100000011 3300005330 Bacteria 95472
48 Ga0070670_100000005 3300005331 Bacteria 351569
49 Ga0070670_100006954 3300005331 Bacteria 9590
50 Ga0070670_100007353 3300005331 Bacteria 9349
51 Ga0070670_100049091 3300005331 Bacteria 3630
52 Ga0068869_100003111 3300005334 Bacteria 10119
53 Ga0070666_10000035 3300005335 Bacteria 121458
54 Ga0070666_10002111 3300005335 Bacteria 12077
55 Ga0070666_10008945 3300005335 Bacteria 6235
56 Ga0070666_10026137 3300005335 Bacteria 3811
57 Ga0070680_100008920 3300005336 Bacteria 7691
58 Ga0068868_100005495 3300005338 Bacteria 8914
59 Ga0070660_100000189 3300005339 Bacteria 41162
60 Ga0070660_100003680 3300005339 Bacteria 10581
61 Ga0070660_100018015 3300005339 Bacteria 5153
62 Ga0070660_100021802 3300005339 Bacteria 4728
63 Ga0070689_100055226 3300005340 Bacteria 3077
64 Ga0070689_100056972 3300005340 Bacteria 3032
65 Ga0070691_10005094 3300005341 Bacteria 5971
66 Ga0070661_100014248 3300005344 Bacteria 5601
67 Ga0070668_100000006 3300005347 Bacteria 176486
68 Ga0070668_100000353 3300005347 Bacteria 30383
69 Ga0070668_100014918 3300005347 Bacteria 5809
70 Ga0070668_100019348 3300005347 Bacteria 5125
71 Ga0070668_100152583 3300005347 Bacteria 1869
72 Ga0070669_100000004 3300005353 Bacteria 314707
73 Ga0070669_100000056 3300005353 Bacteria 111413
74 Ga0070669_100000057 3300005353 Bacteria 110803
75 Ga0070669_100000131 3300005353 Bacteria 68114
76 Ga0070669_100001055 3300005353 Bacteria 20165
77 Ga0070669_100002210 3300005353 Bacteria 14103
78 Ga0070669_100007970 3300005353 Bacteria 7563
79 Ga0070669_100041884 3300005353 Bacteria 3332
80 Ga0070669_100083357 3300005353 Bacteria 2384
81 Ga0070671_100000005 3300005355 Bacteria 256547
82 Ga0070671_100000029 3300005355 Bacteria 112712
83 Ga0070671_100000048 3300005355 Bacteria 82451
84 Ga0070671_100000120 3300005355 Bacteria 50898
85 Ga0070671_100002408 3300005355 Bacteria 14460
86 Ga0070671_100004738 3300005355 Bacteria 10807
87 Ga0070671_100147837 3300005355 Bacteria 1984
88 Ga0070674_100003272 3300005356 Bacteria 9056
89 Ga0070674_100014453 3300005356 Bacteria 4907
90 Ga0070674_100017329 3300005356 Bacteria 4528
91 Ga0070674_100043506 3300005356 Bacteria 3056
92 Ga0070673_100000001 3300005364 Bacteria 239842
93 Ga0070688_100024329 3300005365 Bacteria 3572
94 Ga0070659_100006689 3300005366 Bacteria 8334
95 Ga0070659_100020629 3300005366 Bacteria 5009
96 Ga0070659_100130365 3300005366 Bacteria 2042
97 Ga0070667_100000003 3300005367 Bacteria 447715
98 Ga0070667_100000160 3300005367 Bacteria 83754
99 Ga0070667_100000230 3300005367 Bacteria 63814
100 Ga0070667_100000754 3300005367 Bacteria 30851
101 Ga0070667_100002904 3300005367 Bacteria 14728
102 Ga0070667_100091332 3300005367 Bacteria 2618
103 Ga0070700_100000952 3300005441 Bacteria 14294
104 Ga0070663_100004055 3300005455 Bacteria 8551
105 Ga0070663_100055307 3300005455 Bacteria 2840
106 Ga0070678_100000149 3300005456 Bacteria 29059
107 Ga0070678_100090486 3300005456 Bacteria 2346
108 Ga0070662_100000798 3300005457 Bacteria 19365
109 Ga0070681_10008953 3300005458 Bacteria 9843
110 Ga0068867_100008341 3300005459 Bacteria 7311
111 Ga0068867_100038002 3300005459 Bacteria 3503
112 Ga0070685_10000850 3300005466 Bacteria 16626
113 Ga0070707_100176737 3300005468 Bacteria 2081
114 Ga0070679_100007721 3300005530 Bacteria 10071
115 Ga0068853_100000627 3300005539 Bacteria 24278
116 Ga0068853_100015261 3300005539 Bacteria 6314
117 Ga0068853_100086748 3300005539 Bacteria 2745
118 Ga0070672_100005821 3300005543 Bacteria 8225
119 Ga0070672_100053838 3300005543 Bacteria 3148
120 Ga0070686_100000035 3300005544 Bacteria 108191
121 Ga0070665_100000021 3300005548 Bacteria 389668
122 Ga0070665_100000101 3300005548 Bacteria 159353
123 Ga0070665_100000161 3300005548 Bacteria 122088
124 Ga0070665_100000256 3300005548 Bacteria 87962
125 Ga0070665_100012473 3300005548 Bacteria 8567
126 Ga0070665_100014399 3300005548 Bacteria 7937
127 Ga0068855_100022825 3300005563 Bacteria 7499
128 Ga0068855_100042837 3300005563 Bacteria 5363
129 Ga0068855_100092695 3300005563 Bacteria 3483
130 Ga0070664_100009808 3300005564 Bacteria 7760
131 Ga0068857_100018688 3300005577 Bacteria 6084
132 Ga0068857_100021544 3300005577 Bacteria 5671
133 Ga0068854_100000547 3300005578 Bacteria 22662
134 Ga0068854_100006245 3300005578 Bacteria 7567
135 Ga0068856_100003378 3300005614 Bacteria 16157
136 Ga0068856_100014543 3300005614 Bacteria 7606
137 Ga0068856_100042659 3300005614 Bacteria 4463
138 Ga0068856_100059073 3300005614 Bacteria 3788
139 Ga0068852_100000259 3300005616 Bacteria 35916
140 Ga0068852_100002971 3300005616 Bacteria 11774
141 Ga0068859_100000233 3300005617 Bacteria 54852
142 Ga0068859_100009239 3300005617 Bacteria 9957
143 Ga0068859_100013351 3300005617 Bacteria 8238
144 Ga0068859_100026211 3300005617 Bacteria 5846
145 Ga0068864_100000011 3300005618 Bacteria 350056
146 Ga0068864_100000211 3300005618 Bacteria 52419
147 Ga0068864_100003942 3300005618 Bacteria 12222
148 Ga0068864_100009425 3300005618 Bacteria 8056
149 Ga0068866_10028308 3300005718 Bacteria 2669
150 Ga0068861_100001267 3300005719 Bacteria 15769
151 Ga0068861_100003944 3300005719 Bacteria 9927
152 Ga0068861_100008325 3300005719 Bacteria 7132
153 Ga0068851_10013600 3300005834 Bacteria 3852
154 Ga0068870_10049358 3300005840 Bacteria 2220
155 Ga0068863_100000060 3300005841 Bacteria 122123
156 Ga0068863_100000132 3300005841 Bacteria 78811
157 Ga0068863_100000413 3300005841 Bacteria 43520
158 Ga0068863_100000466 3300005841 Bacteria 41328
159 Ga0068863_100002604 3300005841 Bacteria 17894
160 Ga0068863_100013665 3300005841 Bacteria 7828
161 Ga0068863_100014019 3300005841 Bacteria 7723
162 Ga0068863_100015742 3300005841 Bacteria 7263
163 Ga0068863_100067443 3300005841 Bacteria 3384
164 Ga0068863_100076595 3300005841 Bacteria 3164
165 Ga0068858_100001744 3300005842 Bacteria 22204
166 Ga0068858_100008838 3300005842 Bacteria 9662
167 Ga0068858_100012341 3300005842 Bacteria 8056
168 Ga0068858_100014825 3300005842 Bacteria 7334
169 Ga0068858_100036669 3300005842 Bacteria 4546
170 Ga0068858_100153978 3300005842 Bacteria 2162
171 Ga0068860_100000068 3300005843 Bacteria 179208
172 Ga0068860_100000126 3300005843 Bacteria 122923
173 Ga0068860_100000220 3300005843 Bacteria 89460
174 Ga0068860_100000473 3300005843 Bacteria 49993
175 Ga0068860_100021108 3300005843 Bacteria 6307
176 Ga0068860_100072066 3300005843 Bacteria 3283
177 Ga0068860_100214113 3300005843 Bacteria 1869
178 Ga0068862_100000011 3300005844 Bacteria 270105
179 Ga0068862_100000146 3300005844 Bacteria 80138
180 Ga0068862_100000151 3300005844 Bacteria 78811
181 Ga0068862_100000198 3300005844 Bacteria 66534
182 Ga0068862_100000267 3300005844 Bacteria 58000
183 Ga0068862_100000581 3300005844 Bacteria 38018
184 Ga0068862_100003219 3300005844 Bacteria 14138
185 Ga0068862_100011508 3300005844 Bacteria 7304
186 Ga0068862_100018624 3300005844 Bacteria 5784
187 Ga0068862_100152074 3300005844 Bacteria 2060
188 Ga0081455_10000049 3300005937 Bacteria 126459
189 Ga0081539_10003331 3300005985 Bacteria 20003
190 Ga0075368_10000894 3300006042 Bacteria 9251
191 Ga0075368_10001248 3300006042 Bacteria 8047
192 Ga0075363_100001087 3300006048 Bacteria 9843
193 Ga0075363_100008716 3300006048 Bacteria 4736
194 Ga0075363_100011878 3300006048 Bacteria 4183
195 Ga0075364_10000812 3300006051 Bacteria 16485
196 Ga0075362_10000043 3300006177 Bacteria 44587
197 Ga0075362_10004251 3300006177 Bacteria 5116
198 Ga0075369_10000422 3300006186 Bacteria 12834
199 Ga0075369_10009323 3300006186 Bacteria 3809
200 Ga0075366_10000832 3300006195 Bacteria 14827
201 Ga0075366_10002410 3300006195 Bacteria 9592
202 Ga0075366_10023371 3300006195 Bacteria 3601
203 Ga0075370_10000241 3300006353 Bacteria 19620
204 Ga0075370_10018445 3300006353 Bacteria 3787
