F483855

General Info

Members Datasets Scaffolds Average Seq Length
861 439 787 258

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0071568|Ga0466960_0071568_500_1369
Length 289
Sequence MRRYRPVTSKIGAGGPTVRALKPLAEVGLTMNIVVLVKQVPDSGTPRSLDPADNTVARAAADNVINEIDEYAIEEALTVKEAQGGEVTVLTVGPDSATDAIRKALSMGADKAVHVVDDAIHGSCAVQTSAVLAAALQQMDYDLVLMGATSTDGQVAVMPALLSERLGIPQVSGARKLTVADGKVQVERQTDGGFWALEAPLPAIVSTWDTINEPRYPSFKGIMAAKKKPVEKKSLADLGIDPSTVGLASATSQVLDFAGRPPKGEGVKVNDEGDGAQKLVEYLASQKIV

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
7 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
8 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
9 2558860280 Kutzneria sp. 744 Isolate Unclassified
10 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
11 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
12 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
13 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
14 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
15 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
16 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
17 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
18 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
19 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
20 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
21 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
22 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
23 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
24 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
25 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
26 2855683550 Micromonospora sp. RP3T Isolate Unclassified
27 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
28 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
29 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
30 2858868258 Micromonospora sp. MH33 Isolate Unclassified
31 2858882152 Micromonospora noduli MED15 Isolate Nodule
32 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
33 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
34 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
35 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
36 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
37 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
38 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
39 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
40 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
41 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
42 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
43 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
44 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
45 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
46 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
47 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
48 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
49 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
50 2902582711 Micromonospora sp. AP08 Isolate Unclassified
51 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
52 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
53 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
54 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
55 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
56 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
57 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
58 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
59 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
60 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
63 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
64 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
65 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
78 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
91 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
92 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
93 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
94 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
95 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
96 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
97 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
98 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
99 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
100 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
103 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
104 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
105 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
106 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
107 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
108 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
111 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
112 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
119 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
133 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
135 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
136 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
137 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
138 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
139 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
140 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
141 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
143 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
144 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
145 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
146 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
147 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
153 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
154 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
155 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
158 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
173 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
174 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
175 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
176 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
177 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
178 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
179 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
180 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
189 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
190 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
253 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
254 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
255 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
256 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
257 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
258 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
261 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
262 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
263 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
264 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
265 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
266 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
267 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
268 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
269 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
275 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
276 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
279 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
280 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
281 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
284 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
285 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
300 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
301 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
308 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
309 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
310 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
311 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
312 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
313 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
314 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
315 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
316 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
322 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
326 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
330 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
334 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
337 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
344 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
345 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
416 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
417 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
418 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
419 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
420 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
423 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
424 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
425 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 649633069 Micromonospora sp. L5 Isolate Unclassified
428 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
429 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
430 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
431 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
432 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
433 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
434 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
435 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
436 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
437 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
438 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
439 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.85
Metatranscriptomes 2.56
Isolates 8.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0.7
Rhizoplane 5.92
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1007256 3300000549 Bacteria 1363
2 JGI24737J22298_10052087 3300001990 Bacteria 1242
3 JGI24744J21845_10001881 3300002077 Bacteria 4219
4 JGI24744J21845_10009849 3300002077 Bacteria 1962
5 JGI24742J22300_10001138 3300002244 Bacteria 4130
6 Ga0006778J45830_1043793 3300003162 Bacteria 899
7 JGI25406J46586_10007522 3300003203 Bacteria 4964
8 JGI25406J46586_10026569 3300003203 Bacteria 2230
9 JGI25406J46586_10036226 3300003203 Bacteria 1793
10 JGI25406J46586_10046149 3300003203 Bacteria 1495
11 Ga0058859_11209305 3300004798 Bacteria 1117
12 Ga0070658_10036125 3300005327 Bacteria 3981
13 Ga0070676_10034665 3300005328 Bacteria 2898
14 Ga0070676_10192469 3300005328 Bacteria 1332
15 Ga0070690_100010751 3300005330 Bacteria 5336
16 Ga0070690_100077738 3300005330 Bacteria 2167
17 Ga0070690_100160073 3300005330 Bacteria 1542
18 Ga0070677_10131241 3300005333 Bacteria 1144
19 Ga0068869_100001538 3300005334 Bacteria 13707
20 Ga0068869_100102748 3300005334 Bacteria 2164
21 Ga0068869_100288990 3300005334 Bacteria 1320
22 Ga0070680_100005701 3300005336 Bacteria 9442
23 Ga0070680_100183315 3300005336 Bacteria 1763
24 Ga0070682_100109494 3300005337 Bacteria 1838
25 Ga0068868_100002112 3300005338 Bacteria 13688
26 Ga0068868_100086561 3300005338 Bacteria 2519
27 Ga0070660_100488367 3300005339 Bacteria 1024
28 Ga0070689_100007064 3300005340 Bacteria 7817
29 Ga0070691_10044583 3300005341 Bacteria 2104
30 Ga0070691_10077057 3300005341 Bacteria 1626
31 Ga0070692_10010017 3300005345 Bacteria 4298
32 Ga0070692_10165194 3300005345 Bacteria 1271
33 Ga0070668_100010272 3300005347 Bacteria 6949
34 Ga0070668_100073553 3300005347 Bacteria 2664
35 Ga0070668_100172447 3300005347 Bacteria 1762
36 Ga0070668_100215450 3300005347 Bacteria 1581
37 Ga0070668_100534304 3300005347 Bacteria 1019
38 Ga0070669_100093801 3300005353 Bacteria 2254
39 Ga0070675_100006710 3300005354 Bacteria 8850
40 Ga0070671_100000660 3300005355 Bacteria 24797
41 Ga0070674_100145139 3300005356 Bacteria 1785
42 Ga0070673_100209720 3300005364 Bacteria 1682
43 Ga0070688_100015773 3300005365 Bacteria 4306
44 Ga0070659_100082176 3300005366 Bacteria 2574
45 Ga0070667_100002279 3300005367 Bacteria 16894
46 Ga0070667_100030108 3300005367 Bacteria 4526
47 Ga0070667_100258142 3300005367 Bacteria 1560
48 Ga0070714_100080473 3300005435 Bacteria 2835
49 Ga0070713_100375416 3300005436 Bacteria 1324
50 Ga0070713_100452587 3300005436 Bacteria 1206
51 Ga0070710_10001277 3300005437 Bacteria 11953
