F484132
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 391 | 1738 | 508 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0054694|Ga0501038_0054694_1496_3016 |
| Length | 506 |
| Sequence | MTVIKAADLIESVADALQYISYYHPMDYIKALGEAYEAEQGPAAKDAIAQILTNSRMCAEGHRPICQDTGIVNVFVKWGMDCRLDDTSRPLQDIVDEGVRRAYLHPENRLRASVLRDPAFSRQNTKDNTPCVLTVEMVPGNKVTVDVAAKGGGSENKSKFKMMNPSDSIVDWVLEMIPQMGAGWCPPGMLGIGIGGTAEKAVALAKESLMEPIDMGPLKARGPQNDIEALRIEIFDKVNALGIGAQGLGGLSTILDVKILDWPCHAAGKPVAMIPNCAATRHAHFTLDGSGPTYLDPPNLDEWPDVNWTPDKAAIRVDLDALTPELVQSWKQGDRLLLNGKMLTGRDAAHKRIQDMLAKGEQLPVEFKGRVIYYVGPVDPVGEEVVGPAGPTTATRMDKFTRMMLEQGLLAMVGKAERGPMAVEAIRDHQSAYLMAVGGAAYLVARAIKGSKVVGFEDLGMEAIYEFEVKDFPVTVAVDSEGNNVHHLAPLVWKEKIAKEGLLEKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 213 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 218 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 225 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 228 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 229 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 230 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 231 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 316 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 317 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 325 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 330 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 343 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 345 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 347 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 352 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 353 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 356 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 357 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 358 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 359 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 363 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 364 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 365 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 366 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 367 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 368 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 369 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 370 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 371 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 372 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 373 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 374 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 375 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 376 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 377 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 378 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 379 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 380 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 381 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 382 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 383 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 384 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 385 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 386 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 387 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 388 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 389 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 390 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 391 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.78 |
| Metatranscriptomes | 0 |
| Isolates | 3.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.74 |
| Nodule | 0 |
| Rhizoplane | 2.07 |
| Rhizosphere | 78.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501038_0054694 | 3300049574 | Bacteria | 3432 |
| 2 | SwRhRL2b_contig_1676211 | 2162886007 | Bacteria | 9384 |
| 3 | SwRhRL2b_contig_2205719 | 2162886007 | Bacteria | 4966 |
| 4 | JGI24736J21556_1001131 | 3300001904 | Bacteria | 4891 |
| 5 | JGI24741J21665_1000273 | 3300001915 | Bacteria | 15469 |
| 6 | JGI24741J21665_1006209 | 3300001915 | Bacteria | 2423 |
| 7 | JGI24752J21851_1000148 | 3300001976 | Bacteria | 9539 |
| 8 | JGI24740J21852_10004672 | 3300001979 | Bacteria | 5870 |
| 9 | JGI24739J22299_10027214 | 3300001989 | Bacteria | 2001 |
| 10 | JGI24739J22299_10030387 | 3300001989 | Bacteria | 1873 |
| 11 | JGI24737J22298_10000602 | 3300001990 | Bacteria | 12666 |
| 12 | JGI24737J22298_10005143 | 3300001990 | Bacteria | 4529 |
| 13 | JGI24735J21928_10002161 | 3300002067 | Bacteria | 6904 |
| 14 | JGI24735J21928_10004848 | 3300002067 | Bacteria | 4490 |
| 15 | JGI24735J21928_10017651 | 3300002067 | Bacteria | 2206 |
| 16 | JGI24750J21931_1000219 | 3300002070 | Bacteria | 9756 |
| 17 | JGI24748J21848_1000033 | 3300002074 | Bacteria | 78443 |
| 18 | JGI24738J21930_10001556 | 3300002075 | Bacteria | 6330 |
| 19 | JGI24738J21930_10005865 | 3300002075 | Bacteria | 2918 |
| 20 | JGI24034J26672_10000032 | 3300002239 | Bacteria | 89175 |
| 21 | JGI24751J29686_10000294 | 3300002459 | Bacteria | 18901 |
| 22 | JGI24751J29686_10000300 | 3300002459 | Bacteria | 18715 |
| 23 | JGI25165J46597_1000112 | 3300003214 | Bacteria | 147097 |
| 24 | JGI25165J46597_1000208 | 3300003214 | Bacteria | 84386 |
| 25 | JGI25153J46596_10000021 | 3300003215 | Bacteria | 252651 |
| 26 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 27 | Ga0055542_1000094 | 3300003762 | Bacteria | 119899 |
| 28 | Ga0055529_1000045 | 3300003763 | Bacteria | 209617 |
| 29 | Ga0055530_10000012 | 3300003791 | Bacteria | 164829 |
| 30 | Ga0055531_10000683 | 3300003794 | Bacteria | 28960 |
| 31 | Ga0055531_10008207 | 3300003794 | Bacteria | 5558 |
| 32 | Ga0065704_10001118 | 3300005289 | Bacteria | 24231 |
| 33 | Ga0065704_10070157 | 3300005289 | Bacteria | 211668 |
| 34 | Ga0065704_10072849 | 3300005289 | Bacteria | 7928 |
| 35 | Ga0065704_10084202 | 3300005289 | Bacteria | 3365 |
| 36 | Ga0065707_10090686 | 3300005295 | Bacteria | 4088 |
| 37 | Ga0065707_10109048 | 3300005295 | Bacteria | 2484 |
| 38 | Ga0065707_10117965 | 3300005295 | Bacteria | 2198 |
| 39 | Ga0070658_10000458 | 3300005327 | Bacteria | 35479 |
| 40 | Ga0070658_10000836 | 3300005327 | Bacteria | 26337 |
| 41 | Ga0070658_10004043 | 3300005327 | Bacteria | 12018 |
| 42 | Ga0070658_10006558 | 3300005327 | Bacteria | 9442 |
| 43 | Ga0070658_10007863 | 3300005327 | Bacteria | 8590 |
| 44 | Ga0070658_10020858 | 3300005327 | Bacteria | 5250 |
| 45 | Ga0070683_100095632 | 3300005329 | Bacteria | 2793 |
| 46 | Ga0070683_100114256 | 3300005329 | Bacteria | 2548 |
| 47 | Ga0070690_100000011 | 3300005330 | Bacteria | 95472 |
| 48 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 49 | Ga0070670_100006954 | 3300005331 | Bacteria | 9590 |
| 50 | Ga0070670_100007353 | 3300005331 | Bacteria | 9349 |
| 51 | Ga0070670_100049091 | 3300005331 | Bacteria | 3630 |
| 52 | Ga0068869_100003111 | 3300005334 | Bacteria | 10119 |
| 53 | Ga0070666_10000035 | 3300005335 | Bacteria | 121458 |
| 54 | Ga0070666_10002111 | 3300005335 | Bacteria | 12077 |
| 55 | Ga0070666_10008945 | 3300005335 | Bacteria | 6235 |
| 56 | Ga0070666_10026137 | 3300005335 | Bacteria | 3811 |
| 57 | Ga0070680_100008920 | 3300005336 | Bacteria | 7691 |
| 58 | Ga0068868_100005495 | 3300005338 | Bacteria | 8914 |
| 59 | Ga0070660_100000189 | 3300005339 | Bacteria | 41162 |
| 60 | Ga0070660_100003680 | 3300005339 | Bacteria | 10581 |
| 61 | Ga0070660_100018015 | 3300005339 | Bacteria | 5153 |
| 62 | Ga0070660_100021802 | 3300005339 | Bacteria | 4728 |
| 63 | Ga0070689_100055226 | 3300005340 | Bacteria | 3077 |
| 64 | Ga0070689_100056972 | 3300005340 | Bacteria | 3032 |
| 65 | Ga0070691_10005094 | 3300005341 | Bacteria | 5971 |
| 66 | Ga0070661_100014248 | 3300005344 | Bacteria | 5601 |
| 67 | Ga0070668_100000006 | 3300005347 | Bacteria | 176486 |
| 68 | Ga0070668_100000353 | 3300005347 | Bacteria | 30383 |
| 69 | Ga0070668_100014918 | 3300005347 | Bacteria | 5809 |
| 70 | Ga0070668_100019348 | 3300005347 | Bacteria | 5125 |
| 71 | Ga0070668_100152583 | 3300005347 | Bacteria | 1869 |
| 72 | Ga0070669_100000004 | 3300005353 | Bacteria | 314707 |
| 73 | Ga0070669_100000056 | 3300005353 | Bacteria | 111413 |
| 74 | Ga0070669_100000057 | 3300005353 | Bacteria | 110803 |
| 75 | Ga0070669_100000131 | 3300005353 | Bacteria | 68114 |
| 76 | Ga0070669_100001055 | 3300005353 | Bacteria | 20165 |
| 77 | Ga0070669_100002210 | 3300005353 | Bacteria | 14103 |
| 78 | Ga0070669_100007970 | 3300005353 | Bacteria | 7563 |
| 79 | Ga0070669_100041884 | 3300005353 | Bacteria | 3332 |
| 80 | Ga0070669_100083357 | 3300005353 | Bacteria | 2384 |
| 81 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 82 | Ga0070671_100000029 | 3300005355 | Bacteria | 112712 |
| 83 | Ga0070671_100000048 | 3300005355 | Bacteria | 82451 |
| 84 | Ga0070671_100000120 | 3300005355 | Bacteria | 50898 |
| 85 | Ga0070671_100002408 | 3300005355 | Bacteria | 14460 |
| 86 | Ga0070671_100004738 | 3300005355 | Bacteria | 10807 |
| 87 | Ga0070671_100147837 | 3300005355 | Bacteria | 1984 |
| 88 | Ga0070674_100003272 | 3300005356 | Bacteria | 9056 |
| 89 | Ga0070674_100014453 | 3300005356 | Bacteria | 4907 |
| 90 | Ga0070674_100017329 | 3300005356 | Bacteria | 4528 |
| 91 | Ga0070674_100043506 | 3300005356 | Bacteria | 3056 |
| 92 | Ga0070673_100000001 | 3300005364 | Bacteria | 239842 |
| 93 | Ga0070688_100024329 | 3300005365 | Bacteria | 3572 |
| 94 | Ga0070659_100006689 | 3300005366 | Bacteria | 8334 |
| 95 | Ga0070659_100020629 | 3300005366 | Bacteria | 5009 |
| 96 | Ga0070659_100130365 | 3300005366 | Bacteria | 2042 |
| 97 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 98 | Ga0070667_100000160 | 3300005367 | Bacteria | 83754 |
| 99 | Ga0070667_100000230 | 3300005367 | Bacteria | 63814 |
| 100 | Ga0070667_100000754 | 3300005367 | Bacteria | 30851 |
| 101 | Ga0070667_100002904 | 3300005367 | Bacteria | 14728 |
| 102 | Ga0070667_100091332 | 3300005367 | Bacteria | 2618 |
| 103 | Ga0070700_100000952 | 3300005441 | Bacteria | 14294 |
| 104 | Ga0070663_100004055 | 3300005455 | Bacteria | 8551 |
| 105 | Ga0070663_100055307 | 3300005455 | Bacteria | 2840 |
| 106 | Ga0070678_100000149 | 3300005456 | Bacteria | 29059 |
| 107 | Ga0070678_100090486 | 3300005456 | Bacteria | 2346 |
| 108 | Ga0070662_100000798 | 3300005457 | Bacteria | 19365 |
| 109 | Ga0070681_10008953 | 3300005458 | Bacteria | 9843 |
| 110 | Ga0068867_100008341 | 3300005459 | Bacteria | 7311 |
| 111 | Ga0068867_100038002 | 3300005459 | Bacteria | 3503 |
| 112 | Ga0070685_10000850 | 3300005466 | Bacteria | 16626 |
| 113 | Ga0070707_100176737 | 3300005468 | Bacteria | 2081 |
| 114 | Ga0070679_100007721 | 3300005530 | Bacteria | 10071 |
| 115 | Ga0068853_100000627 | 3300005539 | Bacteria | 24278 |
| 116 | Ga0068853_100015261 | 3300005539 | Bacteria | 6314 |