205 Ga0075370_10031397 3300006353 Bacteria 2965
206 Ga0075370_10044080 3300006353 Bacteria 2522
207 Ga0075370_10061587 3300006353 Bacteria 2138
208 Ga0068871_100009681 3300006358 Bacteria 6997
209 Ga0075434_100000891 3300006871 Bacteria 23915
210 Ga0075434_100003634 3300006871 Bacteria 13773
211 Ga0075434_100013292 3300006871 Bacteria 7828
212 Ga0075429_100069504 3300006880 Bacteria 3066
213 Ga0068865_100000072 3300006881 Bacteria 53411
214 Ga0075436_100000248 3300006914 Bacteria 33736
215 Ga0097620_100000233 3300006931 Bacteria 54852
216 Ga0097620_100009239 3300006931 Bacteria 9957
217 Ga0097620_100013351 3300006931 Bacteria 8238
218 Ga0097620_100026210 3300006931 Bacteria 5846
219 Ga0097620_100034635 3300006931 Bacteria 5068
220 Ga0075435_100001418 3300007076 Bacteria 15465
221 Ga0075435_100003277 3300007076 Bacteria 10966
222 Ga0105251_10002944 3300009011 Bacteria 12768
223 Ga0105251_10004465 3300009011 Bacteria 9506
224 Ga0105251_10012746 3300009011 Bacteria 4739
225 Ga0105250_10005824 3300009092 Bacteria 5472
226 Ga0105240_10007916 3300009093 Bacteria 15328
227 Ga0105240_10009609 3300009093 Bacteria 13679
228 Ga0105240_10045358 3300009093 Bacteria 5577
229 Ga0105240_10061597 3300009093 Bacteria 4676
230 Ga0111539_10003392 3300009094 Bacteria 20991
231 Ga0111539_10022382 3300009094 Bacteria 7767
232 Ga0111539_10029850 3300009094 Bacteria 6634
233 Ga0105245_10008667 3300009098 Bacteria 8870
234 Ga0105245_10010317 3300009098 Bacteria 8137
235 Ga0105247_10004800 3300009101 Bacteria 8610
236 Ga0105247_10025811 3300009101 Bacteria 3546
237 Ga0105247_10036253 3300009101 Bacteria 3007
238 Ga0114129_10082268 3300009147 Bacteria 4474
239 Ga0105243_10000512 3300009148 Bacteria 39573
240 Ga0105243_10007320 3300009148 Bacteria 8488
241 Ga0105243_10014674 3300009148 Bacteria 5929
242 Ga0105243_10056287 3300009148 Bacteria 3127
243 Ga0105241_10022767 3300009174 Bacteria 4644
244 Ga0105242_10000178 3300009176 Bacteria 48486
245 Ga0105248_10000012 3300009177 Bacteria 333963
246 Ga0105248_10000406 3300009177 Bacteria 49988
247 Ga0105248_10013202 3300009177 Bacteria 9094
248 Ga0105248_10014880 3300009177 Bacteria 8570
249 Ga0105248_10044831 3300009177 Bacteria 4960
250 Ga0105248_10075835 3300009177 Bacteria 3779
251 Ga0105237_10000626 3300009545 Bacteria 49404
252 Ga0105238_10284719 3300009551 Bacteria 1634
253 Ga0105249_10000015 3300009553 Bacteria 282138
254 Ga0105249_10000094 3300009553 Bacteria 122611
255 Ga0105249_10002709 3300009553 Bacteria 15315
256 Ga0105249_10003676 3300009553 Bacteria 13223
257 Ga0105249_10025943 3300009553 Bacteria 5278
258 Ga0105148_100001 3300009978 Bacteria 58900
259 Ga0105239_10000438 3300010375 Bacteria 60788
260 Ga0105239_10027754 3300010375 Bacteria 6229
261 Ga0105246_10000074 3300011119 Bacteria 41753
262 Ga0105246_10007060 3300011119 Bacteria 6875
263 Ga0157371_10000032 3300013102 Bacteria 230252
264 Ga0157371_10001651 3300013102 Bacteria 22752
265 Ga0157370_10000213 3300013104 Bacteria 73863
266 Ga0157370_10078843 3300013104 Bacteria 3102
267 Ga0157369_10000384 3300013105 Bacteria 58625
268 Ga0157378_10007434 3300013297 Bacteria 9569
269 Ga0163162_10054081 3300013306 Bacteria 4037
270 Ga0163162_10056077 3300013306 Bacteria 3969
271 Ga0163162_10056710 3300013306 Bacteria 3945
272 Ga0163162_10069879 3300013306 Bacteria 3563
273 Ga0163162_10222910 3300013306 Bacteria 2015
274 Ga0157372_10020739 3300013307 Bacteria 7095
275 Ga0157372_10107406 3300013307 Bacteria 3193
276 Ga0157375_10006006 3300013308 Bacteria 10586
277 Ga0157380_10000031 3300014326 Bacteria 90245
278 Ga0157380_10000484 3300014326 Bacteria 24282
279 Ga0157380_10039808 3300014326 Bacteria 3657
280 Ga0157379_10025953 3300014968 Bacteria 5210
281 Ga0183363_1006 3300015690 Bacteria 400466
282 Ga0163161_10000195 3300017792 Bacteria 55605
283 Ga0163161_10016583 3300017792 Bacteria 5145
284 Ga0213875_10003072 3300021388 Bacteria 9647
285 Ga0207672_1000484 3300025223 Bacteria 5005
286 Ga0209147_100577 3300025229 Bacteria 20552
287 Ga0209563_100030 3300025230 Bacteria 489259
288 Ga0207427_100704 3300025231 Bacteria 15684
289 Ga0209437_108363 3300025233 Bacteria 1657
290 Ga0209677_106107 3300025253 Bacteria 2948
291 Ga0209148_1000011 3300025254 Bacteria 1196503
292 Ga0209148_1000133 3300025254 Bacteria 171351
293 Ga0209148_1001460 3300025254 Bacteria 11963
294 Ga0209233_1000078 3300025261 Bacteria 348118
295 Ga0209233_1000186 3300025261 Bacteria 133572
296 Ga0209455_1000006 3300025272 Bacteria 1196503
297 Ga0209455_1003196 3300025272 Bacteria 5926
298 Ga0209675_1000472 3300025291 Bacteria 30895
299 Ga0209676_1000226 3300025292 Bacteria 124004
300 Ga0209676_1000387 3300025292 Bacteria 80494
301 Ga0209676_1000760 3300025292 Bacteria 43458
302 Ga0209025_1008935 3300025294 Bacteria 7090
303 Ga0209758_1000023 3300025297 Bacteria 612453
304 Ga0209050_1000450 3300025298 Bacteria 74598
305 Ga0209050_1000474 3300025298 Bacteria 71192
306 Ga0209257_1000130 3300025304 Bacteria 212188
307 Ga0209257_1000581 3300025304 Bacteria 61540
308 Ga0207697_10000101 3300025315 Bacteria 39230
309 Ga0207697_10016613 3300025315 Bacteria 3031
310 Ga0207656_10000615 3300025321 Bacteria 11705
311 Ga0207713_1002507 3300025735 Bacteria 13301
312 Ga0207713_1005597 3300025735 Bacteria 7823
313 Ga0207713_1006927 3300025735 Bacteria 6803
314 Ga0207713_1044654 3300025735 Bacteria 1817
315 Ga0207710_10011802 3300025900 Bacteria 3674
316 Ga0207680_10000007 3300025903 Bacteria 623574
317 Ga0207680_10000089 3300025903 Bacteria 41847
318 Ga0207680_10001062 3300025903 Bacteria 12987
319 Ga0207680_10043603 3300025903 Bacteria 2632
320 Ga0207647_10006630 3300025904 Bacteria 8411
321 Ga0207647_10007467 3300025904 Bacteria 7896
322 Ga0207645_10000736 3300025907 Bacteria 27275
323 Ga0207643_10037095 3300025908 Bacteria 2735
324 Ga0207705_10000007 3300025909 Bacteria 597387
325 Ga0207705_10000018 3300025909 Bacteria 319792
326 Ga0207705_10001048 3300025909 Bacteria 22463
327 Ga0207705_10001219 3300025909 Bacteria 20805
328 Ga0207705_10006362 3300025909 Bacteria 8761
329 Ga0207705_10018297 3300025909 Bacteria 5010
330 Ga0207705_10036863 3300025909 Bacteria 3499
331 Ga0207705_10081879 3300025909 Bacteria 2353
332 Ga0207705_10123453 3300025909 Bacteria 1923
333 Ga0207654_10001636 3300025911 Bacteria 11707
334 Ga0207695_10007635 3300025913 Bacteria 13709
335 Ga0207695_10124511 3300025913 Bacteria 2542
336 Ga0207671_10000596 3300025914 Bacteria 48191
337 Ga0207671_10005662 3300025914 Bacteria 11430
338 Ga0207671_10009066 3300025914 Bacteria 8363
339 Ga0207671_10036902 3300025914 Bacteria 3624
340 Ga0207660_10022394 3300025917 Bacteria 4257
341 Ga0207660_10050816 3300025917 Bacteria 2945
342 Ga0207657_10000156 3300025919 Bacteria 69892
343 Ga0207657_10000507 3300025919 Bacteria 41166
344 Ga0207657_10006147 3300025919 Bacteria 12480
345 Ga0207649_10003922 3300025920 Bacteria 8116
346 Ga0207649_10004027 3300025920 Bacteria 8003
347 Ga0207652_10021467 3300025921 Bacteria 5329
348 Ga0207646_10152246 3300025922 Bacteria 2086
349 Ga0207681_10000001 3300025923 Bacteria 1105841
350 Ga0207681_10000010 3300025923 Bacteria 403379
351 Ga0207681_10000019 3300025923 Bacteria 243902
352 Ga0207681_10000053 3300025923 Bacteria 110626
353 Ga0207681_10000224 3300025923 Bacteria 44695
354 Ga0207681_10000288 3300025923 Bacteria 37371
355 Ga0207681_10000578 3300025923 Bacteria 24948
356 Ga0207681_10006398 3300025923 Bacteria 7231
357 Ga0207681_10016986 3300025923 Bacteria 4564
358 Ga0207681_10032395 3300025923 Bacteria 3422
359 Ga0207681_10037009 3300025923 Bacteria 3223
360 Ga0207694_10077662 3300025924 Bacteria 2602
361 Ga0207650_10000018 3300025925 Bacteria 352120
362 Ga0207650_10000249 3300025925 Bacteria 58457
363 Ga0207650_10009614 3300025925 Bacteria 6613
