F483855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 861 | 439 | 787 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0071568|Ga0466960_0071568_500_1369 |
| Length | 289 |
| Sequence | MRRYRPVTSKIGAGGPTVRALKPLAEVGLTMNIVVLVKQVPDSGTPRSLDPADNTVARAAADNVINEIDEYAIEEALTVKEAQGGEVTVLTVGPDSATDAIRKALSMGADKAVHVVDDAIHGSCAVQTSAVLAAALQQMDYDLVLMGATSTDGQVAVMPALLSERLGIPQVSGARKLTVADGKVQVERQTDGGFWALEAPLPAIVSTWDTINEPRYPSFKGIMAAKKKPVEKKSLADLGIDPSTVGLASATSQVLDFAGRPPKGEGVKVNDEGDGAQKLVEYLASQKIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 2 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 5 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 6 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 7 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 8 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 9 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 10 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 11 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 12 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 13 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 14 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 15 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 16 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 17 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 18 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 19 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 20 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 21 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 22 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 23 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 24 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 25 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 26 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 27 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 28 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 29 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 30 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 31 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 32 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 33 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 34 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 35 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 36 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 37 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 38 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 39 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 40 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 41 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 42 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 43 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 44 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 45 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 46 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 47 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 48 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 49 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 50 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 51 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 52 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 53 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 54 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 55 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 56 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 57 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 58 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 59 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 60 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 61 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 62 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 63 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 64 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 65 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 101 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 102 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 117 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 119 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 120 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 121 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 123 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 124 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 125 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 126 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 129 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 130 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 133 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 134 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 135 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 137 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 140 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 141 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 143 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 144 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 145 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 146 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 147 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 148 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 149 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 151 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 176 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 187 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 189 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 190 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 254 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 255 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 257 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 258 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 260 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 261 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 262 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 263 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 264 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 265 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 266 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 267 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 268 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 269 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 270 