F484036

General Info

Members Datasets Scaffolds Average Seq Length
866 356 1732 155

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0497522|Ga0501071_0497522_153_635
Length 160
Sequence MAKTASKPESQDVKVVSSNRRAFHDYAILETLETGIALTGSEIKSIRAGKISLAEAYARVDNGELWLIGAHIPPYTHGAYANHEPLRPRKLLAHSSEIEHLRRQVEAKGMTLVPLRVVLKRGKAKIDIGVARAKKLYDKRAAESERQSKRDIERSLADRE

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
226 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
232 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
237 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
240 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
241 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
242 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
268 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
269 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
270 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
273 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
274 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
275 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
276 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
318 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
327 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
346 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
347 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
348 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
356 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 1.5
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0.12
Rhizoplane 0.58
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0497522 3300049587 Unclassified 935
2 JGI25406J46586_10099214 3300003203 Bacteria 870
3 JGI26145J50221_1005240 3300003371 Bacteria 1063
4 JGI26141J51220_1003409 3300003503 Bacteria 980
5 Ga0058858_1037324 3300004785 Bacteria 728
6 Ga0058859_10070160 3300004798 Bacteria 865
7 Ga0058859_10106164 3300004798 Bacteria 765
8 Ga0058863_10058554 3300004799 Bacteria 733
9 Ga0058861_10058231 3300004800 Bacteria 622
10 Ga0058860_11827996 3300004801 Bacteria 543
11 Ga0058862_10159895 3300004803 Bacteria 853
12 Ga0065707_10148861 3300005295 Bacteria 1681
13 Ga0065707_10221333 3300005295 Bacteria 1224
14 Ga0065707_10625993 3300005295 Bacteria 676
15 Ga0070658_10016316 3300005327 Bacteria 5944
16 Ga0070676_10011371 3300005328 Bacteria 4839
17 Ga0070690_100105338 3300005330 Bacteria 1875
18 Ga0070690_100268087 3300005330 Bacteria 1214
19 Ga0070670_100011632 3300005331 Bacteria 7525
20 Ga0070677_10123539 3300005333 Bacteria 1172
21 Ga0068869_100001319 3300005334 Bacteria 14689
22 Ga0068869_100058153 3300005334 Bacteria 2826
23 Ga0070666_10185406 3300005335 Bacteria 1461
24 Ga0070680_100004668 3300005336 Bacteria 10307
25 Ga0070680_100010304 3300005336 Bacteria 7205
26 Ga0070682_100014141 3300005337 Bacteria 4609
27 Ga0070682_101110132 3300005337 Bacteria 663
28 Ga0068868_100043799 3300005338 Bacteria 3497
29 Ga0068868_100369953 3300005338 Bacteria 1231
30 Ga0068868_100574943 3300005338 Bacteria 996
31 Ga0070660_100000310 3300005339 Bacteria 32400
32 Ga0070660_100070147 3300005339 Bacteria 2734
33 Ga0070689_100122781 3300005340 Bacteria 2076
34 Ga0070689_100258547 3300005340 Bacteria 1439
35 Ga0070689_100764184 3300005340 Bacteria 848
36 Ga0070689_100800922 3300005340 Bacteria 829
37 Ga0070689_101104844 3300005340 Bacteria 709
38 Ga0070691_10006645 3300005341 Bacteria 5293
39 Ga0070691_10109128 3300005341 Bacteria 1382
40 Ga0070691_10130505 3300005341 Bacteria 1273
41 Ga0070691_10734555 3300005341 Bacteria 596
42 Ga0070687_100943598 3300005343 Bacteria 621
43 Ga0070661_100015130 3300005344 Bacteria 5443
44 Ga0070692_10045074 3300005345 Bacteria 2273
45 Ga0070692_10075987 3300005345 Bacteria 1800
46 Ga0070668_100882399 3300005347 Bacteria 799
47 Ga0070668_101866862 3300005347 Bacteria 553
48 Ga0070669_100163817 3300005353 Bacteria 1730
49 Ga0070669_100521868 3300005353 Bacteria 987
50 Ga0070669_100845244 3300005353 Bacteria 780
51 Ga0070675_100947792 3300005354 Bacteria 790
52 Ga0070674_100493192 3300005356 Bacteria 1019
53 Ga0070688_100397228 3300005365 Bacteria 1020
54 Ga0070659_100032893 3300005366 Bacteria 4026
55 Ga0070659_100343215 3300005366 Bacteria 1252
56 Ga0070667_100101454 3300005367 Bacteria 2486
57 Ga0070667_101237905 3300005367 Bacteria 699
58 Ga0070703_10040106 3300005406 Bacteria 1455
59 Ga0070703_10064954 3300005406 Bacteria 1204
60 Ga0070709_10154063 3300005434 Bacteria 1591
61 Ga0070709_11225078 3300005434 Bacteria 604
62 Ga0070714_100060895 3300005435 Bacteria 3241
63 Ga0070714_100847971 3300005435 Bacteria 886
64 Ga0070713_100008635 3300005436 Bacteria 7240
65 Ga0070701_10002547 3300005438 Bacteria 7053
66 Ga0070701_10034111 3300005438 Bacteria 2548
67 Ga0070701_10100068 3300005438 Bacteria 1604
68 Ga0070705_100004869 3300005440 Bacteria 6537
69 Ga0070705_100007639 3300005440 Bacteria 5332
70 Ga0070705_100029506 3300005440 Bacteria 3018
71 Ga0070705_100068773 3300005440 Bacteria 2133
72 Ga0070700_100031452 3300005441 Bacteria 3181
73 Ga0070700_100348142 3300005441 Bacteria 1097
74 Ga0070694_100010663 3300005444 Bacteria 5678
75 Ga0070694_101139352 3300005444 Bacteria 652
76 Ga0070694_101220578 3300005444 Bacteria 630
77 Ga0070694_101232074 3300005444 Bacteria 628
78 Ga0070708_100009491 3300005445 Bacteria 7842
79 Ga0070708_100039322 3300005445 Bacteria 4138
80 Ga0070708_100203564 3300005445 Bacteria 1854
81 Ga0070708_100384988 3300005445 Bacteria 1322
82 Ga0070708_100526974 3300005445 Bacteria 1115
83 Ga0070708_100650112 3300005445 Bacteria 993
84 Ga0070708_100878793 3300005445 Bacteria 842
85 Ga0070663_100002105 3300005455 Bacteria 11139
86 Ga0070663_100969475 3300005455 Bacteria 738
87 Ga0070663_101446746 3300005455 Bacteria 610
88 Ga0070678_100841378 3300005456 Bacteria 835
89 Ga0070662_100014925 3300005457 Bacteria 5194
90 Ga0070662_100059442 3300005457 Bacteria 2784
91 Ga0070662_101043591 3300005457 Bacteria 700
92 Ga0070681_10006123 3300005458 Bacteria 11677
93 Ga0070681_10082842 3300005458 Bacteria 3162
94 Ga0068867_100019768 3300005459 Bacteria 4799
95 Ga0070706_100004745 3300005467 Bacteria 13030
96 Ga0070706_100007662 3300005467 Bacteria 10100
97 Ga0070706_100026105 3300005467 Bacteria 5374
98 Ga0070706_100445910 3300005467 Bacteria 1204
99 Ga0070706_100559190 3300005467 Bacteria 1064
100 Ga0070706_100971853 3300005467 Bacteria 783
101 Ga0070706_101168789 3300005467 Bacteria 707
102 Ga0070706_101473985 3300005467 Unclassified 622
103 Ga0070707_100000342 3300005468 Bacteria 45836
104 Ga0070707_100028692 3300005468 Bacteria 5296
105 Ga0070707_100045335 3300005468 Unclassified 4209
106 Ga0070707_100088891 3300005468 Bacteria 2988
107 Ga0070707_100192460 3300005468 Unclassified 1989
108 Ga0070707_100394740 3300005468 Bacteria 1343
109 Ga0070707_100496106 3300005468 Bacteria 1182
110 Ga0070707_100741603 3300005468 Bacteria 945
111 Ga0070707_100879248 3300005468 Bacteria 860
112 Ga0070707_101531864 3300005468 Bacteria 633
113 Ga0070698_100001171 3300005471 Bacteria 29108
114 Ga0070698_100169364 3300005471 Bacteria 2125
115 Ga0070698_100279972 3300005471 Bacteria 1599
116 Ga0070698_100330910 3300005471 Unclassified 1454
117 Ga0070698_100347865 3300005471 Bacteria 1414
118 Ga0070698_101512883 3300005471 Bacteria 623
119 Ga0070698_101595499 3300005471 Bacteria 604
120 Ga0070699_100003147 3300005518 Bacteria 14603
121 Ga0070699_100007146 3300005518 Bacteria 9699
122 Ga0070699_100014865 3300005518 Bacteria 6693
123 Ga0070699_100118759 3300005518 Bacteria 2324
124 Ga0070699_100151764 3300005518 Bacteria 2049
125 Ga0070699_100235690 3300005518 Bacteria 1632
126 Ga0070699_100281594 3300005518 Unclassified 1489
127 Ga0070699_100501696 3300005518 Bacteria 1102
128 Ga0070699_100901957 3300005518 Bacteria 810
129 Ga0070699_101631060 3300005518 Bacteria 591
130 Ga0070679_100002047 3300005530 Bacteria 18098
131 Ga0070679_100004301 3300005530 Bacteria 13144
132 Ga0070684_100164385 3300005535 Bacteria 2014
133 Ga0070697_100023834 3300005536 Bacteria 4871
134 Ga0070697_100058844 3300005536 Bacteria 3127
135 Ga0070697_100132818 3300005536 Bacteria 2088
136 Ga0070697_100317853 3300005536 Bacteria 1340