| 117 | Ga0068853_100086748 | 3300005539 | Bacteria | 2745 |
| 118 | Ga0070672_100005821 | 3300005543 | Bacteria | 8225 |
| 119 | Ga0070672_100053838 | 3300005543 | Bacteria | 3148 |
| 120 | Ga0070686_100000035 | 3300005544 | Bacteria | 108191 |
| 121 | Ga0070665_100000021 | 3300005548 | Bacteria | 389668 |
| 122 | Ga0070665_100000101 | 3300005548 | Bacteria | 159353 |
| 123 | Ga0070665_100000161 | 3300005548 | Bacteria | 122088 |
| 124 | Ga0070665_100000256 | 3300005548 | Bacteria | 87962 |
| 125 | Ga0070665_100012473 | 3300005548 | Bacteria | 8567 |
| 126 | Ga0070665_100014399 | 3300005548 | Bacteria | 7937 |
| 127 | Ga0068855_100022825 | 3300005563 | Bacteria | 7499 |
| 128 | Ga0068855_100042837 | 3300005563 | Bacteria | 5363 |
| 129 | Ga0068855_100092695 | 3300005563 | Bacteria | 3483 |
| 130 | Ga0070664_100009808 | 3300005564 | Bacteria | 7760 |
| 131 | Ga0068857_100018688 | 3300005577 | Bacteria | 6084 |
| 132 | Ga0068857_100021544 | 3300005577 | Bacteria | 5671 |
| 133 | Ga0068854_100000547 | 3300005578 | Bacteria | 22662 |
| 134 | Ga0068854_100006245 | 3300005578 | Bacteria | 7567 |
| 135 | Ga0068856_100003378 | 3300005614 | Bacteria | 16157 |
| 136 | Ga0068856_100014543 | 3300005614 | Bacteria | 7606 |
| 137 | Ga0068856_100042659 | 3300005614 | Bacteria | 4463 |
| 138 | Ga0068856_100059073 | 3300005614 | Bacteria | 3788 |
| 139 | Ga0068852_100000259 | 3300005616 | Bacteria | 35916 |
| 140 | Ga0068852_100002971 | 3300005616 | Bacteria | 11774 |
| 141 | Ga0068859_100000233 | 3300005617 | Bacteria | 54852 |
| 142 | Ga0068859_100009239 | 3300005617 | Bacteria | 9957 |
| 143 | Ga0068859_100013351 | 3300005617 | Bacteria | 8238 |
| 144 | Ga0068859_100026211 | 3300005617 | Bacteria | 5846 |
| 145 | Ga0068864_100000011 | 3300005618 | Bacteria | 350056 |
| 146 | Ga0068864_100000211 | 3300005618 | Bacteria | 52419 |
| 147 | Ga0068864_100003942 | 3300005618 | Bacteria | 12222 |
| 148 | Ga0068864_100009425 | 3300005618 | Bacteria | 8056 |
| 149 | Ga0068866_10028308 | 3300005718 | Bacteria | 2669 |
| 150 | Ga0068861_100001267 | 3300005719 | Bacteria | 15769 |
| 151 | Ga0068861_100003944 | 3300005719 | Bacteria | 9927 |
| 152 | Ga0068861_100008325 | 3300005719 | Bacteria | 7132 |
| 153 | Ga0068851_10013600 | 3300005834 | Bacteria | 3852 |
| 154 | Ga0068870_10049358 | 3300005840 | Bacteria | 2220 |
| 155 | Ga0068863_100000060 | 3300005841 | Bacteria | 122123 |
| 156 | Ga0068863_100000132 | 3300005841 | Bacteria | 78811 |
| 157 | Ga0068863_100000413 | 3300005841 | Bacteria | 43520 |
| 158 | Ga0068863_100000466 | 3300005841 | Bacteria | 41328 |
| 159 | Ga0068863_100002604 | 3300005841 | Bacteria | 17894 |
| 160 | Ga0068863_100013665 | 3300005841 | Bacteria | 7828 |
| 161 | Ga0068863_100014019 | 3300005841 | Bacteria | 7723 |
| 162 | Ga0068863_100015742 | 3300005841 | Bacteria | 7263 |
| 163 | Ga0068863_100067443 | 3300005841 | Bacteria | 3384 |
| 164 | Ga0068863_100076595 | 3300005841 | Bacteria | 3164 |
| 165 | Ga0068858_100001744 | 3300005842 | Bacteria | 22204 |
| 166 | Ga0068858_100008838 | 3300005842 | Bacteria | 9662 |
| 167 | Ga0068858_100012341 | 3300005842 | Bacteria | 8056 |
| 168 | Ga0068858_100014825 | 3300005842 | Bacteria | 7334 |
| 169 | Ga0068858_100036669 | 3300005842 | Bacteria | 4546 |
| 170 | Ga0068858_100153978 | 3300005842 | Bacteria | 2162 |
| 171 | Ga0068860_100000068 | 3300005843 | Bacteria | 179208 |
| 172 | Ga0068860_100000126 | 3300005843 | Bacteria | 122923 |
| 173 | Ga0068860_100000220 | 3300005843 | Bacteria | 89460 |
| 174 | Ga0068860_100000473 | 3300005843 | Bacteria | 49993 |
| 175 | Ga0068860_100021108 | 3300005843 | Bacteria | 6307 |
| 176 | Ga0068860_100072066 | 3300005843 | Bacteria | 3283 |
| 177 | Ga0068860_100214113 | 3300005843 | Bacteria | 1869 |
| 178 | Ga0068862_100000011 | 3300005844 | Bacteria | 270105 |
| 179 | Ga0068862_100000146 | 3300005844 | Bacteria | 80138 |
| 180 | Ga0068862_100000151 | 3300005844 | Bacteria | 78811 |
| 181 | Ga0068862_100000198 | 3300005844 | Bacteria | 66534 |
| 182 | Ga0068862_100000267 | 3300005844 | Bacteria | 58000 |
| 183 | Ga0068862_100000581 | 3300005844 | Bacteria | 38018 |
| 184 | Ga0068862_100003219 | 3300005844 | Bacteria | 14138 |
| 185 | Ga0068862_100011508 | 3300005844 | Bacteria | 7304 |
| 186 | Ga0068862_100018624 | 3300005844 | Bacteria | 5784 |
| 187 | Ga0068862_100152074 | 3300005844 | Bacteria | 2060 |
| 188 | Ga0081455_10000049 | 3300005937 | Bacteria | 126459 |
| 189 | Ga0081539_10003331 | 3300005985 | Bacteria | 20003 |
| 190 | Ga0075368_10000894 | 3300006042 | Bacteria | 9251 |
| 191 | Ga0075368_10001248 | 3300006042 | Bacteria | 8047 |
| 192 | Ga0075363_100001087 | 3300006048 | Bacteria | 9843 |
| 193 | Ga0075363_100008716 | 3300006048 | Bacteria | 4736 |
| 194 | Ga0075363_100011878 | 3300006048 | Bacteria | 4183 |
| 195 | Ga0075364_10000812 | 3300006051 | Bacteria | 16485 |
| 196 | Ga0075362_10000043 | 3300006177 | Bacteria | 44587 |
| 197 | Ga0075362_10004251 | 3300006177 | Bacteria | 5116 |
| 198 | Ga0075369_10000422 | 3300006186 | Bacteria | 12834 |
| 199 | Ga0075369_10009323 | 3300006186 | Bacteria | 3809 |
| 200 | Ga0075366_10000832 | 3300006195 | Bacteria | 14827 |
| 201 | Ga0075366_10002410 | 3300006195 | Bacteria | 9592 |
| 202 | Ga0075366_10023371 | 3300006195 | Bacteria | 3601 |
| 203 | Ga0075370_10000241 | 3300006353 | Bacteria | 19620 |
| 204 | Ga0075370_10018445 | 3300006353 | Bacteria | 3787 |
| 205 | Ga0075370_10031397 | 3300006353 | Bacteria | 2965 |
| 206 | Ga0075370_10044080 | 3300006353 | Bacteria | 2522 |
| 207 | Ga0075370_10061587 | 3300006353 | Bacteria | 2138 |
| 208 | Ga0068871_100009681 | 3300006358 | Bacteria | 6997 |
| 209 | Ga0075434_100000891 | 3300006871 | Bacteria | 23915 |
| 210 | Ga0075434_100003634 | 3300006871 | Bacteria | 13773 |
| 211 | Ga0075434_100013292 | 3300006871 | Bacteria | 7828 |
| 212 | Ga0075429_100069504 | 3300006880 | Bacteria | 3066 |
| 213 | Ga0068865_100000072 | 3300006881 | Bacteria | 53411 |
| 214 | Ga0075436_100000248 | 3300006914 | Bacteria | 33736 |
| 215 | Ga0097620_100000233 | 3300006931 | Bacteria | 54852 |
| 216 | Ga0097620_100009239 | 3300006931 | Bacteria | 9957 |
| 217 | Ga0097620_100013351 | 3300006931 | Bacteria | 8238 |
| 218 | Ga0097620_100026210 | 3300006931 | Bacteria | 5846 |
| 219 | Ga0097620_100034635 | 3300006931 | Bacteria | 5068 |
| 220 | Ga0075435_100001418 | 3300007076 | Bacteria | 15465 |
| 221 | Ga0075435_100003277 | 3300007076 | Bacteria | 10966 |
| 222 | Ga0105251_10002944 | 3300009011 | Bacteria | 12768 |
| 223 | Ga0105251_10004465 | 3300009011 | Bacteria | 9506 |
| 224 | Ga0105251_10012746 | 3300009011 | Bacteria | 4739 |
| 225 | Ga0105250_10005824 | 3300009092 | Bacteria | 5472 |
| 226 | Ga0105240_10007916 | 3300009093 | Bacteria | 15328 |
| 227 | Ga0105240_10009609 | 3300009093 | Bacteria | 13679 |
| 228 | Ga0105240_10045358 | 3300009093 | Bacteria | 5577 |
| 229 | Ga0105240_10061597 | 3300009093 | Bacteria | 4676 |
| 230 | Ga0111539_10003392 | 3300009094 | Bacteria | 20991 |
| 231 | Ga0111539_10022382 | 3300009094 | Bacteria | 7767 |
| 232 | Ga0111539_10029850 | 3300009094 | Bacteria | 6634 |
| 233 | Ga0105245_10008667 | 3300009098 | Bacteria | 8870 |
| 234 | Ga0105245_10010317 | 3300009098 | Bacteria | 8137 |
| 235 | Ga0105247_10004800 | 3300009101 | Bacteria | 8610 |
| 236 | Ga0105247_10025811 | 3300009101 | Bacteria | 3546 |
| 237 | Ga0105247_10036253 | 3300009101 | Bacteria | 3007 |
| 238 | Ga0114129_10082268 | 3300009147 | Bacteria | 4474 |
| 239 | Ga0105243_10000512 | 3300009148 | Bacteria | 39573 |
| 240 | Ga0105243_10007320 | 3300009148 | Bacteria | 8488 |
| 241 | Ga0105243_10014674 | 3300009148 | Bacteria | 5929 |
| 242 | Ga0105243_10056287 | 3300009148 | Bacteria | 3127 |
| 243 | Ga0105241_10022767 | 3300009174 | Bacteria | 4644 |
| 244 | Ga0105242_10000178 | 3300009176 | Bacteria | 48486 |
| 245 | Ga0105248_10000012 | 3300009177 | Bacteria | 333963 |
| 246 | Ga0105248_10000406 | 3300009177 | Bacteria | 49988 |
| 247 | Ga0105248_10013202 | 3300009177 | Bacteria | 9094 |
| 248 | Ga0105248_10014880 | 3300009177 | Bacteria | 8570 |
| 249 | Ga0105248_10044831 | 3300009177 | Bacteria | 4960 |
| 250 | Ga0105248_10075835 | 3300009177 | Bacteria | 3779 |
| 251 | Ga0105237_10000626 | 3300009545 | Bacteria | 49404 |
| 252 | Ga0105238_10284719 | 3300009551 | Bacteria | 1634 |
| 253 | Ga0105249_10000015 | 3300009553 | Bacteria | 282138 |
| 254 | Ga0105249_10000094 | 3300009553 | Bacteria | 122611 |
| 255 | Ga0105249_10002709 | 3300009553 | Bacteria | 15315 |
| 256 | Ga0105249_10003676 | 3300009553 | Bacteria | 13223 |
| 257 | Ga0105249_10025943 | 3300009553 | Bacteria | 5278 |
| 258 | Ga0105148_100001 | 3300009978 | Bacteria | 58900 |
| 259 | Ga0105239_10000438 | 3300010375 | Bacteria | 60788 |
| 260 | Ga0105239_10027754 | 3300010375 | Bacteria | 6229 |
| 261 | Ga0105246_10000074 | 3300011119 | Bacteria | 41753 |
| 262 | Ga0105246_10007060 | 3300011119 | Bacteria | 6875 |
| 263 | Ga0157371_10000032 | 3300013102 | Bacteria | 230252 |
| 264 | Ga0157371_10001651 | 3300013102 | Bacteria | 22752 |
| 265 | Ga0157370_10000213 | 3300013104 | Bacteria | 73863 |
| 266 | Ga0157370_10078843 | 3300013104 | Bacteria | 3102 |
| 267 | Ga0157369_10000384 | 3300013105 | Bacteria | 58625 |
| 268 | Ga0157378_10007434 | 3300013297 | Bacteria | 9569 |
| 269 | Ga0163162_10054081 | 3300013306 | Bacteria | 4037 |
| 270 | Ga0163162_10056077 | 3300013306 | Bacteria | 3969 |
| 271 | Ga0163162_10056710 | 3300013306 | Bacteria | 3945 |
| 272 | Ga0163162_10069879 | 3300013306 | Bacteria | 3563 |
| 273 | Ga0163162_10222910 | 3300013306 | Bacteria | 2015 |
| 274 | Ga0157372_10020739 | 3300013307 | Bacteria | 7095 |
| 275 | Ga0157372_10107406 | 3300013307 | Bacteria | 3193 |
| 276 | Ga0157375_10006006 | 3300013308 | Bacteria | 10586 |
| 277 | Ga0157380_10000031 | 3300014326 | Bacteria | 90245 |
| 278 | Ga0157380_10000484 | 3300014326 | Bacteria | 24282 |
| 279 | Ga0157380_10039808 | 3300014326 | Bacteria | 3657 |
| 280 | Ga0157379_10025953 | 3300014968 | Bacteria | 5210 |
| 281 | Ga0183363_1006 | 3300015690 | Bacteria | 400466 |
| 282 | Ga0163161_10000195 | 3300017792 | Bacteria | 55605 |
| 283 | Ga0163161_10016583 | 3300017792 | Bacteria | 5145 |
| 284 | Ga0213875_10003072 | 3300021388 | Bacteria | 9647 |
| 285 | Ga0207672_1000484 | 3300025223 | Bacteria | 5005 |
| 286 | Ga0209147_100577 | 3300025229 | Bacteria | 20552 |
| 287 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 288 | Ga0207427_100704 | 3300025231 | Bacteria | 15684 |
| 289 | Ga0209437_108363 | 3300025233 | Bacteria | 1657 |
| 290 | Ga0209677_106107 | 3300025253 | Bacteria | 2948 |
| 291 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 292 | Ga0209148_1000133 | 3300025254 | Bacteria | 171351 |
| 293 | Ga0209148_1001460 | 3300025254 | Bacteria | 11963 |
| 294 | Ga0209233_1000078 | 3300025261 | Bacteria | 348118 |
| 295 | Ga0209233_1000186 | 3300025261 | Bacteria | 133572 |