364 Ga0207650_10026619 3300025925 Bacteria 4128
365 Ga0207687_10010013 3300025927 Bacteria 6203
366 Ga0207687_10021302 3300025927 Bacteria 4306
367 Ga0207644_10000007 3300025931 Bacteria 381778
368 Ga0207644_10000008 3300025931 Bacteria 354219
369 Ga0207644_10000911 3300025931 Bacteria 18743
370 Ga0207644_10002772 3300025931 Bacteria 11281
371 Ga0207644_10012636 3300025931 Bacteria 5612
372 Ga0207644_10015708 3300025931 Bacteria 5086
373 Ga0207690_10006409 3300025932 Bacteria 6975
374 Ga0207690_10034263 3300025932 Bacteria 3271
375 Ga0207706_10001346 3300025933 Bacteria 24541
376 Ga0207706_10003722 3300025933 Bacteria 14550
377 Ga0207706_10022565 3300025933 Bacteria 5648
378 Ga0207706_10050483 3300025933 Bacteria 3675
379 Ga0207709_10000145 3300025935 Bacteria 98629
380 Ga0207709_10003291 3300025935 Bacteria 9694
381 Ga0207709_10010876 3300025935 Bacteria 5012
382 Ga0207709_10049300 3300025935 Bacteria 2570
383 Ga0207670_10037917 3300025936 Bacteria 3144
384 Ga0207669_10000118 3300025937 Bacteria 39673
385 Ga0207669_10000784 3300025937 Bacteria 13595
386 Ga0207704_10000032 3300025938 Bacteria 108408
387 Ga0207704_10003755 3300025938 Bacteria 6911
388 Ga0207691_10076134 3300025940 Bacteria 3024
389 Ga0207691_10121895 3300025940 Bacteria 2310
390 Ga0207711_10000004 3300025941 Bacteria 870636
391 Ga0207711_10000382 3300025941 Bacteria 46910
392 Ga0207711_10003989 3300025941 Bacteria 12679
393 Ga0207711_10005707 3300025941 Bacteria 10503
394 Ga0207711_10008959 3300025941 Bacteria 8366
395 Ga0207711_10011608 3300025941 Bacteria 7319
396 Ga0207711_10028532 3300025941 Bacteria 4697
397 Ga0207711_10044809 3300025941 Bacteria 3778
398 Ga0207689_10000840 3300025942 Bacteria 29578
399 Ga0207679_10042816 3300025945 Bacteria 3256
400 Ga0207667_10000002 3300025949 Bacteria 895662
401 Ga0207667_10000013 3300025949 Bacteria 435875
402 Ga0207667_10004614 3300025949 Bacteria 16903
403 Ga0207667_10005831 3300025949 Bacteria 15010
404 Ga0207667_10014586 3300025949 Bacteria 8949
405 Ga0207667_10028292 3300025949 Bacteria 6090
406 Ga0207667_10078892 3300025949 Bacteria 3412
407 Ga0207667_10130160 3300025949 Bacteria 2592
408 Ga0207651_10000001 3300025960 Bacteria 516823
409 Ga0207651_10103787 3300025960 Bacteria 2116
410 Ga0207712_10000004 3300025961 Bacteria 614655
411 Ga0207712_10000023 3300025961 Bacteria 282081
412 Ga0207712_10001574 3300025961 Bacteria 15363
413 Ga0207712_10001688 3300025961 Bacteria 14823
414 Ga0207712_10071483 3300025961 Bacteria 2496
415 Ga0207668_10000026 3300025972 Bacteria 128309
416 Ga0207668_10000244 3300025972 Bacteria 36489
417 Ga0207668_10002820 3300025972 Bacteria 10168
418 Ga0207668_10011271 3300025972 Bacteria 5426
419 Ga0207640_10000392 3300025981 Bacteria 27827
420 Ga0207640_10000809 3300025981 Bacteria 17796
421 Ga0207640_10002033 3300025981 Bacteria 10932
422 Ga0207640_10007509 3300025981 Bacteria 6021
423 Ga0207640_10025536 3300025981 Bacteria 3577
424 Ga0207640_10059855 3300025981 Bacteria 2515
425 Ga0207640_10064677 3300025981 Bacteria 2437
426 Ga0207658_10000002 3300025986 Bacteria 1364188
427 Ga0207658_10000064 3300025986 Bacteria 117779
428 Ga0207658_10000204 3300025986 Bacteria 61702
429 Ga0207658_10000230 3300025986 Bacteria 58983
430 Ga0207658_10000587 3300025986 Bacteria 32623
431 Ga0207658_10001492 3300025986 Bacteria 18189
432 Ga0207658_10001874 3300025986 Bacteria 15735
433 Ga0207658_10065053 3300025986 Bacteria 2737
434 Ga0207658_10107535 3300025986 Bacteria 2198
435 Ga0207677_10000209 3300026023 Bacteria 47213
436 Ga0207703_10000489 3300026035 Bacteria 41162
437 Ga0207703_10000510 3300026035 Bacteria 40276
438 Ga0207703_10001171 3300026035 Bacteria 24769
439 Ga0207703_10002081 3300026035 Bacteria 17588
440 Ga0207703_10009847 3300026035 Bacteria 7497
441 Ga0207703_10041168 3300026035 Bacteria 3700
442 Ga0207639_10000808 3300026041 Bacteria 21259
443 Ga0207639_10001024 3300026041 Bacteria 19008
444 Ga0207639_10004520 3300026041 Bacteria 9380
445 Ga0207639_10018354 3300026041 Bacteria 4971
446 Ga0207639_10057664 3300026041 Bacteria 2983
447 Ga0207678_10002991 3300026067 Bacteria 15288
448 Ga0207678_10007603 3300026067 Bacteria 9576
449 Ga0207678_10011131 3300026067 Bacteria 7904
450 Ga0207678_10037279 3300026067 Bacteria 4229
451 Ga0207708_10007087 3300026075 Bacteria 8281
452 Ga0207708_10021025 3300026075 Bacteria 4924
453 Ga0207702_10001204 3300026078 Bacteria 26266
454 Ga0207702_10007553 3300026078 Bacteria 9267
455 Ga0207702_10014752 3300026078 Bacteria 6481
456 Ga0207702_10194195 3300026078 Bacteria 1878
457 Ga0207641_10000010 3300026088 Bacteria 402193
458 Ga0207641_10000050 3300026088 Bacteria 175954
459 Ga0207641_10000098 3300026088 Bacteria 123514
460 Ga0207641_10000100 3300026088 Bacteria 122664
461 Ga0207641_10000607 3300026088 Bacteria 39350
462 Ga0207641_10003216 3300026088 Bacteria 14612
463 Ga0207641_10004086 3300026088 Bacteria 12730
464 Ga0207641_10008306 3300026088 Bacteria 8579
465 Ga0207641_10010984 3300026088 Bacteria 7423
466 Ga0207648_10001521 3300026089 Bacteria 25544
467 Ga0207648_10002650 3300026089 Bacteria 19101
468 Ga0207648_10084660 3300026089 Bacteria 2766
469 Ga0207676_10000004 3300026095 Bacteria 725417
470 Ga0207676_10000046 3300026095 Bacteria 149037
471 Ga0207676_10001192 3300026095 Bacteria 19520
472 Ga0207676_10004670 3300026095 Bacteria 9705
473 Ga0207676_10023338 3300026095 Bacteria 4562
474 Ga0207674_10032027 3300026116 Bacteria 5516
475 Ga0207674_10074045 3300026116 Bacteria 3418
476 Ga0207675_100000418 3300026118 Bacteria 41021
477 Ga0207675_100002120 3300026118 Bacteria 19658
478 Ga0207675_100004105 3300026118 Bacteria 14093
479 Ga0207675_100008435 3300026118 Bacteria 9710
480 Ga0207675_100010029 3300026118 Bacteria 8878
481 Ga0207683_10000881 3300026121 Bacteria 27549
482 Ga0207683_10044107 3300026121 Bacteria 3898
483 Ga0207698_10000036 3300026142 Bacteria 105391
484 Ga0207698_10002649 3300026142 Bacteria 10641
485 Ga0207698_10025231 3300026142 Bacteria 4184
486 Ga0207698_10058790 3300026142 Bacteria 2982
487 Ga0209982_1000469 3300027552 Bacteria 4979
488 Ga0209983_1000372 3300027665 Bacteria 9527
489 Ga0209971_1000479 3300027682 Bacteria 10575
490 Ga0209998_10003268 3300027717 Bacteria 3569
491 Ga0209813_10000019 3300027866 Bacteria 75575
492 Ga0209813_10000027 3300027866 Bacteria 69637
493 Ga0209974_10000433 3300027876 Bacteria 13927
494 Ga0209974_10017864 3300027876 Bacteria 2352
495 Ga0207428_10015046 3300027907 Bacteria 6703
496 Ga0268266_10000015 3300028379 Bacteria 630629
497 Ga0268266_10000040 3300028379 Bacteria 323843
498 Ga0268266_10001320 3300028379 Bacteria 30084
499 Ga0268266_10002221 3300028379 Bacteria 21198
500 Ga0268266_10035008 3300028379 Bacteria 4271
501 Ga0268266_10060181 3300028379 Bacteria 3274
502 Ga0268266_10091313 3300028379 Bacteria 2670
503 Ga0268265_10000002 3300028380 Bacteria 1035381
504 Ga0268265_10000021 3300028380 Bacteria 272292
505 Ga0268265_10000026 3300028380 Bacteria 246653
506 Ga0268265_10000128 3300028380 Bacteria 96118
507 Ga0268265_10001138 3300028380 Bacteria 23490
508 Ga0268265_10005503 3300028380 Bacteria 8643
509 Ga0268265_10012215 3300028380 Bacteria 5815
510 Ga0268265_10030522 3300028380 Bacteria 3883
511 Ga0268265_10103097 3300028380 Bacteria 2309
512 Ga0268264_10000003 3300028381 Bacteria 1141976
513 Ga0268264_10000103 3300028381 Bacteria 222439
514 Ga0268264_10000106 3300028381 Bacteria 210031
515 Ga0268264_10000224 3300028381 Bacteria 110355
516 Ga0268264_10000384 3300028381 Bacteria 63602
517 Ga0268264_10000682 3300028381 Bacteria 39550
518 Ga0268264_10002280 3300028381 Bacteria 16989
519 Ga0268264_10005337 3300028381 Bacteria 10890
520 Ga0268264_10051042 3300028381 Bacteria 3446
521 Ga0307517_10033350 3300028786 Bacteria 5918
522 Ga0307511_10002452 3300030521 Bacteria 19398