137 Ga0070697_100560012 3300005536 Bacteria 1003
138 Ga0070697_100708257 3300005536 Bacteria 888
139 Ga0070697_100866228 3300005536 Bacteria 801
140 Ga0068853_100024839 3300005539 Bacteria 5026
141 Ga0070672_100208763 3300005543 Bacteria 1635
142 Ga0070672_100615570 3300005543 Bacteria 947
143 Ga0070686_100141039 3300005544 Bacteria 1678
144 Ga0070686_100807567 3300005544 Bacteria 757
145 Ga0070695_100011643 3300005545 Bacteria 5264
146 Ga0070695_100799162 3300005545 Bacteria 756
147 Ga0070696_100025157 3300005546 Bacteria 4046
148 Ga0070696_100078355 3300005546 Bacteria 2336
149 Ga0070696_100197111 3300005546 Bacteria 1501
150 Ga0070696_100281944 3300005546 Bacteria 1267
151 Ga0070696_100292460 3300005546 Bacteria 1245
152 Ga0070696_101194113 3300005546 Bacteria 642
153 Ga0070696_101426203 3300005546 Bacteria 591
154 Ga0070693_100000079 3300005547 Bacteria 40408
155 Ga0070665_100045149 3300005548 Bacteria 4424
156 Ga0070665_100260487 3300005548 Bacteria 1736
157 Ga0070665_100344798 3300005548 Bacteria 1494
158 Ga0070704_100016933 3300005549 Bacteria 4621
159 Ga0070704_100563965 3300005549 Bacteria 996
160 Ga0070704_101258738 3300005549 Bacteria 676
161 Ga0070704_101532637 3300005549 Bacteria 613
162 Ga0068855_100049421 3300005563 Bacteria 4960
163 Ga0068855_100106461 3300005563 Bacteria 3223
164 Ga0068855_100644382 3300005563 Bacteria 1138
165 Ga0070664_100031662 3300005564 Bacteria 4421
166 Ga0070664_100142638 3300005564 Bacteria 2110
167 Ga0070664_100777754 3300005564 Bacteria 894
168 Ga0068857_100042259 3300005577 Bacteria 4043
169 Ga0068857_100053668 3300005577 Bacteria 3576
170 Ga0068857_100078473 3300005577 Bacteria 2947
171 Ga0068857_100361242 3300005577 Bacteria 1346
172 Ga0068857_100434203 3300005577 Bacteria 1226
173 Ga0068857_100873216 3300005577 Bacteria 861
174 Ga0068854_100001015 3300005578 Bacteria 16890
175 Ga0068854_100252948 3300005578 Bacteria 1407
176 Ga0068856_100042160 3300005614 Bacteria 4489
177 Ga0070702_100171374 3300005615 Bacteria 1412
178 Ga0068852_100021462 3300005616 Bacteria 5157
179 Ga0068859_100002772 3300005617 Bacteria 17751
180 Ga0068859_101402099 3300005617 Bacteria 771
181 Ga0068859_101538248 3300005617 Bacteria 734
182 Ga0068859_102113921 3300005617 Bacteria 621
183 Ga0068859_102153278 3300005617 Unclassified 615
184 Ga0068864_100091433 3300005618 Bacteria 2684
185 Ga0068864_101183278 3300005618 Bacteria 763
186 Ga0068861_100032198 3300005719 Bacteria 3858
187 Ga0068851_10034804 3300005834 Bacteria 2515
188 Ga0068870_10045394 3300005840 Bacteria 2300
189 Ga0068870_10990627 3300005840 Bacteria 599
190 Ga0068863_100107477 3300005841 Bacteria 2655
191 Ga0068863_100436548 3300005841 Bacteria 1284
192 Ga0068863_100627519 3300005841 Bacteria 1065
193 Ga0068863_100729757 3300005841 Bacteria 986
194 Ga0068863_102020333 3300005841 Bacteria 586
195 Ga0068858_100161069 3300005842 Bacteria 2113
196 Ga0068858_102023719 3300005842 Unclassified 569
197 Ga0068860_100028254 3300005843 Bacteria 5398
198 Ga0068860_100049545 3300005843 Bacteria 4000
199 Ga0068860_100116928 3300005843 Bacteria 2551
200 Ga0068860_100293414 3300005843 Bacteria 1592
201 Ga0068860_100436857 3300005843 Bacteria 1300
202 Ga0068860_101257959 3300005843 Bacteria 761
203 Ga0068862_100045935 3300005844 Bacteria 3727
204 Ga0068862_100081320 3300005844 Bacteria 2810
205 Ga0068862_100576175 3300005844 Bacteria 1078
206 Ga0068862_100663602 3300005844 Bacteria 1007
207 Ga0068862_100768604 3300005844 Bacteria 938
208 Ga0081455_10000261 3300005937 Bacteria 69458
209 Ga0081455_10004094 3300005937 Bacteria 16507
210 Ga0081455_10008153 3300005937 Bacteria 10927
211 Ga0081455_10011615 3300005937 Bacteria 8836
212 Ga0081455_10057627 3300005937 Bacteria 3292
213 Ga0081455_10207615 3300005937 Bacteria 1462
214 Ga0081538_10015638 3300005981 Bacteria 5863
215 Ga0081538_10017319 3300005981 Bacteria 5474
216 Ga0081538_10033270 3300005981 Bacteria 3435
217 Ga0081538_10041628 3300005981 Bacteria 2912
218 Ga0081538_10046841 3300005981 Bacteria 2660
219 Ga0081538_10057418 3300005981 Bacteria 2268
220 Ga0081538_10062658 3300005981 Bacteria 2119
221 Ga0081540_1018632 3300005983 Bacteria 4250
222 Ga0081540_1074046 3300005983 Bacteria 1562
223 Ga0081540_1157175 3300005983 Bacteria 888
224 Ga0081539_10003351 3300005985 Bacteria 19892
225 Ga0081539_10007866 3300005985 Bacteria 9514
226 Ga0081539_10016229 3300005985 Bacteria 5339
227 Ga0070717_10055064 3300006028 Bacteria 3281
228 Ga0075365_10006270 3300006038 Bacteria 6523
229 Ga0075365_10168542 3300006038 Bacteria 1528
230 Ga0075368_10101922 3300006042 Bacteria 1179
231 Ga0075363_100091540 3300006048 Bacteria 1674
232 Ga0075364_10593831 3300006051 Bacteria 756
233 Ga0070715_10159090 3300006163 Bacteria 1115
234 Ga0070716_100004550 3300006173 Bacteria 6648
235 Ga0070712_100000261 3300006175 Bacteria 29475
236 Ga0070712_100127714 3300006175 Bacteria 1923
237 Ga0070712_100138726 3300006175 Bacteria 1852
238 Ga0070712_100183166 3300006175 Bacteria 1634
239 Ga0070712_100311278 3300006175 Bacteria 1278
240 Ga0075362_10054696 3300006177 Bacteria 1794
241 Ga0075362_10236803 3300006177 Bacteria 895
242 Ga0075362_10282815 3300006177 Bacteria 821
243 Ga0075367_10057243 3300006178 Bacteria 2318
244 Ga0075369_10038707 3300006186 Bacteria 2035
245 Ga0075427_10010473 3300006194 Bacteria 1389
246 Ga0075366_10004028 3300006195 Bacteria 7855
247 Ga0097621_100310207 3300006237 Bacteria 1395
248 Ga0075370_10317076 3300006353 Bacteria 928
249 Ga0075428_100079033 3300006844 Bacteria 3590
250 Ga0075428_100146380 3300006844 Bacteria 2567
251 Ga0075428_100324038 3300006844 Bacteria 1655
252 Ga0075428_100653041 3300006844 Bacteria 1122
253 Ga0075428_100812671 3300006844 Bacteria 993
254 Ga0075428_101436366 3300006844 Bacteria 723
255 Ga0075428_101541173 3300006844 Bacteria 696
256 Ga0075430_100058973 3300006846 Bacteria 3226
257 Ga0075430_100242524 3300006846 Bacteria 1493
258 Ga0075430_100767225 3300006846 Bacteria 795
259 Ga0075430_101119256 3300006846 Bacteria 648
260 Ga0075430_101192785 3300006846 Bacteria 627
261 Ga0075431_100017289 3300006847 Bacteria 7329
262 Ga0075431_100049524 3300006847 Bacteria 4331
263 Ga0075431_100235672 3300006847 Bacteria 1863
264 Ga0075431_100623832 3300006847 Bacteria 1060
265 Ga0075431_100905644 3300006847 Bacteria 851
266 Ga0075431_100907285 3300006847 Bacteria 850
267 Ga0075431_101188985 3300006847 Bacteria 725
268 Ga0075431_101789500 3300006847 Bacteria 570
269 Ga0075433_10005245 3300006852 Bacteria 10158
270 Ga0075433_10012243 3300006852 Bacteria 6917
271 Ga0075433_10478173 3300006852 Bacteria 1097
272 Ga0075433_10690178 3300006852 Bacteria 894
273 Ga0075433_10929187 3300006852 Bacteria 758
274 Ga0075433_11340744 3300006852 Bacteria 619
275 Ga0075434_100008457 3300006871 Bacteria 9571
276 Ga0075434_100508359 3300006871 Bacteria 1225
277 Ga0075434_100814372 3300006871 Bacteria 950
278 Ga0075434_100898660 3300006871 Bacteria 900
279 Ga0075434_101167003 3300006871 Bacteria 782
280 Ga0075434_101212716 3300006871 Bacteria 766
281 Ga0075434_101236268 3300006871 Bacteria 758
282 Ga0075434_101384589 3300006871 Bacteria 713
283 Ga0075434_101958177 3300006871 Bacteria 591
284 Ga0075429_100121596 3300006880 Bacteria 2282
285 Ga0075429_100366465 3300006880 Bacteria 1262
286 Ga0075429_100663694 3300006880 Bacteria 913
287 Ga0075429_100870380 3300006880 Bacteria 789
288 Ga0068865_100161095 3300006881 Bacteria 1711
289 Ga0068865_100749595 3300006881 Bacteria 839
290 Ga0068865_100919665 3300006881 Bacteria 762
291 Ga0075436_100398072 3300006914 Bacteria 997
292 Ga0075436_100834330 3300006914 Bacteria 687
293 Ga0097620_100002772 3300006931 Bacteria 17751
294 Ga0097620_101402098 3300006931 Bacteria 771
295 Ga0097620_101538258 3300006931 Bacteria 734
296 Ga0097620_102113848 3300006931 Bacteria 621
297 Ga0097620_102153385 3300006931 Unclassified 615
298 Ga0075435_100019255 3300007076 Bacteria 5208
299 Ga0075435_100232803 3300007076 Bacteria 1565
300 Ga0075435_100317442 3300007076 Bacteria 1333
301 Ga0075435_100482499 3300007076 Bacteria 1071
302 Ga0075435_100645492 3300007076 Bacteria 919
303 Ga0075435_101065218 3300007076 Bacteria 706
304 Ga0099794_10001705 3300007265 Bacteria 7780
305 Ga0099794_10132454 3300007265 Bacteria 1259