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 275 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 276 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 277 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 278 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 279 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 280 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 287 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 296 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 300 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 301 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 308 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 310 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 311 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 312 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 313 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 314 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 315 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 316 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 320 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 321 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 322 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 323 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 324 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 325 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 326 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 327 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 364 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 365 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 366 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 372 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 373 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 374 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 375 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 376 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 377 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 378 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 379 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 417 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 419 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 420 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 421 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 424 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 425 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 428 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 429 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 430 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 431 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 432 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 433 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 434 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 435 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 436 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 437 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 438 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 439 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.85 |
| Metatranscriptomes | 2.56 |
| Isolates | 8.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.32 |
| Nodule | 0.7 |
| Rhizoplane | 5.92 |
| Rhizosphere | 80.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1007256 | 3300000549 | Bacteria | 1363 |
| 2 | JGI24737J22298_10052087 | 3300001990 | Bacteria | 1242 |
| 3 | JGI24744J21845_10001881 | 3300002077 | Bacteria | 4219 |
| 4 | JGI24744J21845_10009849 | 3300002077 | Bacteria | 1962 |
| 5 | JGI24742J22300_10001138 | 3300002244 | Bacteria | 4130 |
| 6 | Ga0006778J45830_1043793 | 3300003162 | Bacteria | 899 |
| 7 | JGI25406J46586_10007522 | 3300003203 | Bacteria | 4964 |
| 8 | JGI25406J46586_10026569 | 3300003203 | Bacteria | 2230 |
| 9 | JGI25406J46586_10036226 | 3300003203 | Bacteria | 1793 |
| 10 | JGI25406J46586_10046149 | 3300003203 | Bacteria | 1495 |
| 11 | Ga0058859_11209305 | 3300004798 | Bacteria | 1117 |
| 12 | Ga0070658_10036125 | 3300005327 | Bacteria | 3981 |
| 13 | Ga0070676_10034665 | 3300005328 | Bacteria | 2898 |
| 14 | Ga0070676_10192469 | 3300005328 | Bacteria | 1332 |
| 15 | Ga0070690_100010751 | 3300005330 | Bacteria | 5336 |
| 16 | Ga0070690_100077738 | 3300005330 | Bacteria | 2167 |
| 17 | Ga0070690_100160073 | 3300005330 | Bacteria | 1542 |
| 18 | Ga0070677_10131241 | 3300005333 | Bacteria | 1144 |
| 19 | Ga0068869_100001538 | 3300005334 | Bacteria | 13707 |
| 20 | Ga0068869_100102748 | 3300005334 | Bacteria | 2164 |
| 21 | Ga0068869_100288990 | 3300005334 | Bacteria | 1320 |
| 22 | Ga0070680_100005701 | 3300005336 | Bacteria | 9442 |
| 23 | Ga0070680_100183315 | 3300005336 | Bacteria | 1763 |
| 24 | Ga0070682_100109494 | 3300005337 | Bacteria | 1838 |
| 25 | Ga0068868_100002112 | 3300005338 | Bacteria | 13688 |
| 26 | Ga0068868_100086561 | 3300005338 | Bacteria | 2519 |
| 27 | Ga0070660_100488367 | 3300005339 | Bacteria | 1024 |
| 28 | Ga0070689_100007064 | 3300005340 | Bacteria | 7817 |
| 29 | Ga0070691_10044583 | 3300005341 | Bacteria | 2104 |
| 30 | Ga0070691_10077057 | 3300005341 | Bacteria | 1626 |
| 31 | Ga0070692_10010017 | 3300005345 | Bacteria | 4298 |
| 32 | Ga0070692_10165194 | 3300005345 | Bacteria | 1271 |
| 33 | Ga0070668_100010272 | 3300005347 | Bacteria | 6949 |
| 34 | Ga0070668_100073553 | 3300005347 | Bacteria | 2664 |
| 35 | Ga0070668_100172447 | 3300005347 | Bacteria | 1762 |
| 36 | Ga0070668_100215450 | 3300005347 | Bacteria | 1581 |
| 37 | Ga0070668_100534304 | 3300005347 | Bacteria | 1019 |
| 38 | Ga0070669_100093801 | 3300005353 | Bacteria | 2254 |
| 39 | Ga0070675_100006710 | 3300005354 | Bacteria | 8850 |
| 40 | Ga0070671_100000660 | 3300005355 | Bacteria | 24797 |
| 41 | Ga0070674_100145139 | 3300005356 | Bacteria | 1785 |
| 42 | Ga0070673_100209720 | 3300005364 | Bacteria | 1682 |
| 43 | Ga0070688_100015773 | 3300005365 | Bacteria | 4306 |
| 44 | Ga0070659_100082176 | 3300005366 | Bacteria | 2574 |
| 45 | Ga0070667_100002279 | 3300005367 | Bacteria | 16894 |
| 46 | Ga0070667_100030108 | 3300005367 | Bacteria | 4526 |
| 47 | Ga0070667_100258142 | 3300005367 | Bacteria | 1560 |
| 48 | Ga0070714_100080473 | 3300005435 | Bacteria | 2835 |
| 49 | Ga0070713_100375416 | 3300005436 | Bacteria | 1324 |
| 50 | Ga0070713_100452587 | 3300005436 | Bacteria | 1206 |
| 51 | Ga0070710_10001277 | 3300005437 | Bacteria | 11953 |
| 52 | Ga0070710_10166698 | 3300005437 | Bacteria | 1370 |
| 53 | Ga0070710_10284799 | 3300005437 | Bacteria | 1073 |