| 296 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 297 | Ga0209455_1003196 | 3300025272 | Bacteria | 5926 |
| 298 | Ga0209675_1000472 | 3300025291 | Bacteria | 30895 |
| 299 | Ga0209676_1000226 | 3300025292 | Bacteria | 124004 |
| 300 | Ga0209676_1000387 | 3300025292 | Bacteria | 80494 |
| 301 | Ga0209676_1000760 | 3300025292 | Bacteria | 43458 |
| 302 | Ga0209025_1008935 | 3300025294 | Bacteria | 7090 |
| 303 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 304 | Ga0209050_1000450 | 3300025298 | Bacteria | 74598 |
| 305 | Ga0209050_1000474 | 3300025298 | Bacteria | 71192 |
| 306 | Ga0209257_1000130 | 3300025304 | Bacteria | 212188 |
| 307 | Ga0209257_1000581 | 3300025304 | Bacteria | 61540 |
| 308 | Ga0207697_10000101 | 3300025315 | Bacteria | 39230 |
| 309 | Ga0207697_10016613 | 3300025315 | Bacteria | 3031 |
| 310 | Ga0207656_10000615 | 3300025321 | Bacteria | 11705 |
| 311 | Ga0207713_1002507 | 3300025735 | Bacteria | 13301 |
| 312 | Ga0207713_1005597 | 3300025735 | Bacteria | 7823 |
| 313 | Ga0207713_1006927 | 3300025735 | Bacteria | 6803 |
| 314 | Ga0207713_1044654 | 3300025735 | Bacteria | 1817 |
| 315 | Ga0207710_10011802 | 3300025900 | Bacteria | 3674 |
| 316 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 317 | Ga0207680_10000089 | 3300025903 | Bacteria | 41847 |
| 318 | Ga0207680_10001062 | 3300025903 | Bacteria | 12987 |
| 319 | Ga0207680_10043603 | 3300025903 | Bacteria | 2632 |
| 320 | Ga0207647_10006630 | 3300025904 | Bacteria | 8411 |
| 321 | Ga0207647_10007467 | 3300025904 | Bacteria | 7896 |
| 322 | Ga0207645_10000736 | 3300025907 | Bacteria | 27275 |
| 323 | Ga0207643_10037095 | 3300025908 | Bacteria | 2735 |
| 324 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 325 | Ga0207705_10000018 | 3300025909 | Bacteria | 319792 |
| 326 | Ga0207705_10001048 | 3300025909 | Bacteria | 22463 |
| 327 | Ga0207705_10001219 | 3300025909 | Bacteria | 20805 |
| 328 | Ga0207705_10006362 | 3300025909 | Bacteria | 8761 |
| 329 | Ga0207705_10018297 | 3300025909 | Bacteria | 5010 |
| 330 | Ga0207705_10036863 | 3300025909 | Bacteria | 3499 |
| 331 | Ga0207705_10081879 | 3300025909 | Bacteria | 2353 |
| 332 | Ga0207705_10123453 | 3300025909 | Bacteria | 1923 |
| 333 | Ga0207654_10001636 | 3300025911 | Bacteria | 11707 |
| 334 | Ga0207695_10007635 | 3300025913 | Bacteria | 13709 |
| 335 | Ga0207695_10124511 | 3300025913 | Bacteria | 2542 |
| 336 | Ga0207671_10000596 | 3300025914 | Bacteria | 48191 |
| 337 | Ga0207671_10005662 | 3300025914 | Bacteria | 11430 |
| 338 | Ga0207671_10009066 | 3300025914 | Bacteria | 8363 |
| 339 | Ga0207671_10036902 | 3300025914 | Bacteria | 3624 |
| 340 | Ga0207660_10022394 | 3300025917 | Bacteria | 4257 |
| 341 | Ga0207660_10050816 | 3300025917 | Bacteria | 2945 |
| 342 | Ga0207657_10000156 | 3300025919 | Bacteria | 69892 |
| 343 | Ga0207657_10000507 | 3300025919 | Bacteria | 41166 |
| 344 | Ga0207657_10006147 | 3300025919 | Bacteria | 12480 |
| 345 | Ga0207649_10003922 | 3300025920 | Bacteria | 8116 |
| 346 | Ga0207649_10004027 | 3300025920 | Bacteria | 8003 |
| 347 | Ga0207652_10021467 | 3300025921 | Bacteria | 5329 |
| 348 | Ga0207646_10152246 | 3300025922 | Bacteria | 2086 |
| 349 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 350 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 351 | Ga0207681_10000019 | 3300025923 | Bacteria | 243902 |
| 352 | Ga0207681_10000053 | 3300025923 | Bacteria | 110626 |
| 353 | Ga0207681_10000224 | 3300025923 | Bacteria | 44695 |
| 354 | Ga0207681_10000288 | 3300025923 | Bacteria | 37371 |
| 355 | Ga0207681_10000578 | 3300025923 | Bacteria | 24948 |
| 356 | Ga0207681_10006398 | 3300025923 | Bacteria | 7231 |
| 357 | Ga0207681_10016986 | 3300025923 | Bacteria | 4564 |
| 358 | Ga0207681_10032395 | 3300025923 | Bacteria | 3422 |
| 359 | Ga0207681_10037009 | 3300025923 | Bacteria | 3223 |
| 360 | Ga0207694_10077662 | 3300025924 | Bacteria | 2602 |
| 361 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 362 | Ga0207650_10000249 | 3300025925 | Bacteria | 58457 |
| 363 | Ga0207650_10009614 | 3300025925 | Bacteria | 6613 |
| 364 | Ga0207650_10026619 | 3300025925 | Bacteria | 4128 |
| 365 | Ga0207687_10010013 | 3300025927 | Bacteria | 6203 |
| 366 | Ga0207687_10021302 | 3300025927 | Bacteria | 4306 |
| 367 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 368 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 369 | Ga0207644_10000911 | 3300025931 | Bacteria | 18743 |
| 370 | Ga0207644_10002772 | 3300025931 | Bacteria | 11281 |
| 371 | Ga0207644_10012636 | 3300025931 | Bacteria | 5612 |
| 372 | Ga0207644_10015708 | 3300025931 | Bacteria | 5086 |
| 373 | Ga0207690_10006409 | 3300025932 | Bacteria | 6975 |
| 374 | Ga0207690_10034263 | 3300025932 | Bacteria | 3271 |
| 375 | Ga0207706_10001346 | 3300025933 | Bacteria | 24541 |
| 376 | Ga0207706_10003722 | 3300025933 | Bacteria | 14550 |
| 377 | Ga0207706_10022565 | 3300025933 | Bacteria | 5648 |
| 378 | Ga0207706_10050483 | 3300025933 | Bacteria | 3675 |
| 379 | Ga0207709_10000145 | 3300025935 | Bacteria | 98629 |
| 380 | Ga0207709_10003291 | 3300025935 | Bacteria | 9694 |
| 381 | Ga0207709_10010876 | 3300025935 | Bacteria | 5012 |
| 382 | Ga0207709_10049300 | 3300025935 | Bacteria | 2570 |
| 383 | Ga0207670_10037917 | 3300025936 | Bacteria | 3144 |
| 384 | Ga0207669_10000118 | 3300025937 | Bacteria | 39673 |
| 385 | Ga0207669_10000784 | 3300025937 | Bacteria | 13595 |
| 386 | Ga0207704_10000032 | 3300025938 | Bacteria | 108408 |
| 387 | Ga0207704_10003755 | 3300025938 | Bacteria | 6911 |
| 388 | Ga0207691_10076134 | 3300025940 | Bacteria | 3024 |
| 389 | Ga0207691_10121895 | 3300025940 | Bacteria | 2310 |
| 390 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 391 | Ga0207711_10000382 | 3300025941 | Bacteria | 46910 |
| 392 | Ga0207711_10003989 | 3300025941 | Bacteria | 12679 |
| 393 | Ga0207711_10005707 | 3300025941 | Bacteria | 10503 |
| 394 | Ga0207711_10008959 | 3300025941 | Bacteria | 8366 |
| 395 | Ga0207711_10011608 | 3300025941 | Bacteria | 7319 |
| 396 | Ga0207711_10028532 | 3300025941 | Bacteria | 4697 |
| 397 | Ga0207711_10044809 | 3300025941 | Bacteria | 3778 |
| 398 | Ga0207689_10000840 | 3300025942 | Bacteria | 29578 |
| 399 | Ga0207679_10042816 | 3300025945 | Bacteria | 3256 |
| 400 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 401 | Ga0207667_10000013 | 3300025949 | Bacteria | 435875 |
| 402 | Ga0207667_10004614 | 3300025949 | Bacteria | 16903 |
| 403 | Ga0207667_10005831 | 3300025949 | Bacteria | 15010 |
| 404 | Ga0207667_10014586 | 3300025949 | Bacteria | 8949 |
| 405 | Ga0207667_10028292 | 3300025949 | Bacteria | 6090 |
| 406 | Ga0207667_10078892 | 3300025949 | Bacteria | 3412 |
| 407 | Ga0207667_10130160 | 3300025949 | Bacteria | 2592 |
| 408 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 409 | Ga0207651_10103787 | 3300025960 | Bacteria | 2116 |
| 410 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 411 | Ga0207712_10000023 | 3300025961 | Bacteria | 282081 |
| 412 | Ga0207712_10001574 | 3300025961 | Bacteria | 15363 |
| 413 | Ga0207712_10001688 | 3300025961 | Bacteria | 14823 |
| 414 | Ga0207712_10071483 | 3300025961 | Bacteria | 2496 |
| 415 | Ga0207668_10000026 | 3300025972 | Bacteria | 128309 |
| 416 | Ga0207668_10000244 | 3300025972 | Bacteria | 36489 |
| 417 | Ga0207668_10002820 | 3300025972 | Bacteria | 10168 |
| 418 | Ga0207668_10011271 | 3300025972 | Bacteria | 5426 |
| 419 | Ga0207640_10000392 | 3300025981 | Bacteria | 27827 |
| 420 | Ga0207640_10000809 | 3300025981 | Bacteria | 17796 |
| 421 | Ga0207640_10002033 | 3300025981 | Bacteria | 10932 |
| 422 | Ga0207640_10007509 | 3300025981 | Bacteria | 6021 |
| 423 | Ga0207640_10025536 | 3300025981 | Bacteria | 3577 |
| 424 | Ga0207640_10059855 | 3300025981 | Bacteria | 2515 |
| 425 | Ga0207640_10064677 | 3300025981 | Bacteria | 2437 |
| 426 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 427 | Ga0207658_10000064 | 3300025986 | Bacteria | 117779 |
| 428 | Ga0207658_10000204 | 3300025986 | Bacteria | 61702 |
| 429 | Ga0207658_10000230 | 3300025986 | Bacteria | 58983 |
| 430 | Ga0207658_10000587 | 3300025986 | Bacteria | 32623 |
| 431 | Ga0207658_10001492 | 3300025986 | Bacteria | 18189 |
| 432 | Ga0207658_10001874 | 3300025986 | Bacteria | 15735 |
| 433 | Ga0207658_10065053 | 3300025986 | Bacteria | 2737 |
| 434 | Ga0207658_10107535 | 3300025986 | Bacteria | 2198 |
| 435 | Ga0207677_10000209 | 3300026023 | Bacteria | 47213 |
| 436 | Ga0207703_10000489 | 3300026035 | Bacteria | 41162 |
| 437 | Ga0207703_10000510 | 3300026035 | Bacteria | 40276 |
| 438 | Ga0207703_10001171 | 3300026035 | Bacteria | 24769 |
| 439 | Ga0207703_10002081 | 3300026035 | Bacteria | 17588 |
| 440 | Ga0207703_10009847 | 3300026035 | Bacteria | 7497 |
| 441 | Ga0207703_10041168 | 3300026035 | Bacteria | 3700 |
| 442 | Ga0207639_10000808 | 3300026041 | Bacteria | 21259 |
| 443 | Ga0207639_10001024 | 3300026041 | Bacteria | 19008 |
| 444 | Ga0207639_10004520 | 3300026041 | Bacteria | 9380 |
| 445 | Ga0207639_10018354 | 3300026041 | Bacteria | 4971 |
| 446 | Ga0207639_10057664 | 3300026041 | Bacteria | 2983 |
| 447 | Ga0207678_10002991 | 3300026067 | Bacteria | 15288 |
| 448 | Ga0207678_10007603 | 3300026067 | Bacteria | 9576 |
| 449 | Ga0207678_10011131 | 3300026067 | Bacteria | 7904 |
| 450 | Ga0207678_10037279 | 3300026067 | Bacteria | 4229 |
| 451 | Ga0207708_10007087 | 3300026075 | Bacteria | 8281 |
| 452 | Ga0207708_10021025 | 3300026075 | Bacteria | 4924 |
| 453 | Ga0207702_10001204 | 3300026078 | Bacteria | 26266 |
| 454 | Ga0207702_10007553 | 3300026078 | Bacteria | 9267 |
| 455 | Ga0207702_10014752 | 3300026078 | Bacteria | 6481 |
| 456 | Ga0207702_10194195 | 3300026078 | Bacteria | 1878 |
| 457 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 458 | Ga0207641_10000050 | 3300026088 | Bacteria | 175954 |
| 459 | Ga0207641_10000098 | 3300026088 | Bacteria | 123514 |
| 460 | Ga0207641_10000100 | 3300026088 | Bacteria | 122664 |
| 461 | Ga0207641_10000607 | 3300026088 | Bacteria | 39350 |
| 462 | Ga0207641_10003216 | 3300026088 | Bacteria | 14612 |
| 463 | Ga0207641_10004086 | 3300026088 | Bacteria | 12730 |
| 464 | Ga0207641_10008306 | 3300026088 | Bacteria | 8579 |
| 465 | Ga0207641_10010984 | 3300026088 | Bacteria | 7423 |
| 466 | Ga0207648_10001521 | 3300026089 | Bacteria | 25544 |
| 467 | Ga0207648_10002650 | 3300026089 | Bacteria | 19101 |
| 468 | Ga0207648_10084660 | 3300026089 | Bacteria | 2766 |
| 469 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 470 | Ga0207676_10000046 | 3300026095 | Bacteria | 149037 |
| 471 | Ga0207676_10001192 | 3300026095 | Bacteria | 19520 |
| 472 | Ga0207676_10004670 | 3300026095 | Bacteria | 9705 |
| 473 | Ga0207676_10023338 | 3300026095 | Bacteria | 4562 |
| 474 | Ga0207674_10032027 | 3300026116 | Bacteria | 5516 |
| 475 | Ga0207674_10074045 | 3300026116 | Bacteria | 3418 |