306 Ga0099794_10158707 3300007265 Bacteria 1150
307 Ga0105240_10002551 3300009093 Bacteria 29190
308 Ga0105240_12123425 3300009093 Bacteria 583
309 Ga0105240_12561854 3300009093 Unclassified 527
310 Ga0111539_10000742 3300009094 Bacteria 42306
311 Ga0111539_10022591 3300009094 Bacteria 7727
312 Ga0111539_10095497 3300009094 Bacteria 3492
313 Ga0111539_10473409 3300009094 Bacteria 1459
314 Ga0111539_10622070 3300009094 Bacteria 1257
315 Ga0111539_10696300 3300009094 Bacteria 1183
316 Ga0105245_10142851 3300009098 Bacteria 2256
317 Ga0105245_11329353 3300009098 Bacteria 768
318 Ga0105245_11910135 3300009098 Bacteria 647
319 Ga0105247_10231852 3300009101 Bacteria 1254
320 Ga0105247_10333180 3300009101 Bacteria 1062
321 Ga0114129_10049354 3300009147 Bacteria 5913
322 Ga0114129_10228100 3300009147 Bacteria 2509
323 Ga0114129_10305174 3300009147 Bacteria 2120
324 Ga0114129_10364631 3300009147 Bacteria 1911
325 Ga0114129_10366331 3300009147 Bacteria 1906
326 Ga0114129_10646343 3300009147 Bacteria 1366
327 Ga0114129_10982434 3300009147 Bacteria 1064
328 Ga0114129_11129526 3300009147 Bacteria 979
329 Ga0114129_11169974 3300009147 Bacteria 959
330 Ga0114129_11356890 3300009147 Bacteria 879
331 Ga0114129_11736189 3300009147 Bacteria 761
332 Ga0114129_11759982 3300009147 Bacteria 755
333 Ga0105243_10049740 3300009148 Bacteria 3308
334 Ga0105243_11794693 3300009148 Bacteria 644
335 Ga0105243_12324545 3300009148 Bacteria 574
336 Ga0105241_10043057 3300009174 Bacteria 3418
337 Ga0105241_10265387 3300009174 Bacteria 1460
338 Ga0105242_10088090 3300009176 Bacteria 2607
339 Ga0105242_10618150 3300009176 Bacteria 1049
340 Ga0105248_10032512 3300009177 Bacteria 5830
341 Ga0105248_10287916 3300009177 Bacteria 1850
342 Ga0105248_10353284 3300009177 Bacteria 1655
343 Ga0105248_10423733 3300009177 Bacteria 1499
344 Ga0105248_11124926 3300009177 Bacteria 888
345 Ga0105237_10139084 3300009545 Bacteria 2423
346 Ga0105238_10192412 3300009551 Bacteria 2016
347 Ga0105238_10241930 3300009551 Bacteria 1782
348 Ga0105249_10313949 3300009553 Bacteria 1577
349 Ga0105249_10361360 3300009553 Bacteria 1473
350 Ga0105249_10912371 3300009553 Bacteria 946
351 Ga0105249_11241477 3300009553 Bacteria 816
352 Ga0105249_12316551 3300009553 Bacteria 610
353 Ga0105035_107095 3300009988 Bacteria 937
354 Ga0099796_10170680 3300010159 Bacteria 868
355 Ga0105239_10208774 3300010375 Bacteria 2189
356 Ga0105246_10072549 3300011119 Bacteria 2427
357 Ga0105246_10479227 3300011119 Bacteria 1052
358 Ga0154012_119121 3300013059 Bacteria 903
359 Ga0157373_10036732 3300013100 Bacteria 3513
360 Ga0157371_10084937 3300013102 Bacteria 2243
361 Ga0157371_10142894 3300013102 Bacteria 1705
362 Ga0157371_10147446 3300013102 Bacteria 1677
363 Ga0157370_10240401 3300013104 Bacteria 1675
364 Ga0157369_10018217 3300013105 Bacteria 7876
365 Ga0157374_10680400 3300013296 Bacteria 1041
366 Ga0157378_10574678 3300013297 Bacteria 1135
367 Ga0157378_10783861 3300013297 Bacteria 978
368 Ga0163162_10518256 3300013306 Bacteria 1322
369 Ga0163162_10549954 3300013306 Bacteria 1283
370 Ga0163162_10774940 3300013306 Bacteria 1077
371 Ga0163162_11269276 3300013306 Bacteria 837
372 Ga0157372_10045306 3300013307 Bacteria 4878
373 Ga0157372_10369156 3300013307 Bacteria 1672
374 Ga0157372_10426557 3300013307 Bacteria 1545
375 Ga0157372_11279081 3300013307 Bacteria 847
376 Ga0157375_10236805 3300013308 Bacteria 1985
377 Ga0157375_10482967 3300013308 Bacteria 1404
378 Ga0157375_10675060 3300013308 Bacteria 1188
379 Ga0163163_10116222 3300014325 Bacteria 2706
380 Ga0163163_10448082 3300014325 Bacteria 1351
381 Ga0157380_10650293 3300014326 Bacteria 1051
382 Ga0157380_10729138 3300014326 Bacteria 1000
383 Ga0157380_11867586 3300014326 Bacteria 661
384 Ga0182008_10055373 3300014497 Bacteria 1962
385 Ga0182008_10464511 3300014497 Unclassified 690
386 Ga0157377_10502507 3300014745 Bacteria 848
387 Ga0157376_10087320 3300014969 Bacteria 2691
388 Ga0157376_11456486 3300014969 Bacteria 717
389 Ga0182007_10183629 3300015262 Bacteria 724
390 Ga0163161_10325229 3300017792 Bacteria 1216
391 Ga0163161_10488172 3300017792 Bacteria 1001
392 Ga0163161_10567744 3300017792 Bacteria 932
393 Ga0206356_10850150 3300020070 Bacteria 859
394 Ga0206352_10559314 3300020078 Bacteria 849
395 Ga0206353_10074075 3300020082 Bacteria 1015
396 Ga0206353_10389456 3300020082 Bacteria 894
397 Ga0206353_10676132 3300020082 Bacteria 731
398 Ga0213872_10085402 3300021361 Bacteria 1415
399 Ga0213871_10037955 3300021441 Bacteria 1284
400 Ga0207426_1027401 3300025302 Bacteria 1898
401 Ga0207653_10005168 3300025885 Bacteria 4081
402 Ga0207653_10016341 3300025885 Bacteria 2331
403 Ga0207682_10410247 3300025893 Bacteria 640
404 Ga0207692_10062937 3300025898 Bacteria 1927
405 Ga0207710_10299092 3300025900 Bacteria 813
406 Ga0207688_10092647 3300025901 Bacteria 1737
407 Ga0207680_10213787 3300025903 Bacteria 1319
408 Ga0207647_10033845 3300025904 Bacteria 3268
409 Ga0207647_10125168 3300025904 Bacteria 1513
410 Ga0207685_10117584 3300025905 Bacteria 1162
411 Ga0207699_10036121 3300025906 Bacteria 2815
412 Ga0207699_10178042 3300025906 Bacteria 1428
413 Ga0207699_10179790 3300025906 Bacteria 1421
414 Ga0207699_10769524 3300025906 Bacteria 707
415 Ga0207645_10000313 3300025907 Bacteria 40906
416 Ga0207645_10235601 3300025907 Bacteria 1209
417 Ga0207645_10268016 3300025907 Bacteria 1132
418 Ga0207643_10000952 3300025908 Bacteria 17353
419 Ga0207643_10660933 3300025908 Bacteria 674
420 Ga0207705_10185077 3300025909 Bacteria 1573
421 Ga0207684_10028617 3300025910 Bacteria 4748
422 Ga0207684_10030439 3300025910 Bacteria 4595
423 Ga0207684_10031340 3300025910 Bacteria 4523
424 Ga0207684_10064858 3300025910 Bacteria 3101
425 Ga0207684_10130023 3300025910 Bacteria 2161
426 Ga0207684_10331872 3300025910 Bacteria 1310
427 Ga0207654_10357481 3300025911 Bacteria 1007
428 Ga0207707_10000534 3300025912 Bacteria 38787
429 Ga0207707_10011153 3300025912 Bacteria 7818
430 Ga0207695_10106769 3300025913 Bacteria 2786
431 Ga0207695_10167576 3300025913 Bacteria 2124
432 Ga0207695_10596923 3300025913 Bacteria 985
433 Ga0207671_10125514 3300025914 Bacteria 1965
434 Ga0207693_10001950 3300025915 Bacteria 18071
435 Ga0207693_10022756 3300025915 Bacteria 4977
436 Ga0207693_10093662 3300025915 Bacteria 2355
437 Ga0207693_10120006 3300025915 Bacteria 2065
438 Ga0207663_10075137 3300025916 Bacteria 2192
439 Ga0207660_10038020 3300025917 Bacteria 3357
440 Ga0207660_10089269 3300025917 Bacteria 2281
441 Ga0207660_10105762 3300025917 Bacteria 2109
442 Ga0207660_10628657 3300025917 Bacteria 875
443 Ga0207660_11163463 3300025917 Unclassified 628
444 Ga0207662_10159726 3300025918 Bacteria 1439
445 Ga0207662_10178920 3300025918 Bacteria 1364
446 Ga0207657_10000172 3300025919 Bacteria 66510
447 Ga0207649_10160974 3300025920 Bacteria 1555
448 Ga0207652_10156277 3300025921 Bacteria 2043
449 Ga0207652_10243501 3300025921 Bacteria 1621
450 Ga0207646_10001108 3300025922 Bacteria 34362
451 Ga0207646_10014265 3300025922 Bacteria 7556
452 Ga0207646_10102305 3300025922 Bacteria 2568
453 Ga0207646_10425168 3300025922 Unclassified 1199
454 Ga0207646_10439968 3300025922 Bacteria 1176
455 Ga0207646_10492480 3300025922 Bacteria 1105
456 Ga0207646_11187449 3300025922 Bacteria 669
457 Ga0207681_10176584 3300025923 Bacteria 1623
458 Ga0207681_11378800 3300025923 Bacteria 592
459 Ga0207694_10112326 3300025924 Bacteria 2168
460 Ga0207650_10519932 3300025925 Bacteria 996
461 Ga0207650_10673873 3300025925 Bacteria 873
462 Ga0207659_10152747 3300025926 Bacteria 1804
463 Ga0207659_10257460 3300025926 Bacteria 1418
464 Ga0207687_10183002 3300025927 Bacteria 1625
465 Ga0207687_10650207 3300025927 Bacteria 892
466 Ga0207700_10031702 3300025928 Bacteria 3759
467 Ga0207700_10473107 3300025928 Bacteria 1106
468 Ga0207664_10075482 3300025929 Bacteria 2726
469 Ga0207644_11010336 3300025931 Bacteria 698
470 Ga0207690_10132778 3300025932 Bacteria 1824
471 Ga0207690_10318901 3300025932 Bacteria 1221
472 Ga0207706_10002219 3300025933 Bacteria 18958
473 Ga0207706_10076058 3300025933 Bacteria 2953
474 Ga0207706_10637892 3300025933 Bacteria 913
475 Ga0207706_10877570 3300025933 Bacteria 759
476 Ga0207686_10084592 3300025934 Bacteria 2079