52 Ga0070710_10166698 3300005437 Bacteria 1370
53 Ga0070710_10284799 3300005437 Bacteria 1073
54 Ga0070701_10034555 3300005438 Bacteria 2533
55 Ga0070711_100001571 3300005439 Bacteria 12571
56 Ga0070711_100015196 3300005439 Bacteria 4868
57 Ga0070711_100587608 3300005439 Bacteria 928
58 Ga0070705_100017669 3300005440 Bacteria 3726
59 Ga0070705_100065015 3300005440 Bacteria 2182
60 Ga0070700_100000088 3300005441 Bacteria 61864
61 Ga0070700_100001394 3300005441 Bacteria 12009
62 Ga0070700_100572294 3300005441 Bacteria 881
63 Ga0070694_100104870 3300005444 Bacteria 2005
64 Ga0070694_100374745 3300005444 Bacteria 1108
65 Ga0070708_100055287 3300005445 Bacteria 3529
66 Ga0070663_100018971 3300005455 Bacteria 4522
67 Ga0070663_100097814 3300005455 Bacteria 2185
68 Ga0070678_100000985 3300005456 Bacteria 14721
69 Ga0070678_100174495 3300005456 Bacteria 1754
70 Ga0070678_100463256 3300005456 Bacteria 1112
71 Ga0070662_100022956 3300005457 Bacteria 4280
72 Ga0070662_100028424 3300005457 Bacteria 3891
73 Ga0070662_100172251 3300005457 Bacteria 1700
74 Ga0070681_10004253 3300005458 Bacteria 13572
75 Ga0068867_100000404 3300005459 Bacteria 29014
76 Ga0068867_100128950 3300005459 Bacteria 1963
77 Ga0070685_10152033 3300005466 Bacteria 1467
78 Ga0070685_10412754 3300005466 Bacteria 937
79 Ga0070706_100011901 3300005467 Bacteria 8076
80 Ga0070706_100027827 3300005467 Bacteria 5200
81 Ga0070706_100144106 3300005467 Bacteria 2224
82 Ga0070706_100292841 3300005467 Bacteria 1519
83 Ga0070707_100000256 3300005468 Bacteria 53538
84 Ga0070707_100008621 3300005468 Bacteria 9465
85 Ga0070707_100076895 3300005468 Bacteria 3220
86 Ga0070707_100115330 3300005468 Bacteria 2607
87 Ga0070707_100420591 3300005468 Bacteria 1297
88 Ga0070698_100033546 3300005471 Bacteria 5317
89 Ga0070698_100035045 3300005471 Bacteria 5190
90 Ga0070698_100046972 3300005471 Bacteria 4414
91 Ga0070699_100067973 3300005518 Bacteria 3094
92 Ga0070679_100007103 3300005530 Bacteria 10449
93 Ga0070679_100078349 3300005530 Bacteria 3293
94 Ga0070679_100202088 3300005530 Bacteria 1952
95 Ga0070684_100138184 3300005535 Bacteria 2202
96 Ga0070684_100241988 3300005535 Bacteria 1649
97 Ga0068853_100157482 3300005539 Bacteria 2047
98 Ga0068853_100227962 3300005539 Bacteria 1703
99 Ga0070672_100174187 3300005543 Bacteria 1790
100 Ga0070695_100080722 3300005545 Bacteria 2150
101 Ga0070696_100104220 3300005546 Bacteria 2036
102 Ga0070693_100100901 3300005547 Bacteria 1758
103 Ga0070693_100295719 3300005547 Bacteria 1089
104 Ga0070665_100006667 3300005548 Bacteria 11741
105 Ga0070665_100036041 3300005548 Bacteria 4977
106 Ga0070665_100207197 3300005548 Bacteria 1961
107 Ga0070665_100232216 3300005548 Bacteria 1845
108 Ga0070704_100001226 3300005549 Bacteria 13507
109 Ga0070704_100187582 3300005549 Bacteria 1659
110 Ga0068855_100106991 3300005563 Bacteria 3214
111 Ga0068855_100456480 3300005563 Bacteria 1394
112 Ga0070664_100005365 3300005564 Bacteria 10290
113 Ga0068857_100127700 3300005577 Bacteria 2292
114 Ga0068857_100130327 3300005577 Bacteria 2268
115 Ga0068857_100285451 3300005577 Bacteria 1519
116 Ga0068857_100389631 3300005577 Bacteria 1295
117 Ga0068857_100439471 3300005577 Bacteria 1218
118 Ga0068854_100001406 3300005578 Bacteria 14522
119 Ga0068854_100167135 3300005578 Bacteria 1708
120 Ga0068856_100003019 3300005614 Bacteria 17239
121 Ga0068856_100094781 3300005614 Bacteria 2972
122 Ga0068856_100259297 3300005614 Bacteria 1754
123 Ga0070702_100000347 3300005615 Bacteria 16145
124 Ga0070702_100192079 3300005615 Bacteria 1344
125 Ga0068852_100152494 3300005616 Bacteria 2150
126 Ga0068852_100204692 3300005616 Bacteria 1869
127 Ga0068859_100079740 3300005617 Bacteria 3314
128 Ga0068864_100008230 3300005618 Bacteria 8602
129 Ga0068864_100125656 3300005618 Bacteria 2298
130 Ga0068864_100234324 3300005618 Bacteria 1699
131 Ga0068864_100350926 3300005618 Bacteria 1392
132 Ga0068866_10001788 3300005718 Bacteria 9046
133 Ga0068866_10144847 3300005718 Bacteria 1368
134 Ga0068861_100032541 3300005719 Bacteria 3839
135 Ga0068861_100325692 3300005719 Bacteria 1339
136 Ga0068863_100014312 3300005841 Bacteria 7642
137 Ga0068863_100031833 3300005841 Bacteria 5031
138 Ga0068863_100086939 3300005841 Bacteria 2962
139 Ga0068863_100095166 3300005841 Bacteria 2827
140 Ga0068858_100006025 3300005842 Bacteria 11823
141 Ga0068858_100015931 3300005842 Bacteria 7062
142 Ga0068858_100105269 3300005842 Bacteria 2632
143 Ga0068858_100280519 3300005842 Bacteria 1586
144 Ga0068860_100004983 3300005843 Bacteria 13533
145 Ga0068860_100041810 3300005843 Bacteria 4379
146 Ga0068860_100270666 3300005843 Bacteria 1658
147 Ga0068862_100011571 3300005844 Bacteria 7278
148 Ga0068862_100064458 3300005844 Bacteria 3154
149 Ga0081455_10004297 3300005937 Bacteria 16037
150 Ga0081538_10066848 3300005981 Bacteria 2011
151 Ga0081540_1031200 3300005983 Bacteria 2935
152 Ga0081540_1056257 3300005983 Bacteria 1910
153 Ga0081539_10000706 3300005985 Bacteria 66923
154 Ga0081539_10001346 3300005985 Bacteria 42790
155 Ga0081539_10004243 3300005985 Bacteria 16099
156 Ga0081539_10008166 3300005985 Bacteria 9232
157 Ga0081539_10010521 3300005985 Bacteria 7498
158 Ga0070717_10002691 3300006028 Bacteria 12526
159 Ga0070717_10032743 3300006028 Bacteria 4191
160 Ga0075364_10003109 3300006051 Bacteria 9392
161 Ga0075364_10244467 3300006051 Bacteria 1219
162 Ga0070715_10044225 3300006163 Bacteria 1882
163 Ga0070715_10051233 3300006163 Bacteria 1776
164 Ga0070715_10103097 3300006163 Bacteria 1334
165 Ga0070716_100047995 3300006173 Bacteria 2411
166 Ga0070716_100050887 3300006173 Bacteria 2353
167 Ga0070712_100001155 3300006175 Bacteria 15956
168 Ga0070712_100115740 3300006175 Bacteria 2010
169 Ga0070712_100270310 3300006175 Bacteria 1365
170 Ga0070712_100390913 3300006175 Bacteria 1147
171 Ga0075369_10008069 3300006186 Bacteria 4037
172 Ga0097621_100028126 3300006237 Bacteria 4429
173 Ga0097621_100073376 3300006237 Bacteria 2833
174 Ga0068871_100192239 3300006358 Bacteria 1758
175 Ga0075428_100013229 3300006844 Bacteria 9181
176 Ga0075428_100019167 3300006844 Bacteria 7567
177 Ga0075428_100127004 3300006844 Bacteria 2775
178 Ga0075428_100395764 3300006844 Bacteria 1481
179 Ga0075428_100538251 3300006844 Bacteria 1249
180 Ga0075428_100613417 3300006844 Bacteria 1162
181 Ga0075430_100000172 3300006846 Bacteria 42600
182 Ga0075430_100047945 3300006846 Bacteria 3607
183 Ga0075430_100050293 3300006846 Bacteria 3515
184 Ga0075430_100120536 3300006846 Bacteria 2187
185 Ga0075430_100148082 3300006846 Bacteria 1955
186 Ga0075431_100014192 3300006847 Bacteria 8056
187 Ga0075431_100038656 3300006847 Bacteria 4915
188 Ga0075431_100089627 3300006847 Bacteria 3175
189 Ga0075431_100186681 3300006847 Bacteria 2126
190 Ga0075431_100218855 3300006847 Bacteria 1943
191 Ga0075433_10106479 3300006852 Bacteria 2485
192 Ga0075429_100002268 3300006880 Bacteria 16126
193 Ga0075429_100014921 3300006880 Bacteria 6739
194 Ga0068865_100008010 3300006881 Bacteria 6524
195 Ga0068865_100077216 3300006881 Bacteria 2379
196 Ga0097620_100079742 3300006931 Bacteria 3314
197 Ga0099795_10006768 3300007788 Bacteria 3148
198 Ga0105240_10379487 3300009093 Bacteria 1597
199 Ga0105240_11075148 3300009093 Bacteria 857
200 Ga0111539_10036267 3300009094 Bacteria 5964
201 Ga0111539_10442320 3300009094 Bacteria 1514
202 Ga0111539_10602207 3300009094 Bacteria 1280
203 Ga0105245_10000730 3300009098 Bacteria 29616
204 Ga0105245_10015094 3300009098 Bacteria 6729
205 Ga0105247_10005433 3300009101 Bacteria 8027
206 Ga0105247_10067807 3300009101 Bacteria 2224
207 Ga0105247_10301526 3300009101 Bacteria 1112
208 Ga0114129_10000056 3300009147 Bacteria 99329
209 Ga0114129_10001563 3300009147 Bacteria 31087
210 Ga0114129_10001688 3300009147 Bacteria 30106
211 Ga0114129_10221450 3300009147 Bacteria 2552
212 Ga0114129_10497595 3300009147 Bacteria 1592
213 Ga0114129_10513751 3300009147 Bacteria 1563
214 Ga0114129_10538825 3300009147 Bacteria 1519
215 Ga0114129_10580775 3300009147 Bacteria 1454
216 Ga0114129_10622621 3300009147 Bacteria 1396
217 Ga0105243_10000504 3300009148 Bacteria 39912
218 Ga0105243_10045363 3300009148 Bacteria 3454
219 Ga0105243_10642111 3300009148 Bacteria 1028
220 Ga0105241_10146323 3300009174 Bacteria 1928
221 Ga0105241_10614491 3300009174 Bacteria 983
222 Ga0105242_10000385 3300009176 Bacteria 35131
223 Ga0105242_10388218 3300009176 Bacteria 1299
224 Ga0105248_10185066 3300009177 Bacteria 2347
225 Ga0105248_10523977 3300009177 Bacteria 1336
226 Ga0105237_10848340 3300009545 Bacteria 920
227 Ga0105238_10029759 3300009551 Bacteria 5562
228 Ga0105238_10378008 3300009551 Bacteria 1408
229 Ga0105249_10191833 3300009553 Bacteria 1995
230 Ga0105249_10643001 3300009553 Bacteria 1118
231 Ga0105239_10005637 3300010375 Bacteria 14630
232 Ga0105239_10271523 3300010375 Bacteria 1907
233 Ga0105246_10112244 3300011119 Bacteria 2004
234 Ga0157371_10207633 3300013102 Bacteria 1405
235 Ga0157371_10271609 3300013102 Bacteria 1224
236 Ga0157370_10186250 3300013104 Bacteria 1927
237 Ga0157370_10619493 3300013104 Bacteria 990
238 Ga0157369_10376288 3300013105 Bacteria 1474
239 Ga0157369_10545288 3300013105 Bacteria 1199
240 Ga0157374_10098956 3300013296 Bacteria 2793
241 Ga0157374_10115064 3300013296 Bacteria 2590
242 Ga0157374_10409088 3300013296 Bacteria 1354
243 Ga0157378_10002662 3300013297 Bacteria 15894
244 Ga0157378_10093403 3300013297 Bacteria 2738
245 Ga0163162_10076847 3300013306 Bacteria 3401
246 Ga0163162_10682351 3300013306 Bacteria 1150
247 Ga0157372_10007432 3300013307 Bacteria 11652
248 Ga0157372_10146397 3300013307 Bacteria 2724
249 Ga0157375_10001165 3300013308 Bacteria 22730
250 Ga0157375_10759211 3300013308 Bacteria 1121
251 Ga0157375_10862045 3300013308 Bacteria 1052
252 Ga0163163_10059054 3300014325 Bacteria 3793
253 Ga0163163_10216108 3300014325 Bacteria 1966
254 Ga0163163_10248278 3300014325 Bacteria 1830
255 Ga0163163_10631117 3300014325 Bacteria 1135
256 Ga0163163_10702150 3300014325 Bacteria 1075
257 Ga0163163_10967724 3300014325 Bacteria 914
258 Ga0157380_10000356 3300014326 Bacteria 27415
259 Ga0182008_10089211 3300014497 Bacteria 1519
260 Ga0182008_10100376 3300014497 Bacteria 1430
261 Ga0157377_10061763 3300014745 Bacteria 2142
262 Ga0157379_10017816 3300014968 Bacteria 6257
263 Ga0157379_10059255 3300014968 Bacteria 3423
264 Ga0157379_10147831 3300014968 Bacteria 2119
265 Ga0157379_10428420 3300014968 Bacteria 1219
266 Ga0157376_10022738 3300014969 Bacteria 4894
267 Ga0157376_10378187 3300014969 Bacteria 1363
268 Ga0163161_10000586 3300017792 Bacteria 29129
269 Ga0163161_10166940 3300017792 Bacteria 1681
270 Ga0197907_10709708 3300020069 Bacteria 885
271 Ga0197907_11373820 3300020069 Bacteria 1184
272 Ga0197907_11471116 3300020069 Bacteria 4139
273 Ga0206356_10257786 3300020070 Bacteria 2430
274 Ga0206356_11622265 3300020070 Bacteria 5081
275 Ga0206351_10176129 3300020077 Bacteria 2662
276 Ga0206351_10298870 3300020077 Bacteria 1279
277 Ga0206351_10870924 3300020077 Bacteria 2055
278 Ga0206352_11097006 3300020078 Bacteria 1918
279 Ga0206350_10404111 3300020080 Bacteria 1323
280 Ga0206354_10154531 3300020081 Bacteria 1308
281 Ga0206354_10713285 3300020081 Bacteria 2823
282 Ga0206353_11062360 3300020082 Bacteria 1636
283 Ga0154015_1193276 3300020610 Bacteria 1145
284 Ga0154015_1446516 3300020610 Bacteria 2103
285 Ga0213873_10000139 3300021358 Bacteria 13843
286 Ga0213875_10012490 3300021388 Bacteria 4193
287 Ga0207672_1003656 3300025223 Bacteria 879
288 Ga0207653_10037313 3300025885 Bacteria 1585
289 Ga0207682_10138289 3300025893 Bacteria 1091
290 Ga0207692_10001360 3300025898 Bacteria 9128
291 Ga0207692_10140779 3300025898 Bacteria 1372
292 Ga0207642_10000335 3300025899 Bacteria 14091
293 Ga0207642_10117844 3300025899 Bacteria 1364
294 Ga0207710_10001367 3300025900 Bacteria 12243
295 Ga0207710_10049197 3300025900 Bacteria 1888
296 Ga0207710_10078716 3300025900 Bacteria 1525
297 Ga0207688_10000291 3300025901 Bacteria 22924
298 Ga0207688_10003914 3300025901 Bacteria 8119
299 Ga0207688_10110888 3300025901 Bacteria 1592
300 Ga0207647_10129932 3300025904 Bacteria 1481
301 Ga0207647_10137707 3300025904 Bacteria 1432
302 Ga0207699_10009907 3300025906 Bacteria 4764
303 Ga0207699_10250566 3300025906 Bacteria 1220
304 Ga0207699_10483297 3300025906 Bacteria 892
305 Ga0207645_10095524 3300025907 Bacteria 1914
306 Ga0207645_10185565 3300025907 Bacteria 1365
307 Ga0207705_10004958 3300025909 Bacteria 9994
308 Ga0207684_10003863 3300025910 Bacteria 14398
309 Ga0207684_10010500 3300025910 Bacteria 8148
310 Ga0207684_10028204 3300025910 Bacteria 4782
311 Ga0207707_10004458 3300025912 Bacteria 12330
312 Ga0207695_10349510 3300025913 Bacteria 1366
313 Ga0207693_10000049 3300025915 Bacteria 100347