523 Ga0265327_10010384 3300031251 Bacteria 6556
524 Ga0307513_10041093 3300031456 Bacteria 5108
525 Ga0307513_10107692 3300031456 Bacteria 2790
526 Ga0307408_100000518 3300031548 Bacteria 33310
527 Ga0307408_100002503 3300031548 Bacteria 12854
528 Ga0307408_100008036 3300031548 Bacteria 6975
529 Ga0307408_100059075 3300031548 Bacteria 2790
530 Ga0307508_10000405 3300031616 Bacteria 51700
531 Ga0307508_10035420 3300031616 Bacteria 4498
532 Ga0316576_10017527 3300031727 Bacteria 4869
533 Ga0316576_10117900 3300031727 Bacteria 1992
534 Ga0307405_10002305 3300031731 Bacteria 8371
535 Ga0307405_10018466 3300031731 Bacteria 3848
536 Ga0307405_10019681 3300031731 Bacteria 3756
537 Ga0307413_10010529 3300031824 Bacteria 4492
538 Ga0307413_10058537 3300031824 Bacteria 2362
539 Ga0307413_10061666 3300031824 Bacteria 2315
540 Ga0307413_10106937 3300031824 Bacteria 1863
541 Ga0307413_10107111 3300031824 Bacteria 1862
542 Ga0307410_10006414 3300031852 Bacteria 6347
543 Ga0307406_10000892 3300031901 Bacteria 16774
544 Ga0307406_10034258 3300031901 Bacteria 3114
545 Ga0307406_10056538 3300031901 Bacteria 2513
546 Ga0307407_10029276 3300031903 Bacteria 2956
547 Ga0307412_10000495 3300031911 Bacteria 23495
548 Ga0307412_10002706 3300031911 Bacteria 9846
549 Ga0307412_10008473 3300031911 Bacteria 5872
550 Ga0307412_10012668 3300031911 Bacteria 4921
551 Ga0307412_10018302 3300031911 Bacteria 4213
552 Ga0307409_100008074 3300031995 Bacteria 6354
553 Ga0307409_100088996 3300031995 Bacteria 2522
554 Ga0307409_100095618 3300031995 Bacteria 2448
555 Ga0307416_100007406 3300032002 Bacteria 6977
556 Ga0307416_100009769 3300032002 Bacteria 6305
557 Ga0307416_100032065 3300032002 Bacteria 3965
558 Ga0307416_100066731 3300032002 Bacteria 2964
559 Ga0307414_10000211 3300032004 Bacteria 38909
560 Ga0307414_10000684 3300032004 Bacteria 17354
561 Ga0307414_10002264 3300032004 Bacteria 10056
562 Ga0307414_10037581 3300032004 Bacteria 3244
563 Ga0307414_10045913 3300032004 Bacteria 2994
564 Ga0307414_10184308 3300032004 Bacteria 1682
565 Ga0307411_10032214 3300032005 Bacteria 3236
566 Ga0307411_10033629 3300032005 Bacteria 3182
567 Ga0307411_10055325 3300032005 Bacteria 2610
568 Ga0307415_100003211 3300032126 Bacteria 8294
569 Ga0316583_10030455 3300032133 Bacteria 1921
570 Ga0316580_10020965 3300032139 Bacteria 2014
571 Ga0307510_10015830 3300033180 Bacteria 8914
572 Ga0373932_0010942 3300035112 Bacteria 2207
573 Ga0316574_0030859 3300035398 Bacteria 3248
574 Ga0316574_0084865 3300035398 Bacteria 2015
575 Ga0316582_0000396 3300036647 Bacteria 15815
576 Ga0316582_0100841 3300036647 Bacteria 1912
577 Ga0316584_0044247 3300036712 Bacteria 3320
578 Ga0316584_0060346 3300036712 Bacteria 2840
579 Ga0395899_0004597 3300037312 Bacteria 10759
580 Ga0395900_0039437 3300037418 Bacteria 4866
581 Ga0395905_0053747 3300037471 Bacteria 3769
582 Ga0395905_0083470 3300037471 Bacteria 2993
583 Ga0436364_0542377 3300037853 Bacteria 69584
584 Ga0395901_0042764 3300038443 Bacteria 4699
585 Ga0237819_00202 3300038705 Bacteria 21730
586 Ga0400490_16829 3300038726 Bacteria 6218
587 Ga0400483_031978 3300039062 Bacteria 104878
588 Ga0400483_088306 3300039062 Bacteria 112344
589 Ga0400483_194190 3300039062 Bacteria 89056
590 Ga0400483_291966 3300039062 Bacteria 3316
591 Ga0439441_005969 3300042001 Bacteria 1913
592 Ga0439455_0002922 3300042012 Bacteria 3194
593 Ga0450923_000640 3300042125 Bacteria 4049
594 Ga0439446_0012018 3300042156 Bacteria 2360
595 Ga0439458_0000366 3300042157 Bacteria 11347
596 Ga0439458_0015429 3300042157 Bacteria 1731
597 Ga0439435_0002575 3300042436 Bacteria 3628
598 Ga0439435_0011637 3300042436 Bacteria 2115
599 Ga0451577_0108054 3300042876 Bacteria 2487
600 Ga0466972_0001182 3300044658 Bacteria 12531
601 Ga0466971_0010442 3300044719 Bacteria 4058
602 Ga0451576_0001640 3300045051 Bacteria 37361
603 Ga0451576_0004783 3300045051 Bacteria 17357
604 Ga0495627_000198 3300046453 Bacteria 65997
605 Ga0495627_000519 3300046453 Bacteria 31884
606 Ga0495629_0104191 3300046459 Bacteria 1979
607 Ga0495638_0000012 3300046460 Bacteria 435577
608 Ga0495650_0000302 3300046471 Bacteria 89516
609 Ga0495662_0003397 3300046476 Bacteria 8069
610 Ga0495585_0002681 3300046492 Bacteria 12477
611 Ga0495596_0000247 3300046500 Bacteria 36077
612 Ga0495596_0011228 3300046500 Bacteria 3870
613 Ga0495583_0000796 3300046506 Bacteria 39053
614 Ga0495583_0001345 3300046506 Bacteria 25472
615 Ga0495583_0005024 3300046506 Bacteria 9156
616 Ga0495583_0007631 3300046506 Bacteria 6750
617 Ga0495583_0019839 3300046506 Bacteria 3499
618 Ga0495583_0028368 3300046506 Bacteria 2753
619 Ga0495606_0001599 3300046507 Bacteria 29536
620 Ga0495606_0022947 3300046507 Bacteria 4534
621 Ga0495610_0000050 3300046512 Bacteria 143781
622 Ga0495616_0000698 3300046513 Bacteria 24874
623 Ga0495630_0043625 3300046517 Bacteria 3351
624 Ga0495630_0045240 3300046517 Bacteria 3289
625 Ga0495632_0000076 3300046519 Bacteria 101121
626 Ga0495632_0004214 3300046519 Bacteria 9829
627 Ga0495637_0001954 3300046520 Bacteria 11647
628 Ga0495643_0000009 3300046522 Bacteria 344767
629 Ga0495643_0000036 3300046522 Bacteria 238374
630 Ga0495643_0001323 3300046522 Bacteria 23436
631 Ga0495643_0009838 3300046522 Bacteria 5914
632 Ga0495648_0000038 3300046524 Bacteria 191612
633 Ga0495648_0000961 3300046524 Bacteria 29733
634 Ga0495648_0028497 3300046524 Bacteria 3719
635 Ga0495648_0033200 3300046524 Bacteria 3374
636 Ga0495663_0000023 3300046525 Bacteria 105104
637 Ga0495642_0038527 3300046528 Bacteria 1937
638 Ga0495640_0025868 3300046533 Bacteria 4250
639 Ga0495640_0028980 3300046533 Bacteria 3980
640 Ga0495586_0053631 3300046535 Bacteria 2184
641 Ga0495621_0029444 3300046539 Bacteria 1872
642 Ga0495633_0000136 3300046558 Bacteria 97314
643 Ga0495633_0000770 3300046558 Bacteria 28708
644 Ga0495668_0000004 3300046616 Bacteria 574236
645 Ga0495668_0000016 3300046616 Bacteria 438197
646 Ga0495634_0042569 3300046642 Bacteria 3080
647 Ga0495625_0001219 3300046660 Bacteria 32635
648 Ga0495625_0002974 3300046660 Bacteria 17589
649 Ga0495625_0005534 3300046660 Bacteria 11479
650 Ga0495625_0014265 3300046660 Bacteria 6352
651 Ga0495625_0019483 3300046660 Bacteria 5262
652 Ga0495625_0086559 3300046660 Bacteria 2173
653 Ga0495635_0025699 3300046663 Bacteria 4103
654 Ga0495599_0063078 3300046678 Bacteria 2315
655 Ga0495669_0000050 3300046684 Bacteria 80688
656 Ga0495670_0005533 3300046691 Bacteria 6200
657 Ga0495670_0048955 3300046691 Bacteria 2114
658 Ga0495671_0000013 3300046692 Bacteria 344767
659 Ga0495671_0000034 3300046692 Bacteria 195385
660 Ga0495671_0001499 3300046692 Bacteria 15627
661 Ga0495600_0001875 3300046809 Bacteria 11796
662 Ga0495604_0120136 3300047317 Bacteria 1903
663 Ga0495680_0033086 3300047322 Bacteria 4190
664 Ga0495683_0000816 3300047323 Bacteria 22176
665 Ga0495683_0049724 3300047323 Bacteria 2099
666 Ga0495687_001300 3300047443 Bacteria 23447
667 Ga0495687_001654 3300047443 Bacteria 20024
668 Ga0495673_0000013 3300047469 Bacteria 612902
669 Ga0495681_0000095 3300047470 Bacteria 76975
670 Ga0495686_0000205 3300047472 Bacteria 110370
671 Ga0495686_0000623 3300047472 Bacteria 48691
672 Ga0495686_0001345 3300047472 Bacteria 27514
673 Ga0495686_0001391 3300047472 Bacteria 26822
674 Ga0495686_0014857 3300047472 Bacteria 5345
675 Ga0495626_0000585 3300048091 Bacteria 36107
676 Ga0496100_0010068 3300048903 Bacteria 5341
677 Ga0496102_0000432 3300048905 Bacteria 48412
678 Ga0496102_0004819 3300048905 Bacteria 11408
679 Ga0496103_0000131 3300048906 Bacteria 79787
680 Ga0496103_0000273 3300048906 Bacteria 49052
681 Ga0496103_0005817 3300048906 Bacteria 7364
682 Ga0496104_0001853 3300048907 Bacteria 18302
683 Ga0496104_0140318 3300048907 Bacteria 2321
684 Ga0496105_0001020 3300048908 Bacteria 19340