477 Ga0207686_10825605 3300025934 Bacteria 744
478 Ga0207686_11089004 3300025934 Unclassified 651
479 Ga0207709_10009736 3300025935 Bacteria 5296
480 Ga0207670_10286598 3300025936 Bacteria 1285
481 Ga0207670_10569635 3300025936 Bacteria 927
482 Ga0207670_10717471 3300025936 Bacteria 829
483 Ga0207704_10070453 3300025938 Bacteria 2214
484 Ga0207704_10182937 3300025938 Bacteria 1516
485 Ga0207665_10000410 3300025939 Bacteria 29516
486 Ga0207665_10823882 3300025939 Bacteria 734
487 Ga0207665_11088617 3300025939 Bacteria 637
488 Ga0207691_10053793 3300025940 Bacteria 3674
489 Ga0207691_10099042 3300025940 Bacteria 2603
490 Ga0207691_10183584 3300025940 Bacteria 1827
491 Ga0207711_10566731 3300025941 Bacteria 1059
492 Ga0207711_10894739 3300025941 Bacteria 825
493 Ga0207711_10925174 3300025941 Bacteria 810
494 Ga0207689_10000062 3300025942 Bacteria 84533
495 Ga0207689_10224020 3300025942 Bacteria 1554
496 Ga0207689_10475371 3300025942 Bacteria 1046
497 Ga0207661_10113458 3300025944 Bacteria 2296
498 Ga0207679_10413986 3300025945 Bacteria 1188
499 Ga0207667_10005822 3300025949 Bacteria 15027
500 Ga0207667_10423614 3300025949 Bacteria 1354
501 Ga0207651_10582963 3300025960 Bacteria 976
502 Ga0207712_10005557 3300025961 Bacteria 7957
503 Ga0207712_10021266 3300025961 Bacteria 4258
504 Ga0207712_11535792 3300025961 Bacteria 597
505 Ga0207668_10750621 3300025972 Bacteria 861
506 Ga0207658_10695953 3300025986 Bacteria 918
507 Ga0207677_10982313 3300026023 Bacteria 765
508 Ga0207703_10145682 3300026035 Bacteria 2060
509 Ga0207703_11247465 3300026035 Bacteria 715
510 Ga0207703_11342607 3300026035 Bacteria 688
511 Ga0207703_11390160 3300026035 Bacteria 675
512 Ga0207639_10600031 3300026041 Bacteria 1015
513 Ga0207639_10837130 3300026041 Bacteria 858
514 Ga0207678_10020424 3300026067 Bacteria 5808
515 Ga0207708_10015875 3300026075 Bacteria 5654
516 Ga0207708_10047767 3300026075 Bacteria 3257
517 Ga0207702_10001801 3300026078 Bacteria 21104
518 Ga0207641_10361784 3300026088 Bacteria 1385
519 Ga0207641_10450280 3300026088 Unclassified 1244
520 Ga0207641_10499290 3300026088 Bacteria 1181
521 Ga0207641_11406956 3300026088 Bacteria 698
522 Ga0207648_10000746 3300026089 Bacteria 36535
523 Ga0207648_10460680 3300026089 Bacteria 1159
524 Ga0207648_10535487 3300026089 Bacteria 1074
525 Ga0207676_10029273 3300026095 Bacteria 4121
526 Ga0207676_10393240 3300026095 Bacteria 1294
527 Ga0207674_10031354 3300026116 Bacteria 5586
528 Ga0207674_10039481 3300026116 Bacteria 4892
529 Ga0207674_10046562 3300026116 Bacteria 4452
530 Ga0207674_10047087 3300026116 Bacteria 4423
531 Ga0207674_10232147 3300026116 Bacteria 1793
532 Ga0207674_10459524 3300026116 Bacteria 1230
533 Ga0207675_100006834 3300026118 Bacteria 10804
534 Ga0207675_100403566 3300026118 Bacteria 1347
535 Ga0207675_101555376 3300026118 Bacteria 682
536 Ga0207683_10029426 3300026121 Bacteria 4756
537 Ga0207683_10399277 3300026121 Bacteria 1265
538 Ga0209969_1002222 3300027360 Bacteria 2677
539 Ga0209981_1009590 3300027378 Bacteria 1325
540 Ga0209984_1009208 3300027424 Bacteria 1252
541 Ga0210000_1005881 3300027462 Bacteria 1784
542 Ga0209995_1005705 3300027471 Bacteria 2000
543 Ga0209968_1009680 3300027526 Bacteria 1476
544 Ga0209999_1001614 3300027543 Bacteria 3887
545 Ga0209970_1002979 3300027614 Bacteria 2858
546 Ga0210002_1008045 3300027617 Bacteria 1604
547 Ga0209983_1002641 3300027665 Bacteria 3894
548 Ga0209588_1005820 3300027671 Bacteria 3551
549 Ga0209971_1000050 3300027682 Bacteria 38624
550 Ga0209966_1000407 3300027695 Bacteria 12612
551 Ga0209998_10000054 3300027717 Bacteria 46941
552 Ga0209813_10091914 3300027866 Bacteria 1020
553 Ga0209974_10020587 3300027876 Bacteria 2186
554 Ga0209974_10300581 3300027876 Bacteria 614
555 Ga0207428_10000215 3300027907 Bacteria 79950
556 Ga0268266_10084464 3300028379 Bacteria 2772
557 Ga0268266_10356467 3300028379 Bacteria 1375
558 Ga0268266_10755670 3300028379 Bacteria 938
559 Ga0268266_11137694 3300028379 Bacteria 755
560 Ga0268265_10043181 3300028380 Bacteria 3349
561 Ga0268265_10110412 3300028380 Bacteria 2244
562 Ga0268265_10127560 3300028380 Bacteria 2108
563 Ga0268265_10144246 3300028380 Bacteria 1998
564 Ga0268265_10463866 3300028380 Bacteria 1186
565 Ga0268265_10629615 3300028380 Bacteria 1029
566 Ga0268265_11252635 3300028380 Bacteria 741
567 Ga0268265_11288748 3300028380 Bacteria 730
568 Ga0268264_10115049 3300028381 Bacteria 2363
569 Ga0268264_10334080 3300028381 Bacteria 1437
570 Ga0268264_10412143 3300028381 Bacteria 1301
571 Ga0268264_10692384 3300028381 Bacteria 1012
572 Ga0268264_11128359 3300028381 Bacteria 793
573 Ga0265334_10014548 3300028573 Bacteria 3279
574 Ga0265332_10197555 3300031238 Bacteria 836
575 Ga0265325_10285575 3300031241 Bacteria 739
576 Ga0265340_10025030 3300031247 Bacteria 3027
577 Ga0316579_10150838 3300031691 Unclassified 1121
578 Ga0316576_10303725 3300031727 Bacteria 1192
579 Ga0316576_10620048 3300031727 Unclassified 788
580 Ga0316578_10073113 3300031728 Unclassified 2031
581 Ga0307411_10434726 3300032005 Bacteria 1094
582 Ga0373928_0092209 3300035084 Bacteria 779
583 Ga0373929_0024558 3300035085 Bacteria 1246
584 Ga0373940_0036740 3300035088 Bacteria 1331
585 Ga0373949_0013568 3300035090 Bacteria 1808
586 Ga0373952_0021424 3300035092 Bacteria 1364
587 Ga0373923_0349787 3300035111 Bacteria 706
588 Ga0373939_0187349 3300035114 Bacteria 775
589 Ga0373941_0324898 3300035115 Bacteria 620
590 Ga0373941_0329969 3300035115 Bacteria 616
591 Ga0373946_0277503 3300035171 Bacteria 824
592 Ga0373942_0173107 3300035207 Bacteria 704
593 Ga0373962_0039365 3300035242 Bacteria 1326
594 Ga0316574_0002057 3300035398 Bacteria 9944
595 Ga0316574_0213803 3300035398 Bacteria 1237
596 Ga0373931_0079094 3300035691 Bacteria 1810
597 Ga0373931_0340267 3300035691 Bacteria 937
598 Ga0373931_0559382 3300035691 Bacteria 744
599 Ga0373931_0727900 3300035691 Bacteria 657
600 Ga0373933_0764697 3300035724 Bacteria 636
601 Ga0373947_0708893 3300035725 Bacteria 687
602 Ga0373937_0029412 3300036401 Bacteria 4976
603 Ga0373937_0618264 3300036401 Bacteria 1028
604 Ga0316582_0053407 3300036647 Unclassified 2570
605 Ga0316582_0448353 3300036647 Unclassified 889
606 Ga0316584_0111834 3300036712 Unclassified 2043
607 Ga0373925_0116480 3300037068 Bacteria 2070
608 Ga0373925_0367105 3300037068 Bacteria 1171
609 Ga0395899_0014212 3300037312 Bacteria 6075
610 Ga0395899_0030039 3300037312 Bacteria 4090
611 Ga0395899_0134474 3300037312 Bacteria 1763
612 Ga0395900_0045889 3300037418 Bacteria 4500
613 Ga0395900_0049281 3300037418 Bacteria 4339
614 Ga0395900_0219640 3300037418 Bacteria 1916
615 Ga0395900_0253947 3300037418 Bacteria 1758
616 Ga0395898_0059150 3300037466 Bacteria 3729
617 Ga0395898_0089822 3300037466 Bacteria 2956
618 Ga0395898_0180849 3300037466 Bacteria 2015
619 Ga0395905_0390672 3300037471 Bacteria 1286
620 Ga0395901_0000475 3300038443 Bacteria 46590
621 Ga0395901_0011479 3300038443 Bacteria 8977
622 Ga0395901_0027024 3300038443 Bacteria 5894
623 Ga0395901_0041490 3300038443 Bacteria 4769
624 Ga0395901_0065597 3300038443 Bacteria 3780
625 Ga0242420_015056 3300038996 Bacteria 1334
626 Ga0436360_0674555 3300039438 Bacteria 5082
627 Ga0436360_0946006 3300039438 Bacteria 769
628 Ga0436361_0513859 3300039447 Bacteria 1259
629 Ga0436361_0783817 3300039447 Bacteria 3228
630 Ga0436363_1062953 3300039450 Bacteria 1639
631 Ga0439461_0052124 3300041410 Bacteria 910
632 Ga0451853_2859496 3300041512 Bacteria 1431
633 Ga0439441_007826 3300042001 Bacteria 1733
634 Ga0439441_105230 3300042001 Bacteria 636
635 Ga0439443_025773 3300042003 Bacteria 949
636 Ga0439448_0012288 3300042005 Bacteria 2560
637 Ga0439448_0098019 3300042005 Bacteria 994
638 Ga0439448_0143811 3300042005 Bacteria 826
639 Ga0439450_011717 3300042008 Bacteria 1724
640 Ga0439450_044002 3300042008 Bacteria 1044
641 Ga0439455_0013488 3300042012 Bacteria 1851
642 Ga0439455_0135287 3300042012 Bacteria 696
643 Ga0450889_015939 3300042144 Bacteria 810
644 Ga0439458_0019409 3300042157 Bacteria 1564
645 Ga0439459_0000092 3300042438 Bacteria 8070
646 Ga0439459_0025484 3300042438 Bacteria 1168
647 Ga0439464_0009338 3300042439 Bacteria 2581
648 Ga0439460_0002500 3300042461 Bacteria 4437