| 54 | Ga0070701_10034555 | 3300005438 | Bacteria | 2533 |
| 55 | Ga0070711_100001571 | 3300005439 | Bacteria | 12571 |
| 56 | Ga0070711_100015196 | 3300005439 | Bacteria | 4868 |
| 57 | Ga0070711_100587608 | 3300005439 | Bacteria | 928 |
| 58 | Ga0070705_100017669 | 3300005440 | Bacteria | 3726 |
| 59 | Ga0070705_100065015 | 3300005440 | Bacteria | 2182 |
| 60 | Ga0070700_100000088 | 3300005441 | Bacteria | 61864 |
| 61 | Ga0070700_100001394 | 3300005441 | Bacteria | 12009 |
| 62 | Ga0070700_100572294 | 3300005441 | Bacteria | 881 |
| 63 | Ga0070694_100104870 | 3300005444 | Bacteria | 2005 |
| 64 | Ga0070694_100374745 | 3300005444 | Bacteria | 1108 |
| 65 | Ga0070708_100055287 | 3300005445 | Bacteria | 3529 |
| 66 | Ga0070663_100018971 | 3300005455 | Bacteria | 4522 |
| 67 | Ga0070663_100097814 | 3300005455 | Bacteria | 2185 |
| 68 | Ga0070678_100000985 | 3300005456 | Bacteria | 14721 |
| 69 | Ga0070678_100174495 | 3300005456 | Bacteria | 1754 |
| 70 | Ga0070678_100463256 | 3300005456 | Bacteria | 1112 |
| 71 | Ga0070662_100022956 | 3300005457 | Bacteria | 4280 |
| 72 | Ga0070662_100028424 | 3300005457 | Bacteria | 3891 |
| 73 | Ga0070662_100172251 | 3300005457 | Bacteria | 1700 |
| 74 | Ga0070681_10004253 | 3300005458 | Bacteria | 13572 |
| 75 | Ga0068867_100000404 | 3300005459 | Bacteria | 29014 |
| 76 | Ga0068867_100128950 | 3300005459 | Bacteria | 1963 |
| 77 | Ga0070685_10152033 | 3300005466 | Bacteria | 1467 |
| 78 | Ga0070685_10412754 | 3300005466 | Bacteria | 937 |
| 79 | Ga0070706_100011901 | 3300005467 | Bacteria | 8076 |
| 80 | Ga0070706_100027827 | 3300005467 | Bacteria | 5200 |
| 81 | Ga0070706_100144106 | 3300005467 | Bacteria | 2224 |
| 82 | Ga0070706_100292841 | 3300005467 | Bacteria | 1519 |
| 83 | Ga0070707_100000256 | 3300005468 | Bacteria | 53538 |
| 84 | Ga0070707_100008621 | 3300005468 | Bacteria | 9465 |
| 85 | Ga0070707_100076895 | 3300005468 | Bacteria | 3220 |
| 86 | Ga0070707_100115330 | 3300005468 | Bacteria | 2607 |
| 87 | Ga0070707_100420591 | 3300005468 | Bacteria | 1297 |
| 88 | Ga0070698_100033546 | 3300005471 | Bacteria | 5317 |
| 89 | Ga0070698_100035045 | 3300005471 | Bacteria | 5190 |
| 90 | Ga0070698_100046972 | 3300005471 | Bacteria | 4414 |
| 91 | Ga0070699_100067973 | 3300005518 | Bacteria | 3094 |
| 92 | Ga0070679_100007103 | 3300005530 | Bacteria | 10449 |
| 93 | Ga0070679_100078349 | 3300005530 | Bacteria | 3293 |
| 94 | Ga0070679_100202088 | 3300005530 | Bacteria | 1952 |
| 95 | Ga0070684_100138184 | 3300005535 | Bacteria | 2202 |
| 96 | Ga0070684_100241988 | 3300005535 | Bacteria | 1649 |
| 97 | Ga0068853_100157482 | 3300005539 | Bacteria | 2047 |
| 98 | Ga0068853_100227962 | 3300005539 | Bacteria | 1703 |
| 99 | Ga0070672_100174187 | 3300005543 | Bacteria | 1790 |
| 100 | Ga0070695_100080722 | 3300005545 | Bacteria | 2150 |
| 101 | Ga0070696_100104220 | 3300005546 | Bacteria | 2036 |
| 102 | Ga0070693_100100901 | 3300005547 | Bacteria | 1758 |
| 103 | Ga0070693_100295719 | 3300005547 | Bacteria | 1089 |
| 104 | Ga0070665_100006667 | 3300005548 | Bacteria | 11741 |
| 105 | Ga0070665_100036041 | 3300005548 | Bacteria | 4977 |
| 106 | Ga0070665_100207197 | 3300005548 | Bacteria | 1961 |
| 107 | Ga0070665_100232216 | 3300005548 | Bacteria | 1845 |
| 108 | Ga0070704_100001226 | 3300005549 | Bacteria | 13507 |
| 109 | Ga0070704_100187582 | 3300005549 | Bacteria | 1659 |
| 110 | Ga0068855_100106991 | 3300005563 | Bacteria | 3214 |
| 111 | Ga0068855_100456480 | 3300005563 | Bacteria | 1394 |
| 112 | Ga0070664_100005365 | 3300005564 | Bacteria | 10290 |
| 113 | Ga0068857_100127700 | 3300005577 | Bacteria | 2292 |
| 114 | Ga0068857_100130327 | 3300005577 | Bacteria | 2268 |
| 115 | Ga0068857_100285451 | 3300005577 | Bacteria | 1519 |
| 116 | Ga0068857_100389631 | 3300005577 | Bacteria | 1295 |
| 117 | Ga0068857_100439471 | 3300005577 | Bacteria | 1218 |
| 118 | Ga0068854_100001406 | 3300005578 | Bacteria | 14522 |
| 119 | Ga0068854_100167135 | 3300005578 | Bacteria | 1708 |
| 120 | Ga0068856_100003019 | 3300005614 | Bacteria | 17239 |
| 121 | Ga0068856_100094781 | 3300005614 | Bacteria | 2972 |
| 122 | Ga0068856_100259297 | 3300005614 | Bacteria | 1754 |
| 123 | Ga0070702_100000347 | 3300005615 | Bacteria | 16145 |
| 124 | Ga0070702_100192079 | 3300005615 | Bacteria | 1344 |
| 125 | Ga0068852_100152494 | 3300005616 | Bacteria | 2150 |
| 126 | Ga0068852_100204692 | 3300005616 | Bacteria | 1869 |
| 127 | Ga0068859_100079740 | 3300005617 | Bacteria | 3314 |
| 128 | Ga0068864_100008230 | 3300005618 | Bacteria | 8602 |
| 129 | Ga0068864_100125656 | 3300005618 | Bacteria | 2298 |
| 130 | Ga0068864_100234324 | 3300005618 | Bacteria | 1699 |
| 131 | Ga0068864_100350926 | 3300005618 | Bacteria | 1392 |
| 132 | Ga0068866_10001788 | 3300005718 | Bacteria | 9046 |
| 133 | Ga0068866_10144847 | 3300005718 | Bacteria | 1368 |
| 134 | Ga0068861_100032541 | 3300005719 | Bacteria | 3839 |
| 135 | Ga0068861_100325692 | 3300005719 | Bacteria | 1339 |
| 136 | Ga0068863_100014312 | 3300005841 | Bacteria | 7642 |
| 137 | Ga0068863_100031833 | 3300005841 | Bacteria | 5031 |
| 138 | Ga0068863_100086939 | 3300005841 | Bacteria | 2962 |
| 139 | Ga0068863_100095166 | 3300005841 | Bacteria | 2827 |
| 140 | Ga0068858_100006025 | 3300005842 | Bacteria | 11823 |
| 141 | Ga0068858_100015931 | 3300005842 | Bacteria | 7062 |
| 142 | Ga0068858_100105269 | 3300005842 | Bacteria | 2632 |
| 143 | Ga0068858_100280519 | 3300005842 | Bacteria | 1586 |
| 144 | Ga0068860_100004983 | 3300005843 | Bacteria | 13533 |
| 145 | Ga0068860_100041810 | 3300005843 | Bacteria | 4379 |
| 146 | Ga0068860_100270666 | 3300005843 | Bacteria | 1658 |
| 147 | Ga0068862_100011571 | 3300005844 | Bacteria | 7278 |
| 148 | Ga0068862_100064458 | 3300005844 | Bacteria | 3154 |
| 149 | Ga0081455_10004297 | 3300005937 | Bacteria | 16037 |
| 150 | Ga0081538_10066848 | 3300005981 | Bacteria | 2011 |
| 151 | Ga0081540_1031200 | 3300005983 | Bacteria | 2935 |
| 152 | Ga0081540_1056257 | 3300005983 | Bacteria | 1910 |
| 153 | Ga0081539_10000706 | 3300005985 | Bacteria | 66923 |
| 154 | Ga0081539_10001346 | 3300005985 | Bacteria | 42790 |
| 155 | Ga0081539_10004243 | 3300005985 | Bacteria | 16099 |
| 156 | Ga0081539_10008166 | 3300005985 | Bacteria | 9232 |
| 157 | Ga0081539_10010521 | 3300005985 | Bacteria | 7498 |
| 158 | Ga0070717_10002691 | 3300006028 | Bacteria | 12526 |
| 159 | Ga0070717_10032743 | 3300006028 | Bacteria | 4191 |
| 160 | Ga0075364_10003109 | 3300006051 | Bacteria | 9392 |
| 161 | Ga0075364_10244467 | 3300006051 | Bacteria | 1219 |
| 162 | Ga0070715_10044225 | 3300006163 | Bacteria | 1882 |
| 163 | Ga0070715_10051233 | 3300006163 | Bacteria | 1776 |