685 Ga0496105_0006038 3300048908 Bacteria 9264
686 Ga0496106_0010398 3300048909 Bacteria 6876
687 Ga0496108_0014688 3300048911 Bacteria 6392
688 Ga0496108_0067447 3300048911 Bacteria 3018
689 Ga0496110_0031029 3300048913 Bacteria 4610
690 Ga0496113_0001108 3300048916 Bacteria 14602
691 Ga0496114_0018506 3300048917 Bacteria 5633
692 Ga0496115_0000133 3300048918 Bacteria 67951
693 Ga0496116_0000149 3300048919 Bacteria 141841
694 Ga0496116_0005419 3300048919 Bacteria 11859
695 Ga0496117_0002127 3300048920 Bacteria 25909
696 Ga0496117_0011656 3300048920 Bacteria 7850
697 Ga0496117_0020980 3300048920 Bacteria 5308
698 Ga0496118_0000092 3300048921 Bacteria 169106
699 Ga0496118_0013801 3300048921 Bacteria 7608
700 Ga0496118_0043341 3300048921 Bacteria 3538
701 Ga0496119_0005121 3300048922 Bacteria 12704
702 Ga0496120_0026398 3300048923 Bacteria 3587
703 Ga0496121_0000024 3300048924 Bacteria 462959
704 Ga0496121_0000189 3300048924 Bacteria 137827
705 Ga0496121_0001791 3300048924 Bacteria 34731
706 Ga0496121_0002667 3300048924 Bacteria 26743
707 Ga0496122_0001386 3300048925 Bacteria 39301
708 Ga0496122_0005427 3300048925 Bacteria 15195
709 Ga0496122_0022791 3300048925 Bacteria 5553
710 Ga0496122_0068439 3300048925 Bacteria 2548
711 Ga0496123_0000830 3300048926 Bacteria 49505
712 Ga0496123_0002069 3300048926 Bacteria 25873
713 Ga0496123_0002500 3300048926 Bacteria 22648
714 Ga0496123_0002753 3300048926 Bacteria 21034
715 Ga0496123_0005714 3300048926 Bacteria 12394
716 Ga0496124_0000054 3300048927 Bacteria 252172
717 Ga0496124_0000081 3300048927 Bacteria 208413
718 Ga0496124_0000359 3300048927 Bacteria 83092
719 Ga0496124_0004393 3300048927 Bacteria 16474
720 Ga0496124_0019036 3300048927 Bacteria 6407
721 Ga0496124_0022506 3300048927 Bacteria 5774
722 Ga0496124_0064536 3300048927 Bacteria 3056
723 Ga0496125_0001583 3300048928 Bacteria 32310
724 Ga0496125_0002309 3300048928 Bacteria 25170
725 Ga0496125_0008215 3300048928 Bacteria 10974
726 Ga0496125_0025539 3300048928 Bacteria 5407
727 Ga0496125_0026648 3300048928 Bacteria 5259
728 Ga0496125_0028944 3300048928 Bacteria 4989
729 Ga0496125_0033703 3300048928 Bacteria 4526
730 Ga0496126_0000051 3300048929 Bacteria 313169
731 Ga0496126_0000261 3300048929 Bacteria 112027
732 Ga0496126_0000283 3300048929 Bacteria 107129
733 Ga0495682_0008959 3300049460 Bacteria 3925
734 Ga0501033_0004876 3300049570 Bacteria 10685
735 Ga0501034_0043337 3300049571 Bacteria 4554
736 Ga0501034_0121247 3300049571 Bacteria 2601
737 Ga0501036_0001610 3300049572 Bacteria 17448
738 Ga0501036_0019057 3300049572 Bacteria 5757
739 Ga0501038_0001458 3300049574 Bacteria 21746
740 Ga0501039_0008908 3300049575 Bacteria 7644
741 Ga0501039_0019991 3300049575 Bacteria 5133
742 Ga0501040_0000006 3300049576 Bacteria 97170
743 Ga0501040_0000585 3300049576 Bacteria 22231
744 Ga0501041_0000095 3300049577 Bacteria 35934
745 Ga0501041_0014252 3300049577 Bacteria 4720
746 Ga0501042_0000068 3300049578 Bacteria 37814
747 Ga0501042_0027633 3300049578 Bacteria 3990
748 Ga0501046_0001228 3300049580 Bacteria 24838
749 Ga0501047_0197578 3300049581 Bacteria 1873
750 Ga0501048_0005692 3300049582 Bacteria 9472
751 Ga0501071_0011317 3300049587 Bacteria 6007
752 Ga0501072_0014081 3300049588 Bacteria 6129
753 Ga0501074_0009554 3300049590 Bacteria 7044
754 Ga0501075_0011615 3300049591 Bacteria 6235
755 Ga0501075_0021100 3300049591 Bacteria 4746
756 Ga0501223_000072 3300049663 Bacteria 30438
757 Ga0501224_000004 3300049664 Bacteria 169090
758 Ga0501249_004637 3300049679 Bacteria 2794
759 Ga0501257_000019 3300049686 Bacteria 47149
760 Ga0501225_0000048 3300049705 Bacteria 40596
761 Ga0501234_000355 3300049707 Bacteria 6775
762 Ga0501079_0001670 3300049741 Bacteria 15775
763 Ga0501079_0119515 3300049741 Bacteria 2049
764 Ga0501081_0047224 3300049743 Bacteria 2962
765 Ga0501280_000003 3300049776 Bacteria 93762
766 Ga0501044_0003900 3300049823 Bacteria 16715
767 Ga0501044_0106924 3300049823 Bacteria 2809
768 Ga0501045_0000664 3300049824 Bacteria 21845
769 Ga0501045_0066308 3300049824 Bacteria 2651
770 Ga0501226_000018 3300049853 Bacteria 147268
771 nmdc:mga03683_13905_c1 3300050489 Bacteria 2969
772 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
773 nmdc:mga03n38_370_c1 3300050490 Bacteria 11027
774 nmdc:mga00v17_10869_c1 3300050491 Bacteria 4986
775 nmdc:mga00v17_1706_c1 3300050491 Bacteria 3284
776 nmdc:mga00v17_24700_c1 3300050491 Bacteria 3488
777 nmdc:mga0yw44_10385_c1 3300050492 Bacteria 4755
778 nmdc:mga0k408_19525_c1 3300050493 Bacteria 3789
779 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
780 nmdc:mga06z11_300_c1 3300050494 Bacteria 19031
781 nmdc:mga06z11_4264_c1 3300050494 Bacteria 5613
782 nmdc:mga04h51_121_c1 3300050495 Bacteria 23002
783 nmdc:mga07m45_16221_c1 3300050496 Bacteria 3987
784 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
785 nmdc:mga07m45_53129_c1 3300050496 Bacteria 2289
786 nmdc:mga07m45_67569_c1 3300050496 Bacteria 2031
787 nmdc:mga07m45_9_c1 3300050496 Bacteria 171776
788 nmdc:mga0qj67_76410_c1 3300050509 Bacteria 2679
789 nmdc:mga06r32_72610_c1 3300050510 Bacteria 3331
790 nmdc:mga06r32_85466_c1 3300050510 Bacteria 3076
791 nmdc:mga08y16_48677_c1 3300050511 Bacteria 4436
792 nmdc:mga0n895_10263_c1 3300050512 Bacteria 8257
793 nmdc:mga0n895_14847_c1 3300050512 Bacteria 7088
794 nmdc:mga0rr50_17543_c1 3300050513 Bacteria 4782
795 nmdc:mga0rr50_33414_c1 3300050513 Bacteria 3674
796 nmdc:mga0rr50_4319_c1 3300050513 Bacteria 8331
797 nmdc:mga08x19_1132_c1 3300050514 Bacteria 16629
798 nmdc:mga0a205_143329_c1 3300050515 Bacteria 2289
799 nmdc:mga0a205_147_c1 3300050515 Bacteria 45502
800 nmdc:mga0a205_2826_c1 3300050515 Bacteria 15366
801 nmdc:mga0sz30_1435_c1 3300050516 Bacteria 8513
802 nmdc:mga0sz30_84_c1 3300050516 Bacteria 36247
803 Ga0500610_0000260 3300053079 Bacteria 15921
804 Ga0500643_000143 3300053087 Bacteria 72166
805 Ga0500643_000147 3300053087 Bacteria 71589
806 Ga0500643_001346 3300053087 Bacteria 14309
807 Ga0500643_004690 3300053087 Bacteria 6085
808 Ga0500643_030216 3300053087 Bacteria 1661
809 Ga0500562_008309 3300053108 Bacteria 2622
810 Ga0500592_000973 3300053116 Bacteria 4672
811 Ga0500595_001409 3300053119 Bacteria 12904
812 Ga0500595_014046 3300053119 Bacteria 3050
813 Ga0500607_000152 3300053121 Bacteria 59345
814 Ga0500607_001970 3300053121 Bacteria 17449
815 Ga0500608_021845 3300053122 Bacteria 2961
816 Ga0500642_0000002 3300053130 Bacteria 795093
817 Ga0500642_0000371 3300053130 Bacteria 15124
818 Ga0500658_0022978 3300053134 Bacteria 2377
819 Ga0500564_001564 3300053138 Bacteria 7993
820 Ga0500622_0015279 3300053156 Bacteria 4114
821 Ga0500624_000003 3300053157 Bacteria 253364
822 Ga0500624_000026 3300053157 Bacteria 109681
823 Ga0500624_000070 3300053157 Bacteria 58939
824 Ga0500627_0000017 3300053158 Bacteria 119507
825 Ga0500627_0000040 3300053158 Bacteria 68950
826 Ga0500636_0007959 3300053177 Bacteria 6131
827 Ga0500636_0009697 3300053177 Bacteria 5606
828 Ga0500637_0000045 3300053178 Bacteria 44699
829 Ga0500567_000636 3300053723 Bacteria 12668
830 Ga0500570_004642 3300053724 Bacteria 7259
831 Ga0500625_000014 3300053729 Bacteria 109364
832 Ga0500645_000221 3300053730 Bacteria 43327
833 Ga0500645_001756 3300053730 Bacteria 10510
834 Ga0500645_004518 3300053730 Bacteria 5311
835 Ga0501084_0012758 3300054114 Bacteria 6961
836 Ga0501082_0003521 3300060353 Bacteria 13678
837 Ga0501082_0011432 3300060353 Bacteria 7637
838 Ga0501082_0059779 3300060353 Bacteria 3284
839 Ga0501082_0135088 3300060353 Bacteria 2140
840 Ga0466962_0016226 3300061719 Bacteria 3592
841 Ga0530510_0034564 3300061734 Bacteria 3642
842 2511129875 2510917021 Bacteria 5705459
843 2600201320 2599185354 Bacteria 4398675
844 2643820599 2643221560 Bacteria 4801179