649 Ga0439460_0276826 3300042461 Bacteria 584
650 Ga0451577_0001950 3300042876 Bacteria 26016
651 Ga0451577_0007329 3300042876 Bacteria 10857
652 Ga0451577_0240178 3300042876 Bacteria 1639
653 Ga0451577_0314582 3300042876 Bacteria 1419
654 Ga0451577_0484002 3300042876 Bacteria 1123
655 Ga0453683_0024590 3300044673 Bacteria 3831
656 Ga0453683_0154101 3300044673 Bacteria 1453
657 Ga0453683_0272214 3300044673 Bacteria 1081
658 Ga0466963_0028862 3300044694 Bacteria 3566
659 Ga0453684_0001317 3300044712 Bacteria 73386
660 Ga0453684_0005246 3300044712 Bacteria 25924
661 Ga0453684_0033093 3300044712 Bacteria 7214
662 Ga0453684_0437422 3300044712 Bacteria 1458
663 Ga0453684_0648415 3300044712 Bacteria 1152
664 Ga0453684_0846086 3300044712 Unclassified 983
665 Ga0453684_1364476 3300044712 Bacteria 737
666 Ga0466957_0129714 3300044842 Bacteria 1614
667 Ga0466959_0433961 3300045049 Bacteria 891
668 Ga0451576_0014685 3300045051 Bacteria 8706
669 Ga0451576_0044786 3300045051 Bacteria 4661
670 Ga0451576_0096348 3300045051 Bacteria 3078
671 Ga0451576_0273048 3300045051 Bacteria 1767
672 Ga0451576_0717864 3300045051 Bacteria 1050
673 Ga0451576_0950271 3300045051 Unclassified 901
674 Ga0466967_0048947 3300045976 Bacteria 3694
675 Ga0466967_1836330 3300045976 Bacteria 603
676 Ga0495592_0550889 3300046454 Bacteria 709
677 Ga0495622_0140218 3300046557 Bacteria 1098
678 Ga0495660_0037400 3300046810 Bacteria 2703
679 Ga0496102_0149365 3300048905 Bacteria 2195
680 Ga0496107_1203162 3300048910 Bacteria 545
681 Ga0496109_1349255 3300048912 Bacteria 649
682 Ga0496110_0677508 3300048913 Bacteria 932
683 Ga0496110_1674373 3300048913 Bacteria 546
684 Ga0496126_0142693 3300048929 Bacteria 2060
685 Ga0501032_0357352 3300049569 Bacteria 941
686 Ga0501033_0051227 3300049570 Bacteria 3060
687 Ga0501033_0319821 3300049570 Bacteria 1090
688 Ga0501034_0006395 3300049571 Bacteria 12687
689 Ga0501034_0007238 3300049571 Bacteria 11843
690 Ga0501034_0051803 3300049571 Bacteria 4138
691 Ga0501034_0134102 3300049571 Bacteria 2458
692 Ga0501034_0418654 3300049571 Bacteria 1261
693 Ga0501036_0102574 3300049572 Bacteria 2420
694 Ga0501037_0117021 3300049573 Bacteria 1918
695 Ga0501038_0074226 3300049574 Bacteria 2878
696 Ga0501038_0271562 3300049574 Bacteria 1337
697 Ga0501038_0389305 3300049574 Bacteria 1080
698 Ga0501038_0399247 3300049574 Bacteria 1064
699 Ga0501038_0878723 3300049574 Bacteria 663
700 Ga0501039_0023611 3300049575 Bacteria 4720
701 Ga0501039_0405032 3300049575 Bacteria 1071
702 Ga0501040_0006093 3300049576 Bacteria 7821
703 Ga0501040_0095345 3300049576 Bacteria 2071
704 Ga0501040_0153029 3300049576 Bacteria 1628
705 Ga0501040_0512591 3300049576 Bacteria 865
706 Ga0501040_0670894 3300049576 Bacteria 749
707 Ga0501041_0001681 3300049577 Bacteria 12392
708 Ga0501042_0090711 3300049578 Bacteria 2193
709 Ga0501042_0347595 3300049578 Bacteria 1073
710 Ga0501042_1194737 3300049578 Bacteria 554
711 Ga0501043_0290836 3300049579 Bacteria 1251
712 Ga0501043_0302886 3300049579 Bacteria 1221
713 Ga0501046_0000421 3300049580 Bacteria 42282
714 Ga0501046_0882275 3300049580 Bacteria 624
715 Ga0501047_0135784 3300049581 Bacteria 2340
716 Ga0501047_0317158 3300049581 Bacteria 1399
717 Ga0501047_0834232 3300049581 Bacteria 736
718 Ga0501048_0001598 3300049582 Bacteria 17208
719 Ga0501048_0042830 3300049582 Bacteria 3241
720 Ga0501067_0079133 3300049583 Bacteria 1822
721 Ga0501068_0011116 3300049584 Bacteria 5070
722 Ga0501068_0338976 3300049584 Bacteria 965
723 Ga0501068_0642529 3300049584 Bacteria 692
724 Ga0501069_0465416 3300049585 Bacteria 752
725 Ga0501070_0086316 3300049586 Bacteria 2598
726 Ga0501070_0315203 3300049586 Bacteria 1273
727 Ga0501070_0532679 3300049586 Bacteria 942
728 Ga0501071_1305164 3300049587 Bacteria 561
729 Ga0501071_1499718 3300049587 Bacteria 520
730 Ga0501072_0895876 3300049588 Bacteria 693
731 Ga0501073_0292563 3300049589 Bacteria 1124
732 Ga0501074_0084622 3300049590 Bacteria 2273
733 Ga0501074_0441392 3300049590 Bacteria 923
734 Ga0501075_0016068 3300049591 Bacteria 5385
735 Ga0501075_0071971 3300049591 Bacteria 2613
736 Ga0501075_0230967 3300049591 Bacteria 1411
737 Ga0501075_0517332 3300049591 Bacteria 911
738 Ga0501075_0894965 3300049591 Bacteria 675
739 Ga0501075_1174648 3300049591 Bacteria 582
740 Ga0501076_0018265 3300049592 Bacteria 5343
741 Ga0501076_0279740 3300049592 Bacteria 1367
742 Ga0501076_0323730 3300049592 Bacteria 1264
743 Ga0501076_1495832 3300049592 Bacteria 554
744 Ga0501077_0189685 3300049593 Bacteria 1306
745 Ga0501077_0200368 3300049593 Bacteria 1268
746 Ga0501077_0400306 3300049593 Bacteria 878
747 Ga0501079_0148080 3300049741 Bacteria 1830
748 Ga0501079_0185291 3300049741 Bacteria 1625
749 Ga0501079_1055046 3300049741 Bacteria 640
750 Ga0501080_0331533 3300049742 Bacteria 1376
751 Ga0501080_0372553 3300049742 Bacteria 1287
752 Ga0501080_1017377 3300049742 Bacteria 718
753 Ga0501081_0000905 3300049743 Bacteria 17611
754 Ga0501081_0012146 3300049743 Bacteria 5648
755 Ga0501081_0055527 3300049743 Bacteria 2736
756 Ga0501081_0609773 3300049743 Bacteria 817
757 Ga0501083_0004180 3300049744 Bacteria 10166
758 Ga0501083_0123319 3300049744 Bacteria 1699
759 Ga0501035_0931695 3300049822 Bacteria 686
760 Ga0501044_0767526 3300049823 Bacteria 845
761 Ga0501045_0001258 3300049824 Bacteria 16806
762 Ga0501045_0301846 3300049824 Bacteria 1192
763 Ga0501045_0618191 3300049824 Bacteria 802
764 Ga0501045_0758727 3300049824 Bacteria 715
765 nmdc:mga03683_106374_c1 3300050489 Bacteria 1237
766 nmdc:mga03683_37980_c1 3300050489 Bacteria 1965
767 nmdc:mga03n38_210605_c1 3300050490 Bacteria 1010
768 nmdc:mga00v17_139162_c1 3300050491 Bacteria 1555
769 nmdc:mga0yw44_325547_c1 3300050492 Bacteria 1032
770 nmdc:mga0k408_12586_c1 3300050493 Bacteria 4625
771 nmdc:mga0k408_607475_c1 3300050493 Bacteria 645
772 nmdc:mga06z11_272595_c1 3300050494 Bacteria 1001
773 nmdc:mga06z11_345924_c1 3300050494 Bacteria 889
774 nmdc:mga04h51_148446_c1 3300050495 Bacteria 894
775 nmdc:mga04h51_233143_c1 3300050495 Bacteria 733
776 nmdc:mga05p37_1243176_c1 3300050507 Bacteria 765
777 nmdc:mga05p37_196788_c1 3300050507 Bacteria 2444
778 nmdc:mga05p37_219712_c1 3300050507 Bacteria 2294
779 nmdc:mga05p37_410314_c1 3300050507 Bacteria 1579
780 nmdc:mga05p37_440384_c1 3300050507 Bacteria 1511
781 nmdc:mga05p37_467448_c1 3300050507 Bacteria 1456
782 nmdc:mga05p37_54140_c1 3300050507 Bacteria 4936
783 nmdc:mga05p37_793001_c1 3300050507 Bacteria 1038
784 nmdc:mga05p37_7_c1 3300050507 Bacteria 154761
785 nmdc:mga05p37_89893_c1 3300050507 Bacteria 3784
786 nmdc:mga09592_113095_c1 3300050508 Bacteria 2330
787 nmdc:mga09592_16259_c1 3300050508 Bacteria 6082
788 nmdc:mga09592_285798_c1 3300050508 Bacteria 1430
789 nmdc:mga09592_311175_c1 3300050508 Bacteria 1365
790 nmdc:mga09592_382944_c1 3300050508 Bacteria 1216
791 nmdc:mga09592_904953_c1 3300050508 Bacteria 741
792 nmdc:mga0qj67_26969_c1 3300050509 Bacteria 4450
793 nmdc:mga0qj67_333297_c1 3300050509 Bacteria 1228
794 nmdc:mga0qj67_650427_c1 3300050509 Bacteria 841
795 nmdc:mga0qj67_820138_c1 3300050509 Bacteria 736
796 nmdc:mga06r32_1010958_c1 3300050510 Bacteria 784
797 nmdc:mga06r32_115966_c1 3300050510 Bacteria 2638
798 nmdc:mga06r32_1340412_c1 3300050510 Bacteria 659
799 nmdc:mga06r32_13423_c1 3300050510 Bacteria 7417
800 nmdc:mga06r32_1443371_c1 3300050510 Bacteria 629
801 nmdc:mga06r32_288838_c1 3300050510 Bacteria 1627
802 nmdc:mga06r32_298220_c1 3300050510 Bacteria 1598
803 nmdc:mga06r32_637783_c1 3300050510 Bacteria 1034
804 nmdc:mga06r32_76583_c1 3300050510 Bacteria 3249
805 nmdc:mga06r32_7856_c1 3300050510 Bacteria 9584
806 nmdc:mga06r32_828351_c1 3300050510 Bacteria 885
807 nmdc:mga08y16_181535_c1 3300050511 Bacteria 2185
808 nmdc:mga08y16_23865_c1 3300050511 Bacteria 6459
809 nmdc:mga08y16_299342_c1 3300050511 Bacteria 1658
810 nmdc:mga08y16_869_c1 3300050511 Bacteria 29089
811 nmdc:mga0n895_1047263_c1 3300050512 Bacteria 795
812 nmdc:mga0n895_1378668_c1 3300050512 Bacteria 674
813 nmdc:mga0n895_1454608_c1 3300050512 Bacteria 653
814 nmdc:mga0n895_177866_c1 3300050512 Bacteria 2159
815 nmdc:mga0n895_178504_c1 3300050512 Bacteria 2155
816 nmdc:mga0n895_193878_c1 3300050512 Bacteria 2063
817 nmdc:mga0n895_4068_c1 3300050512 Bacteria 11906