| 164 | Ga0070715_10103097 | 3300006163 | Bacteria | 1334 |
| 165 | Ga0070716_100047995 | 3300006173 | Bacteria | 2411 |
| 166 | Ga0070716_100050887 | 3300006173 | Bacteria | 2353 |
| 167 | Ga0070712_100001155 | 3300006175 | Bacteria | 15956 |
| 168 | Ga0070712_100115740 | 3300006175 | Bacteria | 2010 |
| 169 | Ga0070712_100270310 | 3300006175 | Bacteria | 1365 |
| 170 | Ga0070712_100390913 | 3300006175 | Bacteria | 1147 |
| 171 | Ga0075369_10008069 | 3300006186 | Bacteria | 4037 |
| 172 | Ga0097621_100028126 | 3300006237 | Bacteria | 4429 |
| 173 | Ga0097621_100073376 | 3300006237 | Bacteria | 2833 |
| 174 | Ga0068871_100192239 | 3300006358 | Bacteria | 1758 |
| 175 | Ga0075428_100013229 | 3300006844 | Bacteria | 9181 |
| 176 | Ga0075428_100019167 | 3300006844 | Bacteria | 7567 |
| 177 | Ga0075428_100127004 | 3300006844 | Bacteria | 2775 |
| 178 | Ga0075428_100395764 | 3300006844 | Bacteria | 1481 |
| 179 | Ga0075428_100538251 | 3300006844 | Bacteria | 1249 |
| 180 | Ga0075428_100613417 | 3300006844 | Bacteria | 1162 |
| 181 | Ga0075430_100000172 | 3300006846 | Bacteria | 42600 |
| 182 | Ga0075430_100047945 | 3300006846 | Bacteria | 3607 |
| 183 | Ga0075430_100050293 | 3300006846 | Bacteria | 3515 |
| 184 | Ga0075430_100120536 | 3300006846 | Bacteria | 2187 |
| 185 | Ga0075430_100148082 | 3300006846 | Bacteria | 1955 |
| 186 | Ga0075431_100014192 | 3300006847 | Bacteria | 8056 |
| 187 | Ga0075431_100038656 | 3300006847 | Bacteria | 4915 |
| 188 | Ga0075431_100089627 | 3300006847 | Bacteria | 3175 |
| 189 | Ga0075431_100186681 | 3300006847 | Bacteria | 2126 |
| 190 | Ga0075431_100218855 | 3300006847 | Bacteria | 1943 |
| 191 | Ga0075433_10106479 | 3300006852 | Bacteria | 2485 |
| 192 | Ga0075429_100002268 | 3300006880 | Bacteria | 16126 |
| 193 | Ga0075429_100014921 | 3300006880 | Bacteria | 6739 |
| 194 | Ga0068865_100008010 | 3300006881 | Bacteria | 6524 |
| 195 | Ga0068865_100077216 | 3300006881 | Bacteria | 2379 |
| 196 | Ga0097620_100079742 | 3300006931 | Bacteria | 3314 |
| 197 | Ga0099795_10006768 | 3300007788 | Bacteria | 3148 |
| 198 | Ga0105240_10379487 | 3300009093 | Bacteria | 1597 |
| 199 | Ga0105240_11075148 | 3300009093 | Bacteria | 857 |
| 200 | Ga0111539_10036267 | 3300009094 | Bacteria | 5964 |
| 201 | Ga0111539_10442320 | 3300009094 | Bacteria | 1514 |
| 202 | Ga0111539_10602207 | 3300009094 | Bacteria | 1280 |
| 203 | Ga0105245_10000730 | 3300009098 | Bacteria | 29616 |
| 204 | Ga0105245_10015094 | 3300009098 | Bacteria | 6729 |
| 205 | Ga0105247_10005433 | 3300009101 | Bacteria | 8027 |
| 206 | Ga0105247_10067807 | 3300009101 | Bacteria | 2224 |
| 207 | Ga0105247_10301526 | 3300009101 | Bacteria | 1112 |
| 208 | Ga0114129_10000056 | 3300009147 | Bacteria | 99329 |
| 209 | Ga0114129_10001563 | 3300009147 | Bacteria | 31087 |
| 210 | Ga0114129_10001688 | 3300009147 | Bacteria | 30106 |
| 211 | Ga0114129_10221450 | 3300009147 | Bacteria | 2552 |
| 212 | Ga0114129_10497595 | 3300009147 | Bacteria | 1592 |
| 213 | Ga0114129_10513751 | 3300009147 | Bacteria | 1563 |
| 214 | Ga0114129_10538825 | 3300009147 | Bacteria | 1519 |
| 215 | Ga0114129_10580775 | 3300009147 | Bacteria | 1454 |
| 216 | Ga0114129_10622621 | 3300009147 | Bacteria | 1396 |
| 217 | Ga0105243_10000504 | 3300009148 | Bacteria | 39912 |
| 218 | Ga0105243_10045363 | 3300009148 | Bacteria | 3454 |
| 219 | Ga0105243_10642111 | 3300009148 | Bacteria | 1028 |
| 220 | Ga0105241_10146323 | 3300009174 | Bacteria | 1928 |
| 221 | Ga0105241_10614491 | 3300009174 | Bacteria | 983 |
| 222 | Ga0105242_10000385 | 3300009176 | Bacteria | 35131 |
| 223 | Ga0105242_10388218 | 3300009176 | Bacteria | 1299 |
| 224 | Ga0105248_10185066 | 3300009177 | Bacteria | 2347 |
| 225 | Ga0105248_10523977 | 3300009177 | Bacteria | 1336 |
| 226 | Ga0105237_10848340 | 3300009545 | Bacteria | 920 |
| 227 | Ga0105238_10029759 | 3300009551 | Bacteria | 5562 |
| 228 | Ga0105238_10378008 | 3300009551 | Bacteria | 1408 |
| 229 | Ga0105249_10191833 | 3300009553 | Bacteria | 1995 |
| 230 | Ga0105249_10643001 | 3300009553 | Bacteria | 1118 |
| 231 | Ga0105239_10005637 | 3300010375 | Bacteria | 14630 |
| 232 | Ga0105239_10271523 | 3300010375 | Bacteria | 1907 |
| 233 | Ga0105246_10112244 | 3300011119 | Bacteria | 2004 |
| 234 | Ga0157371_10207633 | 3300013102 | Bacteria | 1405 |
| 235 | Ga0157371_10271609 | 3300013102 | Bacteria | 1224 |
| 236 | Ga0157370_10186250 | 3300013104 | Bacteria | 1927 |
| 237 | Ga0157370_10619493 | 3300013104 | Bacteria | 990 |
| 238 | Ga0157369_10376288 | 3300013105 | Bacteria | 1474 |
| 239 | Ga0157369_10545288 | 3300013105 | Bacteria | 1199 |
| 240 | Ga0157374_10098956 | 3300013296 | Bacteria | 2793 |
| 241 | Ga0157374_10115064 | 3300013296 | Bacteria | 2590 |
| 242 | Ga0157374_10409088 | 3300013296 | Bacteria | 1354 |
| 243 | Ga0157378_10002662 | 3300013297 | Bacteria | 15894 |
| 244 | Ga0157378_10093403 | 3300013297 | Bacteria | 2738 |
| 245 | Ga0163162_10076847 | 3300013306 | Bacteria | 3401 |
| 246 | Ga0163162_10682351 | 3300013306 | Bacteria | 1150 |
| 247 | Ga0157372_10007432 | 3300013307 | Bacteria | 11652 |
| 248 | Ga0157372_10146397 | 3300013307 | Bacteria | 2724 |
| 249 | Ga0157375_10001165 | 3300013308 | Bacteria | 22730 |
| 250 | Ga0157375_10759211 | 3300013308 | Bacteria | 1121 |
| 251 | Ga0157375_10862045 | 3300013308 | Bacteria | 1052 |
| 252 | Ga0163163_10059054 | 3300014325 | Bacteria | 3793 |
| 253 | Ga0163163_10216108 | 3300014325 | Bacteria | 1966 |
| 254 | Ga0163163_10248278 | 3300014325 | Bacteria | 1830 |
| 255 | Ga0163163_10631117 | 3300014325 | Bacteria | 1135 |
| 256 | Ga0163163_10702150 | 3300014325 | Bacteria | 1075 |
| 257 | Ga0163163_10967724 | 3300014325 | Bacteria | 914 |
| 258 | Ga0157380_10000356 | 3300014326 | Bacteria | 27415 |
| 259 | Ga0182008_10089211 | 3300014497 | Bacteria | 1519 |
| 260 | Ga0182008_10100376 | 3300014497 | Bacteria | 1430 |
| 261 | Ga0157377_10061763 | 3300014745 | Bacteria | 2142 |
| 262 | Ga0157379_10017816 | 3300014968 | Bacteria | 6257 |
| 263 | Ga0157379_10059255 | 3300014968 | Bacteria | 3423 |
| 264 | Ga0157379_10147831 | 3300014968 | Bacteria | 2119 |
| 265 | Ga0157379_10428420 | 3300014968 | Bacteria | 1219 |
| 266 | Ga0157376_10022738 | 3300014969 | Bacteria | 4894 |
| 267 | Ga0157376_10378187 | 3300014969 | Bacteria | 1363 |
| 268 | Ga0163161_10000586 | 3300017792 | Bacteria | 29129 |
| 269 | Ga0163161_10166940 | 3300017792 | Bacteria | 1681 |
| 270 | Ga0197907_10709708 | 3300020069 | Bacteria | 885 |
| 271 | Ga0197907_11373820 | 3300020069 | Bacteria | 1184 |
| 272 | Ga0197907_11471116 | 3300020069 | Bacteria | 4139 |