845 2643836443 2643221563 Bacteria 4726935
846 2643951117 2643221588 Bacteria 3692460
847 2644052919 2643221608 Bacteria 4724829
848 2738710524 2738541275 Bacteria 4830863
849 2738848949 2738541301 Bacteria 4834102
850 2738864678 2738541304 Bacteria 4833665
851 2739297196 2738543022 Bacteria 4835059
852 2739358874 2738543033 Bacteria 4833336
853 2739650775 2739367664 Bacteria 4114334
854 2740029248 2739367865 Bacteria 4114482
855 2753767443 2751185897 Bacteria 5322941
856 2809083369 2808606405 Bacteria 4586632
857 2819551054 2818991438 Bacteria 5793701
858 2852654041 2852653556 Bacteria 4050083
859 2852684616 2852680915 Bacteria 4100189
860 2882809210 2882806704 Bacteria 3007728
861 2895881063 2895880812 Bacteria 11255272
862 2896186171 2896184354 Bacteria 3258548
863 2896253511 2896253425 Bacteria 3418029
864 2919138926 2919138771 Bacteria 5281312
865 2928100624 2928100450 Bacteria 4837635
866 2928960686 2928959182 Bacteria 4725774
867 3000867394 3000865235 Bacteria 3106258
868 8054304029 8054302542 Bacteria 5698134
869 8057101684 8057101203 Bacteria 5034064
870 Ga0501038_0054694
871 SwRhRL2b_contig_1676211
872 SwRhRL2b_contig_2205719
873 JGI24736J21556_1001131
874 JGI24741J21665_1000273
875 JGI24741J21665_1006209
876 JGI24752J21851_1000148
877 JGI24740J21852_10004672
878 JGI24739J22299_10027214
879 JGI24739J22299_10030387
880 JGI24737J22298_10000602
881 JGI24737J22298_10005143
882 JGI24735J21928_10002161
883 JGI24735J21928_10004848
884 JGI24735J21928_10017651
885 JGI24750J21931_1000219
886 JGI24748J21848_1000033
887 JGI24738J21930_10001556
888 JGI24738J21930_10005865
889 JGI24034J26672_10000032
890 JGI24751J29686_10000294
891 JGI24751J29686_10000300
892 JGI25165J46597_1000112
893 JGI25165J46597_1000208
894 JGI25153J46596_10000021
895 Ga0055525_1000012
896 Ga0055542_1000094
897 Ga0055529_1000045
898 Ga0055530_10000012
899 Ga0055531_10000683
900 Ga0055531_10008207
901 Ga0065704_10001118
902 Ga0065704_10070157
903 Ga0065704_10072849
904 Ga0065704_10084202
905 Ga0065707_10090686
906 Ga0065707_10109048
907 Ga0065707_10117965
908 Ga0070658_10000458
909 Ga0070658_10000836
910 Ga0070658_10004043
911 Ga0070658_10006558
912 Ga0070658_10007863
913 Ga0070658_10020858
914 Ga0070683_100095632
915 Ga0070683_100114256
916 Ga0070690_100000011
917 Ga0070670_100000005
918 Ga0070670_100006954
919 Ga0070670_100007353
920 Ga0070670_100049091
921 Ga0068869_100003111
922 Ga0070666_10000035
923 Ga0070666_10002111
924 Ga0070666_10008945
925 Ga0070666_10026137
926 Ga0070680_100008920
927 Ga0068868_100005495
928 Ga0070660_100000189
929 Ga0070660_100003680
930 Ga0070660_100018015
931 Ga0070660_100021802
932 Ga0070689_100055226
933 Ga0070689_100056972
934 Ga0070691_10005094
935 Ga0070661_100014248
936 Ga0070668_100000006
937 Ga0070668_100000353
938 Ga0070668_100014918
939 Ga0070668_100019348
940 Ga0070668_100152583
941 Ga0070669_100000004
942 Ga0070669_100000056
943 Ga0070669_100000057
944 Ga0070669_100000131
945 Ga0070669_100001055
946 Ga0070669_100002210
947 Ga0070669_100007970
948 Ga0070669_100041884
949 Ga0070669_100083357
950 Ga0070671_100000005
951 Ga0070671_100000029
952 Ga0070671_100000048
953 Ga0070671_100000120
954 Ga0070671_100002408
955 Ga0070671_100004738
956 Ga0070671_100147837
957 Ga0070674_100003272
958 Ga0070674_100014453
959 Ga0070674_100017329
960 Ga0070674_100043506
961 Ga0070673_100000001
962 Ga0070688_100024329
963 Ga0070659_100006689
964 Ga0070659_100020629
965 Ga0070659_100130365
966 Ga0070667_100000003
967 Ga0070667_100000160
968 Ga0070667_100000230
969 Ga0070667_100000754
970 Ga0070667_100002904
971 Ga0070667_100091332
972 Ga0070700_100000952
973 Ga0070663_100004055
974 Ga0070663_100055307
975 Ga0070678_100000149
976 Ga0070678_100090486
977 Ga0070662_100000798
978 Ga0070681_10008953
979 Ga0068867_100008341
980 Ga0068867_100038002
981 Ga0070685_10000850
982 Ga0070707_100176737
983 Ga0070679_100007721
984 Ga0068853_100000627
985 Ga0068853_100015261
986 Ga0068853_100086748
987 Ga0070672_100005821
988 Ga0070672_100053838
989 Ga0070686_100000035
990 Ga0070665_100000021
991 Ga0070665_100000101
992 Ga0070665_100000161
993 Ga0070665_100000256
994 Ga0070665_100012473
995 Ga0070665_100014399
996 Ga0068855_100022825
997 Ga0068855_100042837
998 Ga0068855_100092695
999 Ga0070664_100009808
1000 Ga0068857_100018688
1001 Ga0068857_100021544
1002 Ga0068854_100000547
1003 Ga0068854_100006245
1004 Ga0068856_100003378
1005 Ga0068856_100014543
1006 Ga0068856_100042659
1007 Ga0068856_100059073
1008 Ga0068852_100000259
1009 Ga0068852_100002971
1010 Ga0068859_100000233
1011 Ga0068859_100009239
1012 Ga0068859_100013351
1013 Ga0068859_100026211
1014 Ga0068864_100000011
1015 Ga0068864_100000211
1016 Ga0068864_100003942
1017 Ga0068864_100009425
1018 Ga0068866_10028308
1019 Ga0068861_100001267
1020 Ga0068861_100003944
1021 Ga0068861_100008325
1022 Ga0068851_10013600
1023 Ga0068870_10049358
1024 Ga0068863_100000060
1025 Ga0068863_100000132
1026 Ga0068863_100000413
1027 Ga0068863_100000466
1028 Ga0068863_100002604
1029 Ga0068863_100013665
1030 Ga0068863_100014019
1031 Ga0068863_100015742
1032 Ga0068863_100067443
1033 Ga0068863_100076595
1034 Ga0068858_100001744
1035 Ga0068858_100008838
1036 Ga0068858_100012341
1037 Ga0068858_100014825
1038 Ga0068858_100036669
1039 Ga0068858_100153978
1040 Ga0068860_100000068
1041 Ga0068860_100000126
1042 Ga0068860_100000220
1043 Ga0068860_100000473
1044 Ga0068860_100021108
1045 Ga0068860_100072066
1046 Ga0068860_100214113
1047 Ga0068862_100000011
1048 Ga0068862_100000146
1049 Ga0068862_100000151
1050 Ga0068862_100000198
1051 Ga0068862_100000267
1052 Ga0068862_100000581
1053 Ga0068862_100003219
1054 Ga0068862_100011508
1055 Ga0068862_100018624
1056 Ga0068862_100152074
1057 Ga0081455_10000049
1058 Ga0081539_10003331
1059 Ga0075368_10000894
1060 Ga0075368_10001248
1061 Ga0075363_100001087
1062 Ga0075363_100008716
1063 Ga0075363_100011878
1064 Ga0075364_10000812
1065 Ga0075362_10000043
1066 Ga0075362_10004251
1067 Ga0075369_10000422
1068 Ga0075369_10009323
1069 Ga0075366_10000832
1070 Ga0075366_10002410
1071 Ga0075366_10023371
1072 Ga0075370_10000241
1073 Ga0075370_10018445
1074 Ga0075370_10031397
1075 Ga0075370_10044080
1076 Ga0075370_10061587
1077 Ga0068871_100009681
1078 Ga0075434_100000891
1079 Ga0075434_100003634
1080 Ga0075434_100013292
1081 Ga0075429_100069504
1082 Ga0068865_100000072
1083 Ga0075436_100000248
1084 Ga0097620_100000233
1085 Ga0097620_100009239
1086 Ga0097620_100013351
1087 Ga0097620_100026210
1088 Ga0097620_100034635
1089 Ga0075435_100001418
1090 Ga0075435_100003277
1091 Ga0105251_10002944
1092 Ga0105251_10004465
1093 Ga0105251_10012746
1094 Ga0105250_10005824
1095 Ga0105240_10007916
1096 Ga0105240_10009609
1097 Ga0105240_10045358
1098 Ga0105240_10061597
1099 Ga0111539_10003392
1100 Ga0111539_10022382
1101 Ga0111539_10029850
1102 Ga0105245_10008667
1103 Ga0105245_10010317
1104 Ga0105247_10004800
1105 Ga0105247_10025811
1106 Ga0105247_10036253
1107 Ga0114129_10082268
1108 Ga0105243_10000512
1109 Ga0105243_10007320
1110 Ga0105243_10014674
1111 Ga0105243_10056287
1112 Ga0105241_10022767
1113 Ga0105242_10000178
1114 Ga0105248_10000012
1115 Ga0105248_10000406
1116 Ga0105248_10013202
1117 Ga0105248_10014880
1118 Ga0105248_10044831
1119 Ga0105248_10075835
1120 Ga0105237_10000626
1121 Ga0105238_10284719
1122 Ga0105249_10000015
1123 Ga0105249_10000094
1124 Ga0105249_10002709
1125 Ga0105249_10003676
1126 Ga0105249_10025943
1127 Ga0105148_100001
1128 Ga0105239_10000438
1129 Ga0105239_10027754
1130 Ga0105246_10000074
1131 Ga0105246_10007060
1132 Ga0157371_10000032
1133 Ga0157371_10001651
1134 Ga0157370_10000213
1135 Ga0157370_10078843
1136 Ga0157369_10000384
1137 Ga0157378_10007434
1138 Ga0163162_10054081
1139 Ga0163162_10056077
1140 Ga0163162_10056710