314 Ga0207693_10036232 3300025915 Bacteria 3888
315 Ga0207693_10083768 3300025915 Bacteria 2498
316 Ga0207663_10001607 3300025916 Bacteria 10627
317 Ga0207663_10028741 3300025916 Bacteria 3258
318 Ga0207660_10000423 3300025917 Bacteria 27874
319 Ga0207660_10592632 3300025917 Bacteria 903
320 Ga0207657_10055510 3300025919 Bacteria 3421
321 Ga0207657_10438006 3300025919 Bacteria 1026
322 Ga0207652_10000455 3300025921 Bacteria 42150
323 Ga0207652_10108368 3300025921 Bacteria 2461
324 Ga0207652_10128226 3300025921 Bacteria 2261
325 Ga0207646_10002655 3300025922 Bacteria 20967
326 Ga0207646_10006235 3300025922 Bacteria 12393
327 Ga0207646_10009832 3300025922 Bacteria 9417
328 Ga0207646_10070412 3300025922 Bacteria 3123
329 Ga0207646_10131225 3300025922 Bacteria 2255
330 Ga0207681_10028903 3300025923 Bacteria 3595
331 Ga0207681_10237597 3300025923 Bacteria 1417
332 Ga0207694_10294048 3300025924 Bacteria 1336
333 Ga0207659_10003058 3300025926 Bacteria 9988
334 Ga0207687_10000816 3300025927 Bacteria 21046
335 Ga0207687_10009213 3300025927 Bacteria 6459
336 Ga0207687_10341466 3300025927 Bacteria 1218
337 Ga0207700_10004366 3300025928 Bacteria 8327
338 Ga0207700_10008373 3300025928 Bacteria 6403
339 Ga0207700_10091515 3300025928 Bacteria 2403
340 Ga0207664_10005215 3300025929 Bacteria 8862
341 Ga0207664_10210072 3300025929 Bacteria 1684
342 Ga0207644_10003347 3300025931 Bacteria 10340
343 Ga0207644_10093464 3300025931 Bacteria 2245
344 Ga0207690_10013887 3300025932 Bacteria 4851
345 Ga0207690_10127818 3300025932 Bacteria 1855
346 Ga0207706_10408708 3300025933 Bacteria 1176
347 Ga0207686_10001914 3300025934 Bacteria 11525
348 Ga0207709_10005434 3300025935 Bacteria 7241
349 Ga0207709_10075520 3300025935 Bacteria 2154
350 Ga0207670_10117163 3300025936 Bacteria 1930
351 Ga0207669_10013219 3300025937 Bacteria 4091
352 Ga0207704_10002624 3300025938 Bacteria 8114
353 Ga0207704_10517492 3300025938 Bacteria 964
354 Ga0207665_10133356 3300025939 Bacteria 1765
355 Ga0207665_10135293 3300025939 Bacteria 1753
356 Ga0207691_10103158 3300025940 Bacteria 2543
357 Ga0207711_10320778 3300025941 Bacteria 1432
358 Ga0207689_10023976 3300025942 Bacteria 5119
359 Ga0207689_10156631 3300025942 Bacteria 1878
360 Ga0207689_10178243 3300025942 Bacteria 1753
361 Ga0207689_10403599 3300025942 Bacteria 1139
362 Ga0207661_10071480 3300025944 Bacteria 2836
363 Ga0207661_10575537 3300025944 Bacteria 1033
364 Ga0207679_10016844 3300025945 Bacteria 4859
365 Ga0207667_10310958 3300025949 Bacteria 1609
366 Ga0207712_10015701 3300025961 Bacteria 4890
367 Ga0207712_10068331 3300025961 Bacteria 2546
368 Ga0207712_10476725 3300025961 Bacteria 1063
369 Ga0207668_10006205 3300025972 Bacteria 7057
370 Ga0207668_10019285 3300025972 Bacteria 4309
371 Ga0207668_10134358 3300025972 Bacteria 1893
372 Ga0207640_10003447 3300025981 Bacteria 8518
373 Ga0207640_10024210 3300025981 Bacteria 3660
374 Ga0207658_10068535 3300025986 Bacteria 2677
375 Ga0207677_10000712 3300026023 Bacteria 19642
376 Ga0207677_10157675 3300026023 Bacteria 1760
377 Ga0207677_10451463 3300026023 Bacteria 1102
378 Ga0207703_10013902 3300026035 Bacteria 6274
379 Ga0207703_10040056 3300026035 Bacteria 3748
380 Ga0207703_10096432 3300026035 Bacteria 2497
381 Ga0207703_10165043 3300026035 Bacteria 1942
382 Ga0207703_10299283 3300026035 Bacteria 1466
383 Ga0207639_10105653 3300026041 Bacteria 2285
384 Ga0207639_10305274 3300026041 Bacteria 1408
385 Ga0207639_10767491 3300026041 Bacteria 897
386 Ga0207678_10034977 3300026067 Bacteria 4375
387 Ga0207678_10059971 3300026067 Bacteria 3273
388 Ga0207678_10061476 3300026067 Bacteria 3230
389 Ga0207678_10098509 3300026067 Bacteria 2498
390 Ga0207708_10000079 3300026075 Bacteria 75645
391 Ga0207708_10033556 3300026075 Bacteria 3900
392 Ga0207708_10150223 3300026075 Bacteria 1833
393 Ga0207702_10001934 3300026078 Bacteria 20217
394 Ga0207702_10162441 3300026078 Bacteria 2041
395 Ga0207641_10006415 3300026088 Bacteria 9912
396 Ga0207641_10058708 3300026088 Bacteria 3275
397 Ga0207641_10075809 3300026088 Bacteria 2905
398 Ga0207641_10102256 3300026088 Bacteria 2526
399 Ga0207641_10108139 3300026088 Bacteria 2461
400 Ga0207648_10044760 3300026089 Bacteria 3884
401 Ga0207648_10201213 3300026089 Bacteria 1766
402 Ga0207676_10013384 3300026095 Bacteria 5893
403 Ga0207676_10107617 3300026095 Bacteria 2326
404 Ga0207676_10304444 3300026095 Bacteria 1456
405 Ga0207676_10655529 3300026095 Bacteria 1013
406 Ga0207674_10045352 3300026116 Bacteria 4522
407 Ga0207674_10103805 3300026116 Bacteria 2821
408 Ga0207674_10150999 3300026116 Bacteria 2280
409 Ga0207674_10312621 3300026116 Bacteria 1520
410 Ga0207675_100050918 3300026118 Bacteria 3865
411 Ga0207675_100117416 3300026118 Bacteria 2515
412 Ga0207675_100470919 3300026118 Bacteria 1247
413 Ga0207683_10000184 3300026121 Bacteria 53332
414 Ga0207683_10182028 3300026121 Bacteria 1905
415 Ga0207683_10228693 3300026121 Bacteria 1696
416 Ga0207698_10204557 3300026142 Bacteria 1771
417 Ga0209179_1045169 3300027512 Bacteria 934
418 Ga0268266_10006671 3300028379 Bacteria 10533
419 Ga0268266_10009625 3300028379 Bacteria 8499
420 Ga0268266_10061251 3300028379 Bacteria 3245
421 Ga0268266_10084119 3300028379 Bacteria 2778
422 Ga0268266_10605798 3300028379 Bacteria 1052
423 Ga0268265_10017563 3300028380 Bacteria 4940
424 Ga0268265_10209497 3300028380 Bacteria 1697
425 Ga0268265_10806604 3300028380 Bacteria 915
426 Ga0268264_10004268 3300028381 Bacteria 12200
427 Ga0268264_10016350 3300028381 Bacteria 6076
428 Ga0268264_10118601 3300028381 Bacteria 2329
429 Ga0268264_10174511 3300028381 Bacteria 1947
430 Ga0265336_10012827 3300028666 Bacteria 2809
431 Ga0307517_10031743 3300028786 Bacteria 6135
432 Ga0307515_10000045 3300028794 Bacteria 301029
433 Ga0307515_10020864 3300028794 Bacteria 11649
434 Ga0307515_10044616 3300028794 Bacteria 6842
435 Ga0307515_10075426 3300028794 Bacteria 4493
436 Ga0265338_10002382 3300028800 Bacteria 28317
437 Ga0265338_10015126 3300028800 Bacteria 8512
438 Ga0307511_10001243 3300030521 Bacteria 26957
439 Ga0307512_10046936 3300030522 Bacteria 3517
440 Ga0265760_10057539 3300031090 Bacteria 1177
441 Ga0307513_10041669 3300031456 Bacteria 5064
442 Ga0307513_10071510 3300031456 Bacteria 3620
443 Ga0307513_10313798 3300031456 Bacteria 1329
444 Ga0307509_10023422 3300031507 Bacteria 6934
445 Ga0307509_10207234 3300031507 Bacteria 1790
446 Ga0307408_100159898 3300031548 Bacteria 1788
447 Ga0307408_100182411 3300031548 Bacteria 1684
448 Ga0307508_10001989 3300031616 Bacteria 22344
449 Ga0307508_10031993 3300031616 Bacteria 4753
450 Ga0307508_10037965 3300031616 Bacteria 4331
451 Ga0307508_10093582 3300031616 Bacteria 2595
452 Ga0307516_10010141 3300031730 Bacteria 10402
453 Ga0307405_10070252 3300031731 Bacteria 2248
454 Ga0307405_10120831 3300031731 Bacteria 1792
455 Ga0307405_10190124 3300031731 Bacteria 1482
456 Ga0307405_10216688 3300031731 Bacteria 1402
457 Ga0307405_10224596 3300031731 Bacteria 1380
458 Ga0307405_10374818 3300031731 Bacteria 1106
459 Ga0307413_10526141 3300031824 Bacteria 954
460 Ga0307518_10000118 3300031838 Bacteria 55183
461 Ga0307410_10009217 3300031852 Bacteria 5524
462 Ga0307410_10053139 3300031852 Bacteria 2740
463 Ga0307410_10311146 3300031852 Bacteria 1246
464 Ga0307410_10334407 3300031852 Bacteria 1205
465 Ga0326468_10000222 3300031889 Bacteria 5912
466 Ga0307406_10001830 3300031901 Bacteria 11592
467 Ga0307406_10227162 3300031901 Bacteria 1391
468 Ga0307406_10261557 3300031901 Bacteria 1309
469 Ga0307407_10192437 3300031903 Bacteria 1361
470 Ga0307412_10119184 3300031911 Bacteria 1897
471 Ga0307412_10174559 3300031911 Bacteria 1610
472 Ga0307412_10186772 3300031911 Bacteria 1564
473 Ga0307409_100000896 3300031995 Bacteria 13804
474 Ga0307409_100019676 3300031995 Bacteria 4579
475 Ga0307409_100118093 3300031995 Bacteria 2239
476 Ga0307409_100158234 3300031995 Bacteria 1977
477 Ga0307409_100245639 3300031995 Bacteria 1633
478 Ga0307409_100333387 3300031995 Bacteria 1424
479 Ga0307409_100342483 3300031995 Bacteria 1407
480 Ga0307409_100483541 3300031995 Bacteria 1202
481 Ga0307409_100540004 3300031995 Bacteria 1143
482 Ga0307409_100686408 3300031995 Bacteria 1022
483 Ga0307416_100016607 3300032002 Bacteria 5123
484 Ga0307416_100142447 3300032002 Bacteria 2181
485 Ga0307416_100195942 3300032002 Bacteria 1911
486 Ga0307416_100201766 3300032002 Bacteria 1888
487 Ga0307416_100253221 3300032002 Bacteria 1715
488 Ga0307416_100325308 3300032002 Bacteria 1542
489 Ga0307414_10045159 3300032004 Bacteria 3015
490 Ga0307414_10530623 3300032004 Bacteria 1046
491 Ga0307415_100021582 3300032126 Bacteria 3961
492 Ga0307415_100022896 3300032126 Bacteria 3866
493 Ga0307415_100076360 3300032126 Bacteria 2375
494 Ga0307415_100272213 3300032126 Bacteria 1388
495 Ga0307415_100346009 3300032126 Bacteria 1249
496 Ga0307415_100651488 3300032126 Bacteria 944
497 Ga0307507_10023912 3300033179 Bacteria 6683
498 Ga0307510_10156592 3300033180 Bacteria 1884
499 Ga0373938_0031597 3300034957 Bacteria 1136
500 Ga0373926_0000890 3300035083 Bacteria 8568
501 Ga0373926_0033009 3300035083 Bacteria 1828
502 Ga0373940_0006757 3300035088 Bacteria 2562
503 Ga0373923_0008873 3300035111 Bacteria 3607
504 Ga0373936_0049895 3300035113 Bacteria 1691
505 Ga0373941_0050561 3300035115 Bacteria 1320
506 Ga0373953_0011143 3300035117 Bacteria 3147
507 Ga0373954_0074727 3300035118 Bacteria 1613
508 Ga0373957_0011809 3300035120 Bacteria 2925
509 Ga0373960_0055161 3300035121 Bacteria 1190
510 Ga0373943_0061428 3300035170 Bacteria 1878
511 Ga0373946_0079777 3300035171 Bacteria 1430
512 Ga0373955_0013453 3300035172 Bacteria 3959
513 Ga0373942_0000264 3300035207 Bacteria 14026
514 Ga0373924_0047950 3300035410 Bacteria 1763
515 Ga0373931_0077729 3300035691 Bacteria 1824
516 Ga0373935_0001786 3300035692 Bacteria 12101
517 Ga0373935_0003202 3300035692 Bacteria 9448
518 Ga0373947_0000007 3300035725 Bacteria 192259
519 Ga0373937_0055734 3300036401 Bacteria 3629
520 Ga0373937_0176641 3300036401 Bacteria 2005
521 Ga0265778_001357 3300036457 Bacteria 2217
522 Ga0373925_0176117 3300037068 Bacteria 1691
523 Ga0373925_0334926 3300037068 Bacteria 1226
524 Ga0395899_0030023 3300037312 Bacteria 4091
525 Ga0395900_0019286 3300037418 Bacteria 6955
526 Ga0395900_0031488 3300037418 Bacteria 5450
527 Ga0395898_0004336 3300037466 Bacteria 15530
528 Ga0395898_0105664 3300037466 Bacteria 2700
529 Ga0395905_0025917 3300037471 Bacteria 5526
530 Ga0436364_0125897 3300037853 Bacteria 7866
531 Ga0436364_0170612 3300037853 Bacteria 3320
532 Ga0436364_0670690 3300037853 Bacteria 5638
533 Ga0436364_0881245 3300037853 Bacteria 2779
534 Ga0436364_1296832 3300037853 Bacteria 11797
535 Ga0395901_0004226 3300038443 Bacteria 14478
536 Ga0395901_0148323 3300038443 Bacteria 2465
537 Ga0436365_1698725 3300039437 Bacteria 3654
538 Ga0436362_0900593 3300039453 Bacteria 33555
539 Ga0439466_0011337 3300041411 Bacteria 3299
540 Ga0451804_0081067 3300041463 Bacteria 1680
541 Ga0451837_1036194 3300041494 Bacteria 1051
542 Ga0451837_1701327 3300041494 Bacteria 1407
543 Ga0451853_0366154 3300041512 Bacteria 9024
544 Ga0439442_000871 3300042002 Bacteria 6205
545 Ga0439459_0007460 3300042438 Bacteria 1848
546 Ga0451577_0204162 3300042876 Bacteria 1784
547 Ga0466969_0051017 3300044656 Bacteria 2037
548 Ga0466972_0011943 3300044658 Bacteria 4363
549 Ga0466972_0020465 3300044658 Bacteria 3306
550 Ga0466965_0082975 3300044683 Bacteria 1622
551 Ga0466965_0146726 3300044683 Bacteria 1231
552 Ga0466966_0004593 3300044684 Bacteria 9097
553 Ga0466966_0018018 3300044684 Bacteria 4664
554 Ga0466966_0025144 3300044684 Bacteria 3891
555 Ga0466966_0039457 3300044684 Bacteria 3041
556 Ga0466966_0058255 3300044684 Bacteria 2442
557 Ga0466966_0266512 3300044684 Bacteria 1031
558 Ga0466966_0273852 3300044684 Bacteria 1016
559 Ga0466961_0070421 3300044693 Bacteria 2220
560 Ga0466961_0070855 3300044693 Bacteria 2213
561 Ga0466961_0083880 3300044693 Bacteria 2015
562 Ga0466961_0147946 3300044693 Bacteria 1468
563 Ga0466961_0155802 3300044693 Bacteria 1425
564 Ga0466963_0017279 3300044694 Bacteria 4495
565 Ga0466963_0018365 3300044694 Bacteria 4371
566 Ga0466963_0030949 3300044694 Bacteria 3456
567 Ga0466963_0051668 3300044694 Bacteria 2725
568 Ga0466963_0247655 3300044694 Bacteria 1250
569 Ga0466963_0261392 3300044694 Bacteria 1215
570 Ga0466964_0044015 3300044706 Bacteria 1813
571 Ga0466964_0046124 3300044706 Bacteria 1775
572 Ga0466964_0059660 3300044706 Bacteria 1585
573 Ga0466964_0107947 3300044706 Bacteria 1237
574 Ga0466971_0008766 3300044719 Bacteria 4412
575 Ga0466971_0011381 3300044719 Bacteria 3897
576 Ga0466971_0011508 3300044719 Bacteria 3873
577 Ga0466971_0037281 3300044719 Bacteria 2179