818 nmdc:mga0n895_606142_c1 3300050512 Bacteria 1097
819 nmdc:mga0n895_80883_c1 3300050512 Bacteria 3238
820 nmdc:mga0n895_896215_c1 3300050512 Bacteria 873
821 nmdc:mga0rr50_1015345_c1 3300050513 Bacteria 706
822 nmdc:mga0rr50_127221_c1 3300050513 Bacteria 2036
823 nmdc:mga0rr50_218325_c1 3300050513 Bacteria 1574
824 nmdc:mga0rr50_311922_c1 3300050513 Bacteria 1318
825 nmdc:mga0rr50_332138_c1 3300050513 Bacteria 1276
826 nmdc:mga0rr50_45524_c1 3300050513 Bacteria 3226
827 nmdc:mga08x19_179196_c1 3300050514 Bacteria 1446
828 nmdc:mga08x19_45941_c1 3300050514 Bacteria 2792
829 nmdc:mga08x19_600786_c1 3300050514 Bacteria 780
830 nmdc:mga0a205_121987_c1 3300050515 Bacteria 2506
831 nmdc:mga0a205_132494_c1 3300050515 Bacteria 2393
832 nmdc:mga0a205_1398685_c1 3300050515 Bacteria 547
833 nmdc:mga0a205_176291_c2 3300050515 Bacteria 1585
834 nmdc:mga0a205_23275_c1 3300050515 Bacteria 5875
835 nmdc:mga0a205_36294_c1 3300050515 Bacteria 4736
836 nmdc:mga0a205_385366_c1 3300050515 Bacteria 1267
837 nmdc:mga0a205_723506_c1 3300050515 Bacteria 845
838 nmdc:mga0a205_753528_c1 3300050515 Bacteria 822
839 nmdc:mga0sz30_152323_c1 3300050516 Bacteria 1023
840 nmdc:mga0sz30_964_c1 3300050516 Bacteria 10317
841 Ga0495601_0134212 3300053077 Bacteria 1613
842 Ga0495619_0026897 3300053085 Bacteria 3704
843 Ga0500646_0335386 3300053090 Bacteria 549
844 Ga0500651_0090353 3300053093 Bacteria 1886
845 Ga0500566_0289055 3300053094 Bacteria 777
846 Ga0500641_0041132 3300053096 Bacteria 1869
847 Ga0500658_0445720 3300053134 Bacteria 590
848 Ga0500616_0003831 3300053153 Bacteria 11126
849 Ga0500552_000468 3300053733 Bacteria 3732
850 Ga0501084_0004842 3300054114 Bacteria 11000
851 Ga0501084_0026998 3300054114 Bacteria 4797
852 Ga0501084_0070587 3300054114 Bacteria 2924
853 Ga0501084_0182061 3300054114 Bacteria 1774
854 Ga0501084_1081632 3300054114 Bacteria 673
855 Ga0501084_1147981 3300054114 Bacteria 652
856 Ga0501082_0001936 3300060353 Bacteria 18212
857 Ga0501082_0007368 3300060353 Bacteria 9493
858 Ga0501082_0033924 3300060353 Bacteria 4402
859 Ga0501082_0720788 3300060353 Bacteria 873
860 Ga0501082_1717133 3300060353 Bacteria 548
861 Ga0530510_0015282 3300061734 Bacteria 5422
862 Ga0530510_0102721 3300061734 Bacteria 2091
863 Ga0530510_0295439 3300061734 Bacteria 1212
864 Ga0530510_0568577 3300061734 Bacteria 861
865 2513589984 2513237087 Bacteria 5817514
866 2905929139 2905926851 Bacteria 4423176
867 Ga0501071_0497522
868 JGI25406J46586_10099214
869 JGI26145J50221_1005240
870 JGI26141J51220_1003409
871 Ga0058858_1037324
872 Ga0058859_10070160
873 Ga0058859_10106164
874 Ga0058863_10058554
875 Ga0058861_10058231
876 Ga0058860_11827996
877 Ga0058862_10159895
878 Ga0065707_10148861
879 Ga0065707_10221333
880 Ga0065707_10625993
881 Ga0070658_10016316
882 Ga0070676_10011371
883 Ga0070690_100105338
884 Ga0070690_100268087
885 Ga0070670_100011632
886 Ga0070677_10123539
887 Ga0068869_100001319
888 Ga0068869_100058153
889 Ga0070666_10185406
890 Ga0070680_100004668
891 Ga0070680_100010304
892 Ga0070682_100014141
893 Ga0070682_101110132
894 Ga0068868_100043799
895 Ga0068868_100369953
896 Ga0068868_100574943
897 Ga0070660_100000310
898 Ga0070660_100070147
899 Ga0070689_100122781
900 Ga0070689_100258547
901 Ga0070689_100764184
902 Ga0070689_100800922
903 Ga0070689_101104844
904 Ga0070691_10006645
905 Ga0070691_10109128
906 Ga0070691_10130505
907 Ga0070691_10734555
908 Ga0070687_100943598
909 Ga0070661_100015130
910 Ga0070692_10045074
911 Ga0070692_10075987
912 Ga0070668_100882399
913 Ga0070668_101866862
914 Ga0070669_100163817
915 Ga0070669_100521868
916 Ga0070669_100845244
917 Ga0070675_100947792
918 Ga0070674_100493192
919 Ga0070688_100397228
920 Ga0070659_100032893
921 Ga0070659_100343215
922 Ga0070667_100101454
923 Ga0070667_101237905
924 Ga0070703_10040106
925 Ga0070703_10064954
926 Ga0070709_10154063
927 Ga0070709_11225078
928 Ga0070714_100060895
929 Ga0070714_100847971
930 Ga0070713_100008635
931 Ga0070701_10002547
932 Ga0070701_10034111
933 Ga0070701_10100068
934 Ga0070705_100004869
935 Ga0070705_100007639
936 Ga0070705_100029506
937 Ga0070705_100068773
938 Ga0070700_100031452
939 Ga0070700_100348142
940 Ga0070694_100010663
941 Ga0070694_101139352
942 Ga0070694_101220578
943 Ga0070694_101232074
944 Ga0070708_100009491
945 Ga0070708_100039322
946 Ga0070708_100203564
947 Ga0070708_100384988
948 Ga0070708_100526974
949 Ga0070708_100650112
950 Ga0070708_100878793
951 Ga0070663_100002105
952 Ga0070663_100969475
953 Ga0070663_101446746
954 Ga0070678_100841378
955 Ga0070662_100014925
956 Ga0070662_100059442
957 Ga0070662_101043591
958 Ga0070681_10006123
959 Ga0070681_10082842
960 Ga0068867_100019768
961 Ga0070706_100004745
962 Ga0070706_100007662
963 Ga0070706_100026105
964 Ga0070706_100445910
965 Ga0070706_100559190
966 Ga0070706_100971853
967 Ga0070706_101168789
968 Ga0070706_101473985
969 Ga0070707_100000342
970 Ga0070707_100028692
971 Ga0070707_100045335
972 Ga0070707_100088891
973 Ga0070707_100192460
974 Ga0070707_100394740
975 Ga0070707_100496106
976 Ga0070707_100741603
977 Ga0070707_100879248
978 Ga0070707_101531864
979 Ga0070698_100001171
980 Ga0070698_100169364
981 Ga0070698_100279972
982 Ga0070698_100330910
983 Ga0070698_100347865
984 Ga0070698_101512883
985 Ga0070698_101595499
986 Ga0070699_100003147
987 Ga0070699_100007146
988 Ga0070699_100014865
989 Ga0070699_100118759
990 Ga0070699_100151764
991 Ga0070699_100235690
992 Ga0070699_100281594
993 Ga0070699_100501696
994 Ga0070699_100901957
995 Ga0070699_101631060
996 Ga0070679_100002047
997 Ga0070679_100004301
998 Ga0070684_100164385
999 Ga0070697_100023834
1000 Ga0070697_100058844
1001 Ga0070697_100132818
1002 Ga0070697_100317853
1003 Ga0070697_100560012
1004 Ga0070697_100708257
1005 Ga0070697_100866228
1006 Ga0068853_100024839
1007 Ga0070672_100208763
1008 Ga0070672_100615570
1009 Ga0070686_100141039
1010 Ga0070686_100807567
1011 Ga0070695_100011643
1012 Ga0070695_100799162
1013 Ga0070696_100025157
1014 Ga0070696_100078355
1015 Ga0070696_100197111
1016 Ga0070696_100281944
1017 Ga0070696_100292460
1018 Ga0070696_101194113
1019 Ga0070696_101426203
1020 Ga0070693_100000079
1021 Ga0070665_100045149
1022 Ga0070665_100260487
1023 Ga0070665_100344798
1024 Ga0070704_100016933
1025 Ga0070704_100563965
1026 Ga0070704_101258738
1027 Ga0070704_101532637
1028 Ga0068855_100049421
1029 Ga0068855_100106461
1030 Ga0068855_100644382
1031 Ga0070664_100031662
1032 Ga0070664_100142638
1033 Ga0070664_100777754
1034 Ga0068857_100042259
1035 Ga0068857_100053668
1036 Ga0068857_100078473
1037 Ga0068857_100361242
1038 Ga0068857_100434203
1039 Ga0068857_100873216
1040 Ga0068854_100001015
1041 Ga0068854_100252948
1042 Ga0068856_100042160
1043 Ga0070702_100171374
1044 Ga0068852_100021462
1045 Ga0068859_100002772
1046 Ga0068859_101402099
1047 Ga0068859_101538248
1048 Ga0068859_102113921
1049 Ga0068859_102153278
1050 Ga0068864_100091433
1051 Ga0068864_101183278
1052 Ga0068861_100032198
1053 Ga0068851_10034804
1054 Ga0068870_10045394
1055 Ga0068870_10990627
1056 Ga0068863_100107477
1057 Ga0068863_100436548
1058 Ga0068863_100627519
1059 Ga0068863_100729757
1060 Ga0068863_102020333
1061 Ga0068858_100161069
1062 Ga0068858_102023719
1063 Ga0068860_100028254
1064 Ga0068860_100049545
1065 Ga0068860_100116928
1066 Ga0068860_100293414
1067 Ga0068860_100436857
1068 Ga0068860_101257959
1069 Ga0068862_100045935
1070 Ga0068862_100081320
1071 Ga0068862_100576175
1072 Ga0068862_100663602
1073 Ga0068862_100768604
1074 Ga0081455_10000261
1075 Ga0081455_10004094
1076 Ga0081455_10008153
1077 Ga0081455_10011615
1078 Ga0081455_10057627
1079 Ga0081455_10207615
1080 Ga0081538_10015638
1081 Ga0081538_10017319
1082 Ga0081538_10033270
1083 Ga0081538_10041628
1084 Ga0081538_10046841
1085 Ga0081538_10057418
1086 Ga0081538_10062658
1087 Ga0081540_1018632
1088 Ga0081540_1074046
1089 Ga0081540_1157175
1090 Ga0081539_10003351
1091 Ga0081539_10007866
1092 Ga0081539_10016229
1093 Ga0070717_10055064
1094 Ga0075365_10006270
1095 Ga0075365_10168542
1096 Ga0075368_10101922
1097 Ga0075363_100091540
1098 Ga0075364_10593831
1099 Ga0070715_10159090
1100 Ga0070716_100004550
1101 Ga0070712_100000261
1102 Ga0070712_100127714
1103 Ga0070712_100138726