| 476 | Ga0207675_100000418 | 3300026118 | Bacteria | 41021 |
| 477 | Ga0207675_100002120 | 3300026118 | Bacteria | 19658 |
| 478 | Ga0207675_100004105 | 3300026118 | Bacteria | 14093 |
| 479 | Ga0207675_100008435 | 3300026118 | Bacteria | 9710 |
| 480 | Ga0207675_100010029 | 3300026118 | Bacteria | 8878 |
| 481 | Ga0207683_10000881 | 3300026121 | Bacteria | 27549 |
| 482 | Ga0207683_10044107 | 3300026121 | Bacteria | 3898 |
| 483 | Ga0207698_10000036 | 3300026142 | Bacteria | 105391 |
| 484 | Ga0207698_10002649 | 3300026142 | Bacteria | 10641 |
| 485 | Ga0207698_10025231 | 3300026142 | Bacteria | 4184 |
| 486 | Ga0207698_10058790 | 3300026142 | Bacteria | 2982 |
| 487 | Ga0209982_1000469 | 3300027552 | Bacteria | 4979 |
| 488 | Ga0209983_1000372 | 3300027665 | Bacteria | 9527 |
| 489 | Ga0209971_1000479 | 3300027682 | Bacteria | 10575 |
| 490 | Ga0209998_10003268 | 3300027717 | Bacteria | 3569 |
| 491 | Ga0209813_10000019 | 3300027866 | Bacteria | 75575 |
| 492 | Ga0209813_10000027 | 3300027866 | Bacteria | 69637 |
| 493 | Ga0209974_10000433 | 3300027876 | Bacteria | 13927 |
| 494 | Ga0209974_10017864 | 3300027876 | Bacteria | 2352 |
| 495 | Ga0207428_10015046 | 3300027907 | Bacteria | 6703 |
| 496 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 497 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 498 | Ga0268266_10001320 | 3300028379 | Bacteria | 30084 |
| 499 | Ga0268266_10002221 | 3300028379 | Bacteria | 21198 |
| 500 | Ga0268266_10035008 | 3300028379 | Bacteria | 4271 |
| 501 | Ga0268266_10060181 | 3300028379 | Bacteria | 3274 |
| 502 | Ga0268266_10091313 | 3300028379 | Bacteria | 2670 |
| 503 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 504 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 505 | Ga0268265_10000026 | 3300028380 | Bacteria | 246653 |
| 506 | Ga0268265_10000128 | 3300028380 | Bacteria | 96118 |
| 507 | Ga0268265_10001138 | 3300028380 | Bacteria | 23490 |
| 508 | Ga0268265_10005503 | 3300028380 | Bacteria | 8643 |
| 509 | Ga0268265_10012215 | 3300028380 | Bacteria | 5815 |
| 510 | Ga0268265_10030522 | 3300028380 | Bacteria | 3883 |
| 511 | Ga0268265_10103097 | 3300028380 | Bacteria | 2309 |
| 512 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 513 | Ga0268264_10000103 | 3300028381 | Bacteria | 222439 |
| 514 | Ga0268264_10000106 | 3300028381 | Bacteria | 210031 |
| 515 | Ga0268264_10000224 | 3300028381 | Bacteria | 110355 |
| 516 | Ga0268264_10000384 | 3300028381 | Bacteria | 63602 |
| 517 | Ga0268264_10000682 | 3300028381 | Bacteria | 39550 |
| 518 | Ga0268264_10002280 | 3300028381 | Bacteria | 16989 |
| 519 | Ga0268264_10005337 | 3300028381 | Bacteria | 10890 |
| 520 | Ga0268264_10051042 | 3300028381 | Bacteria | 3446 |
| 521 | Ga0307517_10033350 | 3300028786 | Bacteria | 5918 |
| 522 | Ga0307511_10002452 | 3300030521 | Bacteria | 19398 |
| 523 | Ga0265327_10010384 | 3300031251 | Bacteria | 6556 |
| 524 | Ga0307513_10041093 | 3300031456 | Bacteria | 5108 |
| 525 | Ga0307513_10107692 | 3300031456 | Bacteria | 2790 |
| 526 | Ga0307408_100000518 | 3300031548 | Bacteria | 33310 |
| 527 | Ga0307408_100002503 | 3300031548 | Bacteria | 12854 |
| 528 | Ga0307408_100008036 | 3300031548 | Bacteria | 6975 |
| 529 | Ga0307408_100059075 | 3300031548 | Bacteria | 2790 |
| 530 | Ga0307508_10000405 | 3300031616 | Bacteria | 51700 |
| 531 | Ga0307508_10035420 | 3300031616 | Bacteria | 4498 |
| 532 | Ga0316576_10017527 | 3300031727 | Bacteria | 4869 |
| 533 | Ga0316576_10117900 | 3300031727 | Bacteria | 1992 |
| 534 | Ga0307405_10002305 | 3300031731 | Bacteria | 8371 |
| 535 | Ga0307405_10018466 | 3300031731 | Bacteria | 3848 |
| 536 | Ga0307405_10019681 | 3300031731 | Bacteria | 3756 |
| 537 | Ga0307413_10010529 | 3300031824 | Bacteria | 4492 |
| 538 | Ga0307413_10058537 | 3300031824 | Bacteria | 2362 |
| 539 | Ga0307413_10061666 | 3300031824 | Bacteria | 2315 |
| 540 | Ga0307413_10106937 | 3300031824 | Bacteria | 1863 |
| 541 | Ga0307413_10107111 | 3300031824 | Bacteria | 1862 |
| 542 | Ga0307410_10006414 | 3300031852 | Bacteria | 6347 |
| 543 | Ga0307406_10000892 | 3300031901 | Bacteria | 16774 |
| 544 | Ga0307406_10034258 | 3300031901 | Bacteria | 3114 |
| 545 | Ga0307406_10056538 | 3300031901 | Bacteria | 2513 |
| 546 | Ga0307407_10029276 | 3300031903 | Bacteria | 2956 |
| 547 | Ga0307412_10000495 | 3300031911 | Bacteria | 23495 |
| 548 | Ga0307412_10002706 | 3300031911 | Bacteria | 9846 |
| 549 | Ga0307412_10008473 | 3300031911 | Bacteria | 5872 |
| 550 | Ga0307412_10012668 | 3300031911 | Bacteria | 4921 |
| 551 | Ga0307412_10018302 | 3300031911 | Bacteria | 4213 |
| 552 | Ga0307409_100008074 | 3300031995 | Bacteria | 6354 |
| 553 | Ga0307409_100088996 | 3300031995 | Bacteria | 2522 |
| 554 | Ga0307409_100095618 | 3300031995 | Bacteria | 2448 |
| 555 | Ga0307416_100007406 | 3300032002 | Bacteria | 6977 |
| 556 | Ga0307416_100009769 | 3300032002 | Bacteria | 6305 |
| 557 | Ga0307416_100032065 | 3300032002 | Bacteria | 3965 |
| 558 | Ga0307416_100066731 | 3300032002 | Bacteria | 2964 |
| 559 | Ga0307414_10000211 | 3300032004 | Bacteria | 38909 |
| 560 | Ga0307414_10000684 | 3300032004 | Bacteria | 17354 |
| 561 | Ga0307414_10002264 | 3300032004 | Bacteria | 10056 |
| 562 | Ga0307414_10037581 | 3300032004 | Bacteria | 3244 |
| 563 | Ga0307414_10045913 | 3300032004 | Bacteria | 2994 |
| 564 | Ga0307414_10184308 | 3300032004 | Bacteria | 1682 |
| 565 | Ga0307411_10032214 | 3300032005 | Bacteria | 3236 |
| 566 | Ga0307411_10033629 | 3300032005 | Bacteria | 3182 |
| 567 | Ga0307411_10055325 | 3300032005 | Bacteria | 2610 |
| 568 | Ga0307415_100003211 | 3300032126 | Bacteria | 8294 |
| 569 | Ga0316583_10030455 | 3300032133 | Bacteria | 1921 |
| 570 | Ga0316580_10020965 | 3300032139 | Bacteria | 2014 |
| 571 | Ga0307510_10015830 | 3300033180 | Bacteria | 8914 |
| 572 | Ga0373932_0010942 | 3300035112 | Bacteria | 2207 |
| 573 | Ga0316574_0030859 | 3300035398 | Bacteria | 3248 |
| 574 | Ga0316574_0084865 | 3300035398 | Bacteria | 2015 |
| 575 | Ga0316582_0000396 | 3300036647 | Bacteria | 15815 |
| 576 | Ga0316582_0100841 | 3300036647 | Bacteria | 1912 |
| 577 | Ga0316584_0044247 | 3300036712 | Bacteria | 3320 |
| 578 | Ga0316584_0060346 | 3300036712 | Bacteria | 2840 |
| 579 | Ga0395899_0004597 | 3300037312 | Bacteria | 10759 |
| 580 | Ga0395900_0039437 | 3300037418 | Bacteria | 4866 |
| 581 | Ga0395905_0053747 | 3300037471 | Bacteria | 3769 |
| 582 | Ga0395905_0083470 | 3300037471 | Bacteria | 2993 |
| 583 | Ga0436364_0542377 | 3300037853 | Bacteria | 69584 |
| 584 | Ga0395901_0042764 | 3300038443 | Bacteria | 4699 |
| 585 | Ga0237819_00202 | 3300038705 | Bacteria | 21730 |
| 586 | Ga0400490_16829 | 3300038726 | Bacteria | 6218 |
| 587 | Ga0400483_031978 | 3300039062 | Bacteria | 104878 |
| 588 | Ga0400483_088306 | 3300039062 | Bacteria | 112344 |
| 589 | Ga0400483_194190 | 3300039062 | Bacteria | 89056 |
| 590 | Ga0400483_291966 | 3300039062 | Bacteria | 3316 |
| 591 | Ga0439441_005969 | 3300042001 | Bacteria | 1913 |
| 592 | Ga0439455_0002922 | 3300042012 | Bacteria | 3194 |
| 593 | Ga0450923_000640 | 3300042125 | Bacteria | 4049 |
| 594 | Ga0439446_0012018 | 3300042156 | Bacteria | 2360 |
| 595 | Ga0439458_0000366 | 3300042157 | Bacteria | 11347 |
| 596 | Ga0439458_0015429 | 3300042157 | Bacteria | 1731 |
| 597 | Ga0439435_0002575 | 3300042436 | Bacteria | 3628 |
| 598 | Ga0439435_0011637 | 3300042436 | Bacteria | 2115 |
| 599 | Ga0451577_0108054 | 3300042876 | Bacteria | 2487 |
| 600 | Ga0466972_0001182 | 3300044658 | Bacteria | 12531 |
| 601 | Ga0466971_0010442 | 3300044719 | Bacteria | 4058 |
| 602 | Ga0451576_0001640 | 3300045051 | Bacteria | 37361 |
| 603 | Ga0451576_0004783 | 3300045051 | Bacteria | 17357 |
| 604 | Ga0495627_000198 | 3300046453 | Bacteria | 65997 |
| 605 | Ga0495627_000519 | 3300046453 | Bacteria | 31884 |
| 606 | Ga0495629_0104191 | 3300046459 | Bacteria | 1979 |
| 607 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 608 | Ga0495650_0000302 | 3300046471 | Bacteria | 89516 |
| 609 | Ga0495662_0003397 | 3300046476 | Bacteria | 8069 |
| 610 | Ga0495585_0002681 | 3300046492 | Bacteria | 12477 |
| 611 | Ga0495596_0000247 | 3300046500 | Bacteria | 36077 |
| 612 | Ga0495596_0011228 | 3300046500 | Bacteria | 3870 |
| 613 | Ga0495583_0000796 | 3300046506 | Bacteria | 39053 |
| 614 | Ga0495583_0001345 | 3300046506 | Bacteria | 25472 |
| 615 | Ga0495583_0005024 | 3300046506 | Bacteria | 9156 |
| 616 | Ga0495583_0007631 | 3300046506 | Bacteria | 6750 |
| 617 | Ga0495583_0019839 | 3300046506 | Bacteria | 3499 |
| 618 | Ga0495583_0028368 | 3300046506 | Bacteria | 2753 |
| 619 | Ga0495606_0001599 | 3300046507 | Bacteria | 29536 |
| 620 | Ga0495606_0022947 | 3300046507 | Bacteria | 4534 |
| 621 | Ga0495610_0000050 | 3300046512 | Bacteria | 143781 |
| 622 | Ga0495616_0000698 | 3300046513 | Bacteria | 24874 |
| 623 | Ga0495630_0043625 | 3300046517 | Bacteria | 3351 |
| 624 | Ga0495630_0045240 | 3300046517 | Bacteria | 3289 |
| 625 | Ga0495632_0000076 | 3300046519 | Bacteria | 101121 |
| 626 | Ga0495632_0004214 | 3300046519 | Bacteria | 9829 |
| 627 | Ga0495637_0001954 | 3300046520 | Bacteria | 11647 |
| 628 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 629 | Ga0495643_0000036 | 3300046522 | Bacteria | 238374 |
| 630 | Ga0495643_0001323 | 3300046522 | Bacteria | 23436 |
| 631 | Ga0495643_0009838 | 3300046522 | Bacteria | 5914 |
| 632 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 633 | Ga0495648_0000961 | 3300046524 | Bacteria | 29733 |
| 634 | Ga0495648_0028497 | 3300046524 | Bacteria | 3719 |
| 635 | Ga0495648_0033200 | 3300046524 | Bacteria | 3374 |
| 636 | Ga0495663_0000023 | 3300046525 | Bacteria | 105104 |
| 637 | Ga0495642_0038527 | 3300046528 | Bacteria | 1937 |
| 638 | Ga0495640_0025868 | 3300046533 | Bacteria | 4250 |
| 639 | Ga0495640_0028980 | 3300046533 | Bacteria | 3980 |
| 640 | Ga0495586_0053631 | 3300046535 | Bacteria | 2184 |
| 641 | Ga0495621_0029444 | 3300046539 | Bacteria | 1872 |
| 642 | Ga0495633_0000136 | 3300046558 | Bacteria | 97314 |
| 643 | Ga0495633_0000770 | 3300046558 | Bacteria | 28708 |
| 644 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 645 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 646 | Ga0495634_0042569 | 3300046642 | Bacteria | 3080 |
| 647 | Ga0495625_0001219 | 3300046660 | Bacteria | 32635 |
| 648 | Ga0495625_0002974 | 3300046660 | Bacteria | 17589 |
| 649 | Ga0495625_0005534 | 3300046660 | Bacteria | 11479 |
| 650 | Ga0495625_0014265 | 3300046660 | Bacteria | 6352 |
| 651 | Ga0495625_0019483 | 3300046660 | Bacteria | 5262 |
| 652 | Ga0495625_0086559 | 3300046660 | Bacteria | 2173 |
| 653 | Ga0495635_0025699 | 3300046663 | Bacteria | 4103 |
| 654 | Ga0495599_0063078 | 3300046678 | Bacteria | 2315 |
| 655 | Ga0495669_0000050 | 3300046684 | Bacteria | 80688 |
| 656 | Ga0495670_0005533 | 3300046691 | Bacteria | 6200 |
| 657 | Ga0495670_0048955 | 3300046691 | Bacteria | 2114 |