578 Ga0466971_0043046 3300044719 Bacteria 2029
579 Ga0466971_0044511 3300044719 Bacteria 1993
580 Ga0466971_0123300 3300044719 Bacteria 1200
581 Ga0466968_0001405 3300044735 Bacteria 8627
582 Ga0466970_0031469 3300044765 Bacteria 2802
583 Ga0466970_0060040 3300044765 Bacteria 2036
584 Ga0466957_0108379 3300044842 Bacteria 1759
585 Ga0466957_0209765 3300044842 Bacteria 1282
586 Ga0466957_0258149 3300044842 Bacteria 1160
587 Ga0466960_0006650 3300044901 Bacteria 4648
588 Ga0466960_0042131 3300044901 Bacteria 2166
589 Ga0466960_0046291 3300044901 Bacteria 2082
590 Ga0466960_0054401 3300044901 Bacteria 1943
591 Ga0466960_0071568 3300044901 Bacteria 1727
592 Ga0466960_0106934 3300044901 Bacteria 1448
593 Ga0466960_0148549 3300044901 Bacteria 1250
594 Ga0466959_0001545 3300045049 Bacteria 14163
595 Ga0466959_0020240 3300045049 Bacteria 4899
596 Ga0466959_0116879 3300045049 Bacteria 1899
597 Ga0466959_0284935 3300045049 Bacteria 1133
598 Ga0466959_0418831 3300045049 Bacteria 909
599 Ga0466959_0455066 3300045049 Bacteria 867
600 Ga0466958_0006216 3300045836 Bacteria 6481
601 Ga0466958_0076215 3300045836 Bacteria 2058
602 Ga0466958_0088779 3300045836 Bacteria 1910
603 Ga0466958_0089794 3300045836 Bacteria 1900
604 Ga0466958_0098827 3300045836 Bacteria 1813
605 Ga0466958_0120689 3300045836 Bacteria 1641
606 Ga0466967_0000157 3300045976 Bacteria 27186
607 Ga0466967_0007460 3300045976 Bacteria 7891
608 Ga0466967_0009661 3300045976 Bacteria 7176
609 Ga0466967_0011058 3300045976 Bacteria 6813
610 Ga0466967_0020903 3300045976 Bacteria 5303
611 Ga0466967_0051461 3300045976 Bacteria 3610
612 Ga0466967_0060861 3300045976 Bacteria 3348
613 Ga0466967_0132829 3300045976 Bacteria 2312
614 Ga0466967_0149197 3300045976 Bacteria 2184
615 Ga0466967_0161062 3300045976 Bacteria 2106
616 Ga0466967_0176053 3300045976 Bacteria 2015
617 Ga0466967_0263849 3300045976 Bacteria 1648
618 Ga0466967_0403737 3300045976 Bacteria 1330
619 Ga0495592_0012558 3300046454 Bacteria 6436
620 Ga0495603_0004397 3300046455 Bacteria 8401
621 Ga0495603_0182245 3300046455 Bacteria 1215
622 Ga0495629_0041148 3300046459 Bacteria 3252
623 Ga0495629_0141310 3300046459 Bacteria 1675
624 Ga0495629_0183981 3300046459 Bacteria 1447
625 Ga0495651_0009568 3300046462 Bacteria 7446
626 Ga0495580_0113823 3300046472 Bacteria 1879
627 Ga0495664_0017094 3300046477 Bacteria 4143
628 Ga0495594_0003426 3300046499 Bacteria 8182
629 Ga0495628_0124496 3300046516 Bacteria 1975
630 Ga0495630_0144676 3300046517 Bacteria 1808
631 Ga0495630_0268476 3300046517 Bacteria 1303
632 Ga0495632_0160106 3300046519 Bacteria 1037
633 Ga0495666_0092176 3300046526 Bacteria 1429
634 Ga0495652_0149229 3300046529 Bacteria 1828
635 Ga0495665_0115513 3300046531 Bacteria 1406
636 Ga0495645_0076536 3300046543 Bacteria 2407
637 Ga0495668_0280021 3300046616 Bacteria 914
638 Ga0495634_0033316 3300046642 Bacteria 3540
639 Ga0495657_0058106 3300046675 Bacteria 2569
640 Ga0495623_0011563 3300046679 Bacteria 5715
641 Ga0495646_0053323 3300046680 Bacteria 2438
642 Ga0495624_0031544 3300046690 Bacteria 3443
643 Ga0495624_0249828 3300046690 Bacteria 1073
644 Ga0495600_0113698 3300046809 Bacteria 1762
645 Ga0495604_0232565 3300047317 Bacteria 1263
646 Ga0495672_0070041 3300047320 Bacteria 1989
647 Ga0495676_0184959 3300047321 Bacteria 1457
648 Ga0495680_0239051 3300047322 Bacteria 1290
649 Ga0495675_0007693 3300047444 Bacteria 6646
650 Ga0495684_0006994 3300047471 Bacteria 8762
651 Ga0495593_0078823 3300047673 Bacteria 1705
652 Ga0495602_0081358 3300048088 Bacteria 2723
653 Ga0496100_0006929 3300048903 Bacteria 6212
654 Ga0496100_0010164 3300048903 Bacteria 5321
655 Ga0496100_0133308 3300048903 Bacteria 1752
656 Ga0496101_0026648 3300048904 Bacteria 4020
657 Ga0496101_0074556 3300048904 Bacteria 2496
658 Ga0496102_0000030 3300048905 Bacteria 221326
659 Ga0496102_0000976 3300048905 Bacteria 26908
660 Ga0496102_0005338 3300048905 Bacteria 10909
661 Ga0496102_0234873 3300048905 Bacteria 1728
662 Ga0496103_0000068 3300048906 Bacteria 121996
663 Ga0496103_0005142 3300048906 Bacteria 7875
664 Ga0496104_0004070 3300048907 Bacteria 12681
665 Ga0496104_0015707 3300048907 Bacteria 6867
666 Ga0496104_0096351 3300048907 Bacteria 2830
667 Ga0496104_0300003 3300048907 Bacteria 1519
668 Ga0496105_0018374 3300048908 Bacteria 5617
669 Ga0496105_0023416 3300048908 Bacteria 5008
670 Ga0496105_0027387 3300048908 Bacteria 4656
671 Ga0496105_0181950 3300048908 Bacteria 1721
672 Ga0496105_0255820 3300048908 Bacteria 1418
673 Ga0496106_0003384 3300048909 Bacteria 11884
674 Ga0496106_0257548 3300048909 Bacteria 1396
675 Ga0496107_0000383 3300048910 Bacteria 24008
676 Ga0496108_0000111 3300048911 Bacteria 82745
677 Ga0496108_0012767 3300048911 Bacteria 6839
678 Ga0496108_0018306 3300048911 Bacteria 5736
679 Ga0496108_0031658 3300048911 Bacteria 4390
680 Ga0496108_0034906 3300048911 Bacteria 4179
681 Ga0496108_0049489 3300048911 Bacteria 3515
682 Ga0496108_0332328 3300048911 Bacteria 1325
683 Ga0496108_0348777 3300048911 Bacteria 1292
684 Ga0496109_0025238 3300048912 Bacteria 5294
685 Ga0496109_0045242 3300048912 Bacteria 3993
686 Ga0496109_0353309 3300048912 Bacteria 1388
687 Ga0496109_0486518 3300048912 Bacteria 1165
688 Ga0496110_0045802 3300048913 Bacteria 3824
689 Ga0496110_0245050 3300048913 Bacteria 1631
690 Ga0496111_0047756 3300048914 Bacteria 3083
691 Ga0496111_0081553 3300048914 Bacteria 2361
692 Ga0496111_0203221 3300048914 Bacteria 1472
693 Ga0496112_0026180 3300048915 Bacteria 5609
694 Ga0496112_0310705 3300048915 Bacteria 1521
695 Ga0496112_0350995 3300048915 Bacteria 1417
696 Ga0496113_0104993 3300048916 Bacteria 2193
697 Ga0496113_0168939 3300048916 Bacteria 1732
698 Ga0496113_0340373 3300048916 Bacteria 1203
699 Ga0496114_0002030 3300048917 Bacteria 15418
700 Ga0496114_0411070 3300048917 Bacteria 1198
701 Ga0496115_0004444 3300048918 Bacteria 10165
702 Ga0496115_0186268 3300048918 Bacteria 1715
703 Ga0496116_0000152 3300048919 Bacteria 141311
704 Ga0496117_0000059 3300048920 Bacteria 260163
705 Ga0496118_0000061 3300048921 Bacteria 220889
706 Ga0496118_0203369 3300048921 Bacteria 1170
707 Ga0496119_0001310 3300048922 Bacteria 30642
708 Ga0496120_0022502 3300048923 Bacteria 3964
709 Ga0496121_0047196 3300048924 Bacteria 3678
710 Ga0496121_0058209 3300048924 Bacteria 3196
711 Ga0496124_0020330 3300048927 Bacteria 6140
712 Ga0496125_0034873 3300048928 Bacteria 4426
713 Ga0496126_0000213 3300048929 Bacteria 128366
714 Ga0496126_0021483 3300048929 Bacteria 6303
715 Ga0501318_004057 3300049534 Bacteria 1384
716 Ga0501318_015052 3300049534 Bacteria 920
717 Ga0501321_008874 3300049537 Bacteria 1075
718 Ga0501031_0340208 3300049568 Bacteria 971
719 Ga0501032_0047866 3300049569 Bacteria 2887
720 Ga0501034_0440837 3300049571 Bacteria 1221
721 Ga0501034_0517336 3300049571 Bacteria 1106
722 Ga0501036_0400352 3300049572 Bacteria 1145
723 Ga0501037_0190213 3300049573 Bacteria 1453
724 Ga0501038_0039540 3300049574 Bacteria 4125
725 Ga0501038_0394583 3300049574 Bacteria 1071
726 Ga0501039_0436604 3300049575 Bacteria 1028
727 Ga0501042_0132542 3300049578 Bacteria 1796
728 Ga0501042_0362305 3300049578 Bacteria 1049
729 Ga0501043_0562824 3300049579 Bacteria 846
730 Ga0501046_0179994 3300049580 Bacteria 1581
731 Ga0501047_0033318 3300049581 Bacteria 4972
732 Ga0501047_0223391 3300049581 Bacteria 1739
733 Ga0501047_0579287 3300049581 Bacteria 945
734 Ga0501069_0012874 3300049585 Bacteria 4454
735 Ga0501072_0511399 3300049588 Bacteria 950
736 Ga0501074_0033213 3300049590 Bacteria 3739
737 Ga0501035_0241627 3300049822 Bacteria 1536
738 Ga0501044_0027569 3300049823 Bacteria 6001
739 Ga0501044_0059542 3300049823 Bacteria 3912
740 Ga0501044_0282723 3300049823 Bacteria 1592
741 nmdc:mga00v17_2707_c1 3300050491 Bacteria 9094
742 nmdc:mga00v17_31527_c1 3300050491 Bacteria 3127
743 nmdc:mga06z11_111245_c1 3300050494 Bacteria 1517
744 nmdc:mga07m45_58622_c1 3300050496 Bacteria 2178
745 nmdc:mga05p37_106_c2 3300050507 Bacteria 31952
746 nmdc:mga05p37_119483_c1 3300050507 Bacteria 3238
747 nmdc:mga05p37_374844_c1 3300050507 Bacteria 1669
748 nmdc:mga05p37_466289_c1 3300050507 Bacteria 1458
749 nmdc:mga05p37_500100_c1 3300050507 Bacteria 1395
750 nmdc:mga05p37_720_c1 3300050507 Bacteria 36593
751 nmdc:mga05p37_8792_c1 3300050507 Bacteria 11934
752 nmdc:mga09592_17727_c1 3300050508 Bacteria 5836
753 nmdc:mga09592_283_c1 3300050508 Bacteria 37042
754 nmdc:mga09592_73481_c1 3300050508 Bacteria 2905
755 nmdc:mga0qj67_18091_c1 3300050509 Bacteria 5369
756 nmdc:mga0qj67_6_c1 3300050509 Bacteria 17977
757 nmdc:mga0qj67_99093_c1 3300050509 Bacteria 2348
758 nmdc:mga0qj67_992_c1 3300050509 Bacteria 19574
759 nmdc:mga06r32_101443_c1 3300050510 Bacteria 2825
760 nmdc:mga06r32_111486_c1 3300050510 Bacteria 2692
761 nmdc:mga06r32_1181_c1 3300050510 Bacteria 23551
762 nmdc:mga06r32_7649_c1 3300050510 Bacteria 9717
763 nmdc:mga08y16_13716_c1 3300050511 Bacteria 8532
764 nmdc:mga08y16_229632_c1 3300050511 Bacteria 1919
765 nmdc:mga08y16_449371_c1 3300050511 Bacteria 1314
766 nmdc:mga0n895_132741_c1 3300050512 Bacteria 2516
767 nmdc:mga0a205_391613_c1 3300050515 Bacteria 1254
768 nmdc:mga0sz30_13101_c1 3300050516 Bacteria 3240
769 nmdc:mga0sz30_34826_c1 3300050516 Bacteria 2099
770 Ga0495601_0158548 3300053077 Bacteria 1478
771 Ga0495612_0025403 3300053078 Bacteria 2378
772 Ga0495595_0003839 3300053084 Bacteria 5989
773 Ga0500644_0029016 3300053088 Bacteria 1736
774 Ga0500583_0046072 3300053092 Bacteria 2005
775 Ga0500641_0017733 3300053096 Bacteria 2668
776 Ga0500660_020708 3300053100 Bacteria 3505
777 Ga0500569_017482 3300053109 Bacteria 1834
778 Ga0500652_047283 3300053131 Bacteria 1748
779 Ga0500568_0003911 3300053139 Bacteria 8106
780 Ga0500588_0002726 3300053146 Bacteria 3635
781 Ga0500600_0066452 3300053149 Bacteria 1991
782 Ga0500630_080537 3300053159 Bacteria 1524
783 Ga0500633_0130479 3300053160 Bacteria 938
784 Ga0466962_0017907 3300061719 Bacteria 3409
785 Ga0466962_0038075 3300061719 Bacteria 2303
786 Ga0466962_0052483 3300061719 Bacteria 1949
787 Ga0466962_0148837 3300061719 Bacteria 1135

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0579287 Ga0501047_0579287_242_931 211
2 3300009147 Ga0114129_10513751 Ga0114129_105137512 222
3 3300025942 Ga0207689_10403599 Ga0207689_104035992 225
4 3300005468 Ga0070707_100115330 Ga0070707_1001153302 227
5 3300005518 Ga0070699_100067973 Ga0070699_1000679732 227
6 3300025922 Ga0207646_10070412 Ga0207646_100704123 227
7 iso_pu_bacteria 8003830390 8003831193 228
8 3300028800 Ga0265338_10015126 Ga0265338_100151262 229
9 3300042876 Ga0451577_0204162 Ga0451577_0204162_567_1322 229
10 3300005445 Ga0070708_100055287 Ga0070708_1000552873 230
11 3300005467 Ga0070706_100027827 Ga0070706_1000278271 230
12 3300005467 Ga0070706_100144106 Ga0070706_1001441062 230
13 3300005468 Ga0070707_100000256 Ga0070707_1000002565 230
14 3300005468 Ga0070707_100076895 Ga0070707_1000768952 230
15 3300005471 Ga0070698_100035045 Ga0070698_1000350451 230
16 3300005471 Ga0070698_100046972 Ga0070698_1000469723 230
17 3300006028 Ga0070717_10032743 Ga0070717_100327434 230
18 3300025910 Ga0207684_10003863 Ga0207684_100038639 230
19 3300025910 Ga0207684_10028204 Ga0207684_100282044 230
20 3300025922 Ga0207646_10002655 Ga0207646_100026557 230
21 3300025922 Ga0207646_10009832 Ga0207646_100098324 230
22 3300025929 Ga0207664_10005215 Ga0207664_100052153 230
23 3300031090 Ga0265760_10057539 Ga0265760_100575392 230
24 iso_pu_bacteria 2862507626 2862516603 232
25 3300038443 Ga0395901_0004226 Ga0395901_0004226_11616_12395 233
26 3300013296 Ga0157374_10409088 Ga0157374_104090882 234
27 3300037853 Ga0436364_0670690 Ga0436364_0670690_2566_3354 234
28 3300045976 Ga0466967_0000157 Ga0466967_0000157_4627_5409 234
29 3300006175 Ga0070712_100390913 Ga0070712_1003909132 235
30 3300048911 Ga0496108_0332328 Ga0496108_0332328_36_815 235
31 3300048912 Ga0496109_0025238 Ga0496109_0025238_1450_2229 235
32 3300009147 Ga0114129_10538825 Ga0114129_105388251 236
33 3300025944 Ga0207661_10575537 Ga0207661_105755371 236
34 3300036401 Ga0373937_0176641 Ga0373937_0176641_1036_1812 236
35 3300044735 Ga0466968_0001405 Ga0466968_0001405_1032_1814 236
36 3300046455 Ga0495603_0004397 Ga0495603_0004397_460_1221 236
37 3300001990 JGI24737J22298_10052087 JGI24737J22298_100520871 237
38 3300005327 Ga0070658_10036125 Ga0070658_100361254 237
39 3300005530 Ga0070679_100202088 Ga0070679_1002020882 237
40 3300005535 Ga0070684_100241988 Ga0070684_1002419882 237
41 3300009093 Ga0105240_11075148 Ga0105240_110751481 237
42 3300020069 Ga0197907_10709708 Ga0197907_107097081 237
43 3300020070 Ga0206356_10257786 Ga0206356_102577863 237
44 3300020081 Ga0206354_10154531 Ga0206354_101545312 237