| 273 | Ga0206356_10257786 | 3300020070 | Bacteria | 2430 |
| 274 | Ga0206356_11622265 | 3300020070 | Bacteria | 5081 |
| 275 | Ga0206351_10176129 | 3300020077 | Bacteria | 2662 |
| 276 | Ga0206351_10298870 | 3300020077 | Bacteria | 1279 |
| 277 | Ga0206351_10870924 | 3300020077 | Bacteria | 2055 |
| 278 | Ga0206352_11097006 | 3300020078 | Bacteria | 1918 |
| 279 | Ga0206350_10404111 | 3300020080 | Bacteria | 1323 |
| 280 | Ga0206354_10154531 | 3300020081 | Bacteria | 1308 |
| 281 | Ga0206354_10713285 | 3300020081 | Bacteria | 2823 |
| 282 | Ga0206353_11062360 | 3300020082 | Bacteria | 1636 |
| 283 | Ga0154015_1193276 | 3300020610 | Bacteria | 1145 |
| 284 | Ga0154015_1446516 | 3300020610 | Bacteria | 2103 |
| 285 | Ga0213873_10000139 | 3300021358 | Bacteria | 13843 |
| 286 | Ga0213875_10012490 | 3300021388 | Bacteria | 4193 |
| 287 | Ga0207672_1003656 | 3300025223 | Bacteria | 879 |
| 288 | Ga0207653_10037313 | 3300025885 | Bacteria | 1585 |
| 289 | Ga0207682_10138289 | 3300025893 | Bacteria | 1091 |
| 290 | Ga0207692_10001360 | 3300025898 | Bacteria | 9128 |
| 291 | Ga0207692_10140779 | 3300025898 | Bacteria | 1372 |
| 292 | Ga0207642_10000335 | 3300025899 | Bacteria | 14091 |
| 293 | Ga0207642_10117844 | 3300025899 | Bacteria | 1364 |
| 294 | Ga0207710_10001367 | 3300025900 | Bacteria | 12243 |
| 295 | Ga0207710_10049197 | 3300025900 | Bacteria | 1888 |
| 296 | Ga0207710_10078716 | 3300025900 | Bacteria | 1525 |
| 297 | Ga0207688_10000291 | 3300025901 | Bacteria | 22924 |
| 298 | Ga0207688_10003914 | 3300025901 | Bacteria | 8119 |
| 299 | Ga0207688_10110888 | 3300025901 | Bacteria | 1592 |
| 300 | Ga0207647_10129932 | 3300025904 | Bacteria | 1481 |
| 301 | Ga0207647_10137707 | 3300025904 | Bacteria | 1432 |
| 302 | Ga0207699_10009907 | 3300025906 | Bacteria | 4764 |
| 303 | Ga0207699_10250566 | 3300025906 | Bacteria | 1220 |
| 304 | Ga0207699_10483297 | 3300025906 | Bacteria | 892 |
| 305 | Ga0207645_10095524 | 3300025907 | Bacteria | 1914 |
| 306 | Ga0207645_10185565 | 3300025907 | Bacteria | 1365 |
| 307 | Ga0207705_10004958 | 3300025909 | Bacteria | 9994 |
| 308 | Ga0207684_10003863 | 3300025910 | Bacteria | 14398 |
| 309 | Ga0207684_10010500 | 3300025910 | Bacteria | 8148 |
| 310 | Ga0207684_10028204 | 3300025910 | Bacteria | 4782 |
| 311 | Ga0207707_10004458 | 3300025912 | Bacteria | 12330 |
| 312 | Ga0207695_10349510 | 3300025913 | Bacteria | 1366 |
| 313 | Ga0207693_10000049 | 3300025915 | Bacteria | 100347 |
| 314 | Ga0207693_10036232 | 3300025915 | Bacteria | 3888 |
| 315 | Ga0207693_10083768 | 3300025915 | Bacteria | 2498 |
| 316 | Ga0207663_10001607 | 3300025916 | Bacteria | 10627 |
| 317 | Ga0207663_10028741 | 3300025916 | Bacteria | 3258 |
| 318 | Ga0207660_10000423 | 3300025917 | Bacteria | 27874 |
| 319 | Ga0207660_10592632 | 3300025917 | Bacteria | 903 |
| 320 | Ga0207657_10055510 | 3300025919 | Bacteria | 3421 |
| 321 | Ga0207657_10438006 | 3300025919 | Bacteria | 1026 |
| 322 | Ga0207652_10000455 | 3300025921 | Bacteria | 42150 |
| 323 | Ga0207652_10108368 | 3300025921 | Bacteria | 2461 |
| 324 | Ga0207652_10128226 | 3300025921 | Bacteria | 2261 |
| 325 | Ga0207646_10002655 | 3300025922 | Bacteria | 20967 |
| 326 | Ga0207646_10006235 | 3300025922 | Bacteria | 12393 |
| 327 | Ga0207646_10009832 | 3300025922 | Bacteria | 9417 |
| 328 | Ga0207646_10070412 | 3300025922 | Bacteria | 3123 |
| 329 | Ga0207646_10131225 | 3300025922 | Bacteria | 2255 |
| 330 | Ga0207681_10028903 | 3300025923 | Bacteria | 3595 |
| 331 | Ga0207681_10237597 | 3300025923 | Bacteria | 1417 |
| 332 | Ga0207694_10294048 | 3300025924 | Bacteria | 1336 |
| 333 | Ga0207659_10003058 | 3300025926 | Bacteria | 9988 |
| 334 | Ga0207687_10000816 | 3300025927 | Bacteria | 21046 |
| 335 | Ga0207687_10009213 | 3300025927 | Bacteria | 6459 |
| 336 | Ga0207687_10341466 | 3300025927 | Bacteria | 1218 |
| 337 | Ga0207700_10004366 | 3300025928 | Bacteria | 8327 |
| 338 | Ga0207700_10008373 | 3300025928 | Bacteria | 6403 |
| 339 | Ga0207700_10091515 | 3300025928 | Bacteria | 2403 |
| 340 | Ga0207664_10005215 | 3300025929 | Bacteria | 8862 |
| 341 | Ga0207664_10210072 | 3300025929 | Bacteria | 1684 |
| 342 | Ga0207644_10003347 | 3300025931 | Bacteria | 10340 |
| 343 | Ga0207644_10093464 | 3300025931 | Bacteria | 2245 |
| 344 | Ga0207690_10013887 | 3300025932 | Bacteria | 4851 |
| 345 | Ga0207690_10127818 | 3300025932 | Bacteria | 1855 |
| 346 | Ga0207706_10408708 | 3300025933 | Bacteria | 1176 |
| 347 | Ga0207686_10001914 | 3300025934 | Bacteria | 11525 |
| 348 | Ga0207709_10005434 | 3300025935 | Bacteria | 7241 |
| 349 | Ga0207709_10075520 | 3300025935 | Bacteria | 2154 |
| 350 | Ga0207670_10117163 | 3300025936 | Bacteria | 1930 |
| 351 | Ga0207669_10013219 | 3300025937 | Bacteria | 4091 |
| 352 | Ga0207704_10002624 | 3300025938 | Bacteria | 8114 |
| 353 | Ga0207704_10517492 | 3300025938 | Bacteria | 964 |
| 354 | Ga0207665_10133356 | 3300025939 | Bacteria | 1765 |
| 355 | Ga0207665_10135293 | 3300025939 | Bacteria | 1753 |
| 356 | Ga0207691_10103158 | 3300025940 | Bacteria | 2543 |
| 357 | Ga0207711_10320778 | 3300025941 | Bacteria | 1432 |
| 358 | Ga0207689_10023976 | 3300025942 | Bacteria | 5119 |
| 359 | Ga0207689_10156631 | 3300025942 | Bacteria | 1878 |
| 360 | Ga0207689_10178243 | 3300025942 | Bacteria | 1753 |
| 361 | Ga0207689_10403599 | 3300025942 | Bacteria | 1139 |
| 362 | Ga0207661_10071480 | 3300025944 | Bacteria | 2836 |
| 363 | Ga0207661_10575537 | 3300025944 | Bacteria | 1033 |
| 364 | Ga0207679_10016844 | 3300025945 | Bacteria | 4859 |
| 365 | Ga0207667_10310958 | 3300025949 | Bacteria | 1609 |
| 366 | Ga0207712_10015701 | 3300025961 | Bacteria | 4890 |
| 367 | Ga0207712_10068331 | 3300025961 | Bacteria | 2546 |
| 368 | Ga0207712_10476725 | 3300025961 | Bacteria | 1063 |
| 369 | Ga0207668_10006205 | 3300025972 | Bacteria | 7057 |
| 370 | Ga0207668_10019285 | 3300025972 | Bacteria | 4309 |
| 371 | Ga0207668_10134358 | 3300025972 | Bacteria | 1893 |
| 372 | Ga0207640_10003447 | 3300025981 | Bacteria | 8518 |
| 373 | Ga0207640_10024210 | 3300025981 | Bacteria | 3660 |
| 374 | Ga0207658_10068535 | 3300025986 | Bacteria | 2677 |
| 375 | Ga0207677_10000712 | 3300026023 | Bacteria | 19642 |
| 376 | Ga0207677_10157675 | 3300026023 | Bacteria | 1760 |
| 377 | Ga0207677_10451463 | 3300026023 | Bacteria | 1102 |
| 378 | Ga0207703_10013902 | 3300026035 | Bacteria | 6274 |
| 379 | Ga0207703_10040056 | 3300026035 | Bacteria | 3748 |
| 380 | Ga0207703_10096432 | 3300026035 | Bacteria | 2497 |
| 381 | Ga0207703_10165043 | 3300026035 | Bacteria | 1942 |
| 382 | Ga0207703_10299283 | 3300026035 | Bacteria | 1466 |
| 383 | Ga0207639_10105653 | 3300026041 | Bacteria | 2285 |