| 658 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 659 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 660 | Ga0495671_0001499 | 3300046692 | Bacteria | 15627 |
| 661 | Ga0495600_0001875 | 3300046809 | Bacteria | 11796 |
| 662 | Ga0495604_0120136 | 3300047317 | Bacteria | 1903 |
| 663 | Ga0495680_0033086 | 3300047322 | Bacteria | 4190 |
| 664 | Ga0495683_0000816 | 3300047323 | Bacteria | 22176 |
| 665 | Ga0495683_0049724 | 3300047323 | Bacteria | 2099 |
| 666 | Ga0495687_001300 | 3300047443 | Bacteria | 23447 |
| 667 | Ga0495687_001654 | 3300047443 | Bacteria | 20024 |
| 668 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 669 | Ga0495681_0000095 | 3300047470 | Bacteria | 76975 |
| 670 | Ga0495686_0000205 | 3300047472 | Bacteria | 110370 |
| 671 | Ga0495686_0000623 | 3300047472 | Bacteria | 48691 |
| 672 | Ga0495686_0001345 | 3300047472 | Bacteria | 27514 |
| 673 | Ga0495686_0001391 | 3300047472 | Bacteria | 26822 |
| 674 | Ga0495686_0014857 | 3300047472 | Bacteria | 5345 |
| 675 | Ga0495626_0000585 | 3300048091 | Bacteria | 36107 |
| 676 | Ga0496100_0010068 | 3300048903 | Bacteria | 5341 |
| 677 | Ga0496102_0000432 | 3300048905 | Bacteria | 48412 |
| 678 | Ga0496102_0004819 | 3300048905 | Bacteria | 11408 |
| 679 | Ga0496103_0000131 | 3300048906 | Bacteria | 79787 |
| 680 | Ga0496103_0000273 | 3300048906 | Bacteria | 49052 |
| 681 | Ga0496103_0005817 | 3300048906 | Bacteria | 7364 |
| 682 | Ga0496104_0001853 | 3300048907 | Bacteria | 18302 |
| 683 | Ga0496104_0140318 | 3300048907 | Bacteria | 2321 |
| 684 | Ga0496105_0001020 | 3300048908 | Bacteria | 19340 |
| 685 | Ga0496105_0006038 | 3300048908 | Bacteria | 9264 |
| 686 | Ga0496106_0010398 | 3300048909 | Bacteria | 6876 |
| 687 | Ga0496108_0014688 | 3300048911 | Bacteria | 6392 |
| 688 | Ga0496108_0067447 | 3300048911 | Bacteria | 3018 |
| 689 | Ga0496110_0031029 | 3300048913 | Bacteria | 4610 |
| 690 | Ga0496113_0001108 | 3300048916 | Bacteria | 14602 |
| 691 | Ga0496114_0018506 | 3300048917 | Bacteria | 5633 |
| 692 | Ga0496115_0000133 | 3300048918 | Bacteria | 67951 |
| 693 | Ga0496116_0000149 | 3300048919 | Bacteria | 141841 |
| 694 | Ga0496116_0005419 | 3300048919 | Bacteria | 11859 |
| 695 | Ga0496117_0002127 | 3300048920 | Bacteria | 25909 |
| 696 | Ga0496117_0011656 | 3300048920 | Bacteria | 7850 |
| 697 | Ga0496117_0020980 | 3300048920 | Bacteria | 5308 |
| 698 | Ga0496118_0000092 | 3300048921 | Bacteria | 169106 |
| 699 | Ga0496118_0013801 | 3300048921 | Bacteria | 7608 |
| 700 | Ga0496118_0043341 | 3300048921 | Bacteria | 3538 |
| 701 | Ga0496119_0005121 | 3300048922 | Bacteria | 12704 |
| 702 | Ga0496120_0026398 | 3300048923 | Bacteria | 3587 |
| 703 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 704 | Ga0496121_0000189 | 3300048924 | Bacteria | 137827 |
| 705 | Ga0496121_0001791 | 3300048924 | Bacteria | 34731 |
| 706 | Ga0496121_0002667 | 3300048924 | Bacteria | 26743 |
| 707 | Ga0496122_0001386 | 3300048925 | Bacteria | 39301 |
| 708 | Ga0496122_0005427 | 3300048925 | Bacteria | 15195 |
| 709 | Ga0496122_0022791 | 3300048925 | Bacteria | 5553 |
| 710 | Ga0496122_0068439 | 3300048925 | Bacteria | 2548 |
| 711 | Ga0496123_0000830 | 3300048926 | Bacteria | 49505 |
| 712 | Ga0496123_0002069 | 3300048926 | Bacteria | 25873 |
| 713 | Ga0496123_0002500 | 3300048926 | Bacteria | 22648 |
| 714 | Ga0496123_0002753 | 3300048926 | Bacteria | 21034 |
| 715 | Ga0496123_0005714 | 3300048926 | Bacteria | 12394 |
| 716 | Ga0496124_0000054 | 3300048927 | Bacteria | 252172 |
| 717 | Ga0496124_0000081 | 3300048927 | Bacteria | 208413 |
| 718 | Ga0496124_0000359 | 3300048927 | Bacteria | 83092 |
| 719 | Ga0496124_0004393 | 3300048927 | Bacteria | 16474 |
| 720 | Ga0496124_0019036 | 3300048927 | Bacteria | 6407 |
| 721 | Ga0496124_0022506 | 3300048927 | Bacteria | 5774 |
| 722 | Ga0496124_0064536 | 3300048927 | Bacteria | 3056 |
| 723 | Ga0496125_0001583 | 3300048928 | Bacteria | 32310 |
| 724 | Ga0496125_0002309 | 3300048928 | Bacteria | 25170 |
| 725 | Ga0496125_0008215 | 3300048928 | Bacteria | 10974 |
| 726 | Ga0496125_0025539 | 3300048928 | Bacteria | 5407 |
| 727 | Ga0496125_0026648 | 3300048928 | Bacteria | 5259 |
| 728 | Ga0496125_0028944 | 3300048928 | Bacteria | 4989 |
| 729 | Ga0496125_0033703 | 3300048928 | Bacteria | 4526 |
| 730 | Ga0496126_0000051 | 3300048929 | Bacteria | 313169 |
| 731 | Ga0496126_0000261 | 3300048929 | Bacteria | 112027 |
| 732 | Ga0496126_0000283 | 3300048929 | Bacteria | 107129 |
| 733 | Ga0495682_0008959 | 3300049460 | Bacteria | 3925 |
| 734 | Ga0501033_0004876 | 3300049570 | Bacteria | 10685 |
| 735 | Ga0501034_0043337 | 3300049571 | Bacteria | 4554 |
| 736 | Ga0501034_0121247 | 3300049571 | Bacteria | 2601 |
| 737 | Ga0501036_0001610 | 3300049572 | Bacteria | 17448 |
| 738 | Ga0501036_0019057 | 3300049572 | Bacteria | 5757 |
| 739 | Ga0501038_0001458 | 3300049574 | Bacteria | 21746 |
| 740 | Ga0501039_0008908 | 3300049575 | Bacteria | 7644 |
| 741 | Ga0501039_0019991 | 3300049575 | Bacteria | 5133 |
| 742 | Ga0501040_0000006 | 3300049576 | Bacteria | 97170 |
| 743 | Ga0501040_0000585 | 3300049576 | Bacteria | 22231 |
| 744 | Ga0501041_0000095 | 3300049577 | Bacteria | 35934 |
| 745 | Ga0501041_0014252 | 3300049577 | Bacteria | 4720 |
| 746 | Ga0501042_0000068 | 3300049578 | Bacteria | 37814 |
| 747 | Ga0501042_0027633 | 3300049578 | Bacteria | 3990 |
| 748 | Ga0501046_0001228 | 3300049580 | Bacteria | 24838 |
| 749 | Ga0501047_0197578 | 3300049581 | Bacteria | 1873 |
| 750 | Ga0501048_0005692 | 3300049582 | Bacteria | 9472 |
| 751 | Ga0501071_0011317 | 3300049587 | Bacteria | 6007 |
| 752 | Ga0501072_0014081 | 3300049588 | Bacteria | 6129 |
| 753 | Ga0501074_0009554 | 3300049590 | Bacteria | 7044 |
| 754 | Ga0501075_0011615 | 3300049591 | Bacteria | 6235 |
| 755 | Ga0501075_0021100 | 3300049591 | Bacteria | 4746 |
| 756 | Ga0501223_000072 | 3300049663 | Bacteria | 30438 |
| 757 | Ga0501224_000004 | 3300049664 | Bacteria | 169090 |
| 758 | Ga0501249_004637 | 3300049679 | Bacteria | 2794 |
| 759 | Ga0501257_000019 | 3300049686 | Bacteria | 47149 |
| 760 | Ga0501225_0000048 | 3300049705 | Bacteria | 40596 |
| 761 | Ga0501234_000355 | 3300049707 | Bacteria | 6775 |
| 762 | Ga0501079_0001670 | 3300049741 | Bacteria | 15775 |
| 763 | Ga0501079_0119515 | 3300049741 | Bacteria | 2049 |
| 764 | Ga0501081_0047224 | 3300049743 | Bacteria | 2962 |
| 765 | Ga0501280_000003 | 3300049776 | Bacteria | 93762 |
| 766 | Ga0501044_0003900 | 3300049823 | Bacteria | 16715 |
| 767 | Ga0501044_0106924 | 3300049823 | Bacteria | 2809 |
| 768 | Ga0501045_0000664 | 3300049824 | Bacteria | 21845 |
| 769 | Ga0501045_0066308 | 3300049824 | Bacteria | 2651 |
| 770 | Ga0501226_000018 | 3300049853 | Bacteria | 147268 |
| 771 | nmdc:mga03683_13905_c1 | 3300050489 | Bacteria | 2969 |
| 772 | nmdc:mga03683_3_c1 | 3300050489 | Bacteria | 285872 |
| 773 | nmdc:mga03n38_370_c1 | 3300050490 | Bacteria | 11027 |
| 774 | nmdc:mga00v17_10869_c1 | 3300050491 | Bacteria | 4986 |
| 775 | nmdc:mga00v17_1706_c1 | 3300050491 | Bacteria | 3284 |
| 776 | nmdc:mga00v17_24700_c1 | 3300050491 | Bacteria | 3488 |
| 777 | nmdc:mga0yw44_10385_c1 | 3300050492 | Bacteria | 4755 |
| 778 | nmdc:mga0k408_19525_c1 | 3300050493 | Bacteria | 3789 |
| 779 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 780 | nmdc:mga06z11_300_c1 | 3300050494 | Bacteria | 19031 |
| 781 | nmdc:mga06z11_4264_c1 | 3300050494 | Bacteria | 5613 |
| 782 | nmdc:mga04h51_121_c1 | 3300050495 | Bacteria | 23002 |
| 783 | nmdc:mga07m45_16221_c1 | 3300050496 | Bacteria | 3987 |
| 784 | nmdc:mga07m45_1_c1 | 3300050496 | Bacteria | 485809 |
| 785 | nmdc:mga07m45_53129_c1 | 3300050496 | Bacteria | 2289 |
| 786 | nmdc:mga07m45_67569_c1 | 3300050496 | Bacteria | 2031 |
| 787 | nmdc:mga07m45_9_c1 | 3300050496 | Bacteria | 171776 |
| 788 | nmdc:mga0qj67_76410_c1 | 3300050509 | Bacteria | 2679 |
| 789 | nmdc:mga06r32_72610_c1 | 3300050510 | Bacteria | 3331 |
| 790 | nmdc:mga06r32_85466_c1 | 3300050510 | Bacteria | 3076 |
| 791 | nmdc:mga08y16_48677_c1 | 3300050511 | Bacteria | 4436 |
| 792 | nmdc:mga0n895_10263_c1 | 3300050512 | Bacteria | 8257 |
| 793 | nmdc:mga0n895_14847_c1 | 3300050512 | Bacteria | 7088 |
| 794 | nmdc:mga0rr50_17543_c1 | 3300050513 | Bacteria | 4782 |
| 795 | nmdc:mga0rr50_33414_c1 | 3300050513 | Bacteria | 3674 |
| 796 | nmdc:mga0rr50_4319_c1 | 3300050513 | Bacteria | 8331 |
| 797 | nmdc:mga08x19_1132_c1 | 3300050514 | Bacteria | 16629 |
| 798 | nmdc:mga0a205_143329_c1 | 3300050515 | Bacteria | 2289 |
| 799 | nmdc:mga0a205_147_c1 | 3300050515 | Bacteria | 45502 |
| 800 | nmdc:mga0a205_2826_c1 | 3300050515 | Bacteria | 15366 |
| 801 | nmdc:mga0sz30_1435_c1 | 3300050516 | Bacteria | 8513 |
| 802 | nmdc:mga0sz30_84_c1 | 3300050516 | Bacteria | 36247 |
| 803 | Ga0500610_0000260 | 3300053079 | Bacteria | 15921 |
| 804 | Ga0500643_000143 | 3300053087 | Bacteria | 72166 |
| 805 | Ga0500643_000147 | 3300053087 | Bacteria | 71589 |
| 806 | Ga0500643_001346 | 3300053087 | Bacteria | 14309 |
| 807 | Ga0500643_004690 | 3300053087 | Bacteria | 6085 |
| 808 | Ga0500643_030216 | 3300053087 | Bacteria | 1661 |
| 809 | Ga0500562_008309 | 3300053108 | Bacteria | 2622 |
| 810 | Ga0500592_000973 | 3300053116 | Bacteria | 4672 |
| 811 | Ga0500595_001409 | 3300053119 | Bacteria | 12904 |
| 812 | Ga0500595_014046 | 3300053119 | Bacteria | 3050 |
| 813 | Ga0500607_000152 | 3300053121 | Bacteria | 59345 |
| 814 | Ga0500607_001970 | 3300053121 | Bacteria | 17449 |
| 815 | Ga0500608_021845 | 3300053122 | Bacteria | 2961 |
| 816 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 817 | Ga0500642_0000371 | 3300053130 | Bacteria | 15124 |
| 818 | Ga0500658_0022978 | 3300053134 | Bacteria | 2377 |
| 819 | Ga0500564_001564 | 3300053138 | Bacteria | 7993 |
| 820 | Ga0500622_0015279 | 3300053156 | Bacteria | 4114 |
| 821 | Ga0500624_000003 | 3300053157 | Bacteria | 253364 |
| 822 | Ga0500624_000026 | 3300053157 | Bacteria | 109681 |
| 823 | Ga0500624_000070 | 3300053157 | Bacteria | 58939 |
| 824 | Ga0500627_0000017 | 3300053158 | Bacteria | 119507 |
| 825 | Ga0500627_0000040 | 3300053158 | Bacteria | 68950 |
| 826 | Ga0500636_0007959 | 3300053177 | Bacteria | 6131 |
| 827 | Ga0500636_0009697 | 3300053177 | Bacteria | 5606 |
| 828 | Ga0500637_0000045 | 3300053178 | Bacteria | 44699 |
| 829 | Ga0500567_000636 | 3300053723 | Bacteria | 12668 |
| 830 | Ga0500570_004642 | 3300053724 | Bacteria | 7259 |
| 831 | Ga0500625_000014 | 3300053729 | Bacteria | 109364 |
| 832 | Ga0500645_000221 | 3300053730 | Bacteria | 43327 |
| 833 | Ga0500645_001756 | 3300053730 | Bacteria | 10510 |
| 834 | Ga0500645_004518 | 3300053730 | Bacteria | 5311 |
| 835 | Ga0501084_0012758 | 3300054114 | Bacteria | 6961 |
| 836 | Ga0501082_0003521 | 3300060353 | Bacteria | 13678 |
| 837 | Ga0501082_0011432 | 3300060353 | Bacteria | 7637 |
| 838 | Ga0501082_0059779 | 3300060353 | Bacteria | 3284 |