45 3300025904 Ga0207647_10129932 Ga0207647_101299322 237
46 3300025904 Ga0207647_10137707 Ga0207647_101377072 237
47 3300025921 Ga0207652_10128226 Ga0207652_101282262 237
48 3300025944 Ga0207661_10071480 Ga0207661_100714803 237
49 3300038443 Ga0395901_0148323 Ga0395901_0148323_576_1418 237
50 3300044706 Ga0466964_0044015 Ga0466964_0044015_80_859 237
51 3300044901 Ga0466960_0106934 Ga0466960_0106934_573_1352 237
52 3300045836 Ga0466958_0089794 Ga0466958_0089794_607_1386 237
53 3300045976 Ga0466967_0011058 Ga0466967_0011058_5694_6473 237
54 3300045976 Ga0466967_0132829 Ga0466967_0132829_769_1548 237
55 3300005530 Ga0070679_100078349 Ga0070679_1000783493 238
56 3300013104 Ga0157370_10619493 Ga0157370_106194932 238
57 3300020077 Ga0206351_10870924 Ga0206351_108709243 238
58 3300020080 Ga0206350_10404111 Ga0206350_104041111 238
59 3300020082 Ga0206353_11062360 Ga0206353_110623602 238
60 3300020610 Ga0154015_1193276 Ga0154015_11932762 238
61 3300025921 Ga0207652_10108368 Ga0207652_101083682 238
62 3300032126 Ga0307415_100651488 Ga0307415_1006514882 238
63 3300044658 Ga0466972_0020465 Ga0466972_0020465_284_1063 238
64 3300044694 Ga0466963_0018365 Ga0466963_0018365_398_1177 238
65 3300044706 Ga0466964_0046124 Ga0466964_0046124_102_881 238
66 3300044719 Ga0466971_0008766 Ga0466971_0008766_272_1051 238
67 3300044901 Ga0466960_0148549 Ga0466960_0148549_319_1098 238
68 3300045976 Ga0466967_0020903 Ga0466967_0020903_255_1052 238
69 3300049588 Ga0501072_0511399 Ga0501072_0511399_124_903 238
70 3300049823 Ga0501044_0282723 Ga0501044_0282723_478_1257 238
71 3300061719 Ga0466962_0148837 Ga0466962_0148837_165_944 238
72 3300005614 Ga0068856_100259297 Ga0068856_1002592972 239
73 3300005618 Ga0068864_100350926 Ga0068864_1003509262 239
74 3300014968 Ga0157379_10428420 Ga0157379_104284202 239
75 3300026095 Ga0207676_10655529 Ga0207676_106555291 239
76 3300045836 Ga0466958_0098827 Ga0466958_0098827_62_841 239
77 3300046690 Ga0495624_0249828 Ga0495624_0249828_46_825 239
78 3300050511 nmdc:mga08y16_449371_c1 nmdc:mga08y16_449371_c1_507_1277 239
79 iso_pu_bacteria 2675903059 2676480843 239
80 iso_pu_bacteria 2816332139 2816505041 239
81 iso_pu_bacteria 2816332139 2816507091 239
82 3300031548 Ga0307408_100182411 Ga0307408_1001824112 240
83 3300031731 Ga0307405_10224596 Ga0307405_102245962 240
84 3300031838 Ga0307518_10000118 Ga0307518_1000011820 240
85 3300032126 Ga0307415_100346009 Ga0307415_1003460092 240
86 iso_pu_bacteria 2515154088 2515496124 240
87 iso_pu_bacteria 2515154129 2515719894 240
88 iso_pu_bacteria 2515154137 2515758431 240
89 iso_pu_bacteria 2515154202 2516082443 240
90 iso_pu_bacteria 2515154203 2516090388 240
91 iso_pu_bacteria 2558860112 2558910766 240
92 iso_pu_bacteria 2558860280 2559429469 240
93 iso_pu_bacteria 2622736605 2623501224 240
94 iso_pu_bacteria 2622736626 2623587109 240
95 iso_pu_bacteria 2622736626 2623588246 240
96 iso_pu_bacteria 2751185782 2753264849 240
97 iso_pu_bacteria 2772190715 2772642507 240
98 iso_pu_bacteria 2775506925 2776370061 240
99 iso_pu_bacteria 2831935698 2831937754 240
100 iso_pu_bacteria 2832004796 2832007437 240
101 iso_pu_bacteria 2855670206 2855671195 240
102 iso_pu_bacteria 2855676851 2855682395 240
103 iso_pu_bacteria 2855683550 2855689574 240
104 iso_pu_bacteria 2856858025 2856860922 240
105 iso_pu_bacteria 2857288857 2857295528 240
106 iso_pu_bacteria 2858848962 2858850681 240
107 iso_pu_bacteria 2858868258 2858874568 240
108 iso_pu_bacteria 2858882152 2858883948 240
109 iso_pu_bacteria 2858888857 2858889901 240
110 iso_pu_bacteria 2858895516 2858900752 240
111 iso_pu_bacteria 2858902515 2858903638 240
112 iso_pu_bacteria 2863067949 2863072918 240
113 iso_pu_bacteria 2866065130 2866067453 240
114 iso_pu_bacteria 2867302475 2867304984 240
115 iso_pu_bacteria 2867312974 2867315764 240
116 iso_pu_bacteria 2867319477 2867323770 240
117 iso_pu_bacteria 2869048445 2869050866 240
118 iso_pu_bacteria 2869061728 2869068169 240
119 iso_pu_bacteria 2869068681 2869071356 240
120 iso_pu_bacteria 2880489317 2880493191 240
121 iso_pu_bacteria 2880495981 2880499119 240
122 iso_pu_bacteria 2884693830 2884702614 240
123 iso_pu_bacteria 2895427314 2895429397 240
124 iso_pu_bacteria 2895442618 2895452114 240
125 iso_pu_bacteria 2902582711 2902587130 240
126 iso_pu_bacteria 2915358134 2915362932 240
127 iso_pu_bacteria 2929219909 2929221114 240
128 iso_pu_bacteria 2929226422 2929227707 240
129 iso_pu_bacteria 2996221748 2996222654 240
130 iso_pu_bacteria 3002998708 3002999884 240
131 iso_pu_bacteria 649633069 649811674 240
132 iso_pu_bacteria 8003856774 8003863880 240
133 iso_pu_bacteria 8003870546 8003876045 240
134 iso_pu_bacteria 8053945823 8053946644 240
135 iso_pu_bacteria 8054472261 8054476772 240
136 iso_pu_bacteria 8054704163 8054705120 240
137 iso_pu_bacteria 8054727385 8054730726 240
138 iso_pu_bacteria 8054734606 8054736344 240
139 iso_pu_bacteria 8055066027 8055072846 240
140 iso_pu_bacteria 8055172936 8055173044 240
141 iso_pu_bacteria 8055412473 8055418296 240
142 3300006051 Ga0075364_10244467 Ga0075364_102444672 241
143 3300026121 Ga0207683_10182028 Ga0207683_101820282 241
144 3300049823 Ga0501044_0027569 Ga0501044_0027569_4361_5134 241
145 iso_pu_bacteria 2523231044 2523386673 241
146 iso_pu_bacteria 2551306166 2552109708 241
147 iso_pu_bacteria 2585427649 2586058962 241
148 iso_pu_bacteria 2751185725 2753038392 241
149 iso_pu_bacteria 2751185792 2753326903 241
150 iso_pu_bacteria 2795385472 2795794263 241
151 iso_pu_bacteria 2808606522 2809592286 241
152 iso_pu_bacteria 2915768154 2915772917 241
153 iso_pu_bacteria 2932398195 2932399380 241
154 iso_pu_bacteria 2956939328 2956939348 241
155 iso_pu_bacteria 3001119090 3001122140 241
156 3300005330 Ga0070690_100160073 Ga0070690_1001600732 242
157 3300005334 Ga0068869_100001538 Ga0068869_10000153813 242
158 3300005338 Ga0068868_100086561 Ga0068868_1000865611 242
159 3300005345 Ga0070692_10010017 Ga0070692_100100172 242
160 3300005347 Ga0070668_100172447 Ga0070668_1001724472 242
161 3300005354 Ga0070675_100006710 Ga0070675_1000067105 242
162 3300005366 Ga0070659_100082176 Ga0070659_1000821762 242
163 3300005441 Ga0070700_100572294 Ga0070700_1005722941 242
164 3300005455 Ga0070663_100097814 Ga0070663_1000978143 242
165 3300005456 Ga0070678_100174495 Ga0070678_1001744952 242
166 3300005457 Ga0070662_100028424 Ga0070662_1000284245 242
167 3300005535 Ga0070684_100138184 Ga0070684_1001381844 242
168 3300005547 Ga0070693_100100901 Ga0070693_1001009013 242
169 3300005564 Ga0070664_100005365 Ga0070664_10000536510 242
170 3300005577 Ga0068857_100127700 Ga0068857_1001277002 242
171 3300005577 Ga0068857_100285451 Ga0068857_1002854512 242
172 3300005618 Ga0068864_100234324 Ga0068864_1002343242 242
173 3300005843 Ga0068860_100270666 Ga0068860_1002706662 242
174 3300005937 Ga0081455_10004297 Ga0081455_100042975 242
175 3300006844 Ga0075428_100013229 Ga0075428_10001322910 242
176 3300006844 Ga0075428_100127004 Ga0075428_1001270042 242
177 3300006844 Ga0075428_100395764 Ga0075428_1003957642 242
178 3300006844 Ga0075428_100613417 Ga0075428_1006134171 242
179 3300006846 Ga0075430_100047945 Ga0075430_1000479452 242
180 3300006846 Ga0075430_100050293 Ga0075430_1000502933 242
181 3300006846 Ga0075430_100120536 Ga0075430_1001205362 242
182 3300006846 Ga0075430_100148082 Ga0075430_1001480821 242
183 3300006847 Ga0075431_100014192 Ga0075431_1000141923 242
184 3300006847 Ga0075431_100186681 Ga0075431_1001866812 242
185 3300006880 Ga0075429_100002268 Ga0075429_1000022686 242
186 3300009094 Ga0111539_10036267 Ga0111539_100362675 242
187 3300009098 Ga0105245_10015094 Ga0105245_100150945 242
188 3300009147 Ga0114129_10000056 Ga0114129_1000005674 242
189 3300009147 Ga0114129_10001563 Ga0114129_1000156310 242
190 3300009147 Ga0114129_10001688 Ga0114129_1000168820 242
191 3300009147 Ga0114129_10580775 Ga0114129_105807752 242
192 3300009147 Ga0114129_10622621 Ga0114129_106226212 242
193 3300009148 Ga0105243_10045363 Ga0105243_100453634 242
194 3300009177 Ga0105248_10185066 Ga0105248_101850662 242
195 3300010375 Ga0105239_10271523 Ga0105239_102715233 242
196 3300013102 Ga0157371_10207633 Ga0157371_102076332 242
197 3300013308 Ga0157375_10759211 Ga0157375_107592111 242
198 3300025901 Ga0207688_10110888 Ga0207688_101108882 242
199 3300025926 Ga0207659_10003058 Ga0207659_100030583 242
200 3300025927 Ga0207687_10009213 Ga0207687_100092133 242
201 3300025932 Ga0207690_10013887 Ga0207690_100138875 242
202 3300025935 Ga0207709_10075520 Ga0207709_100755202 242
203 3300025942 Ga0207689_10023976 Ga0207689_100239765 242
204 3300025945 Ga0207679_10016844 Ga0207679_100168445 242
205 3300026023 Ga0207677_10157675 Ga0207677_101576752 242
206 3300026067 Ga0207678_10034977 Ga0207678_100349774 242
207 3300026067 Ga0207678_10061476 Ga0207678_100614763 242
208 3300026095 Ga0207676_10107617 Ga0207676_101076173 242
209 3300026116 Ga0207674_10312621 Ga0207674_103126212 242
210 3300028381 Ga0268264_10118601 Ga0268264_101186011 242
211 3300031548 Ga0307408_100159898 Ga0307408_1001598982 242
212 3300031852 Ga0307410_10311146 Ga0307410_103111462 242
213 3300031852 Ga0307410_10334407 Ga0307410_103344072 242
214 3300031901 Ga0307406_10227162 Ga0307406_102271622 242
215 3300031903 Ga0307407_10192437 Ga0307407_101924372 242
216 3300031911 Ga0307412_10174559 Ga0307412_101745592 242
217 3300031995 Ga0307409_100019676 Ga0307409_1000196762 242
218 3300031995 Ga0307409_100342483 Ga0307409_1003424832 242
219 3300032002 Ga0307416_100201766 Ga0307416_1002017662 242
220 3300032002 Ga0307416_100253221 Ga0307416_1002532212 242
221 3300032126 Ga0307415_100021582 Ga0307415_1000215822 242
222 3300037312 Ga0395899_0030023 Ga0395899_0030023_798_1577 242
223 3300037418 Ga0395900_0031488 Ga0395900_0031488_2863_3642 242
224 3300037466 Ga0395898_0004336 Ga0395898_0004336_6609_7388 242
225 3300037471 Ga0395905_0025917 Ga0395905_0025917_2811_3590 242
226 3300044684 Ga0466966_0273852 Ga0466966_0273852_95_877 242
227 3300045976 Ga0466967_0051461 Ga0466967_0051461_1882_2661 242
228 3300046455 Ga0495603_0182245 Ga0495603_0182245_372_1151 242
229 3300047320 Ga0495672_0070041 Ga0495672_0070041_727_1518 242
230 3300048912 Ga0496109_0486518 Ga0496109_0486518_65_844 242
231 3300049571 Ga0501034_0517336 Ga0501034_0517336_226_1005 242
232 3300049578 Ga0501042_0362305 Ga0501042_0362305_211_990 242
233 3300050507 nmdc:mga05p37_106_c2 nmdc:mga05p37_106_c2_11142_11921 242
234 3300050507 nmdc:mga05p37_466289_c1 nmdc:mga05p37_466289_c1_181_960 242
235 3300050507 nmdc:mga05p37_500100_c1 nmdc:mga05p37_500100_c1_57_836 242
236 3300050507 nmdc:mga05p37_720_c1 nmdc:mga05p37_720_c1_17353_18132 242
237 3300050507 nmdc:mga05p37_8792_c1 nmdc:mga05p37_8792_c1_2803_3582 242
238 3300050508 nmdc:mga09592_17727_c1 nmdc:mga09592_17727_c1_4871_5650 242
239 3300050508 nmdc:mga09592_283_c1 nmdc:mga09592_283_c1_20787_21566 242
240 3300050508 nmdc:mga09592_73481_c1 nmdc:mga09592_73481_c1_1750_2529 242
241 3300050509 nmdc:mga0qj67_18091_c1 nmdc:mga0qj67_18091_c1_3201_3980 242
242 3300050509 nmdc:mga0qj67_6_c1 nmdc:mga0qj67_6_c1_16065_16844 242
243 3300050509 nmdc:mga0qj67_99093_c1 nmdc:mga0qj67_99093_c1_706_1485 242
244 3300050510 nmdc:mga06r32_101443_c1 nmdc:mga06r32_101443_c1_23_802 242
245 3300050510 nmdc:mga06r32_7649_c1 nmdc:mga06r32_7649_c1_8059_8838 242
246 3300050511 nmdc:mga08y16_13716_c1 nmdc:mga08y16_13716_c1_3886_4665 242
247 3300053100 Ga0500660_020708 Ga0500660_020708_2521_3300 242
248 3300005548 Ga0070665_100232216 Ga0070665_1002322162 243
249 3300006847 Ga0075431_100038656 Ga0075431_1000386567 243
250 3300025928 Ga0207700_10004366 Ga0207700_100043666 243
251 3300045976 Ga0466967_0060861 Ga0466967_0060861_2040_2816 243
252 3300048911 Ga0496108_0000111 Ga0496108_0000111_49125_49901 243
253 3300048911 Ga0496108_0018306 Ga0496108_0018306_4688_5479 243
254 3300049572 Ga0501036_0400352 Ga0501036_0400352_163_942 243
255 3300050510 nmdc:mga06r32_1181_c1 nmdc:mga06r32_1181_c1_4060_4836 243
256 3300000549 LJQas_1007256 LJQas_10072561 244
257 3300002077 JGI24744J21845_10001881 JGI24744J21845_100018813 244
258 3300002077 JGI24744J21845_10009849 JGI24744J21845_100098492 244
259 3300002244 JGI24742J22300_10001138 JGI24742J22300_100011383 244
260 3300003162 Ga0006778J45830_1043793 Ga0006778J45830_10437931 244
261 3300003203 JGI25406J46586_10007522 JGI25406J46586_100075226 244
262 3300003203 JGI25406J46586_10026569 JGI25406J46586_100265691 244
263 3300003203 JGI25406J46586_10036226 JGI25406J46586_100362262 244
264 3300003203 JGI25406J46586_10046149 JGI25406J46586_100461491 244
265 3300004798 Ga0058859_11209305 Ga0058859_112093051 244
266 3300005328 Ga0070676_10034665 Ga0070676_100346652 244
267 3300005328 Ga0070676_10192469 Ga0070676_101924691 244