1104 Ga0070712_100183166
1105 Ga0070712_100311278
1106 Ga0075362_10054696
1107 Ga0075362_10236803
1108 Ga0075362_10282815
1109 Ga0075367_10057243
1110 Ga0075369_10038707
1111 Ga0075427_10010473
1112 Ga0075366_10004028
1113 Ga0097621_100310207
1114 Ga0075370_10317076
1115 Ga0075428_100079033
1116 Ga0075428_100146380
1117 Ga0075428_100324038
1118 Ga0075428_100653041
1119 Ga0075428_100812671
1120 Ga0075428_101436366
1121 Ga0075428_101541173
1122 Ga0075430_100058973
1123 Ga0075430_100242524
1124 Ga0075430_100767225
1125 Ga0075430_101119256
1126 Ga0075430_101192785
1127 Ga0075431_100017289
1128 Ga0075431_100049524
1129 Ga0075431_100235672
1130 Ga0075431_100623832
1131 Ga0075431_100905644
1132 Ga0075431_100907285
1133 Ga0075431_101188985
1134 Ga0075431_101789500
1135 Ga0075433_10005245
1136 Ga0075433_10012243
1137 Ga0075433_10478173
1138 Ga0075433_10690178
1139 Ga0075433_10929187
1140 Ga0075433_11340744
1141 Ga0075434_100008457
1142 Ga0075434_100508359
1143 Ga0075434_100814372
1144 Ga0075434_100898660
1145 Ga0075434_101167003
1146 Ga0075434_101212716
1147 Ga0075434_101236268
1148 Ga0075434_101384589
1149 Ga0075434_101958177
1150 Ga0075429_100121596
1151 Ga0075429_100366465
1152 Ga0075429_100663694
1153 Ga0075429_100870380
1154 Ga0068865_100161095
1155 Ga0068865_100749595
1156 Ga0068865_100919665
1157 Ga0075436_100398072
1158 Ga0075436_100834330
1159 Ga0097620_100002772
1160 Ga0097620_101402098
1161 Ga0097620_101538258
1162 Ga0097620_102113848
1163 Ga0097620_102153385
1164 Ga0075435_100019255
1165 Ga0075435_100232803
1166 Ga0075435_100317442
1167 Ga0075435_100482499
1168 Ga0075435_100645492
1169 Ga0075435_101065218
1170 Ga0099794_10001705
1171 Ga0099794_10132454
1172 Ga0099794_10158707
1173 Ga0105240_10002551
1174 Ga0105240_12123425
1175 Ga0105240_12561854
1176 Ga0111539_10000742
1177 Ga0111539_10022591
1178 Ga0111539_10095497
1179 Ga0111539_10473409
1180 Ga0111539_10622070
1181 Ga0111539_10696300
1182 Ga0105245_10142851
1183 Ga0105245_11329353
1184 Ga0105245_11910135
1185 Ga0105247_10231852
1186 Ga0105247_10333180
1187 Ga0114129_10049354
1188 Ga0114129_10228100
1189 Ga0114129_10305174
1190 Ga0114129_10364631
1191 Ga0114129_10366331
1192 Ga0114129_10646343
1193 Ga0114129_10982434
1194 Ga0114129_11129526
1195 Ga0114129_11169974
1196 Ga0114129_11356890
1197 Ga0114129_11736189
1198 Ga0114129_11759982
1199 Ga0105243_10049740
1200 Ga0105243_11794693
1201 Ga0105243_12324545
1202 Ga0105241_10043057
1203 Ga0105241_10265387
1204 Ga0105242_10088090
1205 Ga0105242_10618150
1206 Ga0105248_10032512
1207 Ga0105248_10287916
1208 Ga0105248_10353284
1209 Ga0105248_10423733
1210 Ga0105248_11124926
1211 Ga0105237_10139084
1212 Ga0105238_10192412
1213 Ga0105238_10241930
1214 Ga0105249_10313949
1215 Ga0105249_10361360
1216 Ga0105249_10912371
1217 Ga0105249_11241477
1218 Ga0105249_12316551
1219 Ga0105035_107095
1220 Ga0099796_10170680
1221 Ga0105239_10208774
1222 Ga0105246_10072549
1223 Ga0105246_10479227
1224 Ga0154012_119121
1225 Ga0157373_10036732
1226 Ga0157371_10084937
1227 Ga0157371_10142894
1228 Ga0157371_10147446
1229 Ga0157370_10240401
1230 Ga0157369_10018217
1231 Ga0157374_10680400
1232 Ga0157378_10574678
1233 Ga0157378_10783861
1234 Ga0163162_10518256
1235 Ga0163162_10549954
1236 Ga0163162_10774940
1237 Ga0163162_11269276
1238 Ga0157372_10045306
1239 Ga0157372_10369156
1240 Ga0157372_10426557
1241 Ga0157372_11279081
1242 Ga0157375_10236805
1243 Ga0157375_10482967
1244 Ga0157375_10675060
1245 Ga0163163_10116222
1246 Ga0163163_10448082
1247 Ga0157380_10650293
1248 Ga0157380_10729138
1249 Ga0157380_11867586
1250 Ga0182008_10055373
1251 Ga0182008_10464511
1252 Ga0157377_10502507
1253 Ga0157376_10087320
1254 Ga0157376_11456486
1255 Ga0182007_10183629
1256 Ga0163161_10325229
1257 Ga0163161_10488172
1258 Ga0163161_10567744
1259 Ga0206356_10850150
1260 Ga0206352_10559314
1261 Ga0206353_10074075
1262 Ga0206353_10389456
1263 Ga0206353_10676132
1264 Ga0213872_10085402
1265 Ga0213871_10037955
1266 Ga0207426_1027401
1267 Ga0207653_10005168
1268 Ga0207653_10016341
1269 Ga0207682_10410247
1270 Ga0207692_10062937
1271 Ga0207710_10299092
1272 Ga0207688_10092647
1273 Ga0207680_10213787
1274 Ga0207647_10033845
1275 Ga0207647_10125168
1276 Ga0207685_10117584
1277 Ga0207699_10036121
1278 Ga0207699_10178042
1279 Ga0207699_10179790
1280 Ga0207699_10769524
1281 Ga0207645_10000313
1282 Ga0207645_10235601
1283 Ga0207645_10268016
1284 Ga0207643_10000952
1285 Ga0207643_10660933
1286 Ga0207705_10185077
1287 Ga0207684_10028617
1288 Ga0207684_10030439
1289 Ga0207684_10031340
1290 Ga0207684_10064858
1291 Ga0207684_10130023
1292 Ga0207684_10331872
1293 Ga0207654_10357481
1294 Ga0207707_10000534
1295 Ga0207707_10011153
1296 Ga0207695_10106769
1297 Ga0207695_10167576
1298 Ga0207695_10596923
1299 Ga0207671_10125514
1300 Ga0207693_10001950
1301 Ga0207693_10022756
1302 Ga0207693_10093662
1303 Ga0207693_10120006
1304 Ga0207663_10075137
1305 Ga0207660_10038020
1306 Ga0207660_10089269
1307 Ga0207660_10105762
1308 Ga0207660_10628657
1309 Ga0207660_11163463
1310 Ga0207662_10159726
1311 Ga0207662_10178920
1312 Ga0207657_10000172
1313 Ga0207649_10160974
1314 Ga0207652_10156277
1315 Ga0207652_10243501
1316 Ga0207646_10001108
1317 Ga0207646_10014265
1318 Ga0207646_10102305
1319 Ga0207646_10425168
1320 Ga0207646_10439968
1321 Ga0207646_10492480
1322 Ga0207646_11187449
1323 Ga0207681_10176584
1324 Ga0207681_11378800
1325 Ga0207694_10112326
1326 Ga0207650_10519932
1327 Ga0207650_10673873
1328 Ga0207659_10152747
1329 Ga0207659_10257460
1330 Ga0207687_10183002
1331 Ga0207687_10650207
1332 Ga0207700_10031702
1333 Ga0207700_10473107
1334 Ga0207664_10075482
1335 Ga0207644_11010336
1336 Ga0207690_10132778
1337 Ga0207690_10318901
1338 Ga0207706_10002219
1339 Ga0207706_10076058
1340 Ga0207706_10637892
1341 Ga0207706_10877570
1342 Ga0207686_10084592
1343 Ga0207686_10825605
1344 Ga0207686_11089004
1345 Ga0207709_10009736
1346 Ga0207670_10286598
1347 Ga0207670_10569635
1348 Ga0207670_10717471
1349 Ga0207704_10070453
1350 Ga0207704_10182937
1351 Ga0207665_10000410
1352 Ga0207665_10823882
1353 Ga0207665_11088617
1354 Ga0207691_10053793
1355 Ga0207691_10099042
1356 Ga0207691_10183584
1357 Ga0207711_10566731
1358 Ga0207711_10894739
1359 Ga0207711_10925174
1360 Ga0207689_10000062
1361 Ga0207689_10224020
1362 Ga0207689_10475371
1363 Ga0207661_10113458
1364 Ga0207679_10413986
1365 Ga0207667_10005822
1366 Ga0207667_10423614
1367 Ga0207651_10582963
1368 Ga0207712_10005557
1369 Ga0207712_10021266
1370 Ga0207712_11535792
1371 Ga0207668_10750621
1372 Ga0207658_10695953
1373 Ga0207677_10982313
1374 Ga0207703_10145682
1375 Ga0207703_11247465
1376 Ga0207703_11342607
1377 Ga0207703_11390160
1378 Ga0207639_10600031
1379 Ga0207639_10837130
1380 Ga0207678_10020424
1381 Ga0207708_10015875
1382 Ga0207708_10047767
1383 Ga0207702_10001801
1384 Ga0207641_10361784
1385 Ga0207641_10450280
1386 Ga0207641_10499290
1387 Ga0207641_11406956
1388 Ga0207648_10000746
1389 Ga0207648_10460680
1390 Ga0207648_10535487
1391 Ga0207676_10029273
1392 Ga0207676_10393240
1393 Ga0207674_10031354
1394 Ga0207674_10039481
1395 Ga0207674_10046562
1396 Ga0207674_10047087
1397 Ga0207674_10232147
1398 Ga0207674_10459524
1399 Ga0207675_100006834
1400 Ga0207675_100403566
1401 Ga0207675_101555376
1402 Ga0207683_10029426
1403 Ga0207683_10399277
1404 Ga0209969_1002222
1405 Ga0209981_1009590
1406 Ga0209984_1009208
1407 Ga0210000_1005881
1408 Ga0209995_1005705
1409 Ga0209968_1009680
1410 Ga0209999_1001614
1411 Ga0209970_1002979
1412 Ga0210002_1008045
1413 Ga0209983_1002641
1414 Ga0209588_1005820
1415 Ga0209971_1000050
1416 Ga0209966_1000407
1417 Ga0209998_10000054
1418 Ga0209813_10091914
1419 Ga0209974_10020587
1420 Ga0209974_10300581
1421 Ga0207428_10000215
1422 Ga0268266_10084464
1423 Ga0268266_10356467
1424 Ga0268266_10755670
1425 Ga0268266_11137694
1426 Ga0268265_10043181
1427 Ga0268265_10110412
1428 Ga0268265_10127560
1429 Ga0268265_10144246
1430 Ga0268265_10463866
1431 Ga0268265_10629615
1432 Ga0268265_11252635
1433 Ga0268265_11288748
1434 Ga0268264_10115049
1435 Ga0268264_10334080
1436 Ga0268264_10412143
1437 Ga0268264_10692384
1438 Ga0268264_11128359
1439 Ga0265334_10014548
1440 Ga0265332_10197555
1441 Ga0265325_10285575
1442 Ga0265340_10025030