1141 Ga0163162_10069879
1142 Ga0163162_10222910
1143 Ga0157372_10020739
1144 Ga0157372_10107406
1145 Ga0157375_10006006
1146 Ga0157380_10000031
1147 Ga0157380_10000484
1148 Ga0157380_10039808
1149 Ga0157379_10025953
1150 Ga0183363_1006
1151 Ga0163161_10000195
1152 Ga0163161_10016583
1153 Ga0213875_10003072
1154 Ga0207672_1000484
1155 Ga0209147_100577
1156 Ga0209563_100030
1157 Ga0207427_100704
1158 Ga0209437_108363
1159 Ga0209677_106107
1160 Ga0209148_1000011
1161 Ga0209148_1000133
1162 Ga0209148_1001460
1163 Ga0209233_1000078
1164 Ga0209233_1000186
1165 Ga0209455_1000006
1166 Ga0209455_1003196
1167 Ga0209675_1000472
1168 Ga0209676_1000226
1169 Ga0209676_1000387
1170 Ga0209676_1000760
1171 Ga0209025_1008935
1172 Ga0209758_1000023
1173 Ga0209050_1000450
1174 Ga0209050_1000474
1175 Ga0209257_1000130
1176 Ga0209257_1000581
1177 Ga0207697_10000101
1178 Ga0207697_10016613
1179 Ga0207656_10000615
1180 Ga0207713_1002507
1181 Ga0207713_1005597
1182 Ga0207713_1006927
1183 Ga0207713_1044654
1184 Ga0207710_10011802
1185 Ga0207680_10000007
1186 Ga0207680_10000089
1187 Ga0207680_10001062
1188 Ga0207680_10043603
1189 Ga0207647_10006630
1190 Ga0207647_10007467
1191 Ga0207645_10000736
1192 Ga0207643_10037095
1193 Ga0207705_10000007
1194 Ga0207705_10000018
1195 Ga0207705_10001048
1196 Ga0207705_10001219
1197 Ga0207705_10006362
1198 Ga0207705_10018297
1199 Ga0207705_10036863
1200 Ga0207705_10081879
1201 Ga0207705_10123453
1202 Ga0207654_10001636
1203 Ga0207695_10007635
1204 Ga0207695_10124511
1205 Ga0207671_10000596
1206 Ga0207671_10005662
1207 Ga0207671_10009066
1208 Ga0207671_10036902
1209 Ga0207660_10022394
1210 Ga0207660_10050816
1211 Ga0207657_10000156
1212 Ga0207657_10000507
1213 Ga0207657_10006147
1214 Ga0207649_10003922
1215 Ga0207649_10004027
1216 Ga0207652_10021467
1217 Ga0207646_10152246
1218 Ga0207681_10000001
1219 Ga0207681_10000010
1220 Ga0207681_10000019
1221 Ga0207681_10000053
1222 Ga0207681_10000224
1223 Ga0207681_10000288
1224 Ga0207681_10000578
1225 Ga0207681_10006398
1226 Ga0207681_10016986
1227 Ga0207681_10032395
1228 Ga0207681_10037009
1229 Ga0207694_10077662
1230 Ga0207650_10000018
1231 Ga0207650_10000249
1232 Ga0207650_10009614
1233 Ga0207650_10026619
1234 Ga0207687_10010013
1235 Ga0207687_10021302
1236 Ga0207644_10000007
1237 Ga0207644_10000008
1238 Ga0207644_10000911
1239 Ga0207644_10002772
1240 Ga0207644_10012636
1241 Ga0207644_10015708
1242 Ga0207690_10006409
1243 Ga0207690_10034263
1244 Ga0207706_10001346
1245 Ga0207706_10003722
1246 Ga0207706_10022565
1247 Ga0207706_10050483
1248 Ga0207709_10000145
1249 Ga0207709_10003291
1250 Ga0207709_10010876
1251 Ga0207709_10049300
1252 Ga0207670_10037917
1253 Ga0207669_10000118
1254 Ga0207669_10000784
1255 Ga0207704_10000032
1256 Ga0207704_10003755
1257 Ga0207691_10076134
1258 Ga0207691_10121895
1259 Ga0207711_10000004
1260 Ga0207711_10000382
1261 Ga0207711_10003989
1262 Ga0207711_10005707
1263 Ga0207711_10008959
1264 Ga0207711_10011608
1265 Ga0207711_10028532
1266 Ga0207711_10044809
1267 Ga0207689_10000840
1268 Ga0207679_10042816
1269 Ga0207667_10000002
1270 Ga0207667_10000013
1271 Ga0207667_10004614
1272 Ga0207667_10005831
1273 Ga0207667_10014586
1274 Ga0207667_10028292
1275 Ga0207667_10078892
1276 Ga0207667_10130160
1277 Ga0207651_10000001
1278 Ga0207651_10103787
1279 Ga0207712_10000004
1280 Ga0207712_10000023
1281 Ga0207712_10001574
1282 Ga0207712_10001688
1283 Ga0207712_10071483
1284 Ga0207668_10000026
1285 Ga0207668_10000244
1286 Ga0207668_10002820
1287 Ga0207668_10011271
1288 Ga0207640_10000392
1289 Ga0207640_10000809
1290 Ga0207640_10002033
1291 Ga0207640_10007509
1292 Ga0207640_10025536
1293 Ga0207640_10059855
1294 Ga0207640_10064677
1295 Ga0207658_10000002
1296 Ga0207658_10000064
1297 Ga0207658_10000204
1298 Ga0207658_10000230
1299 Ga0207658_10000587
1300 Ga0207658_10001492
1301 Ga0207658_10001874
1302 Ga0207658_10065053
1303 Ga0207658_10107535
1304 Ga0207677_10000209
1305 Ga0207703_10000489
1306 Ga0207703_10000510
1307 Ga0207703_10001171
1308 Ga0207703_10002081
1309 Ga0207703_10009847
1310 Ga0207703_10041168
1311 Ga0207639_10000808
1312 Ga0207639_10001024
1313 Ga0207639_10004520
1314 Ga0207639_10018354
1315 Ga0207639_10057664
1316 Ga0207678_10002991
1317 Ga0207678_10007603
1318 Ga0207678_10011131
1319 Ga0207678_10037279
1320 Ga0207708_10007087
1321 Ga0207708_10021025
1322 Ga0207702_10001204
1323 Ga0207702_10007553
1324 Ga0207702_10014752
1325 Ga0207702_10194195
1326 Ga0207641_10000010
1327 Ga0207641_10000050
1328 Ga0207641_10000098
1329 Ga0207641_10000100
1330 Ga0207641_10000607
1331 Ga0207641_10003216
1332 Ga0207641_10004086
1333 Ga0207641_10008306
1334 Ga0207641_10010984
1335 Ga0207648_10001521
1336 Ga0207648_10002650
1337 Ga0207648_10084660
1338 Ga0207676_10000004
1339 Ga0207676_10000046
1340 Ga0207676_10001192
1341 Ga0207676_10004670
1342 Ga0207676_10023338
1343 Ga0207674_10032027
1344 Ga0207674_10074045
1345 Ga0207675_100000418
1346 Ga0207675_100002120
1347 Ga0207675_100004105
1348 Ga0207675_100008435
1349 Ga0207675_100010029
1350 Ga0207683_10000881
1351 Ga0207683_10044107
1352 Ga0207698_10000036
1353 Ga0207698_10002649
1354 Ga0207698_10025231
1355 Ga0207698_10058790
1356 Ga0209982_1000469
1357 Ga0209983_1000372
1358 Ga0209971_1000479
1359 Ga0209998_10003268
1360 Ga0209813_10000019
1361 Ga0209813_10000027
1362 Ga0209974_10000433
1363 Ga0209974_10017864
1364 Ga0207428_10015046
1365 Ga0268266_10000015
1366 Ga0268266_10000040
1367 Ga0268266_10001320
1368 Ga0268266_10002221
1369 Ga0268266_10035008
1370 Ga0268266_10060181
1371 Ga0268266_10091313
1372 Ga0268265_10000002
1373 Ga0268265_10000021
1374 Ga0268265_10000026
1375 Ga0268265_10000128
1376 Ga0268265_10001138
1377 Ga0268265_10005503
1378 Ga0268265_10012215
1379 Ga0268265_10030522
1380 Ga0268265_10103097
1381 Ga0268264_10000003
1382 Ga0268264_10000103
1383 Ga0268264_10000106
1384 Ga0268264_10000224
1385 Ga0268264_10000384
1386 Ga0268264_10000682
1387 Ga0268264_10002280
1388 Ga0268264_10005337
1389 Ga0268264_10051042
1390 Ga0307517_10033350
1391 Ga0307511_10002452
1392 Ga0265327_10010384
1393 Ga0307513_10041093
1394 Ga0307513_10107692
1395 Ga0307408_100000518
1396 Ga0307408_100002503
1397 Ga0307408_100008036
1398 Ga0307408_100059075
1399 Ga0307508_10000405
1400 Ga0307508_10035420
1401 Ga0316576_10017527
1402 Ga0316576_10117900
1403 Ga0307405_10002305
1404 Ga0307405_10018466
1405 Ga0307405_10019681
1406 Ga0307413_10010529
1407 Ga0307413_10058537
1408 Ga0307413_10061666
1409 Ga0307413_10106937
1410 Ga0307413_10107111
1411 Ga0307410_10006414
1412 Ga0307406_10000892
1413 Ga0307406_10034258
1414 Ga0307406_10056538
1415 Ga0307407_10029276
1416 Ga0307412_10000495
1417 Ga0307412_10002706
1418 Ga0307412_10008473
1419 Ga0307412_10012668
1420 Ga0307412_10018302
1421 Ga0307409_100008074
1422 Ga0307409_100088996
1423 Ga0307409_100095618
1424 Ga0307416_100007406
1425 Ga0307416_100009769
1426 Ga0307416_100032065
1427 Ga0307416_100066731
1428 Ga0307414_10000211
1429 Ga0307414_10000684
1430 Ga0307414_10002264
1431 Ga0307414_10037581
1432 Ga0307414_10045913
1433 Ga0307414_10184308
1434 Ga0307411_10032214
1435 Ga0307411_10033629
1436 Ga0307411_10055325
1437 Ga0307415_100003211
1438 Ga0316583_10030455
1439 Ga0316580_10020965
1440 Ga0307510_10015830
1441 Ga0373932_0010942
1442 Ga0316574_0030859
1443 Ga0316574_0084865
1444 Ga0316582_0000396
1445 Ga0316582_0100841
1446 Ga0316584_0044247
1447 Ga0316584_0060346
1448 Ga0395899_0004597
1449 Ga0395900_0039437
1450 Ga0395905_0053747
1451 Ga0395905_0083470
1452 Ga0436364_0542377
1453 Ga0395901_0042764
1454 Ga0237819_00202
1455 Ga0400490_16829
1456 Ga0400483_031978
1457 Ga0400483_088306
1458 Ga0400483_194190
1459 Ga0400483_291966
1460 Ga0439441_005969
1461 Ga0439455_0002922
1462 Ga0450923_000640
1463 Ga0439446_0012018
1464 Ga0439458_0000366
1465 Ga0439458_0015429