| 839 | Ga0501082_0135088 | 3300060353 | Bacteria | 2140 |
| 840 | Ga0466962_0016226 | 3300061719 | Bacteria | 3592 |
| 841 | Ga0530510_0034564 | 3300061734 | Bacteria | 3642 |
| 842 | 2511129875 | 2510917021 | Bacteria | 5705459 |
| 843 | 2600201320 | 2599185354 | Bacteria | 4398675 |
| 844 | 2643820599 | 2643221560 | Bacteria | 4801179 |
| 845 | 2643836443 | 2643221563 | Bacteria | 4726935 |
| 846 | 2643951117 | 2643221588 | Bacteria | 3692460 |
| 847 | 2644052919 | 2643221608 | Bacteria | 4724829 |
| 848 | 2738710524 | 2738541275 | Bacteria | 4830863 |
| 849 | 2738848949 | 2738541301 | Bacteria | 4834102 |
| 850 | 2738864678 | 2738541304 | Bacteria | 4833665 |
| 851 | 2739297196 | 2738543022 | Bacteria | 4835059 |
| 852 | 2739358874 | 2738543033 | Bacteria | 4833336 |
| 853 | 2739650775 | 2739367664 | Bacteria | 4114334 |
| 854 | 2740029248 | 2739367865 | Bacteria | 4114482 |
| 855 | 2753767443 | 2751185897 | Bacteria | 5322941 |
| 856 | 2809083369 | 2808606405 | Bacteria | 4586632 |
| 857 | 2819551054 | 2818991438 | Bacteria | 5793701 |
| 858 | 2852654041 | 2852653556 | Bacteria | 4050083 |
| 859 | 2852684616 | 2852680915 | Bacteria | 4100189 |
| 860 | 2882809210 | 2882806704 | Bacteria | 3007728 |
| 861 | 2895881063 | 2895880812 | Bacteria | 11255272 |
| 862 | 2896186171 | 2896184354 | Bacteria | 3258548 |
| 863 | 2896253511 | 2896253425 | Bacteria | 3418029 |
| 864 | 2919138926 | 2919138771 | Bacteria | 5281312 |
| 865 | 2928100624 | 2928100450 | Bacteria | 4837635 |
| 866 | 2928960686 | 2928959182 | Bacteria | 4725774 |
| 867 | 3000867394 | 3000865235 | Bacteria | 3106258 |
| 868 | 8054304029 | 8054302542 | Bacteria | 5698134 |
| 869 | 8057101684 | 8057101203 | Bacteria | 5034064 |
| 870 | Ga0501038_0054694 | |||
| 871 | SwRhRL2b_contig_1676211 | |||
| 872 | SwRhRL2b_contig_2205719 | |||
| 873 | JGI24736J21556_1001131 | |||
| 874 | JGI24741J21665_1000273 | |||
| 875 | JGI24741J21665_1006209 | |||
| 876 | JGI24752J21851_1000148 | |||
| 877 | JGI24740J21852_10004672 | |||
| 878 | JGI24739J22299_10027214 | |||
| 879 | JGI24739J22299_10030387 | |||
| 880 | JGI24737J22298_10000602 | |||
| 881 | JGI24737J22298_10005143 | |||
| 882 | JGI24735J21928_10002161 | |||
| 883 | JGI24735J21928_10004848 | |||
| 884 | JGI24735J21928_10017651 | |||
| 885 | JGI24750J21931_1000219 | |||
| 886 | JGI24748J21848_1000033 | |||
| 887 | JGI24738J21930_10001556 | |||
| 888 | JGI24738J21930_10005865 | |||
| 889 | JGI24034J26672_10000032 | |||
| 890 | JGI24751J29686_10000294 | |||
| 891 | JGI24751J29686_10000300 | |||
| 892 | JGI25165J46597_1000112 | |||
| 893 | JGI25165J46597_1000208 | |||
| 894 | JGI25153J46596_10000021 | |||
| 895 | Ga0055525_1000012 | |||
| 896 | Ga0055542_1000094 | |||
| 897 | Ga0055529_1000045 | |||
| 898 | Ga0055530_10000012 | |||
| 899 | Ga0055531_10000683 | |||
| 900 | Ga0055531_10008207 | |||
| 901 | Ga0065704_10001118 | |||
| 902 | Ga0065704_10070157 | |||
| 903 | Ga0065704_10072849 | |||
| 904 | Ga0065704_10084202 | |||
| 905 | Ga0065707_10090686 | |||
| 906 | Ga0065707_10109048 | |||
| 907 | Ga0065707_10117965 | |||
| 908 | Ga0070658_10000458 | |||
| 909 | Ga0070658_10000836 | |||
| 910 | Ga0070658_10004043 | |||
| 911 | Ga0070658_10006558 | |||
| 912 | Ga0070658_10007863 | |||
| 913 | Ga0070658_10020858 | |||
| 914 | Ga0070683_100095632 | |||
| 915 | Ga0070683_100114256 | |||
| 916 | Ga0070690_100000011 | |||
| 917 | Ga0070670_100000005 | |||
| 918 | Ga0070670_100006954 | |||
| 919 | Ga0070670_100007353 | |||
| 920 | Ga0070670_100049091 | |||
| 921 | Ga0068869_100003111 | |||
| 922 | Ga0070666_10000035 | |||
| 923 | Ga0070666_10002111 | |||
| 924 | Ga0070666_10008945 | |||
| 925 | Ga0070666_10026137 | |||
| 926 | Ga0070680_100008920 | |||
| 927 | Ga0068868_100005495 | |||
| 928 | Ga0070660_100000189 | |||
| 929 | Ga0070660_100003680 | |||
| 930 | Ga0070660_100018015 | |||
| 931 | Ga0070660_100021802 | |||
| 932 | Ga0070689_100055226 | |||
| 933 | Ga0070689_100056972 | |||
| 934 | Ga0070691_10005094 | |||
| 935 | Ga0070661_100014248 | |||
| 936 | Ga0070668_100000006 | |||
| 937 | Ga0070668_100000353 | |||
| 938 | Ga0070668_100014918 | |||
| 939 | Ga0070668_100019348 | |||
| 940 | Ga0070668_100152583 | |||
| 941 | Ga0070669_100000004 | |||
| 942 | Ga0070669_100000056 | |||
| 943 | Ga0070669_100000057 | |||
| 944 | Ga0070669_100000131 | |||
| 945 | Ga0070669_100001055 | |||
| 946 | Ga0070669_100002210 | |||
| 947 | Ga0070669_100007970 | |||
| 948 | Ga0070669_100041884 | |||
| 949 | Ga0070669_100083357 | |||
| 950 | Ga0070671_100000005 | |||
| 951 | Ga0070671_100000029 | |||
| 952 | Ga0070671_100000048 | |||
| 953 | Ga0070671_100000120 | |||
| 954 | Ga0070671_100002408 | |||
| 955 | Ga0070671_100004738 | |||
| 956 | Ga0070671_100147837 | |||
| 957 | Ga0070674_100003272 | |||
| 958 | Ga0070674_100014453 | |||
| 959 | Ga0070674_100017329 | |||
| 960 | Ga0070674_100043506 | |||
| 961 | Ga0070673_100000001 | |||
| 962 | Ga0070688_100024329 | |||
| 963 | Ga0070659_100006689 | |||
| 964 | Ga0070659_100020629 | |||
| 965 | Ga0070659_100130365 | |||
| 966 | Ga0070667_100000003 | |||
| 967 | Ga0070667_100000160 | |||
| 968 | Ga0070667_100000230 | |||
| 969 | Ga0070667_100000754 | |||
| 970 | Ga0070667_100002904 | |||
| 971 | Ga0070667_100091332 | |||
| 972 | Ga0070700_100000952 | |||
| 973 | Ga0070663_100004055 | |||
| 974 | Ga0070663_100055307 | |||
| 975 | Ga0070678_100000149 | |||
| 976 | Ga0070678_100090486 | |||
| 977 | Ga0070662_100000798 | |||
| 978 | Ga0070681_10008953 | |||
| 979 | Ga0068867_100008341 | |||
| 980 | Ga0068867_100038002 | |||
| 981 | Ga0070685_10000850 | |||
| 982 | Ga0070707_100176737 | |||
| 983 | Ga0070679_100007721 | |||
| 984 | Ga0068853_100000627 | |||
| 985 | Ga0068853_100015261 | |||
| 986 | Ga0068853_100086748 | |||
| 987 | Ga0070672_100005821 | |||
| 988 | Ga0070672_100053838 | |||
| 989 | Ga0070686_100000035 | |||
| 990 | Ga0070665_100000021 | |||
| 991 | Ga0070665_100000101 | |||
| 992 | Ga0070665_100000161 | |||
| 993 | Ga0070665_100000256 | |||
| 994 | Ga0070665_100012473 | |||
| 995 | Ga0070665_100014399 | |||
| 996 | Ga0068855_100022825 | |||
| 997 | Ga0068855_100042837 | |||
| 998 | Ga0068855_100092695 | |||
| 999 | Ga0070664_100009808 | |||
| 1000 | Ga0068857_100018688 | |||
| 1001 | Ga0068857_100021544 | |||
| 1002 | Ga0068854_100000547 | |||
| 1003 | Ga0068854_100006245 | |||
| 1004 | Ga0068856_100003378 | |||
| 1005 | Ga0068856_100014543 | |||
| 1006 | Ga0068856_100042659 | |||
| 1007 | Ga0068856_100059073 | |||
| 1008 | Ga0068852_100000259 | |||
| 1009 | Ga0068852_100002971 | |||
| 1010 | Ga0068859_100000233 | |||
| 1011 | Ga0068859_100009239 | |||
| 1012 | Ga0068859_100013351 | |||
| 1013 | Ga0068859_100026211 | |||
| 1014 | Ga0068864_100000011 | |||
| 1015 | Ga0068864_100000211 | |||
| 1016 | Ga0068864_100003942 | |||
| 1017 | Ga0068864_100009425 | |||
| 1018 | Ga0068866_10028308 | |||
| 1019 | Ga0068861_100001267 | |||
| 1020 | Ga0068861_100003944 | |||
| 1021 | Ga0068861_100008325 | |||
| 1022 | Ga0068851_10013600 | |||
| 1023 | Ga0068870_10049358 | |||
| 1024 | Ga0068863_100000060 | |||
| 1025 | Ga0068863_100000132 | |||
| 1026 | Ga0068863_100000413 | |||
| 1027 | Ga0068863_100000466 | |||
| 1028 | Ga0068863_100002604 | |||
| 1029 | Ga0068863_100013665 | |||
| 1030 | Ga0068863_100014019 | |||
| 1031 | Ga0068863_100015742 | |||
| 1032 | Ga0068863_100067443 | |||
| 1033 | Ga0068863_100076595 | |||
| 1034 | Ga0068858_100001744 | |||
| 1035 | Ga0068858_100008838 | |||
| 1036 | Ga0068858_100012341 | |||
| 1037 | Ga0068858_100014825 | |||
| 1038 | Ga0068858_100036669 | |||
| 1039 | Ga0068858_100153978 | |||
| 1040 | Ga0068860_100000068 | |||
| 1041 | Ga0068860_100000126 | |||
| 1042 | Ga0068860_100000220 | |||
| 1043 | Ga0068860_100000473 | |||
| 1044 | Ga0068860_100021108 | |||
| 1045 | Ga0068860_100072066 | |||
| 1046 | Ga0068860_100214113 | |||
| 1047 | Ga0068862_100000011 | |||
| 1048 | Ga0068862_100000146 | |||
| 1049 | Ga0068862_100000151 | |||
| 1050 | Ga0068862_100000198 | |||
| 1051 | Ga0068862_100000267 | |||
| 1052 | Ga0068862_100000581 | |||
| 1053 | Ga0068862_100003219 | |||
| 1054 | Ga0068862_100011508 | |||
| 1055 | Ga0068862_100018624 | |||
| 1056 | Ga0068862_100152074 | |||
| 1057 | Ga0081455_10000049 | |||
| 1058 | Ga0081539_10003331 | |||
| 1059 | Ga0075368_10000894 | |||
| 1060 | Ga0075368_10001248 | |||
| 1061 | Ga0075363_100001087 | |||
| 1062 | Ga0075363_100008716 | |||
| 1063 | Ga0075363_100011878 | |||
| 1064 | Ga0075364_10000812 | |||
| 1065 | Ga0075362_10000043 | |||
| 1066 | Ga0075362_10004251 | |||
| 1067 | Ga0075369_10000422 | |||
| 1068 | Ga0075369_10009323 | |||
| 1069 | Ga0075366_10000832 | |||
| 1070 | Ga0075366_10002410 | |||
| 1071 | Ga0075366_10023371 | |||
| 1072 | Ga0075370_10000241 | |||
| 1073 | Ga0075370_10018445 | |||
| 1074 | Ga0075370_10031397 | |||
| 1075 | Ga0075370_10044080 | |||
| 1076 | Ga0075370_10061587 | |||
| 1077 | Ga0068871_100009681 | |||
| 1078 | Ga0075434_100000891 | |||
| 1079 | Ga0075434_100003634 | |||
| 1080 | Ga0075434_100013292 | |||
| 1081 | Ga0075429_100069504 | |||
| 1082 | Ga0068865_100000072 | |||
| 1083 | Ga0075436_100000248 | |||
| 1084 | Ga0097620_100000233 | |||
| 1085 | Ga0097620_100009239 | |||
| 1086 | Ga0097620_100013351 | |||
| 1087 | Ga0097620_100026210 | |||
| 1088 | Ga0097620_100034635 | |||
| 1089 | Ga0075435_100001418 | |||
| 1090 | Ga0075435_100003277 | |||
| 1091 | Ga0105251_10002944 | |||
| 1092 | Ga0105251_10004465 | |||
| 1093 | Ga0105251_10012746 | |||
| 1094 | Ga0105250_10005824 | |||
| 1095 | Ga0105240_10007916 | |||
| 1096 | Ga0105240_10009609 | |||
| 1097 | Ga0105240_10045358 | |||
| 1098 | Ga0105240_10061597 | |||
| 1099 | Ga0111539_10003392 | |||
| 1100 | Ga0111539_10022382 | |||
| 1101 | Ga0111539_10029850 | |||
| 1102 | Ga0105245_10008667 | |||
| 1103 | Ga0105245_10010317 | |||
| 1104 | Ga0105247_10004800 | |||
| 1105 | Ga0105247_10025811 | |||
| 1106 | Ga0105247_10036253 | |||
| 1107 | Ga0114129_10082268 | |||
| 1108 | Ga0105243_10000512 | |||
| 1109 | Ga0105243_10007320 | |||
| 1110 | Ga0105243_10014674 | |||
| 1111 | Ga0105243_10056287 | |||
| 1112 | Ga0105241_10022767 | |||
| 1113 | Ga0105242_10000178 | |||
| 1114 | Ga0105248_10000012 | |||
| 1115 | Ga0105248_10000406 | |||
| 1116 | Ga0105248_10013202 | |||
| 1117 | Ga0105248_10014880 | |||
| 1118 | Ga0105248_10044831 | |||
| 1119 | Ga0105248_10075835 | |||
| 1120 | Ga0105237_10000626 | |||
| 1121 | Ga0105238_10284719 | |||
| 1122 | Ga0105249_10000015 | |||
| 1123 | Ga0105249_10000094 | |||
| 1124 | Ga0105249_10002709 | |||
| 1125 | Ga0105249_10003676 | |||
| 1126 | Ga0105249_10025943 | |||
| 1127 | Ga0105148_100001 | |||
| 1128 | Ga0105239_10000438 | |||
| 1129 | Ga0105239_10027754 | |||
| 1130 | Ga0105246_10000074 | |||
| 1131 | Ga0105246_10007060 | |||
| 1132 | Ga0157371_10000032 | |||
| 1133 | Ga0157371_10001651 | |||
| 1134 | Ga0157370_10000213 | |||
| 1135 | Ga0157370_10078843 | |||
| 1136 | Ga0157369_10000384 | |||