268 3300005330 Ga0070690_100010751 Ga0070690_1000107511 244
269 3300005330 Ga0070690_100077738 Ga0070690_1000777382 244
270 3300005333 Ga0070677_10131241 Ga0070677_101312412 244
271 3300005334 Ga0068869_100102748 Ga0068869_1001027482 244
272 3300005334 Ga0068869_100288990 Ga0068869_1002889901 244
273 3300005336 Ga0070680_100005701 Ga0070680_1000057013 244
274 3300005336 Ga0070680_100183315 Ga0070680_1001833152 244
275 3300005337 Ga0070682_100109494 Ga0070682_1001094942 244
276 3300005338 Ga0068868_100002112 Ga0068868_1000021122 244
277 3300005339 Ga0070660_100488367 Ga0070660_1004883671 244
278 3300005340 Ga0070689_100007064 Ga0070689_1000070643 244
279 3300005341 Ga0070691_10044583 Ga0070691_100445831 244
280 3300005341 Ga0070691_10077057 Ga0070691_100770572 244
281 3300005345 Ga0070692_10165194 Ga0070692_101651942 244
282 3300005347 Ga0070668_100010272 Ga0070668_1000102724 244
283 3300005347 Ga0070668_100073553 Ga0070668_1000735533 244
284 3300005347 Ga0070668_100215450 Ga0070668_1002154502 244
285 3300005347 Ga0070668_100534304 Ga0070668_1005343041 244
286 3300005353 Ga0070669_100093801 Ga0070669_1000938012 244
287 3300005355 Ga0070671_100000660 Ga0070671_10000066024 244
288 3300005356 Ga0070674_100145139 Ga0070674_1001451392 244
289 3300005364 Ga0070673_100209720 Ga0070673_1002097202 244
290 3300005365 Ga0070688_100015773 Ga0070688_1000157734 244
291 3300005367 Ga0070667_100002279 Ga0070667_1000022799 244
292 3300005367 Ga0070667_100030108 Ga0070667_1000301083 244
293 3300005367 Ga0070667_100258142 Ga0070667_1002581422 244
294 3300005435 Ga0070714_100080473 Ga0070714_1000804731 244
295 3300005436 Ga0070713_100375416 Ga0070713_1003754162 244
296 3300005436 Ga0070713_100452587 Ga0070713_1004525871 244
297 3300005437 Ga0070710_10001277 Ga0070710_100012778 244
298 3300005437 Ga0070710_10166698 Ga0070710_101666981 244
299 3300005437 Ga0070710_10284799 Ga0070710_102847991 244
300 3300005438 Ga0070701_10034555 Ga0070701_100345551 244
301 3300005439 Ga0070711_100001571 Ga0070711_1000015715 244
302 3300005439 Ga0070711_100015196 Ga0070711_1000151964 244
303 3300005439 Ga0070711_100587608 Ga0070711_1005876081 244
304 3300005440 Ga0070705_100017669 Ga0070705_1000176694 244
305 3300005440 Ga0070705_100065015 Ga0070705_1000650152 244
306 3300005441 Ga0070700_100000088 Ga0070700_1000000887 244
307 3300005441 Ga0070700_100001394 Ga0070700_1000013943 244
308 3300005444 Ga0070694_100104870 Ga0070694_1001048702 244
309 3300005444 Ga0070694_100374745 Ga0070694_1003747451 244
310 3300005455 Ga0070663_100018971 Ga0070663_1000189712 244
311 3300005456 Ga0070678_100000985 Ga0070678_10000098513 244
312 3300005456 Ga0070678_100463256 Ga0070678_1004632562 244
313 3300005457 Ga0070662_100022956 Ga0070662_1000229561 244
314 3300005457 Ga0070662_100172251 Ga0070662_1001722511 244
315 3300005458 Ga0070681_10004253 Ga0070681_100042537 244
316 3300005459 Ga0068867_100000404 Ga0068867_1000004044 244
317 3300005459 Ga0068867_100128950 Ga0068867_1001289502 244
318 3300005466 Ga0070685_10152033 Ga0070685_101520332 244
319 3300005466 Ga0070685_10412754 Ga0070685_104127541 244
320 3300005467 Ga0070706_100011901 Ga0070706_1000119016 244
321 3300005467 Ga0070706_100292841 Ga0070706_1002928412 244
322 3300005468 Ga0070707_100008621 Ga0070707_1000086218 244
323 3300005468 Ga0070707_100420591 Ga0070707_1004205911 244
324 3300005471 Ga0070698_100033546 Ga0070698_1000335464 244
325 3300005530 Ga0070679_100007103 Ga0070679_1000071034 244
326 3300005539 Ga0068853_100157482 Ga0068853_1001574822 244
327 3300005539 Ga0068853_100227962 Ga0068853_1002279622 244
328 3300005543 Ga0070672_100174187 Ga0070672_1001741872 244
329 3300005545 Ga0070695_100080722 Ga0070695_1000807222 244
330 3300005546 Ga0070696_100104220 Ga0070696_1001042202 244
331 3300005547 Ga0070693_100295719 Ga0070693_1002957191 244
332 3300005548 Ga0070665_100006667 Ga0070665_10000666712 244
333 3300005548 Ga0070665_100036041 Ga0070665_1000360416 244
334 3300005548 Ga0070665_100207197 Ga0070665_1002071971 244
335 3300005549 Ga0070704_100001226 Ga0070704_1000012265 244
336 3300005549 Ga0070704_100187582 Ga0070704_1001875821 244
337 3300005563 Ga0068855_100106991 Ga0068855_1001069913 244
338 3300005563 Ga0068855_100456480 Ga0068855_1004564802 244
339 3300005577 Ga0068857_100130327 Ga0068857_1001303274 244
340 3300005577 Ga0068857_100389631 Ga0068857_1003896312 244
341 3300005577 Ga0068857_100439471 Ga0068857_1004394712 244
342 3300005578 Ga0068854_100001406 Ga0068854_10000140610 244
343 3300005578 Ga0068854_100167135 Ga0068854_1001671351 244
344 3300005614 Ga0068856_100003019 Ga0068856_1000030198 244
345 3300005614 Ga0068856_100094781 Ga0068856_1000947811 244
346 3300005615 Ga0070702_100000347 Ga0070702_10000034719 244
347 3300005615 Ga0070702_100192079 Ga0070702_1001920792 244
348 3300005616 Ga0068852_100152494 Ga0068852_1001524943 244
349 3300005616 Ga0068852_100204692 Ga0068852_1002046922 244
350 3300005617 Ga0068859_100079740 Ga0068859_1000797405 244
351 3300005618 Ga0068864_100008230 Ga0068864_1000082309 244
352 3300005618 Ga0068864_100125656 Ga0068864_1001256562 244
353 3300005718 Ga0068866_10001788 Ga0068866_100017883 244
354 3300005718 Ga0068866_10144847 Ga0068866_101448471 244
355 3300005719 Ga0068861_100032541 Ga0068861_1000325411 244
356 3300005719 Ga0068861_100325692 Ga0068861_1003256922 244
357 3300005841 Ga0068863_100014312 Ga0068863_1000143127 244
358 3300005841 Ga0068863_100031833 Ga0068863_1000318334 244
359 3300005841 Ga0068863_100086939 Ga0068863_1000869392 244
360 3300005841 Ga0068863_100095166 Ga0068863_1000951665 244
361 3300005842 Ga0068858_100006025 Ga0068858_10000602510 244
362 3300005842 Ga0068858_100015931 Ga0068858_1000159316 244
363 3300005842 Ga0068858_100105269 Ga0068858_1001052693 244
364 3300005842 Ga0068858_100280519 Ga0068858_1002805192 244
365 3300005843 Ga0068860_100004983 Ga0068860_10000498311 244
366 3300005843 Ga0068860_100041810 Ga0068860_1000418106 244
367 3300005844 Ga0068862_100011571 Ga0068862_1000115716 244
368 3300005844 Ga0068862_100064458 Ga0068862_1000644585 244
369 3300005981 Ga0081538_10066848 Ga0081538_100668482 244
370 3300005983 Ga0081540_1031200 Ga0081540_10312002 244
371 3300005983 Ga0081540_1056257 Ga0081540_10562572 244
372 3300005985 Ga0081539_10000706 Ga0081539_1000070617 244
373 3300005985 Ga0081539_10001346 Ga0081539_1000134618 244
374 3300005985 Ga0081539_10004243 Ga0081539_100042437 244
375 3300005985 Ga0081539_10008166 Ga0081539_100081669 244
376 3300005985 Ga0081539_10010521 Ga0081539_100105216 244
377 3300006028 Ga0070717_10002691 Ga0070717_100026913 244
378 3300006051 Ga0075364_10003109 Ga0075364_100031096 244
379 3300006163 Ga0070715_10044225 Ga0070715_100442252 244
380 3300006163 Ga0070715_10051233 Ga0070715_100512332 244
381 3300006163 Ga0070715_10103097 Ga0070715_101030972 244
382 3300006173 Ga0070716_100047995 Ga0070716_1000479952 244
383 3300006173 Ga0070716_100050887 Ga0070716_1000508872 244
384 3300006175 Ga0070712_100001155 Ga0070712_1000011551 244
385 3300006175 Ga0070712_100115740 Ga0070712_1001157402 244
386 3300006175 Ga0070712_100270310 Ga0070712_1002703101 244
387 3300006186 Ga0075369_10008069 Ga0075369_100080692 244
388 3300006237 Ga0097621_100028126 Ga0097621_1000281263 244
389 3300006237 Ga0097621_100073376 Ga0097621_1000733763 244
390 3300006358 Ga0068871_100192239 Ga0068871_1001922392 244
391 3300006844 Ga0075428_100019167 Ga0075428_1000191677 244
392 3300006844 Ga0075428_100538251 Ga0075428_1005382511 244
393 3300006846 Ga0075430_100000172 Ga0075430_1000001726 244
394 3300006847 Ga0075431_100089627 Ga0075431_1000896273 244
395 3300006847 Ga0075431_100218855 Ga0075431_1002188552 244
396 3300006852 Ga0075433_10106479 Ga0075433_101064792 244
397 3300006880 Ga0075429_100014921 Ga0075429_1000149216 244
398 3300006881 Ga0068865_100008010 Ga0068865_1000080106 244
399 3300006881 Ga0068865_100077216 Ga0068865_1000772162 244
400 3300006931 Ga0097620_100079742 Ga0097620_1000797421 244
401 3300007788 Ga0099795_10006768 Ga0099795_100067682 244
402 3300009093 Ga0105240_10379487 Ga0105240_103794872 244
403 3300009094 Ga0111539_10442320 Ga0111539_104423202 244
404 3300009094 Ga0111539_10602207 Ga0111539_106022072 244
405 3300009098 Ga0105245_10000730 Ga0105245_100007309 244
406 3300009101 Ga0105247_10005433 Ga0105247_100054331 244
407 3300009101 Ga0105247_10067807 Ga0105247_100678072 244
408 3300009101 Ga0105247_10301526 Ga0105247_103015262 244
409 3300009147 Ga0114129_10221450 Ga0114129_102214502 244
410 3300009147 Ga0114129_10497595 Ga0114129_104975951 244
411 3300009148 Ga0105243_10000504 Ga0105243_1000050413 244
412 3300009148 Ga0105243_10642111 Ga0105243_106421111 244
413 3300009174 Ga0105241_10146323 Ga0105241_101463231 244
414 3300009174 Ga0105241_10614491 Ga0105241_106144912 244
415 3300009176 Ga0105242_10000385 Ga0105242_1000038515 244
416 3300009176 Ga0105242_10388218 Ga0105242_103882181 244
417 3300009177 Ga0105248_10523977 Ga0105248_105239772 244
418 3300009545 Ga0105237_10848340 Ga0105237_108483401 244
419 3300009551 Ga0105238_10029759 Ga0105238_100297594 244
420 3300009551 Ga0105238_10378008 Ga0105238_103780082 244
421 3300009553 Ga0105249_10191833 Ga0105249_101918331 244
422 3300009553 Ga0105249_10643001 Ga0105249_106430012 244
423 3300010375 Ga0105239_10005637 Ga0105239_100056378 244
424 3300011119 Ga0105246_10112244 Ga0105246_101122442 244
425 3300013102 Ga0157371_10271609 Ga0157371_102716091 244
426 3300013104 Ga0157370_10186250 Ga0157370_101862502 244
427 3300013105 Ga0157369_10376288 Ga0157369_103762882 244
428 3300013105 Ga0157369_10545288 Ga0157369_105452882 244
429 3300013296 Ga0157374_10098956 Ga0157374_100989562 244
430 3300013296 Ga0157374_10115064 Ga0157374_101150643 244
431 3300013297 Ga0157378_10002662 Ga0157378_100026622 244
432 3300013297 Ga0157378_10093403 Ga0157378_100934031 244
433 3300013306 Ga0163162_10076847 Ga0163162_100768472 244
434 3300013306 Ga0163162_10682351 Ga0163162_106823512 244
435 3300013307 Ga0157372_10007432 Ga0157372_100074322 244
436 3300013307 Ga0157372_10146397 Ga0157372_101463972 244
437 3300013308 Ga0157375_10001165 Ga0157375_100011651 244
438 3300013308 Ga0157375_10862045 Ga0157375_108620452 244
439 3300014325 Ga0163163_10059054 Ga0163163_100590543 244
440 3300014325 Ga0163163_10216108 Ga0163163_102161082 244
441 3300014325 Ga0163163_10248278 Ga0163163_102482782 244
442 3300014325 Ga0163163_10631117 Ga0163163_106311172 244
443 3300014325 Ga0163163_10702150 Ga0163163_107021502 244
444 3300014325 Ga0163163_10967724 Ga0163163_109677242 244
445 3300014326 Ga0157380_10000356 Ga0157380_1000035613 244
446 3300014497 Ga0182008_10089211 Ga0182008_100892111 244
447 3300014497 Ga0182008_10100376 Ga0182008_101003762 244
448 3300014745 Ga0157377_10061763 Ga0157377_100617632 244
449 3300014968 Ga0157379_10017816 Ga0157379_100178166 244
450 3300014968 Ga0157379_10059255 Ga0157379_100592555 244
451 3300014968 Ga0157379_10147831 Ga0157379_101478312 244
452 3300014969 Ga0157376_10022738 Ga0157376_100227383 244
453 3300014969 Ga0157376_10378187 Ga0157376_103781871 244
454 3300017792 Ga0163161_10000586 Ga0163161_1000058613 244
455 3300017792 Ga0163161_10166940 Ga0163161_101669402 244
456 3300020069 Ga0197907_11373820 Ga0197907_113738201 244
457 3300020069 Ga0197907_11471116 Ga0197907_114711163 244
458 3300020070 Ga0206356_11622265 Ga0206356_116222653 244
459 3300020077 Ga0206351_10176129 Ga0206351_101761292 244
460 3300020077 Ga0206351_10298870 Ga0206351_102988701 244
461 3300020078 Ga0206352_11097006 Ga0206352_110970062 244
462 3300020081 Ga0206354_10713285 Ga0206354_107132852 244
463 3300020610 Ga0154015_1446516 Ga0154015_14465162 244
464 3300021358 Ga0213873_10000139 Ga0213873_100001398 244
465 3300021388 Ga0213875_10012490 Ga0213875_100124905 244
466 3300025223 Ga0207672_1003656 Ga0207672_10036561 244
467 3300025885 Ga0207653_10037313 Ga0207653_100373132 244
468 3300025893 Ga0207682_10138289 Ga0207682_101382891 244
469 3300025898 Ga0207692_10001360 Ga0207692_100013604 244
470 3300025898 Ga0207692_10140779 Ga0207692_101407792 244
471 3300025899 Ga0207642_10000335 Ga0207642_100003359 244
472 3300025899 Ga0207642_10117844 Ga0207642_101178441 244
473 3300025900 Ga0207710_10001367 Ga0207710_100013675 244
474 3300025900 Ga0207710_10049197 Ga0207710_100491972 244
475 3300025900 Ga0207710_10078716 Ga0207710_100787161 244
476 3300025901 Ga0207688_10000291 Ga0207688_100002911 244
477 3300025901 Ga0207688_10003914 Ga0207688_1000391410 244
478 3300025906 Ga0207699_10009907 Ga0207699_100099074 244
479 3300025906 Ga0207699_10250566 Ga0207699_102505661 244
480 3300025906 Ga0207699_10483297 Ga0207699_104832971 244
481 3300025907 Ga0207645_10095524 Ga0207645_100955242 244
482 3300025907 Ga0207645_10185565 Ga0207645_101855651 244