| 384 | Ga0207639_10305274 | 3300026041 | Bacteria | 1408 |
| 385 | Ga0207639_10767491 | 3300026041 | Bacteria | 897 |
| 386 | Ga0207678_10034977 | 3300026067 | Bacteria | 4375 |
| 387 | Ga0207678_10059971 | 3300026067 | Bacteria | 3273 |
| 388 | Ga0207678_10061476 | 3300026067 | Bacteria | 3230 |
| 389 | Ga0207678_10098509 | 3300026067 | Bacteria | 2498 |
| 390 | Ga0207708_10000079 | 3300026075 | Bacteria | 75645 |
| 391 | Ga0207708_10033556 | 3300026075 | Bacteria | 3900 |
| 392 | Ga0207708_10150223 | 3300026075 | Bacteria | 1833 |
| 393 | Ga0207702_10001934 | 3300026078 | Bacteria | 20217 |
| 394 | Ga0207702_10162441 | 3300026078 | Bacteria | 2041 |
| 395 | Ga0207641_10006415 | 3300026088 | Bacteria | 9912 |
| 396 | Ga0207641_10058708 | 3300026088 | Bacteria | 3275 |
| 397 | Ga0207641_10075809 | 3300026088 | Bacteria | 2905 |
| 398 | Ga0207641_10102256 | 3300026088 | Bacteria | 2526 |
| 399 | Ga0207641_10108139 | 3300026088 | Bacteria | 2461 |
| 400 | Ga0207648_10044760 | 3300026089 | Bacteria | 3884 |
| 401 | Ga0207648_10201213 | 3300026089 | Bacteria | 1766 |
| 402 | Ga0207676_10013384 | 3300026095 | Bacteria | 5893 |
| 403 | Ga0207676_10107617 | 3300026095 | Bacteria | 2326 |
| 404 | Ga0207676_10304444 | 3300026095 | Bacteria | 1456 |
| 405 | Ga0207676_10655529 | 3300026095 | Bacteria | 1013 |
| 406 | Ga0207674_10045352 | 3300026116 | Bacteria | 4522 |
| 407 | Ga0207674_10103805 | 3300026116 | Bacteria | 2821 |
| 408 | Ga0207674_10150999 | 3300026116 | Bacteria | 2280 |
| 409 | Ga0207674_10312621 | 3300026116 | Bacteria | 1520 |
| 410 | Ga0207675_100050918 | 3300026118 | Bacteria | 3865 |
| 411 | Ga0207675_100117416 | 3300026118 | Bacteria | 2515 |
| 412 | Ga0207675_100470919 | 3300026118 | Bacteria | 1247 |
| 413 | Ga0207683_10000184 | 3300026121 | Bacteria | 53332 |
| 414 | Ga0207683_10182028 | 3300026121 | Bacteria | 1905 |
| 415 | Ga0207683_10228693 | 3300026121 | Bacteria | 1696 |
| 416 | Ga0207698_10204557 | 3300026142 | Bacteria | 1771 |
| 417 | Ga0209179_1045169 | 3300027512 | Bacteria | 934 |
| 418 | Ga0268266_10006671 | 3300028379 | Bacteria | 10533 |
| 419 | Ga0268266_10009625 | 3300028379 | Bacteria | 8499 |
| 420 | Ga0268266_10061251 | 3300028379 | Bacteria | 3245 |
| 421 | Ga0268266_10084119 | 3300028379 | Bacteria | 2778 |
| 422 | Ga0268266_10605798 | 3300028379 | Bacteria | 1052 |
| 423 | Ga0268265_10017563 | 3300028380 | Bacteria | 4940 |
| 424 | Ga0268265_10209497 | 3300028380 | Bacteria | 1697 |
| 425 | Ga0268265_10806604 | 3300028380 | Bacteria | 915 |
| 426 | Ga0268264_10004268 | 3300028381 | Bacteria | 12200 |
| 427 | Ga0268264_10016350 | 3300028381 | Bacteria | 6076 |
| 428 | Ga0268264_10118601 | 3300028381 | Bacteria | 2329 |
| 429 | Ga0268264_10174511 | 3300028381 | Bacteria | 1947 |
| 430 | Ga0265336_10012827 | 3300028666 | Bacteria | 2809 |
| 431 | Ga0307517_10031743 | 3300028786 | Bacteria | 6135 |
| 432 | Ga0307515_10000045 | 3300028794 | Bacteria | 301029 |
| 433 | Ga0307515_10020864 | 3300028794 | Bacteria | 11649 |
| 434 | Ga0307515_10044616 | 3300028794 | Bacteria | 6842 |
| 435 | Ga0307515_10075426 | 3300028794 | Bacteria | 4493 |
| 436 | Ga0265338_10002382 | 3300028800 | Bacteria | 28317 |
| 437 | Ga0265338_10015126 | 3300028800 | Bacteria | 8512 |
| 438 | Ga0307511_10001243 | 3300030521 | Bacteria | 26957 |
| 439 | Ga0307512_10046936 | 3300030522 | Bacteria | 3517 |
| 440 | Ga0265760_10057539 | 3300031090 | Bacteria | 1177 |
| 441 | Ga0307513_10041669 | 3300031456 | Bacteria | 5064 |
| 442 | Ga0307513_10071510 | 3300031456 | Bacteria | 3620 |
| 443 | Ga0307513_10313798 | 3300031456 | Bacteria | 1329 |
| 444 | Ga0307509_10023422 | 3300031507 | Bacteria | 6934 |
| 445 | Ga0307509_10207234 | 3300031507 | Bacteria | 1790 |
| 446 | Ga0307408_100159898 | 3300031548 | Bacteria | 1788 |
| 447 | Ga0307408_100182411 | 3300031548 | Bacteria | 1684 |
| 448 | Ga0307508_10001989 | 3300031616 | Bacteria | 22344 |
| 449 | Ga0307508_10031993 | 3300031616 | Bacteria | 4753 |
| 450 | Ga0307508_10037965 | 3300031616 | Bacteria | 4331 |
| 451 | Ga0307508_10093582 | 3300031616 | Bacteria | 2595 |
| 452 | Ga0307516_10010141 | 3300031730 | Bacteria | 10402 |
| 453 | Ga0307405_10070252 | 3300031731 | Bacteria | 2248 |
| 454 | Ga0307405_10120831 | 3300031731 | Bacteria | 1792 |
| 455 | Ga0307405_10190124 | 3300031731 | Bacteria | 1482 |
| 456 | Ga0307405_10216688 | 3300031731 | Bacteria | 1402 |
| 457 | Ga0307405_10224596 | 3300031731 | Bacteria | 1380 |
| 458 | Ga0307405_10374818 | 3300031731 | Bacteria | 1106 |
| 459 | Ga0307413_10526141 | 3300031824 | Bacteria | 954 |
| 460 | Ga0307518_10000118 | 3300031838 | Bacteria | 55183 |
| 461 | Ga0307410_10009217 | 3300031852 | Bacteria | 5524 |
| 462 | Ga0307410_10053139 | 3300031852 | Bacteria | 2740 |
| 463 | Ga0307410_10311146 | 3300031852 | Bacteria | 1246 |
| 464 | Ga0307410_10334407 | 3300031852 | Bacteria | 1205 |
| 465 | Ga0326468_10000222 | 3300031889 | Bacteria | 5912 |
| 466 | Ga0307406_10001830 | 3300031901 | Bacteria | 11592 |
| 467 | Ga0307406_10227162 | 3300031901 | Bacteria | 1391 |
| 468 | Ga0307406_10261557 | 3300031901 | Bacteria | 1309 |
| 469 | Ga0307407_10192437 | 3300031903 | Bacteria | 1361 |
| 470 | Ga0307412_10119184 | 3300031911 | Bacteria | 1897 |
| 471 | Ga0307412_10174559 | 3300031911 | Bacteria | 1610 |
| 472 | Ga0307412_10186772 | 3300031911 | Bacteria | 1564 |
| 473 | Ga0307409_100000896 | 3300031995 | Bacteria | 13804 |
| 474 | Ga0307409_100019676 | 3300031995 | Bacteria | 4579 |
| 475 | Ga0307409_100118093 | 3300031995 | Bacteria | 2239 |
| 476 | Ga0307409_100158234 | 3300031995 | Bacteria | 1977 |
| 477 | Ga0307409_100245639 | 3300031995 | Bacteria | 1633 |
| 478 | Ga0307409_100333387 | 3300031995 | Bacteria | 1424 |
| 479 | Ga0307409_100342483 | 3300031995 | Bacteria | 1407 |
| 480 | Ga0307409_100483541 | 3300031995 | Bacteria | 1202 |
| 481 | Ga0307409_100540004 | 3300031995 | Bacteria | 1143 |
| 482 | Ga0307409_100686408 | 3300031995 | Bacteria | 1022 |
| 483 | Ga0307416_100016607 | 3300032002 | Bacteria | 5123 |
| 484 | Ga0307416_100142447 | 3300032002 | Bacteria | 2181 |
| 485 | Ga0307416_100195942 | 3300032002 | Bacteria | 1911 |
| 486 | Ga0307416_100201766 | 3300032002 | Bacteria | 1888 |
| 487 | Ga0307416_100253221 | 3300032002 | Bacteria | 1715 |
| 488 | Ga0307416_100325308 | 3300032002 | Bacteria | 1542 |
| 489 | Ga0307414_10045159 | 3300032004 | Bacteria | 3015 |
| 490 | Ga0307414_10530623 | 3300032004 | Bacteria | 1046 |
| 491 | Ga0307415_100021582 | 3300032126 | Bacteria | 3961 |
| 492 | Ga0307415_100022896 | 3300032126 | Bacteria | 3866 |
| 493 | Ga0307415_100076360 | 3300032126 | Bacteria | 2375 |