| 1137 | Ga0157378_10007434 | |||
| 1138 | Ga0163162_10054081 | |||
| 1139 | Ga0163162_10056077 | |||
| 1140 | Ga0163162_10056710 | |||
| 1141 | Ga0163162_10069879 | |||
| 1142 | Ga0163162_10222910 | |||
| 1143 | Ga0157372_10020739 | |||
| 1144 | Ga0157372_10107406 | |||
| 1145 | Ga0157375_10006006 | |||
| 1146 | Ga0157380_10000031 | |||
| 1147 | Ga0157380_10000484 | |||
| 1148 | Ga0157380_10039808 | |||
| 1149 | Ga0157379_10025953 | |||
| 1150 | Ga0183363_1006 | |||
| 1151 | Ga0163161_10000195 | |||
| 1152 | Ga0163161_10016583 | |||
| 1153 | Ga0213875_10003072 | |||
| 1154 | Ga0207672_1000484 | |||
| 1155 | Ga0209147_100577 | |||
| 1156 | Ga0209563_100030 | |||
| 1157 | Ga0207427_100704 | |||
| 1158 | Ga0209437_108363 | |||
| 1159 | Ga0209677_106107 | |||
| 1160 | Ga0209148_1000011 | |||
| 1161 | Ga0209148_1000133 | |||
| 1162 | Ga0209148_1001460 | |||
| 1163 | Ga0209233_1000078 | |||
| 1164 | Ga0209233_1000186 | |||
| 1165 | Ga0209455_1000006 | |||
| 1166 | Ga0209455_1003196 | |||
| 1167 | Ga0209675_1000472 | |||
| 1168 | Ga0209676_1000226 | |||
| 1169 | Ga0209676_1000387 | |||
| 1170 | Ga0209676_1000760 | |||
| 1171 | Ga0209025_1008935 | |||
| 1172 | Ga0209758_1000023 | |||
| 1173 | Ga0209050_1000450 | |||
| 1174 | Ga0209050_1000474 | |||
| 1175 | Ga0209257_1000130 | |||
| 1176 | Ga0209257_1000581 | |||
| 1177 | Ga0207697_10000101 | |||
| 1178 | Ga0207697_10016613 | |||
| 1179 | Ga0207656_10000615 | |||
| 1180 | Ga0207713_1002507 | |||
| 1181 | Ga0207713_1005597 | |||
| 1182 | Ga0207713_1006927 | |||
| 1183 | Ga0207713_1044654 | |||
| 1184 | Ga0207710_10011802 | |||
| 1185 | Ga0207680_10000007 | |||
| 1186 | Ga0207680_10000089 | |||
| 1187 | Ga0207680_10001062 | |||
| 1188 | Ga0207680_10043603 | |||
| 1189 | Ga0207647_10006630 | |||
| 1190 | Ga0207647_10007467 | |||
| 1191 | Ga0207645_10000736 | |||
| 1192 | Ga0207643_10037095 | |||
| 1193 | Ga0207705_10000007 | |||
| 1194 | Ga0207705_10000018 | |||
| 1195 | Ga0207705_10001048 | |||
| 1196 | Ga0207705_10001219 | |||
| 1197 | Ga0207705_10006362 | |||
| 1198 | Ga0207705_10018297 | |||
| 1199 | Ga0207705_10036863 | |||
| 1200 | Ga0207705_10081879 | |||
| 1201 | Ga0207705_10123453 | |||
| 1202 | Ga0207654_10001636 | |||
| 1203 | Ga0207695_10007635 | |||
| 1204 | Ga0207695_10124511 | |||
| 1205 | Ga0207671_10000596 | |||
| 1206 | Ga0207671_10005662 | |||
| 1207 | Ga0207671_10009066 | |||
| 1208 | Ga0207671_10036902 | |||
| 1209 | Ga0207660_10022394 | |||
| 1210 | Ga0207660_10050816 | |||
| 1211 | Ga0207657_10000156 | |||
| 1212 | Ga0207657_10000507 | |||
| 1213 | Ga0207657_10006147 | |||
| 1214 | Ga0207649_10003922 | |||
| 1215 | Ga0207649_10004027 | |||
| 1216 | Ga0207652_10021467 | |||
| 1217 | Ga0207646_10152246 | |||
| 1218 | Ga0207681_10000001 | |||
| 1219 | Ga0207681_10000010 | |||
| 1220 | Ga0207681_10000019 | |||
| 1221 | Ga0207681_10000053 | |||
| 1222 | Ga0207681_10000224 | |||
| 1223 | Ga0207681_10000288 | |||
| 1224 | Ga0207681_10000578 | |||
| 1225 | Ga0207681_10006398 | |||
| 1226 | Ga0207681_10016986 | |||
| 1227 | Ga0207681_10032395 | |||
| 1228 | Ga0207681_10037009 | |||
| 1229 | Ga0207694_10077662 | |||
| 1230 | Ga0207650_10000018 | |||
| 1231 | Ga0207650_10000249 | |||
| 1232 | Ga0207650_10009614 | |||
| 1233 | Ga0207650_10026619 | |||
| 1234 | Ga0207687_10010013 | |||
| 1235 | Ga0207687_10021302 | |||
| 1236 | Ga0207644_10000007 | |||
| 1237 | Ga0207644_10000008 | |||
| 1238 | Ga0207644_10000911 | |||
| 1239 | Ga0207644_10002772 | |||
| 1240 | Ga0207644_10012636 | |||
| 1241 | Ga0207644_10015708 | |||
| 1242 | Ga0207690_10006409 | |||
| 1243 | Ga0207690_10034263 | |||
| 1244 | Ga0207706_10001346 | |||
| 1245 | Ga0207706_10003722 | |||
| 1246 | Ga0207706_10022565 | |||
| 1247 | Ga0207706_10050483 | |||
| 1248 | Ga0207709_10000145 | |||
| 1249 | Ga0207709_10003291 | |||
| 1250 | Ga0207709_10010876 | |||
| 1251 | Ga0207709_10049300 | |||
| 1252 | Ga0207670_10037917 | |||
| 1253 | Ga0207669_10000118 | |||
| 1254 | Ga0207669_10000784 | |||
| 1255 | Ga0207704_10000032 | |||
| 1256 | Ga0207704_10003755 | |||
| 1257 | Ga0207691_10076134 | |||
| 1258 | Ga0207691_10121895 | |||
| 1259 | Ga0207711_10000004 | |||
| 1260 | Ga0207711_10000382 | |||
| 1261 | Ga0207711_10003989 | |||
| 1262 | Ga0207711_10005707 | |||
| 1263 | Ga0207711_10008959 | |||
| 1264 | Ga0207711_10011608 | |||
| 1265 | Ga0207711_10028532 | |||
| 1266 | Ga0207711_10044809 | |||
| 1267 | Ga0207689_10000840 | |||
| 1268 | Ga0207679_10042816 | |||
| 1269 | Ga0207667_10000002 | |||
| 1270 | Ga0207667_10000013 | |||
| 1271 | Ga0207667_10004614 | |||
| 1272 | Ga0207667_10005831 | |||
| 1273 | Ga0207667_10014586 | |||
| 1274 | Ga0207667_10028292 | |||
| 1275 | Ga0207667_10078892 | |||
| 1276 | Ga0207667_10130160 | |||
| 1277 | Ga0207651_10000001 | |||
| 1278 | Ga0207651_10103787 | |||
| 1279 | Ga0207712_10000004 | |||
| 1280 | Ga0207712_10000023 | |||
| 1281 | Ga0207712_10001574 | |||
| 1282 | Ga0207712_10001688 | |||
| 1283 | Ga0207712_10071483 | |||
| 1284 | Ga0207668_10000026 | |||
| 1285 | Ga0207668_10000244 | |||
| 1286 | Ga0207668_10002820 | |||
| 1287 | Ga0207668_10011271 | |||
| 1288 | Ga0207640_10000392 | |||
| 1289 | Ga0207640_10000809 | |||
| 1290 | Ga0207640_10002033 | |||
| 1291 | Ga0207640_10007509 | |||
| 1292 | Ga0207640_10025536 | |||
| 1293 | Ga0207640_10059855 | |||
| 1294 | Ga0207640_10064677 | |||
| 1295 | Ga0207658_10000002 | |||
| 1296 | Ga0207658_10000064 | |||
| 1297 | Ga0207658_10000204 | |||
| 1298 | Ga0207658_10000230 | |||
| 1299 | Ga0207658_10000587 | |||
| 1300 | Ga0207658_10001492 | |||
| 1301 | Ga0207658_10001874 | |||
| 1302 | Ga0207658_10065053 | |||
| 1303 | Ga0207658_10107535 | |||
| 1304 | Ga0207677_10000209 | |||
| 1305 | Ga0207703_10000489 | |||
| 1306 | Ga0207703_10000510 | |||
| 1307 | Ga0207703_10001171 | |||
| 1308 | Ga0207703_10002081 | |||
| 1309 | Ga0207703_10009847 | |||
| 1310 | Ga0207703_10041168 | |||
| 1311 | Ga0207639_10000808 | |||
| 1312 | Ga0207639_10001024 | |||
| 1313 | Ga0207639_10004520 | |||
| 1314 | Ga0207639_10018354 | |||
| 1315 | Ga0207639_10057664 | |||
| 1316 | Ga0207678_10002991 | |||
| 1317 | Ga0207678_10007603 | |||
| 1318 | Ga0207678_10011131 | |||
| 1319 | Ga0207678_10037279 | |||
| 1320 | Ga0207708_10007087 | |||
| 1321 | Ga0207708_10021025 | |||
| 1322 | Ga0207702_10001204 | |||
| 1323 | Ga0207702_10007553 | |||
| 1324 | Ga0207702_10014752 | |||
| 1325 | Ga0207702_10194195 | |||
| 1326 | Ga0207641_10000010 | |||
| 1327 | Ga0207641_10000050 | |||
| 1328 | Ga0207641_10000098 | |||
| 1329 | Ga0207641_10000100 | |||
| 1330 | Ga0207641_10000607 | |||
| 1331 | Ga0207641_10003216 | |||
| 1332 | Ga0207641_10004086 | |||
| 1333 | Ga0207641_10008306 | |||
| 1334 | Ga0207641_10010984 | |||
| 1335 | Ga0207648_10001521 | |||
| 1336 | Ga0207648_10002650 | |||
| 1337 | Ga0207648_10084660 | |||
| 1338 | Ga0207676_10000004 | |||
| 1339 | Ga0207676_10000046 | |||
| 1340 | Ga0207676_10001192 | |||
| 1341 | Ga0207676_10004670 | |||
| 1342 | Ga0207676_10023338 | |||
| 1343 | Ga0207674_10032027 | |||
| 1344 | Ga0207674_10074045 | |||
| 1345 | Ga0207675_100000418 | |||
| 1346 | Ga0207675_100002120 | |||
| 1347 | Ga0207675_100004105 | |||
| 1348 | Ga0207675_100008435 | |||
| 1349 | Ga0207675_100010029 | |||
| 1350 | Ga0207683_10000881 | |||
| 1351 | Ga0207683_10044107 | |||
| 1352 | Ga0207698_10000036 | |||
| 1353 | Ga0207698_10002649 | |||
| 1354 | Ga0207698_10025231 | |||
| 1355 | Ga0207698_10058790 | |||
| 1356 | Ga0209982_1000469 | |||
| 1357 | Ga0209983_1000372 | |||
| 1358 | Ga0209971_1000479 | |||
| 1359 | Ga0209998_10003268 | |||
| 1360 | Ga0209813_10000019 | |||
| 1361 | Ga0209813_10000027 | |||
| 1362 | Ga0209974_10000433 | |||
| 1363 | Ga0209974_10017864 | |||
| 1364 | Ga0207428_10015046 | |||
| 1365 | Ga0268266_10000015 | |||
| 1366 | Ga0268266_10000040 | |||
| 1367 | Ga0268266_10001320 | |||
| 1368 | Ga0268266_10002221 | |||
| 1369 | Ga0268266_10035008 | |||
| 1370 | Ga0268266_10060181 | |||
| 1371 | Ga0268266_10091313 | |||
| 1372 | Ga0268265_10000002 | |||
| 1373 | Ga0268265_10000021 | |||
| 1374 | Ga0268265_10000026 | |||
| 1375 | Ga0268265_10000128 | |||
| 1376 | Ga0268265_10001138 | |||
| 1377 | Ga0268265_10005503 | |||
| 1378 | Ga0268265_10012215 | |||
| 1379 | Ga0268265_10030522 | |||
| 1380 | Ga0268265_10103097 | |||
| 1381 | Ga0268264_10000003 | |||
| 1382 | Ga0268264_10000103 | |||
| 1383 | Ga0268264_10000106 | |||
| 1384 | Ga0268264_10000224 | |||
| 1385 | Ga0268264_10000384 | |||
| 1386 | Ga0268264_10000682 | |||
| 1387 | Ga0268264_10002280 | |||
| 1388 | Ga0268264_10005337 | |||
| 1389 | Ga0268264_10051042 | |||
| 1390 | Ga0307517_10033350 | |||
| 1391 | Ga0307511_10002452 | |||
| 1392 | Ga0265327_10010384 | |||
| 1393 | Ga0307513_10041093 | |||
| 1394 | Ga0307513_10107692 | |||
| 1395 | Ga0307408_100000518 | |||
| 1396 | Ga0307408_100002503 | |||
| 1397 | Ga0307408_100008036 | |||
| 1398 | Ga0307408_100059075 | |||
| 1399 | Ga0307508_10000405 | |||
| 1400 | Ga0307508_10035420 | |||
| 1401 | Ga0316576_10017527 | |||
| 1402 | Ga0316576_10117900 | |||
| 1403 | Ga0307405_10002305 | |||
| 1404 | Ga0307405_10018466 | |||
| 1405 | Ga0307405_10019681 | |||
| 1406 | Ga0307413_10010529 | |||
| 1407 | Ga0307413_10058537 | |||
| 1408 | Ga0307413_10061666 | |||
| 1409 | Ga0307413_10106937 | |||
| 1410 | Ga0307413_10107111 | |||
| 1411 | Ga0307410_10006414 | |||
| 1412 | Ga0307406_10000892 | |||
| 1413 | Ga0307406_10034258 | |||
| 1414 | Ga0307406_10056538 | |||
| 1415 | Ga0307407_10029276 | |||
| 1416 | Ga0307412_10000495 | |||
| 1417 | Ga0307412_10002706 | |||
| 1418 | Ga0307412_10008473 | |||
| 1419 | Ga0307412_10012668 | |||
| 1420 | Ga0307412_10018302 | |||
| 1421 | Ga0307409_100008074 | |||
| 1422 | Ga0307409_100088996 | |||
| 1423 | Ga0307409_100095618 | |||
| 1424 | Ga0307416_100007406 | |||
| 1425 | Ga0307416_100009769 | |||
| 1426 | Ga0307416_100032065 | |||
| 1427 | Ga0307416_100066731 | |||
| 1428 | Ga0307414_10000211 | |||
| 1429 | Ga0307414_10000684 | |||
| 1430 | Ga0307414_10002264 | |||
| 1431 | Ga0307414_10037581 | |||
| 1432 | Ga0307414_10045913 | |||
| 1433 | Ga0307414_10184308 | |||
| 1434 | Ga0307411_10032214 | |||
| 1435 | Ga0307411_10033629 | |||
| 1436 | Ga0307411_10055325 | |||
| 1437 | Ga0307415_100003211 | |||
| 1438 | Ga0316583_10030455 | |||
| 1439 | Ga0316580_10020965 | |||
| 1440 | Ga0307510_10015830 | |||
| 1441 | Ga0373932_0010942 | |||
| 1442 | Ga0316574_0030859 | |||
| 1443 | Ga0316574_0084865 | |||
| 1444 | Ga0316582_0000396 | |||
| 1445 | Ga0316582_0100841 | |||
| 1446 | Ga0316584_0044247 | |||
| 1447 | Ga0316584_0060346 | |||
| 1448 | Ga0395899_0004597 | |||
| 1449 | Ga0395900_0039437 | |||
| 1450 | Ga0395905_0053747 | |||
| 1451 | Ga0395905_0083470 | |||
| 1452 | Ga0436364_0542377 | |||
| 1453 | Ga0395901_0042764 | |||
| 1454 | Ga0237819_00202 | |||
| 1455 | Ga0400490_16829 | |||
| 1456 | Ga0400483_031978 | |||
| 1457 | Ga0400483_088306 | |||