483 3300025909 Ga0207705_10004958 Ga0207705_100049586 244
484 3300025910 Ga0207684_10010500 Ga0207684_100105006 244
485 3300025912 Ga0207707_10004458 Ga0207707_100044585 244
486 3300025913 Ga0207695_10349510 Ga0207695_103495102 244
487 3300025915 Ga0207693_10000049 Ga0207693_100000491 244
488 3300025915 Ga0207693_10036232 Ga0207693_100362323 244
489 3300025915 Ga0207693_10083768 Ga0207693_100837681 244
490 3300025916 Ga0207663_10001607 Ga0207663_100016078 244
491 3300025916 Ga0207663_10028741 Ga0207663_100287412 244
492 3300025917 Ga0207660_10000423 Ga0207660_1000042315 244
493 3300025917 Ga0207660_10592632 Ga0207660_105926321 244
494 3300025919 Ga0207657_10055510 Ga0207657_100555102 244
495 3300025919 Ga0207657_10438006 Ga0207657_104380062 244
496 3300025921 Ga0207652_10000455 Ga0207652_1000045530 244
497 3300025922 Ga0207646_10006235 Ga0207646_1000623510 244
498 3300025922 Ga0207646_10131225 Ga0207646_101312252 244
499 3300025923 Ga0207681_10028903 Ga0207681_100289033 244
500 3300025923 Ga0207681_10237597 Ga0207681_102375971 244
501 3300025924 Ga0207694_10294048 Ga0207694_102940481 244
502 3300025927 Ga0207687_10000816 Ga0207687_1000081610 244
503 3300025927 Ga0207687_10341466 Ga0207687_103414661 244
504 3300025928 Ga0207700_10008373 Ga0207700_100083735 244
505 3300025928 Ga0207700_10091515 Ga0207700_100915153 244
506 3300025929 Ga0207664_10210072 Ga0207664_102100722 244
507 3300025931 Ga0207644_10003347 Ga0207644_100033474 244
508 3300025931 Ga0207644_10093464 Ga0207644_100934643 244
509 3300025932 Ga0207690_10127818 Ga0207690_101278182 244
510 3300025933 Ga0207706_10408708 Ga0207706_104087082 244
511 3300025934 Ga0207686_10001914 Ga0207686_1000191410 244
512 3300025935 Ga0207709_10005434 Ga0207709_100054345 244
513 3300025936 Ga0207670_10117163 Ga0207670_101171632 244
514 3300025937 Ga0207669_10013219 Ga0207669_100132193 244
515 3300025938 Ga0207704_10002624 Ga0207704_100026248 244
516 3300025938 Ga0207704_10517492 Ga0207704_105174922 244
517 3300025939 Ga0207665_10133356 Ga0207665_101333562 244
518 3300025939 Ga0207665_10135293 Ga0207665_101352931 244
519 3300025940 Ga0207691_10103158 Ga0207691_101031583 244
520 3300025941 Ga0207711_10320778 Ga0207711_103207782 244
521 3300025942 Ga0207689_10156631 Ga0207689_101566312 244
522 3300025942 Ga0207689_10178243 Ga0207689_101782432 244
523 3300025949 Ga0207667_10310958 Ga0207667_103109582 244
524 3300025961 Ga0207712_10015701 Ga0207712_100157014 244
525 3300025961 Ga0207712_10068331 Ga0207712_100683311 244
526 3300025961 Ga0207712_10476725 Ga0207712_104767251 244
527 3300025972 Ga0207668_10006205 Ga0207668_100062055 244
528 3300025972 Ga0207668_10019285 Ga0207668_100192853 244
529 3300025972 Ga0207668_10134358 Ga0207668_101343582 244
530 3300025981 Ga0207640_10003447 Ga0207640_100034472 244
531 3300025981 Ga0207640_10024210 Ga0207640_100242103 244
532 3300025986 Ga0207658_10068535 Ga0207658_100685352 244
533 3300026023 Ga0207677_10000712 Ga0207677_100007129 244
534 3300026023 Ga0207677_10451463 Ga0207677_104514631 244
535 3300026035 Ga0207703_10013902 Ga0207703_100139025 244
536 3300026035 Ga0207703_10040056 Ga0207703_100400563 244
537 3300026035 Ga0207703_10096432 Ga0207703_100964323 244
538 3300026035 Ga0207703_10165043 Ga0207703_101650432 244
539 3300026035 Ga0207703_10299283 Ga0207703_102992832 244
540 3300026041 Ga0207639_10105653 Ga0207639_101056533 244
541 3300026041 Ga0207639_10305274 Ga0207639_103052741 244
542 3300026041 Ga0207639_10767491 Ga0207639_107674911 244
543 3300026067 Ga0207678_10059971 Ga0207678_100599711 244
544 3300026067 Ga0207678_10098509 Ga0207678_100985093 244
545 3300026075 Ga0207708_10000079 Ga0207708_1000007947 244
546 3300026075 Ga0207708_10033556 Ga0207708_100335561 244
547 3300026075 Ga0207708_10150223 Ga0207708_101502232 244
548 3300026078 Ga0207702_10001934 Ga0207702_1000193411 244
549 3300026078 Ga0207702_10162441 Ga0207702_101624412 244
550 3300026088 Ga0207641_10006415 Ga0207641_1000641510 244
551 3300026088 Ga0207641_10058708 Ga0207641_100587081 244
552 3300026088 Ga0207641_10075809 Ga0207641_100758092 244
553 3300026088 Ga0207641_10102256 Ga0207641_101022561 244
554 3300026088 Ga0207641_10108139 Ga0207641_101081392 244
555 3300026089 Ga0207648_10044760 Ga0207648_100447605 244
556 3300026089 Ga0207648_10201213 Ga0207648_102012132 244
557 3300026095 Ga0207676_10013384 Ga0207676_100133844 244
558 3300026095 Ga0207676_10304444 Ga0207676_103044442 244
559 3300026116 Ga0207674_10045352 Ga0207674_100453527 244
560 3300026116 Ga0207674_10103805 Ga0207674_101038053 244
561 3300026116 Ga0207674_10150999 Ga0207674_101509991 244
562 3300026118 Ga0207675_100050918 Ga0207675_1000509181 244
563 3300026118 Ga0207675_100117416 Ga0207675_1001174163 244
564 3300026118 Ga0207675_100470919 Ga0207675_1004709192 244
565 3300026121 Ga0207683_10000184 Ga0207683_1000018458 244
566 3300026121 Ga0207683_10228693 Ga0207683_102286932 244
567 3300026142 Ga0207698_10204557 Ga0207698_102045572 244
568 3300027512 Ga0209179_1045169 Ga0209179_10451691 244
569 3300028379 Ga0268266_10006671 Ga0268266_100066713 244
570 3300028379 Ga0268266_10009625 Ga0268266_100096258 244
571 3300028379 Ga0268266_10061251 Ga0268266_100612512 244
572 3300028379 Ga0268266_10084119 Ga0268266_100841193 244
573 3300028379 Ga0268266_10605798 Ga0268266_106057981 244
574 3300028380 Ga0268265_10017563 Ga0268265_100175634 244
575 3300028380 Ga0268265_10209497 Ga0268265_102094972 244
576 3300028380 Ga0268265_10806604 Ga0268265_108066041 244
577 3300028381 Ga0268264_10004268 Ga0268264_100042686 244
578 3300028381 Ga0268264_10016350 Ga0268264_100163503 244
579 3300028381 Ga0268264_10174511 Ga0268264_101745112 244
580 3300028666 Ga0265336_10012827 Ga0265336_100128273 244
581 3300028786 Ga0307517_10031743 Ga0307517_100317437 244
582 3300028794 Ga0307515_10000045 Ga0307515_1000004592 244
583 3300028794 Ga0307515_10020864 Ga0307515_100208645 244
584 3300028794 Ga0307515_10044616 Ga0307515_100446165 244
585 3300028794 Ga0307515_10075426 Ga0307515_100754263 244
586 3300028800 Ga0265338_10002382 Ga0265338_1000238217 244
587 3300030521 Ga0307511_10001243 Ga0307511_100012432 244
588 3300030522 Ga0307512_10046936 Ga0307512_100469365 244
589 3300031456 Ga0307513_10041669 Ga0307513_100416696 244
590 3300031456 Ga0307513_10071510 Ga0307513_100715105 244
591 3300031456 Ga0307513_10313798 Ga0307513_103137982 244
592 3300031507 Ga0307509_10023422 Ga0307509_100234225 244
593 3300031507 Ga0307509_10207234 Ga0307509_102072341 244
594 3300031616 Ga0307508_10001989 Ga0307508_1000198914 244
595 3300031616 Ga0307508_10031993 Ga0307508_100319935 244
596 3300031616 Ga0307508_10037965 Ga0307508_100379652 244
597 3300031616 Ga0307508_10093582 Ga0307508_100935822 244
598 3300031730 Ga0307516_10010141 Ga0307516_100101417 244
599 3300031731 Ga0307405_10070252 Ga0307405_100702523 244
600 3300031731 Ga0307405_10120831 Ga0307405_101208312 244
601 3300031731 Ga0307405_10190124 Ga0307405_101901241 244
602 3300031731 Ga0307405_10216688 Ga0307405_102166882 244
603 3300031731 Ga0307405_10374818 Ga0307405_103748181 244
604 3300031824 Ga0307413_10526141 Ga0307413_105261411 244
605 3300031852 Ga0307410_10009217 Ga0307410_100092174 244
606 3300031852 Ga0307410_10053139 Ga0307410_100531393 244
607 3300031889 Ga0326468_10000222 Ga0326468_100002224 244
608 3300031901 Ga0307406_10001830 Ga0307406_1000183011 244
609 3300031901 Ga0307406_10261557 Ga0307406_102615572 244
610 3300031911 Ga0307412_10119184 Ga0307412_101191842 244
611 3300031911 Ga0307412_10186772 Ga0307412_101867722 244
612 3300031995 Ga0307409_100000896 Ga0307409_1000008967 244
613 3300031995 Ga0307409_100118093 Ga0307409_1001180932 244
614 3300031995 Ga0307409_100158234 Ga0307409_1001582342 244
615 3300031995 Ga0307409_100245639 Ga0307409_1002456392 244
616 3300031995 Ga0307409_100333387 Ga0307409_1003333872 244
617 3300031995 Ga0307409_100483541 Ga0307409_1004835412 244
618 3300031995 Ga0307409_100540004 Ga0307409_1005400042 244
619 3300031995 Ga0307409_100686408 Ga0307409_1006864081 244
620 3300032002 Ga0307416_100016607 Ga0307416_1000166076 244
621 3300032002 Ga0307416_100142447 Ga0307416_1001424472 244
622 3300032002 Ga0307416_100195942 Ga0307416_1001959422 244
623 3300032002 Ga0307416_100325308 Ga0307416_1003253083 244
624 3300032004 Ga0307414_10045159 Ga0307414_100451593 244
625 3300032004 Ga0307414_10530623 Ga0307414_105306231 244
626 3300032126 Ga0307415_100022896 Ga0307415_1000228963 244
627 3300032126 Ga0307415_100076360 Ga0307415_1000763603 244
628 3300032126 Ga0307415_100272213 Ga0307415_1002722132 244
629 3300033179 Ga0307507_10023912 Ga0307507_100239125 244
630 3300033180 Ga0307510_10156592 Ga0307510_101565922 244
631 3300034957 Ga0373938_0031597 Ga0373938_0031597_237_1016 244
632 3300035083 Ga0373926_0000890 Ga0373926_0000890_1960_2739 244
633 3300035083 Ga0373926_0033009 Ga0373926_0033009_138_917 244
634 3300035088 Ga0373940_0006757 Ga0373940_0006757_1516_2295 244
635 3300035111 Ga0373923_0008873 Ga0373923_0008873_817_1596 244
636 3300035113 Ga0373936_0049895 Ga0373936_0049895_39_818 244
637 3300035115 Ga0373941_0050561 Ga0373941_0050561_188_988 244
638 3300035117 Ga0373953_0011143 Ga0373953_0011143_1556_2335 244
639 3300035118 Ga0373954_0074727 Ga0373954_0074727_187_966 244
640 3300035120 Ga0373957_0011809 Ga0373957_0011809_768_1547 244
641 3300035121 Ga0373960_0055161 Ga0373960_0055161_247_1047 244
642 3300035170 Ga0373943_0061428 Ga0373943_0061428_1005_1784 244
643 3300035171 Ga0373946_0079777 Ga0373946_0079777_226_1005 244
644 3300035172 Ga0373955_0013453 Ga0373955_0013453_2243_3022 244
645 3300035207 Ga0373942_0000264 Ga0373942_0000264_1965_2744 244
646 3300035410 Ga0373924_0047950 Ga0373924_0047950_808_1587 244
647 3300035691 Ga0373931_0077729 Ga0373931_0077729_713_1513 244
648 3300035692 Ga0373935_0001786 Ga0373935_0001786_2270_3049 244
649 3300035692 Ga0373935_0003202 Ga0373935_0003202_4095_4874 244
650 3300035725 Ga0373947_0000007 Ga0373947_0000007_178015_178794 244
651 3300036401 Ga0373937_0055734 Ga0373937_0055734_54_833 244
652 3300036457 Ga0265778_001357 Ga0265778_001357_595_1383 244
653 3300037068 Ga0373925_0176117 Ga0373925_0176117_508_1287 244
654 3300037068 Ga0373925_0334926 Ga0373925_0334926_76_855 244
655 3300037418 Ga0395900_0019286 Ga0395900_0019286_5101_5880 244
656 3300037466 Ga0395898_0105664 Ga0395898_0105664_1028_1807 244
657 3300037853 Ga0436364_0125897 Ga0436364_0125897_2574_3356 244
658 3300037853 Ga0436364_0170612 Ga0436364_0170612_121_900 244
659 3300037853 Ga0436364_0881245 Ga0436364_0881245_1508_2287 244
660 3300037853 Ga0436364_1296832 Ga0436364_1296832_7151_7933 244
661 3300039437 Ga0436365_1698725 Ga0436365_1698725_734_1594 244
662 3300039453 Ga0436362_0900593 Ga0436362_0900593_9517_10377 244
663 3300041411 Ga0439466_0011337 Ga0439466_0011337_1451_2251 244
664 3300041463 Ga0451804_0081067 Ga0451804_0081067_143_922 244
665 3300041494 Ga0451837_1036194 Ga0451837_1036194_104_889 244
666 3300041494 Ga0451837_1701327 Ga0451837_1701327_103_882 244
667 3300041512 Ga0451853_0366154 Ga0451853_0366154_7307_8086 244
668 3300042002 Ga0439442_000871 Ga0439442_000871_3820_4620 244
669 3300042438 Ga0439459_0007460 Ga0439459_0007460_412_1191 244
670 3300044656 Ga0466969_0051017 Ga0466969_0051017_887_1669 244
671 3300044658 Ga0466972_0011943 Ga0466972_0011943_2845_3645 244
672 3300044683 Ga0466965_0082975 Ga0466965_0082975_242_1021 244
673 3300044683 Ga0466965_0146726 Ga0466965_0146726_164_943 244
674 3300044684 Ga0466966_0004593 Ga0466966_0004593_2880_3662 244
675 3300044684 Ga0466966_0018018 Ga0466966_0018018_501_1280 244
676 3300044684 Ga0466966_0025144 Ga0466966_0025144_2901_3683 244
677 3300044684 Ga0466966_0039457 Ga0466966_0039457_468_1247 244
678 3300044684 Ga0466966_0058255 Ga0466966_0058255_929_1708 244
679 3300044684 Ga0466966_0266512 Ga0466966_0266512_157_936 244
680 3300044693 Ga0466961_0070421 Ga0466961_0070421_675_1457 244
681 3300044693 Ga0466961_0070855 Ga0466961_0070855_471_1250 244
682 3300044693 Ga0466961_0083880 Ga0466961_0083880_1003_1782 244
683 3300044693 Ga0466961_0147946 Ga0466961_0147946_229_1008 244
684 3300044693 Ga0466961_0155802 Ga0466961_0155802_255_1037 244
685 3300044694 Ga0466963_0017279 Ga0466963_0017279_3659_4438 244
686 3300044694 Ga0466963_0030949 Ga0466963_0030949_1085_1864 244
687 3300044694 Ga0466963_0051668 Ga0466963_0051668_1018_1797 244
688 3300044694 Ga0466963_0247655 Ga0466963_0247655_39_818 244
689 3300044694 Ga0466963_0261392 Ga0466963_0261392_92_871 244
690 3300044706 Ga0466964_0059660 Ga0466964_0059660_323_1102 244
691 3300044706 Ga0466964_0107947 Ga0466964_0107947_183_962 244
692 3300044719 Ga0466971_0011381 Ga0466971_0011381_1744_2523 244
693 3300044719 Ga0466971_0011508 Ga0466971_0011508_1900_2679 244