| 494 | Ga0307415_100272213 | 3300032126 | Bacteria | 1388 |
| 495 | Ga0307415_100346009 | 3300032126 | Bacteria | 1249 |
| 496 | Ga0307415_100651488 | 3300032126 | Bacteria | 944 |
| 497 | Ga0307507_10023912 | 3300033179 | Bacteria | 6683 |
| 498 | Ga0307510_10156592 | 3300033180 | Bacteria | 1884 |
| 499 | Ga0373938_0031597 | 3300034957 | Bacteria | 1136 |
| 500 | Ga0373926_0000890 | 3300035083 | Bacteria | 8568 |
| 501 | Ga0373926_0033009 | 3300035083 | Bacteria | 1828 |
| 502 | Ga0373940_0006757 | 3300035088 | Bacteria | 2562 |
| 503 | Ga0373923_0008873 | 3300035111 | Bacteria | 3607 |
| 504 | Ga0373936_0049895 | 3300035113 | Bacteria | 1691 |
| 505 | Ga0373941_0050561 | 3300035115 | Bacteria | 1320 |
| 506 | Ga0373953_0011143 | 3300035117 | Bacteria | 3147 |
| 507 | Ga0373954_0074727 | 3300035118 | Bacteria | 1613 |
| 508 | Ga0373957_0011809 | 3300035120 | Bacteria | 2925 |
| 509 | Ga0373960_0055161 | 3300035121 | Bacteria | 1190 |
| 510 | Ga0373943_0061428 | 3300035170 | Bacteria | 1878 |
| 511 | Ga0373946_0079777 | 3300035171 | Bacteria | 1430 |
| 512 | Ga0373955_0013453 | 3300035172 | Bacteria | 3959 |
| 513 | Ga0373942_0000264 | 3300035207 | Bacteria | 14026 |
| 514 | Ga0373924_0047950 | 3300035410 | Bacteria | 1763 |
| 515 | Ga0373931_0077729 | 3300035691 | Bacteria | 1824 |
| 516 | Ga0373935_0001786 | 3300035692 | Bacteria | 12101 |
| 517 | Ga0373935_0003202 | 3300035692 | Bacteria | 9448 |
| 518 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 519 | Ga0373937_0055734 | 3300036401 | Bacteria | 3629 |
| 520 | Ga0373937_0176641 | 3300036401 | Bacteria | 2005 |
| 521 | Ga0265778_001357 | 3300036457 | Bacteria | 2217 |
| 522 | Ga0373925_0176117 | 3300037068 | Bacteria | 1691 |
| 523 | Ga0373925_0334926 | 3300037068 | Bacteria | 1226 |
| 524 | Ga0395899_0030023 | 3300037312 | Bacteria | 4091 |
| 525 | Ga0395900_0019286 | 3300037418 | Bacteria | 6955 |
| 526 | Ga0395900_0031488 | 3300037418 | Bacteria | 5450 |
| 527 | Ga0395898_0004336 | 3300037466 | Bacteria | 15530 |
| 528 | Ga0395898_0105664 | 3300037466 | Bacteria | 2700 |
| 529 | Ga0395905_0025917 | 3300037471 | Bacteria | 5526 |
| 530 | Ga0436364_0125897 | 3300037853 | Bacteria | 7866 |
| 531 | Ga0436364_0170612 | 3300037853 | Bacteria | 3320 |
| 532 | Ga0436364_0670690 | 3300037853 | Bacteria | 5638 |
| 533 | Ga0436364_0881245 | 3300037853 | Bacteria | 2779 |
| 534 | Ga0436364_1296832 | 3300037853 | Bacteria | 11797 |
| 535 | Ga0395901_0004226 | 3300038443 | Bacteria | 14478 |
| 536 | Ga0395901_0148323 | 3300038443 | Bacteria | 2465 |
| 537 | Ga0436365_1698725 | 3300039437 | Bacteria | 3654 |
| 538 | Ga0436362_0900593 | 3300039453 | Bacteria | 33555 |
| 539 | Ga0439466_0011337 | 3300041411 | Bacteria | 3299 |
| 540 | Ga0451804_0081067 | 3300041463 | Bacteria | 1680 |
| 541 | Ga0451837_1036194 | 3300041494 | Bacteria | 1051 |
| 542 | Ga0451837_1701327 | 3300041494 | Bacteria | 1407 |
| 543 | Ga0451853_0366154 | 3300041512 | Bacteria | 9024 |
| 544 | Ga0439442_000871 | 3300042002 | Bacteria | 6205 |
| 545 | Ga0439459_0007460 | 3300042438 | Bacteria | 1848 |
| 546 | Ga0451577_0204162 | 3300042876 | Bacteria | 1784 |
| 547 | Ga0466969_0051017 | 3300044656 | Bacteria | 2037 |
| 548 | Ga0466972_0011943 | 3300044658 | Bacteria | 4363 |
| 549 | Ga0466972_0020465 | 3300044658 | Bacteria | 3306 |
| 550 | Ga0466965_0082975 | 3300044683 | Bacteria | 1622 |
| 551 | Ga0466965_0146726 | 3300044683 | Bacteria | 1231 |
| 552 | Ga0466966_0004593 | 3300044684 | Bacteria | 9097 |
| 553 | Ga0466966_0018018 | 3300044684 | Bacteria | 4664 |
| 554 | Ga0466966_0025144 | 3300044684 | Bacteria | 3891 |
| 555 | Ga0466966_0039457 | 3300044684 | Bacteria | 3041 |
| 556 | Ga0466966_0058255 | 3300044684 | Bacteria | 2442 |
| 557 | Ga0466966_0266512 | 3300044684 | Bacteria | 1031 |
| 558 | Ga0466966_0273852 | 3300044684 | Bacteria | 1016 |
| 559 | Ga0466961_0070421 | 3300044693 | Bacteria | 2220 |
| 560 | Ga0466961_0070855 | 3300044693 | Bacteria | 2213 |
| 561 | Ga0466961_0083880 | 3300044693 | Bacteria | 2015 |
| 562 | Ga0466961_0147946 | 3300044693 | Bacteria | 1468 |
| 563 | Ga0466961_0155802 | 3300044693 | Bacteria | 1425 |
| 564 | Ga0466963_0017279 | 3300044694 | Bacteria | 4495 |
| 565 | Ga0466963_0018365 | 3300044694 | Bacteria | 4371 |
| 566 | Ga0466963_0030949 | 3300044694 | Bacteria | 3456 |
| 567 | Ga0466963_0051668 | 3300044694 | Bacteria | 2725 |
| 568 | Ga0466963_0247655 | 3300044694 | Bacteria | 1250 |
| 569 | Ga0466963_0261392 | 3300044694 | Bacteria | 1215 |
| 570 | Ga0466964_0044015 | 3300044706 | Bacteria | 1813 |
| 571 | Ga0466964_0046124 | 3300044706 | Bacteria | 1775 |
| 572 | Ga0466964_0059660 | 3300044706 | Bacteria | 1585 |
| 573 | Ga0466964_0107947 | 3300044706 | Bacteria | 1237 |
| 574 | Ga0466971_0008766 | 3300044719 | Bacteria | 4412 |
| 575 | Ga0466971_0011381 | 3300044719 | Bacteria | 3897 |
| 576 | Ga0466971_0011508 | 3300044719 | Bacteria | 3873 |
| 577 | Ga0466971_0037281 | 3300044719 | Bacteria | 2179 |
| 578 | Ga0466971_0043046 | 3300044719 | Bacteria | 2029 |
| 579 | Ga0466971_0044511 | 3300044719 | Bacteria | 1993 |
| 580 | Ga0466971_0123300 | 3300044719 | Bacteria | 1200 |
| 581 | Ga0466968_0001405 | 3300044735 | Bacteria | 8627 |
| 582 | Ga0466970_0031469 | 3300044765 | Bacteria | 2802 |
| 583 | Ga0466970_0060040 | 3300044765 | Bacteria | 2036 |
| 584 | Ga0466957_0108379 | 3300044842 | Bacteria | 1759 |
| 585 | Ga0466957_0209765 | 3300044842 | Bacteria | 1282 |
| 586 | Ga0466957_0258149 | 3300044842 | Bacteria | 1160 |
| 587 | Ga0466960_0006650 | 3300044901 | Bacteria | 4648 |
| 588 | Ga0466960_0042131 | 3300044901 | Bacteria | 2166 |
| 589 | Ga0466960_0046291 | 3300044901 | Bacteria | 2082 |
| 590 | Ga0466960_0054401 | 3300044901 | Bacteria | 1943 |
| 591 | Ga0466960_0071568 | 3300044901 | Bacteria | 1727 |
| 592 | Ga0466960_0106934 | 3300044901 | Bacteria | 1448 |
| 593 | Ga0466960_0148549 | 3300044901 | Bacteria | 1250 |
| 594 | Ga0466959_0001545 | 3300045049 | Bacteria | 14163 |
| 595 | Ga0466959_0020240 | 3300045049 | Bacteria | 4899 |
| 596 | Ga0466959_0116879 | 3300045049 | Bacteria | 1899 |
| 597 | Ga0466959_0284935 | 3300045049 | Bacteria | 1133 |
| 598 | Ga0466959_0418831 | 3300045049 | Bacteria | 909 |
| 599 | Ga0466959_0455066 | 3300045049 | Bacteria | 867 |
| 600 | Ga0466958_0006216 | 3300045836 | Bacteria | 6481 |
| 601 | Ga0466958_0076215 | 3300045836 | Bacteria | 2058 |
| 602 | Ga0466958_0088779 | 3300045836 | Bacteria | 1910 |
| 603 | Ga0466958_0089794 | 3300045836 | Bacteria | 1900 |
| 604 | Ga0466958_0098827 | 3300045836 | Bacteria | 1813 |
| 605 | Ga0466958_0120689 | 3300045836 | Bacteria | 1641 |