1443 Ga0316579_10150838
1444 Ga0316576_10303725
1445 Ga0316576_10620048
1446 Ga0316578_10073113
1447 Ga0307411_10434726
1448 Ga0373928_0092209
1449 Ga0373929_0024558
1450 Ga0373940_0036740
1451 Ga0373949_0013568
1452 Ga0373952_0021424
1453 Ga0373923_0349787
1454 Ga0373939_0187349
1455 Ga0373941_0324898
1456 Ga0373941_0329969
1457 Ga0373946_0277503
1458 Ga0373942_0173107
1459 Ga0373962_0039365
1460 Ga0316574_0002057
1461 Ga0316574_0213803
1462 Ga0373931_0079094
1463 Ga0373931_0340267
1464 Ga0373931_0559382
1465 Ga0373931_0727900
1466 Ga0373933_0764697
1467 Ga0373947_0708893
1468 Ga0373937_0029412
1469 Ga0373937_0618264
1470 Ga0316582_0053407
1471 Ga0316582_0448353
1472 Ga0316584_0111834
1473 Ga0373925_0116480
1474 Ga0373925_0367105
1475 Ga0395899_0014212
1476 Ga0395899_0030039
1477 Ga0395899_0134474
1478 Ga0395900_0045889
1479 Ga0395900_0049281
1480 Ga0395900_0219640
1481 Ga0395900_0253947
1482 Ga0395898_0059150
1483 Ga0395898_0089822
1484 Ga0395898_0180849
1485 Ga0395905_0390672
1486 Ga0395901_0000475
1487 Ga0395901_0011479
1488 Ga0395901_0027024
1489 Ga0395901_0041490
1490 Ga0395901_0065597
1491 Ga0242420_015056
1492 Ga0436360_0674555
1493 Ga0436360_0946006
1494 Ga0436361_0513859
1495 Ga0436361_0783817
1496 Ga0436363_1062953
1497 Ga0439461_0052124
1498 Ga0451853_2859496
1499 Ga0439441_007826
1500 Ga0439441_105230
1501 Ga0439443_025773
1502 Ga0439448_0012288
1503 Ga0439448_0098019
1504 Ga0439448_0143811
1505 Ga0439450_011717
1506 Ga0439450_044002
1507 Ga0439455_0013488
1508 Ga0439455_0135287
1509 Ga0450889_015939
1510 Ga0439458_0019409
1511 Ga0439459_0000092
1512 Ga0439459_0025484
1513 Ga0439464_0009338
1514 Ga0439460_0002500
1515 Ga0439460_0276826
1516 Ga0451577_0001950
1517 Ga0451577_0007329
1518 Ga0451577_0240178
1519 Ga0451577_0314582
1520 Ga0451577_0484002
1521 Ga0453683_0024590
1522 Ga0453683_0154101
1523 Ga0453683_0272214
1524 Ga0466963_0028862
1525 Ga0453684_0001317
1526 Ga0453684_0005246
1527 Ga0453684_0033093
1528 Ga0453684_0437422
1529 Ga0453684_0648415
1530 Ga0453684_0846086
1531 Ga0453684_1364476
1532 Ga0466957_0129714
1533 Ga0466959_0433961
1534 Ga0451576_0014685
1535 Ga0451576_0044786
1536 Ga0451576_0096348
1537 Ga0451576_0273048
1538 Ga0451576_0717864
1539 Ga0451576_0950271
1540 Ga0466967_0048947
1541 Ga0466967_1836330
1542 Ga0495592_0550889
1543 Ga0495622_0140218
1544 Ga0495660_0037400
1545 Ga0496102_0149365
1546 Ga0496107_1203162
1547 Ga0496109_1349255
1548 Ga0496110_0677508
1549 Ga0496110_1674373
1550 Ga0496126_0142693
1551 Ga0501032_0357352
1552 Ga0501033_0051227
1553 Ga0501033_0319821
1554 Ga0501034_0006395
1555 Ga0501034_0007238
1556 Ga0501034_0051803
1557 Ga0501034_0134102
1558 Ga0501034_0418654
1559 Ga0501036_0102574
1560 Ga0501037_0117021
1561 Ga0501038_0074226
1562 Ga0501038_0271562
1563 Ga0501038_0389305
1564 Ga0501038_0399247
1565 Ga0501038_0878723
1566 Ga0501039_0023611
1567 Ga0501039_0405032
1568 Ga0501040_0006093
1569 Ga0501040_0095345
1570 Ga0501040_0153029
1571 Ga0501040_0512591
1572 Ga0501040_0670894
1573 Ga0501041_0001681
1574 Ga0501042_0090711
1575 Ga0501042_0347595
1576 Ga0501042_1194737
1577 Ga0501043_0290836
1578 Ga0501043_0302886
1579 Ga0501046_0000421
1580 Ga0501046_0882275
1581 Ga0501047_0135784
1582 Ga0501047_0317158
1583 Ga0501047_0834232
1584 Ga0501048_0001598
1585 Ga0501048_0042830
1586 Ga0501067_0079133
1587 Ga0501068_0011116
1588 Ga0501068_0338976
1589 Ga0501068_0642529
1590 Ga0501069_0465416
1591 Ga0501070_0086316
1592 Ga0501070_0315203
1593 Ga0501070_0532679
1594 Ga0501071_1305164
1595 Ga0501071_1499718
1596 Ga0501072_0895876
1597 Ga0501073_0292563
1598 Ga0501074_0084622
1599 Ga0501074_0441392
1600 Ga0501075_0016068
1601 Ga0501075_0071971
1602 Ga0501075_0230967
1603 Ga0501075_0517332
1604 Ga0501075_0894965
1605 Ga0501075_1174648
1606 Ga0501076_0018265
1607 Ga0501076_0279740
1608 Ga0501076_0323730
1609 Ga0501076_1495832
1610 Ga0501077_0189685
1611 Ga0501077_0200368
1612 Ga0501077_0400306
1613 Ga0501079_0148080
1614 Ga0501079_0185291
1615 Ga0501079_1055046
1616 Ga0501080_0331533
1617 Ga0501080_0372553
1618 Ga0501080_1017377
1619 Ga0501081_0000905
1620 Ga0501081_0012146
1621 Ga0501081_0055527
1622 Ga0501081_0609773
1623 Ga0501083_0004180
1624 Ga0501083_0123319
1625 Ga0501035_0931695
1626 Ga0501044_0767526
1627 Ga0501045_0001258
1628 Ga0501045_0301846
1629 Ga0501045_0618191
1630 Ga0501045_0758727
1631 nmdc:mga03683_106374_c1
1632 nmdc:mga03683_37980_c1
1633 nmdc:mga03n38_210605_c1
1634 nmdc:mga00v17_139162_c1
1635 nmdc:mga0yw44_325547_c1
1636 nmdc:mga0k408_12586_c1
1637 nmdc:mga0k408_607475_c1
1638 nmdc:mga06z11_272595_c1
1639 nmdc:mga06z11_345924_c1
1640 nmdc:mga04h51_148446_c1
1641 nmdc:mga04h51_233143_c1
1642 nmdc:mga05p37_1243176_c1
1643 nmdc:mga05p37_196788_c1
1644 nmdc:mga05p37_219712_c1
1645 nmdc:mga05p37_410314_c1
1646 nmdc:mga05p37_440384_c1
1647 nmdc:mga05p37_467448_c1
1648 nmdc:mga05p37_54140_c1
1649 nmdc:mga05p37_793001_c1
1650 nmdc:mga05p37_7_c1
1651 nmdc:mga05p37_89893_c1
1652 nmdc:mga09592_113095_c1
1653 nmdc:mga09592_16259_c1
1654 nmdc:mga09592_285798_c1
1655 nmdc:mga09592_311175_c1
1656 nmdc:mga09592_382944_c1
1657 nmdc:mga09592_904953_c1
1658 nmdc:mga0qj67_26969_c1
1659 nmdc:mga0qj67_333297_c1
1660 nmdc:mga0qj67_650427_c1
1661 nmdc:mga0qj67_820138_c1
1662 nmdc:mga06r32_1010958_c1
1663 nmdc:mga06r32_115966_c1
1664 nmdc:mga06r32_1340412_c1
1665 nmdc:mga06r32_13423_c1
1666 nmdc:mga06r32_1443371_c1
1667 nmdc:mga06r32_288838_c1
1668 nmdc:mga06r32_298220_c1
1669 nmdc:mga06r32_637783_c1
1670 nmdc:mga06r32_76583_c1
1671 nmdc:mga06r32_7856_c1
1672 nmdc:mga06r32_828351_c1
1673 nmdc:mga08y16_181535_c1
1674 nmdc:mga08y16_23865_c1
1675 nmdc:mga08y16_299342_c1
1676 nmdc:mga08y16_869_c1
1677 nmdc:mga0n895_1047263_c1
1678 nmdc:mga0n895_1378668_c1
1679 nmdc:mga0n895_1454608_c1
1680 nmdc:mga0n895_177866_c1
1681 nmdc:mga0n895_178504_c1
1682 nmdc:mga0n895_193878_c1
1683 nmdc:mga0n895_4068_c1
1684 nmdc:mga0n895_606142_c1
1685 nmdc:mga0n895_80883_c1
1686 nmdc:mga0n895_896215_c1
1687 nmdc:mga0rr50_1015345_c1
1688 nmdc:mga0rr50_127221_c1
1689 nmdc:mga0rr50_218325_c1
1690 nmdc:mga0rr50_311922_c1
1691 nmdc:mga0rr50_332138_c1
1692 nmdc:mga0rr50_45524_c1
1693 nmdc:mga08x19_179196_c1
1694 nmdc:mga08x19_45941_c1
1695 nmdc:mga08x19_600786_c1
1696 nmdc:mga0a205_121987_c1
1697 nmdc:mga0a205_132494_c1
1698 nmdc:mga0a205_1398685_c1
1699 nmdc:mga0a205_176291_c2
1700 nmdc:mga0a205_23275_c1
1701 nmdc:mga0a205_36294_c1
1702 nmdc:mga0a205_385366_c1
1703 nmdc:mga0a205_723506_c1
1704 nmdc:mga0a205_753528_c1
1705 nmdc:mga0sz30_152323_c1
1706 nmdc:mga0sz30_964_c1
1707 Ga0495601_0134212
1708 Ga0495619_0026897
1709 Ga0500646_0335386
1710 Ga0500651_0090353
1711 Ga0500566_0289055
1712 Ga0500641_0041132
1713 Ga0500658_0445720
1714 Ga0500616_0003831
1715 Ga0500552_000468
1716 Ga0501084_0004842
1717 Ga0501084_0026998
1718 Ga0501084_0070587
1719 Ga0501084_0182061
1720 Ga0501084_1081632
1721 Ga0501084_1147981
1722 Ga0501082_0001936
1723 Ga0501082_0007368
1724 Ga0501082_0033924
1725 Ga0501082_0720788
1726 Ga0501082_1717133
1727 Ga0530510_0015282
1728 Ga0530510_0102721
1729 Ga0530510_0295439
1730 Ga0530510_0568577
1731 2513589984
1732 2905929139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

16

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.9659 9 131
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.949 9 132
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9463 9 127
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.9462 9 132
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9147 9 127
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9312 4 132 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9228 14 131 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9103 4 132 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8861 14 131 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.7133 10 131 2.40.280.10
ID Description Score Start End GO Terms
AF-A7L9H9-F1-model_v4 SmpB 0.9888 24 127 GO:0003723
GO:0005829
AF-A7L9H9-F1-model_v4 SmpB 0.9794 24 127 GO:0003723
GO:0005829
AF-A0A660ZPQ7-F1-model_v4 SsrA-binding protein 0.9783 9 132 GO:0003723
GO:0005829
AF-A0A3C2C3N6-F1-model_v4 SsrA-binding protein 0.9773 7 122 GO:0003723
GO:0005829
AF-A0A2E0C8T3-F1-model_v4 deleted 0.9738 10 127

Map