694 3300044719 Ga0466971_0037281 Ga0466971_0037281_880_1659 244
695 3300044719 Ga0466971_0043046 Ga0466971_0043046_279_1061 244
696 3300044719 Ga0466971_0044511 Ga0466971_0044511_127_906 244
697 3300044719 Ga0466971_0123300 Ga0466971_0123300_65_847 244
698 3300044765 Ga0466970_0031469 Ga0466970_0031469_1039_1818 244
699 3300044765 Ga0466970_0060040 Ga0466970_0060040_1217_1999 244
700 3300044842 Ga0466957_0108379 Ga0466957_0108379_217_999 244
701 3300044842 Ga0466957_0209765 Ga0466957_0209765_239_1018 244
702 3300044842 Ga0466957_0258149 Ga0466957_0258149_300_1079 244
703 3300044901 Ga0466960_0006650 Ga0466960_0006650_74_853 244
704 3300044901 Ga0466960_0042131 Ga0466960_0042131_706_1485 244
705 3300044901 Ga0466960_0046291 Ga0466960_0046291_1181_1960 244
706 3300044901 Ga0466960_0054401 Ga0466960_0054401_191_970 244
707 3300044901 Ga0466960_0071568 Ga0466960_0071568_500_1369 244
708 3300045049 Ga0466959_0001545 Ga0466959_0001545_6511_7290 244
709 3300045049 Ga0466959_0020240 Ga0466959_0020240_3599_4381 244
710 3300045049 Ga0466959_0116879 Ga0466959_0116879_972_1754 244
711 3300045049 Ga0466959_0284935 Ga0466959_0284935_74_853 244
712 3300045049 Ga0466959_0418831 Ga0466959_0418831_38_817 244
713 3300045049 Ga0466959_0455066 Ga0466959_0455066_40_819 244
714 3300045836 Ga0466958_0006216 Ga0466958_0006216_1170_1949 244
715 3300045836 Ga0466958_0076215 Ga0466958_0076215_274_1053 244
716 3300045836 Ga0466958_0088779 Ga0466958_0088779_282_1061 244
717 3300045836 Ga0466958_0120689 Ga0466958_0120689_793_1572 244
718 3300045976 Ga0466967_0007460 Ga0466967_0007460_3409_4188 244
719 3300045976 Ga0466967_0009661 Ga0466967_0009661_891_1670 244
720 3300045976 Ga0466967_0149197 Ga0466967_0149197_160_945 244
721 3300045976 Ga0466967_0161062 Ga0466967_0161062_515_1294 244
722 3300045976 Ga0466967_0176053 Ga0466967_0176053_442_1224 244
723 3300045976 Ga0466967_0263849 Ga0466967_0263849_123_902 244
724 3300045976 Ga0466967_0403737 Ga0466967_0403737_104_883 244
725 3300046454 Ga0495592_0012558 Ga0495592_0012558_4664_5443 244
726 3300046459 Ga0495629_0041148 Ga0495629_0041148_947_1726 244
727 3300046459 Ga0495629_0141310 Ga0495629_0141310_226_1005 244
728 3300046459 Ga0495629_0183981 Ga0495629_0183981_405_1184 244
729 3300046462 Ga0495651_0009568 Ga0495651_0009568_2239_3018 244
730 3300046472 Ga0495580_0113823 Ga0495580_0113823_552_1331 244
731 3300046477 Ga0495664_0017094 Ga0495664_0017094_1962_2741 244
732 3300046499 Ga0495594_0003426 Ga0495594_0003426_5999_6778 244
733 3300046516 Ga0495628_0124496 Ga0495628_0124496_1143_1922 244
734 3300046517 Ga0495630_0144676 Ga0495630_0144676_457_1236 244
735 3300046517 Ga0495630_0268476 Ga0495630_0268476_234_1013 244
736 3300046519 Ga0495632_0160106 Ga0495632_0160106_119_898 244
737 3300046526 Ga0495666_0092176 Ga0495666_0092176_601_1380 244
738 3300046529 Ga0495652_0149229 Ga0495652_0149229_524_1303 244
739 3300046531 Ga0495665_0115513 Ga0495665_0115513_216_995 244
740 3300046543 Ga0495645_0076536 Ga0495645_0076536_1264_2043 244
741 3300046616 Ga0495668_0280021 Ga0495668_0280021_43_822 244
742 3300046642 Ga0495634_0033316 Ga0495634_0033316_1527_2306 244
743 3300046675 Ga0495657_0058106 Ga0495657_0058106_1124_1903 244
744 3300046679 Ga0495623_0011563 Ga0495623_0011563_4405_5184 244
745 3300046680 Ga0495646_0053323 Ga0495646_0053323_666_1445 244
746 3300046690 Ga0495624_0031544 Ga0495624_0031544_2026_2805 244
747 3300046809 Ga0495600_0113698 Ga0495600_0113698_110_889 244
748 3300047317 Ga0495604_0232565 Ga0495604_0232565_127_906 244
749 3300047321 Ga0495676_0184959 Ga0495676_0184959_262_1041 244
750 3300047322 Ga0495680_0239051 Ga0495680_0239051_281_1060 244
751 3300047444 Ga0495675_0007693 Ga0495675_0007693_1189_1968 244
752 3300047471 Ga0495684_0006994 Ga0495684_0006994_2239_3018 244
753 3300047673 Ga0495593_0078823 Ga0495593_0078823_201_980 244
754 3300048088 Ga0495602_0081358 Ga0495602_0081358_203_982 244
755 3300048903 Ga0496100_0006929 Ga0496100_0006929_4247_5032 244
756 3300048903 Ga0496100_0010164 Ga0496100_0010164_3026_3826 244
757 3300048903 Ga0496100_0133308 Ga0496100_0133308_65_865 244
758 3300048904 Ga0496101_0026648 Ga0496101_0026648_1353_2138 244
759 3300048904 Ga0496101_0074556 Ga0496101_0074556_984_1784 244
760 3300048905 Ga0496102_0000030 Ga0496102_0000030_218524_219309 244
761 3300048905 Ga0496102_0000976 Ga0496102_0000976_18919_19719 244
762 3300048905 Ga0496102_0005338 Ga0496102_0005338_3022_3822 244
763 3300048905 Ga0496102_0234873 Ga0496102_0234873_403_1203 244
764 3300048906 Ga0496103_0000068 Ga0496103_0000068_14801_15586 244
765 3300048906 Ga0496103_0005142 Ga0496103_0005142_4443_5243 244
766 3300048907 Ga0496104_0004070 Ga0496104_0004070_1625_2404 244
767 3300048907 Ga0496104_0015707 Ga0496104_0015707_1910_2695 244
768 3300048907 Ga0496104_0096351 Ga0496104_0096351_878_1657 244
769 3300048907 Ga0496104_0300003 Ga0496104_0300003_208_1008 244
770 3300048908 Ga0496105_0018374 Ga0496105_0018374_3529_4308 244
771 3300048908 Ga0496105_0023416 Ga0496105_0023416_2230_3009 244
772 3300048908 Ga0496105_0027387 Ga0496105_0027387_2521_3306 244
773 3300048908 Ga0496105_0181950 Ga0496105_0181950_279_1079 244
774 3300048908 Ga0496105_0255820 Ga0496105_0255820_455_1270 244
775 3300048909 Ga0496106_0003384 Ga0496106_0003384_4058_4858 244
776 3300048909 Ga0496106_0257548 Ga0496106_0257548_270_1049 244
777 3300048910 Ga0496107_0000383 Ga0496107_0000383_1067_1867 244
778 3300048911 Ga0496108_0012767 Ga0496108_0012767_1347_2126 244
779 3300048911 Ga0496108_0031658 Ga0496108_0031658_2237_3037 244
780 3300048911 Ga0496108_0034906 Ga0496108_0034906_2938_3738 244
781 3300048911 Ga0496108_0049489 Ga0496108_0049489_1005_1784 244
782 3300048911 Ga0496108_0348777 Ga0496108_0348777_92_871 244
783 3300048912 Ga0496109_0045242 Ga0496109_0045242_765_1565 244
784 3300048912 Ga0496109_0353309 Ga0496109_0353309_414_1193 244
785 3300048913 Ga0496110_0045802 Ga0496110_0045802_1025_1804 244
786 3300048913 Ga0496110_0245050 Ga0496110_0245050_97_897 244
787 3300048914 Ga0496111_0047756 Ga0496111_0047756_1733_2533 244
788 3300048914 Ga0496111_0081553 Ga0496111_0081553_750_1529 244
789 3300048914 Ga0496111_0203221 Ga0496111_0203221_520_1299 244
790 3300048915 Ga0496112_0026180 Ga0496112_0026180_3415_4230 244
791 3300048915 Ga0496112_0310705 Ga0496112_0310705_664_1464 244
792 3300048915 Ga0496112_0350995 Ga0496112_0350995_305_1084 244
793 3300048916 Ga0496113_0104993 Ga0496113_0104993_369_1184 244
794 3300048916 Ga0496113_0168939 Ga0496113_0168939_828_1628 244
795 3300048916 Ga0496113_0340373 Ga0496113_0340373_134_913 244
796 3300048917 Ga0496114_0002030 Ga0496114_0002030_4259_5059 244
797 3300048917 Ga0496114_0411070 Ga0496114_0411070_91_891 244
798 3300048918 Ga0496115_0004444 Ga0496115_0004444_4896_5696 244
799 3300048918 Ga0496115_0186268 Ga0496115_0186268_56_856 244
800 3300048919 Ga0496116_0000152 Ga0496116_0000152_7854_8639 244
801 3300048920 Ga0496117_0000059 Ga0496117_0000059_257427_258212 244
802 3300048921 Ga0496118_0000061 Ga0496118_0000061_218142_218927 244
803 3300048921 Ga0496118_0203369 Ga0496118_0203369_267_1067 244
804 3300048922 Ga0496119_0001310 Ga0496119_0001310_1956_2741 244
805 3300048923 Ga0496120_0022502 Ga0496120_0022502_2021_2806 244
806 3300048924 Ga0496121_0047196 Ga0496121_0047196_2568_3350 244
807 3300048924 Ga0496121_0058209 Ga0496121_0058209_1861_2646 244
808 3300048927 Ga0496124_0020330 Ga0496124_0020330_2104_2889 244
809 3300048928 Ga0496125_0034873 Ga0496125_0034873_1601_2386 244
810 3300048929 Ga0496126_0000213 Ga0496126_0000213_125552_126337 244
811 3300048929 Ga0496126_0021483 Ga0496126_0021483_2148_2927 244
812 3300049534 Ga0501318_004057 Ga0501318_004057_42_821 244
813 3300049534 Ga0501318_015052 Ga0501318_015052_25_804 244
814 3300049537 Ga0501321_008874 Ga0501321_008874_252_1031 244
815 3300049568 Ga0501031_0340208 Ga0501031_0340208_60_839 244
816 3300049569 Ga0501032_0047866 Ga0501032_0047866_723_1502 244
817 3300049571 Ga0501034_0440837 Ga0501034_0440837_86_874 244
818 3300049573 Ga0501037_0190213 Ga0501037_0190213_127_906 244
819 3300049574 Ga0501038_0039540 Ga0501038_0039540_2527_3306 244
820 3300049574 Ga0501038_0394583 Ga0501038_0394583_197_976 244
821 3300049575 Ga0501039_0436604 Ga0501039_0436604_42_821 244
822 3300049578 Ga0501042_0132542 Ga0501042_0132542_196_975 244
823 3300049579 Ga0501043_0562824 Ga0501043_0562824_46_825 244
824 3300049580 Ga0501046_0179994 Ga0501046_0179994_255_1034 244
825 3300049581 Ga0501047_0033318 Ga0501047_0033318_1947_2726 244
826 3300049581 Ga0501047_0223391 Ga0501047_0223391_471_1250 244
827 3300049585 Ga0501069_0012874 Ga0501069_0012874_1554_2333 244
828 3300049590 Ga0501074_0033213 Ga0501074_0033213_2848_3627 244
829 3300049822 Ga0501035_0241627 Ga0501035_0241627_636_1415 244
830 3300049823 Ga0501044_0059542 Ga0501044_0059542_589_1368 244
831 3300050491 nmdc:mga00v17_2707_c1 nmdc:mga00v17_2707_c1_3159_3959 244
832 3300050491 nmdc:mga00v17_31527_c1 nmdc:mga00v17_31527_c1_1186_1986 244
833 3300050494 nmdc:mga06z11_111245_c1 nmdc:mga06z11_111245_c1_264_1064 244
834 3300050496 nmdc:mga07m45_58622_c1 nmdc:mga07m45_58622_c1_979_1764 244
835 3300050507 nmdc:mga05p37_119483_c1 nmdc:mga05p37_119483_c1_1285_2085 244
836 3300050507 nmdc:mga05p37_374844_c1 nmdc:mga05p37_374844_c1_209_988 244
837 3300050509 nmdc:mga0qj67_992_c1 nmdc:mga0qj67_992_c1_6926_7705 244
838 3300050510 nmdc:mga06r32_111486_c1 nmdc:mga06r32_111486_c1_533_1333 244
839 3300050511 nmdc:mga08y16_229632_c1 nmdc:mga08y16_229632_c1_1043_1843 244
840 3300050512 nmdc:mga0n895_132741_c1 nmdc:mga0n895_132741_c1_517_1296 244
841 3300050515 nmdc:mga0a205_391613_c1 nmdc:mga0a205_391613_c1_159_938 244
842 3300050516 nmdc:mga0sz30_13101_c1 nmdc:mga0sz30_13101_c1_1314_2114 244
843 3300050516 nmdc:mga0sz30_34826_c1 nmdc:mga0sz30_34826_c1_1105_1905 244
844 3300053077 Ga0495601_0158548 Ga0495601_0158548_341_1120 244
845 3300053078 Ga0495612_0025403 Ga0495612_0025403_199_978 244
846 3300053084 Ga0495595_0003839 Ga0495595_0003839_2636_3415 244
847 3300053088 Ga0500644_0029016 Ga0500644_0029016_909_1688 244
848 3300053092 Ga0500583_0046072 Ga0500583_0046072_520_1299 244
849 3300053096 Ga0500641_0017733 Ga0500641_0017733_823_1602 244
850 3300053109 Ga0500569_017482 Ga0500569_017482_192_971 244
851 3300053131 Ga0500652_047283 Ga0500652_047283_773_1552 244
852 3300053139 Ga0500568_0003911 Ga0500568_0003911_5751_6530 244
853 3300053146 Ga0500588_0002726 Ga0500588_0002726_467_1246 244
854 3300053149 Ga0500600_0066452 Ga0500600_0066452_33_812 244
855 3300053159 Ga0500630_080537 Ga0500630_080537_493_1272 244
856 3300053160 Ga0500633_0130479 Ga0500633_0130479_41_820 244
857 3300061719 Ga0466962_0017907 Ga0466962_0017907_1458_2237 244
858 3300061719 Ga0466962_0038075 Ga0466962_0038075_437_1216 244
859 3300061719 Ga0466962_0052483 Ga0466962_0052483_428_1207 244
860 iso_pu_bacteria 2867507094 2867508357 244
861 iso_pu_bacteria 8001781756 8001782038 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

53

238

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rln-assembly1.cif.gz_A structural basis of cytosolic dna recognition by innate immune receptors 0.8583 128 156
3b6y-assembly2.cif.gz_B crystal structure of the second hin-200 domain of interferon-inducible protein 16 0.847 128 156
6hhx-assembly1.cif.gz_B structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine 0.8451 129 155
4cj2-assembly2.cif.gz_D crystal structure of hewl in complex with affitin h4 0.8407 132 155
6hhx-assembly1.cif.gz_A structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine 0.8404 129 155
ID Description Score Start End Superfamily
af_Q9JLC4_344_670_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.8537 131 155 2.120.10.10
af_A0A0R0JSL2_58_168_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8423 129 155 3.60.10.10
1wydB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8398 129 153 2.40.50.140
af_P0DOV2_527_619_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.839 128 156 2.40.50.140
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8389 1 215 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A348NR47-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9005 1 166 GO:0005829
GO:0009055
AF-A0A0M8TA28-F1-model_v4 Electron transfer flavoprotein subunit beta 0.8981 102 168
AF-A0A6G3BPL7-F1-model_v4 Electron transfer flavoprotein subunit beta 0.8947 1 173 GO:0005829
GO:0009055
AF-A0A7K1A1C4-F1-model_v4 Electron transfer flavoprotein subunit beta 0.8838 1 174 GO:0005829
GO:0009055
AF-A0A7K2ECA5-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.8823 1 209 GO:0009055

Feature Viewer

pLDDT pTM Quality
86.2 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map