| 1458 | Ga0400483_194190 | |||
| 1459 | Ga0400483_291966 | |||
| 1460 | Ga0439441_005969 | |||
| 1461 | Ga0439455_0002922 | |||
| 1462 | Ga0450923_000640 | |||
| 1463 | Ga0439446_0012018 | |||
| 1464 | Ga0439458_0000366 | |||
| 1465 | Ga0439458_0015429 | |||
| 1466 | Ga0439435_0002575 | |||
| 1467 | Ga0439435_0011637 | |||
| 1468 | Ga0451577_0108054 | |||
| 1469 | Ga0466972_0001182 | |||
| 1470 | Ga0466971_0010442 | |||
| 1471 | Ga0451576_0001640 | |||
| 1472 | Ga0451576_0004783 | |||
| 1473 | Ga0495627_000198 | |||
| 1474 | Ga0495627_000519 | |||
| 1475 | Ga0495629_0104191 | |||
| 1476 | Ga0495638_0000012 | |||
| 1477 | Ga0495650_0000302 | |||
| 1478 | Ga0495662_0003397 | |||
| 1479 | Ga0495585_0002681 | |||
| 1480 | Ga0495596_0000247 | |||
| 1481 | Ga0495596_0011228 | |||
| 1482 | Ga0495583_0000796 | |||
| 1483 | Ga0495583_0001345 | |||
| 1484 | Ga0495583_0005024 | |||
| 1485 | Ga0495583_0007631 | |||
| 1486 | Ga0495583_0019839 | |||
| 1487 | Ga0495583_0028368 | |||
| 1488 | Ga0495606_0001599 | |||
| 1489 | Ga0495606_0022947 | |||
| 1490 | Ga0495610_0000050 | |||
| 1491 | Ga0495616_0000698 | |||
| 1492 | Ga0495630_0043625 | |||
| 1493 | Ga0495630_0045240 | |||
| 1494 | Ga0495632_0000076 | |||
| 1495 | Ga0495632_0004214 | |||
| 1496 | Ga0495637_0001954 | |||
| 1497 | Ga0495643_0000009 | |||
| 1498 | Ga0495643_0000036 | |||
| 1499 | Ga0495643_0001323 | |||
| 1500 | Ga0495643_0009838 | |||
| 1501 | Ga0495648_0000038 | |||
| 1502 | Ga0495648_0000961 | |||
| 1503 | Ga0495648_0028497 | |||
| 1504 | Ga0495648_0033200 | |||
| 1505 | Ga0495663_0000023 | |||
| 1506 | Ga0495642_0038527 | |||
| 1507 | Ga0495640_0025868 | |||
| 1508 | Ga0495640_0028980 | |||
| 1509 | Ga0495586_0053631 | |||
| 1510 | Ga0495621_0029444 | |||
| 1511 | Ga0495633_0000136 | |||
| 1512 | Ga0495633_0000770 | |||
| 1513 | Ga0495668_0000004 | |||
| 1514 | Ga0495668_0000016 | |||
| 1515 | Ga0495634_0042569 | |||
| 1516 | Ga0495625_0001219 | |||
| 1517 | Ga0495625_0002974 | |||
| 1518 | Ga0495625_0005534 | |||
| 1519 | Ga0495625_0014265 | |||
| 1520 | Ga0495625_0019483 | |||
| 1521 | Ga0495625_0086559 | |||
| 1522 | Ga0495635_0025699 | |||
| 1523 | Ga0495599_0063078 | |||
| 1524 | Ga0495669_0000050 | |||
| 1525 | Ga0495670_0005533 | |||
| 1526 | Ga0495670_0048955 | |||
| 1527 | Ga0495671_0000013 | |||
| 1528 | Ga0495671_0000034 | |||
| 1529 | Ga0495671_0001499 | |||
| 1530 | Ga0495600_0001875 | |||
| 1531 | Ga0495604_0120136 | |||
| 1532 | Ga0495680_0033086 | |||
| 1533 | Ga0495683_0000816 | |||
| 1534 | Ga0495683_0049724 | |||
| 1535 | Ga0495687_001300 | |||
| 1536 | Ga0495687_001654 | |||
| 1537 | Ga0495673_0000013 | |||
| 1538 | Ga0495681_0000095 | |||
| 1539 | Ga0495686_0000205 | |||
| 1540 | Ga0495686_0000623 | |||
| 1541 | Ga0495686_0001345 | |||
| 1542 | Ga0495686_0001391 | |||
| 1543 | Ga0495686_0014857 | |||
| 1544 | Ga0495626_0000585 | |||
| 1545 | Ga0496100_0010068 | |||
| 1546 | Ga0496102_0000432 | |||
| 1547 | Ga0496102_0004819 | |||
| 1548 | Ga0496103_0000131 | |||
| 1549 | Ga0496103_0000273 | |||
| 1550 | Ga0496103_0005817 | |||
| 1551 | Ga0496104_0001853 | |||
| 1552 | Ga0496104_0140318 | |||
| 1553 | Ga0496105_0001020 | |||
| 1554 | Ga0496105_0006038 | |||
| 1555 | Ga0496106_0010398 | |||
| 1556 | Ga0496108_0014688 | |||
| 1557 | Ga0496108_0067447 | |||
| 1558 | Ga0496110_0031029 | |||
| 1559 | Ga0496113_0001108 | |||
| 1560 | Ga0496114_0018506 | |||
| 1561 | Ga0496115_0000133 | |||
| 1562 | Ga0496116_0000149 | |||
| 1563 | Ga0496116_0005419 | |||
| 1564 | Ga0496117_0002127 | |||
| 1565 | Ga0496117_0011656 | |||
| 1566 | Ga0496117_0020980 | |||
| 1567 | Ga0496118_0000092 | |||
| 1568 | Ga0496118_0013801 | |||
| 1569 | Ga0496118_0043341 | |||
| 1570 | Ga0496119_0005121 | |||
| 1571 | Ga0496120_0026398 | |||
| 1572 | Ga0496121_0000024 | |||
| 1573 | Ga0496121_0000189 | |||
| 1574 | Ga0496121_0001791 | |||
| 1575 | Ga0496121_0002667 | |||
| 1576 | Ga0496122_0001386 | |||
| 1577 | Ga0496122_0005427 | |||
| 1578 | Ga0496122_0022791 | |||
| 1579 | Ga0496122_0068439 | |||
| 1580 | Ga0496123_0000830 | |||
| 1581 | Ga0496123_0002069 | |||
| 1582 | Ga0496123_0002500 | |||
| 1583 | Ga0496123_0002753 | |||
| 1584 | Ga0496123_0005714 | |||
| 1585 | Ga0496124_0000054 | |||
| 1586 | Ga0496124_0000081 | |||
| 1587 | Ga0496124_0000359 | |||
| 1588 | Ga0496124_0004393 | |||
| 1589 | Ga0496124_0019036 | |||
| 1590 | Ga0496124_0022506 | |||
| 1591 | Ga0496124_0064536 | |||
| 1592 | Ga0496125_0001583 | |||
| 1593 | Ga0496125_0002309 | |||
| 1594 | Ga0496125_0008215 | |||
| 1595 | Ga0496125_0025539 | |||
| 1596 | Ga0496125_0026648 | |||
| 1597 | Ga0496125_0028944 | |||
| 1598 | Ga0496125_0033703 | |||
| 1599 | Ga0496126_0000051 | |||
| 1600 | Ga0496126_0000261 | |||
| 1601 | Ga0496126_0000283 | |||
| 1602 | Ga0495682_0008959 | |||
| 1603 | Ga0501033_0004876 | |||
| 1604 | Ga0501034_0043337 | |||
| 1605 | Ga0501034_0121247 | |||
| 1606 | Ga0501036_0001610 | |||
| 1607 | Ga0501036_0019057 | |||
| 1608 | Ga0501038_0001458 | |||
| 1609 | Ga0501039_0008908 | |||
| 1610 | Ga0501039_0019991 | |||
| 1611 | Ga0501040_0000006 | |||
| 1612 | Ga0501040_0000585 | |||
| 1613 | Ga0501041_0000095 | |||
| 1614 | Ga0501041_0014252 | |||
| 1615 | Ga0501042_0000068 | |||
| 1616 | Ga0501042_0027633 | |||
| 1617 | Ga0501046_0001228 | |||
| 1618 | Ga0501047_0197578 | |||
| 1619 | Ga0501048_0005692 | |||
| 1620 | Ga0501071_0011317 | |||
| 1621 | Ga0501072_0014081 | |||
| 1622 | Ga0501074_0009554 | |||
| 1623 | Ga0501075_0011615 | |||
| 1624 | Ga0501075_0021100 | |||
| 1625 | Ga0501223_000072 | |||
| 1626 | Ga0501224_000004 | |||
| 1627 | Ga0501249_004637 | |||
| 1628 | Ga0501257_000019 | |||
| 1629 | Ga0501225_0000048 | |||
| 1630 | Ga0501234_000355 | |||
| 1631 | Ga0501079_0001670 | |||
| 1632 | Ga0501079_0119515 | |||
| 1633 | Ga0501081_0047224 | |||
| 1634 | Ga0501280_000003 | |||
| 1635 | Ga0501044_0003900 | |||
| 1636 | Ga0501044_0106924 | |||
| 1637 | Ga0501045_0000664 | |||
| 1638 | Ga0501045_0066308 | |||
| 1639 | Ga0501226_000018 | |||
| 1640 | nmdc:mga03683_13905_c1 | |||
| 1641 | nmdc:mga03683_3_c1 | |||
| 1642 | nmdc:mga03n38_370_c1 | |||
| 1643 | nmdc:mga00v17_10869_c1 | |||
| 1644 | nmdc:mga00v17_1706_c1 | |||
| 1645 | nmdc:mga00v17_24700_c1 | |||
| 1646 | nmdc:mga0yw44_10385_c1 | |||
| 1647 | nmdc:mga0k408_19525_c1 | |||
| 1648 | nmdc:mga0k408_2_c1 | |||
| 1649 | nmdc:mga06z11_300_c1 | |||
| 1650 | nmdc:mga06z11_4264_c1 | |||
| 1651 | nmdc:mga04h51_121_c1 | |||
| 1652 | nmdc:mga07m45_16221_c1 | |||
| 1653 | nmdc:mga07m45_1_c1 | |||
| 1654 | nmdc:mga07m45_53129_c1 | |||
| 1655 | nmdc:mga07m45_67569_c1 | |||
| 1656 | nmdc:mga07m45_9_c1 | |||
| 1657 | nmdc:mga0qj67_76410_c1 | |||
| 1658 | nmdc:mga06r32_72610_c1 | |||
| 1659 | nmdc:mga06r32_85466_c1 | |||
| 1660 | nmdc:mga08y16_48677_c1 | |||
| 1661 | nmdc:mga0n895_10263_c1 | |||
| 1662 | nmdc:mga0n895_14847_c1 | |||
| 1663 | nmdc:mga0rr50_17543_c1 | |||
| 1664 | nmdc:mga0rr50_33414_c1 | |||
| 1665 | nmdc:mga0rr50_4319_c1 | |||
| 1666 | nmdc:mga08x19_1132_c1 | |||
| 1667 | nmdc:mga0a205_143329_c1 | |||
| 1668 | nmdc:mga0a205_147_c1 | |||
| 1669 | nmdc:mga0a205_2826_c1 | |||
| 1670 | nmdc:mga0sz30_1435_c1 | |||
| 1671 | nmdc:mga0sz30_84_c1 | |||
| 1672 | Ga0500610_0000260 | |||
| 1673 | Ga0500643_000143 | |||
| 1674 | Ga0500643_000147 | |||
| 1675 | Ga0500643_001346 | |||
| 1676 | Ga0500643_004690 | |||
| 1677 | Ga0500643_030216 | |||
| 1678 | Ga0500562_008309 | |||
| 1679 | Ga0500592_000973 | |||
| 1680 | Ga0500595_001409 | |||
| 1681 | Ga0500595_014046 | |||
| 1682 | Ga0500607_000152 | |||
| 1683 | Ga0500607_001970 | |||
| 1684 | Ga0500608_021845 | |||
| 1685 | Ga0500642_0000002 | |||
| 1686 | Ga0500642_0000371 | |||
| 1687 | Ga0500658_0022978 | |||
| 1688 | Ga0500564_001564 | |||
| 1689 | Ga0500622_0015279 | |||
| 1690 | Ga0500624_000003 | |||
| 1691 | Ga0500624_000026 | |||
| 1692 | Ga0500624_000070 | |||
| 1693 | Ga0500627_0000017 | |||
| 1694 | Ga0500627_0000040 | |||
| 1695 | Ga0500636_0007959 | |||
| 1696 | Ga0500636_0009697 | |||
| 1697 | Ga0500637_0000045 | |||
| 1698 | Ga0500567_000636 | |||
| 1699 | Ga0500570_004642 | |||
| 1700 | Ga0500625_000014 | |||
| 1701 | Ga0500645_000221 | |||
| 1702 | Ga0500645_001756 | |||
| 1703 | Ga0500645_004518 | |||
| 1704 | Ga0501084_0012758 | |||
| 1705 | Ga0501082_0003521 | |||
| 1706 | Ga0501082_0011432 | |||
| 1707 | Ga0501082_0059779 | |||
| 1708 | Ga0501082_0135088 | |||
| 1709 | Ga0466962_0016226 | |||
| 1710 | Ga0530510_0034564 | |||
| 1711 | 2511129875 | |||
| 1712 | 2600201320 | |||
| 1713 | 2643820599 | |||
| 1714 | 2643836443 | |||
| 1715 | 2643951117 | |||
| 1716 | 2644052919 | |||
| 1717 | 2738710524 | |||
| 1718 | 2738848949 | |||
| 1719 | 2738864678 | |||
| 1720 | 2739297196 | |||
| 1721 | 2739358874 | |||
| 1722 | 2739650775 | |||
| 1723 | 2740029248 | |||
| 1724 | 2753767443 | |||
| 1725 | 2809083369 | |||
| 1726 | 2819551054 | |||
| 1727 | 2852654041 | |||
| 1728 | 2852684616 | |||
| 1729 | 2882809210 | |||
| 1730 | 2895881063 | |||
| 1731 | 2896186171 | |||
| 1732 | 2896253511 | |||
| 1733 | 2919138926 | |||
| 1734 | 2928100624 | |||
| 1735 | 2928960686 | |||
| 1736 | 3000867394 | |||
| 1737 | 8054304029 | |||
| 1738 | 8057101684 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xky-assembly1.cif.gz_A | crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex | 0.8888 | 12 | 290 |
| 7xky-assembly1.cif.gz_A | crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex | 0.8735 | 12 | 290 |
| 5dni-assembly2.cif.gz_B | crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit | 0.8464 | 316 | 488 |
| 6uq9-assembly1.cif.gz_A | crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate | 0.821 | 6 | 492 |
| 6uql-assembly1.cif.gz_B | crystal structure of r471a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate | 0.8205 | 6 | 492 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E9AH43_359_548_3.20.130.10 | Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain | 0.8452 | 313 | 486 | 3.20.130.10 |
| 5dniA00 | Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain | 0.8158 | 316 | 488 | 3.20.130.10 |
| 2hvvA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.7927 | 401 | 435 | 3.40.140.10 |
| af_P0AC35_1_176_3.20.130.10 | Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain | 0.7909 | 316 | 488 | 3.20.130.10 |
| 5dniA00 | Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain | 0.7865 | 316 | 488 | 3.20.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0TCW2-F1-model_v4 | Fumarate hydratase | 0.9864 | 4 | 285 |
GO:0016829
GO:0046872 GO:0051539 |
| AF-A0A2D5CI99-F1-model_v4 | deleted | 0.9842 | 4 | 278 |
|
| AF-A0A349KRR0-F1-model_v4 | Fumarate hydratase | 0.9836 | 4 | 276 |
GO:0016829
GO:0046872 GO:0051539 |
| AF-A0A536ZL77-F1-model_v4 | Fumarate hydratase | 0.9833 | 4 | 307 |
GO:0016829
GO:0046872 GO:0051539 |
| AF-A0A3C0TCW2-F1-model_v4 | Fumarate hydratase | 0.983 | 4 | 285 |
GO:0016829
GO:0046872 GO:0051539 |