1466 Ga0439435_0002575
1467 Ga0439435_0011637
1468 Ga0451577_0108054
1469 Ga0466972_0001182
1470 Ga0466971_0010442
1471 Ga0451576_0001640
1472 Ga0451576_0004783
1473 Ga0495627_000198
1474 Ga0495627_000519
1475 Ga0495629_0104191
1476 Ga0495638_0000012
1477 Ga0495650_0000302
1478 Ga0495662_0003397
1479 Ga0495585_0002681
1480 Ga0495596_0000247
1481 Ga0495596_0011228
1482 Ga0495583_0000796
1483 Ga0495583_0001345
1484 Ga0495583_0005024
1485 Ga0495583_0007631
1486 Ga0495583_0019839
1487 Ga0495583_0028368
1488 Ga0495606_0001599
1489 Ga0495606_0022947
1490 Ga0495610_0000050
1491 Ga0495616_0000698
1492 Ga0495630_0043625
1493 Ga0495630_0045240
1494 Ga0495632_0000076
1495 Ga0495632_0004214
1496 Ga0495637_0001954
1497 Ga0495643_0000009
1498 Ga0495643_0000036
1499 Ga0495643_0001323
1500 Ga0495643_0009838
1501 Ga0495648_0000038
1502 Ga0495648_0000961
1503 Ga0495648_0028497
1504 Ga0495648_0033200
1505 Ga0495663_0000023
1506 Ga0495642_0038527
1507 Ga0495640_0025868
1508 Ga0495640_0028980
1509 Ga0495586_0053631
1510 Ga0495621_0029444
1511 Ga0495633_0000136
1512 Ga0495633_0000770
1513 Ga0495668_0000004
1514 Ga0495668_0000016
1515 Ga0495634_0042569
1516 Ga0495625_0001219
1517 Ga0495625_0002974
1518 Ga0495625_0005534
1519 Ga0495625_0014265
1520 Ga0495625_0019483
1521 Ga0495625_0086559
1522 Ga0495635_0025699
1523 Ga0495599_0063078
1524 Ga0495669_0000050
1525 Ga0495670_0005533
1526 Ga0495670_0048955
1527 Ga0495671_0000013
1528 Ga0495671_0000034
1529 Ga0495671_0001499
1530 Ga0495600_0001875
1531 Ga0495604_0120136
1532 Ga0495680_0033086
1533 Ga0495683_0000816
1534 Ga0495683_0049724
1535 Ga0495687_001300
1536 Ga0495687_001654
1537 Ga0495673_0000013
1538 Ga0495681_0000095
1539 Ga0495686_0000205
1540 Ga0495686_0000623
1541 Ga0495686_0001345
1542 Ga0495686_0001391
1543 Ga0495686_0014857
1544 Ga0495626_0000585
1545 Ga0496100_0010068
1546 Ga0496102_0000432
1547 Ga0496102_0004819
1548 Ga0496103_0000131
1549 Ga0496103_0000273
1550 Ga0496103_0005817
1551 Ga0496104_0001853
1552 Ga0496104_0140318
1553 Ga0496105_0001020
1554 Ga0496105_0006038
1555 Ga0496106_0010398
1556 Ga0496108_0014688
1557 Ga0496108_0067447
1558 Ga0496110_0031029
1559 Ga0496113_0001108
1560 Ga0496114_0018506
1561 Ga0496115_0000133
1562 Ga0496116_0000149
1563 Ga0496116_0005419
1564 Ga0496117_0002127
1565 Ga0496117_0011656
1566 Ga0496117_0020980
1567 Ga0496118_0000092
1568 Ga0496118_0013801
1569 Ga0496118_0043341
1570 Ga0496119_0005121
1571 Ga0496120_0026398
1572 Ga0496121_0000024
1573 Ga0496121_0000189
1574 Ga0496121_0001791
1575 Ga0496121_0002667
1576 Ga0496122_0001386
1577 Ga0496122_0005427
1578 Ga0496122_0022791
1579 Ga0496122_0068439
1580 Ga0496123_0000830
1581 Ga0496123_0002069
1582 Ga0496123_0002500
1583 Ga0496123_0002753
1584 Ga0496123_0005714
1585 Ga0496124_0000054
1586 Ga0496124_0000081
1587 Ga0496124_0000359
1588 Ga0496124_0004393
1589 Ga0496124_0019036
1590 Ga0496124_0022506
1591 Ga0496124_0064536
1592 Ga0496125_0001583
1593 Ga0496125_0002309
1594 Ga0496125_0008215
1595 Ga0496125_0025539
1596 Ga0496125_0026648
1597 Ga0496125_0028944
1598 Ga0496125_0033703
1599 Ga0496126_0000051
1600 Ga0496126_0000261
1601 Ga0496126_0000283
1602 Ga0495682_0008959
1603 Ga0501033_0004876
1604 Ga0501034_0043337
1605 Ga0501034_0121247
1606 Ga0501036_0001610
1607 Ga0501036_0019057
1608 Ga0501038_0001458
1609 Ga0501039_0008908
1610 Ga0501039_0019991
1611 Ga0501040_0000006
1612 Ga0501040_0000585
1613 Ga0501041_0000095
1614 Ga0501041_0014252
1615 Ga0501042_0000068
1616 Ga0501042_0027633
1617 Ga0501046_0001228
1618 Ga0501047_0197578
1619 Ga0501048_0005692
1620 Ga0501071_0011317
1621 Ga0501072_0014081
1622 Ga0501074_0009554
1623 Ga0501075_0011615
1624 Ga0501075_0021100
1625 Ga0501223_000072
1626 Ga0501224_000004
1627 Ga0501249_004637
1628 Ga0501257_000019
1629 Ga0501225_0000048
1630 Ga0501234_000355
1631 Ga0501079_0001670
1632 Ga0501079_0119515
1633 Ga0501081_0047224
1634 Ga0501280_000003
1635 Ga0501044_0003900
1636 Ga0501044_0106924
1637 Ga0501045_0000664
1638 Ga0501045_0066308
1639 Ga0501226_000018
1640 nmdc:mga03683_13905_c1
1641 nmdc:mga03683_3_c1
1642 nmdc:mga03n38_370_c1
1643 nmdc:mga00v17_10869_c1
1644 nmdc:mga00v17_1706_c1
1645 nmdc:mga00v17_24700_c1
1646 nmdc:mga0yw44_10385_c1
1647 nmdc:mga0k408_19525_c1
1648 nmdc:mga0k408_2_c1
1649 nmdc:mga06z11_300_c1
1650 nmdc:mga06z11_4264_c1
1651 nmdc:mga04h51_121_c1
1652 nmdc:mga07m45_16221_c1
1653 nmdc:mga07m45_1_c1
1654 nmdc:mga07m45_53129_c1
1655 nmdc:mga07m45_67569_c1
1656 nmdc:mga07m45_9_c1
1657 nmdc:mga0qj67_76410_c1
1658 nmdc:mga06r32_72610_c1
1659 nmdc:mga06r32_85466_c1
1660 nmdc:mga08y16_48677_c1
1661 nmdc:mga0n895_10263_c1
1662 nmdc:mga0n895_14847_c1
1663 nmdc:mga0rr50_17543_c1
1664 nmdc:mga0rr50_33414_c1
1665 nmdc:mga0rr50_4319_c1
1666 nmdc:mga08x19_1132_c1
1667 nmdc:mga0a205_143329_c1
1668 nmdc:mga0a205_147_c1
1669 nmdc:mga0a205_2826_c1
1670 nmdc:mga0sz30_1435_c1
1671 nmdc:mga0sz30_84_c1
1672 Ga0500610_0000260
1673 Ga0500643_000143
1674 Ga0500643_000147
1675 Ga0500643_001346
1676 Ga0500643_004690
1677 Ga0500643_030216
1678 Ga0500562_008309
1679 Ga0500592_000973
1680 Ga0500595_001409
1681 Ga0500595_014046
1682 Ga0500607_000152
1683 Ga0500607_001970
1684 Ga0500608_021845
1685 Ga0500642_0000002
1686 Ga0500642_0000371
1687 Ga0500658_0022978
1688 Ga0500564_001564
1689 Ga0500622_0015279
1690 Ga0500624_000003
1691 Ga0500624_000026
1692 Ga0500624_000070
1693 Ga0500627_0000017
1694 Ga0500627_0000040
1695 Ga0500636_0007959
1696 Ga0500636_0009697
1697 Ga0500637_0000045
1698 Ga0500567_000636
1699 Ga0500570_004642
1700 Ga0500625_000014
1701 Ga0500645_000221
1702 Ga0500645_001756
1703 Ga0500645_004518
1704 Ga0501084_0012758
1705 Ga0501082_0003521
1706 Ga0501082_0011432
1707 Ga0501082_0059779
1708 Ga0501082_0135088
1709 Ga0466962_0016226
1710 Ga0530510_0034564
1711 2511129875
1712 2600201320
1713 2643820599
1714 2643836443
1715 2643951117
1716 2644052919
1717 2738710524
1718 2738848949
1719 2738864678
1720 2739297196
1721 2739358874
1722 2739650775
1723 2740029248
1724 2753767443
1725 2809083369
1726 2819551054
1727 2852654041
1728 2852684616
1729 2882809210
1730 2895881063
1731 2896186171
1732 2896253511
1733 2919138926
1734 2928100624
1735 2928960686
1736 3000867394
1737 8054304029
1738 8057101684

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05683

Fumerase_C

Fumarase C-terminus

289

489

0.97

PF05681

Fumerase

Fumarate hydratase (Fumerase)

10

286

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xky-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.8888 12 290
7xky-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.8735 12 290
5dni-assembly2.cif.gz_B crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit 0.8464 316 488
6uq9-assembly1.cif.gz_A crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.821 6 492
6uql-assembly1.cif.gz_B crystal structure of r471a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.8205 6 492
ID Description Score Start End Superfamily
af_E9AH43_359_548_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8452 313 486 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8158 316 488 3.20.130.10
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7927 401 435 3.40.140.10
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.7909 316 488 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.7865 316 488 3.20.130.10
ID Description Score Start End GO Terms
AF-A0A3C0TCW2-F1-model_v4 Fumarate hydratase 0.9864 4 285 GO:0016829
GO:0046872
GO:0051539
AF-A0A2D5CI99-F1-model_v4 deleted 0.9842 4 278
AF-A0A349KRR0-F1-model_v4 Fumarate hydratase 0.9836 4 276 GO:0016829
GO:0046872
GO:0051539
AF-A0A536ZL77-F1-model_v4 Fumarate hydratase 0.9833 4 307 GO:0016829
GO:0046872
GO:0051539
AF-A0A3C0TCW2-F1-model_v4 Fumarate hydratase 0.983 4 285 GO:0016829
GO:0046872
GO:0051539

Map