| 606 | Ga0466967_0000157 | 3300045976 | Bacteria | 27186 |
| 607 | Ga0466967_0007460 | 3300045976 | Bacteria | 7891 |
| 608 | Ga0466967_0009661 | 3300045976 | Bacteria | 7176 |
| 609 | Ga0466967_0011058 | 3300045976 | Bacteria | 6813 |
| 610 | Ga0466967_0020903 | 3300045976 | Bacteria | 5303 |
| 611 | Ga0466967_0051461 | 3300045976 | Bacteria | 3610 |
| 612 | Ga0466967_0060861 | 3300045976 | Bacteria | 3348 |
| 613 | Ga0466967_0132829 | 3300045976 | Bacteria | 2312 |
| 614 | Ga0466967_0149197 | 3300045976 | Bacteria | 2184 |
| 615 | Ga0466967_0161062 | 3300045976 | Bacteria | 2106 |
| 616 | Ga0466967_0176053 | 3300045976 | Bacteria | 2015 |
| 617 | Ga0466967_0263849 | 3300045976 | Bacteria | 1648 |
| 618 | Ga0466967_0403737 | 3300045976 | Bacteria | 1330 |
| 619 | Ga0495592_0012558 | 3300046454 | Bacteria | 6436 |
| 620 | Ga0495603_0004397 | 3300046455 | Bacteria | 8401 |
| 621 | Ga0495603_0182245 | 3300046455 | Bacteria | 1215 |
| 622 | Ga0495629_0041148 | 3300046459 | Bacteria | 3252 |
| 623 | Ga0495629_0141310 | 3300046459 | Bacteria | 1675 |
| 624 | Ga0495629_0183981 | 3300046459 | Bacteria | 1447 |
| 625 | Ga0495651_0009568 | 3300046462 | Bacteria | 7446 |
| 626 | Ga0495580_0113823 | 3300046472 | Bacteria | 1879 |
| 627 | Ga0495664_0017094 | 3300046477 | Bacteria | 4143 |
| 628 | Ga0495594_0003426 | 3300046499 | Bacteria | 8182 |
| 629 | Ga0495628_0124496 | 3300046516 | Bacteria | 1975 |
| 630 | Ga0495630_0144676 | 3300046517 | Bacteria | 1808 |
| 631 | Ga0495630_0268476 | 3300046517 | Bacteria | 1303 |
| 632 | Ga0495632_0160106 | 3300046519 | Bacteria | 1037 |
| 633 | Ga0495666_0092176 | 3300046526 | Bacteria | 1429 |
| 634 | Ga0495652_0149229 | 3300046529 | Bacteria | 1828 |
| 635 | Ga0495665_0115513 | 3300046531 | Bacteria | 1406 |
| 636 | Ga0495645_0076536 | 3300046543 | Bacteria | 2407 |
| 637 | Ga0495668_0280021 | 3300046616 | Bacteria | 914 |
| 638 | Ga0495634_0033316 | 3300046642 | Bacteria | 3540 |
| 639 | Ga0495657_0058106 | 3300046675 | Bacteria | 2569 |
| 640 | Ga0495623_0011563 | 3300046679 | Bacteria | 5715 |
| 641 | Ga0495646_0053323 | 3300046680 | Bacteria | 2438 |
| 642 | Ga0495624_0031544 | 3300046690 | Bacteria | 3443 |
| 643 | Ga0495624_0249828 | 3300046690 | Bacteria | 1073 |
| 644 | Ga0495600_0113698 | 3300046809 | Bacteria | 1762 |
| 645 | Ga0495604_0232565 | 3300047317 | Bacteria | 1263 |
| 646 | Ga0495672_0070041 | 3300047320 | Bacteria | 1989 |
| 647 | Ga0495676_0184959 | 3300047321 | Bacteria | 1457 |
| 648 | Ga0495680_0239051 | 3300047322 | Bacteria | 1290 |
| 649 | Ga0495675_0007693 | 3300047444 | Bacteria | 6646 |
| 650 | Ga0495684_0006994 | 3300047471 | Bacteria | 8762 |
| 651 | Ga0495593_0078823 | 3300047673 | Bacteria | 1705 |
| 652 | Ga0495602_0081358 | 3300048088 | Bacteria | 2723 |
| 653 | Ga0496100_0006929 | 3300048903 | Bacteria | 6212 |
| 654 | Ga0496100_0010164 | 3300048903 | Bacteria | 5321 |
| 655 | Ga0496100_0133308 | 3300048903 | Bacteria | 1752 |
| 656 | Ga0496101_0026648 | 3300048904 | Bacteria | 4020 |
| 657 | Ga0496101_0074556 | 3300048904 | Bacteria | 2496 |
| 658 | Ga0496102_0000030 | 3300048905 | Bacteria | 221326 |
| 659 | Ga0496102_0000976 | 3300048905 | Bacteria | 26908 |
| 660 | Ga0496102_0005338 | 3300048905 | Bacteria | 10909 |
| 661 | Ga0496102_0234873 | 3300048905 | Bacteria | 1728 |
| 662 | Ga0496103_0000068 | 3300048906 | Bacteria | 121996 |
| 663 | Ga0496103_0005142 | 3300048906 | Bacteria | 7875 |
| 664 | Ga0496104_0004070 | 3300048907 | Bacteria | 12681 |
| 665 | Ga0496104_0015707 | 3300048907 | Bacteria | 6867 |
| 666 | Ga0496104_0096351 | 3300048907 | Bacteria | 2830 |
| 667 | Ga0496104_0300003 | 3300048907 | Bacteria | 1519 |
| 668 | Ga0496105_0018374 | 3300048908 | Bacteria | 5617 |
| 669 | Ga0496105_0023416 | 3300048908 | Bacteria | 5008 |
| 670 | Ga0496105_0027387 | 3300048908 | Bacteria | 4656 |
| 671 | Ga0496105_0181950 | 3300048908 | Bacteria | 1721 |
| 672 | Ga0496105_0255820 | 3300048908 | Bacteria | 1418 |
| 673 | Ga0496106_0003384 | 3300048909 | Bacteria | 11884 |
| 674 | Ga0496106_0257548 | 3300048909 | Bacteria | 1396 |
| 675 | Ga0496107_0000383 | 3300048910 | Bacteria | 24008 |
| 676 | Ga0496108_0000111 | 3300048911 | Bacteria | 82745 |
| 677 | Ga0496108_0012767 | 3300048911 | Bacteria | 6839 |
| 678 | Ga0496108_0018306 | 3300048911 | Bacteria | 5736 |
| 679 | Ga0496108_0031658 | 3300048911 | Bacteria | 4390 |
| 680 | Ga0496108_0034906 | 3300048911 | Bacteria | 4179 |
| 681 | Ga0496108_0049489 | 3300048911 | Bacteria | 3515 |
| 682 | Ga0496108_0332328 | 3300048911 | Bacteria | 1325 |
| 683 | Ga0496108_0348777 | 3300048911 | Bacteria | 1292 |
| 684 | Ga0496109_0025238 | 3300048912 | Bacteria | 5294 |
| 685 | Ga0496109_0045242 | 3300048912 | Bacteria | 3993 |
| 686 | Ga0496109_0353309 | 3300048912 | Bacteria | 1388 |
| 687 | Ga0496109_0486518 | 3300048912 | Bacteria | 1165 |
| 688 | Ga0496110_0045802 | 3300048913 | Bacteria | 3824 |
| 689 | Ga0496110_0245050 | 3300048913 | Bacteria | 1631 |
| 690 | Ga0496111_0047756 | 3300048914 | Bacteria | 3083 |
| 691 | Ga0496111_0081553 | 3300048914 | Bacteria | 2361 |
| 692 | Ga0496111_0203221 | 3300048914 | Bacteria | 1472 |
| 693 | Ga0496112_0026180 | 3300048915 | Bacteria | 5609 |
| 694 | Ga0496112_0310705 | 3300048915 | Bacteria | 1521 |
| 695 | Ga0496112_0350995 | 3300048915 | Bacteria | 1417 |
| 696 | Ga0496113_0104993 | 3300048916 | Bacteria | 2193 |
| 697 | Ga0496113_0168939 | 3300048916 | Bacteria | 1732 |
| 698 | Ga0496113_0340373 | 3300048916 | Bacteria | 1203 |
| 699 | Ga0496114_0002030 | 3300048917 | Bacteria | 15418 |
| 700 | Ga0496114_0411070 | 3300048917 | Bacteria | 1198 |
| 701 | Ga0496115_0004444 | 3300048918 | Bacteria | 10165 |
| 702 | Ga0496115_0186268 | 3300048918 | Bacteria | 1715 |
| 703 | Ga0496116_0000152 | 3300048919 | Bacteria | 141311 |
| 704 | Ga0496117_0000059 | 3300048920 | Bacteria | 260163 |
| 705 | Ga0496118_0000061 | 3300048921 | Bacteria | 220889 |
| 706 | Ga0496118_0203369 | 3300048921 | Bacteria | 1170 |
| 707 | Ga0496119_0001310 | 3300048922 | Bacteria | 30642 |
| 708 | Ga0496120_0022502 | 3300048923 | Bacteria | 3964 |
| 709 | Ga0496121_0047196 | 3300048924 | Bacteria | 3678 |
| 710 | Ga0496121_0058209 | 3300048924 | Bacteria | 3196 |
| 711 | Ga0496124_0020330 | 3300048927 | Bacteria | 6140 |
| 712 | Ga0496125_0034873 | 3300048928 | Bacteria | 4426 |
| 713 | Ga0496126_0000213 | 3300048929 | Bacteria | 128366 |
| 714 | Ga0496126_0021483 | 3300048929 | Bacteria | 6303 |
| 715 | Ga0501318_004057 | 3300049534 | Bacteria | 1384 |
| 716 | Ga0501318_015052 | 3300049534 | Bacteria | 920 |
| 717 | Ga0501321_008874 | 3300049537 | Bacteria | 1075 |
| 718 | Ga0501031_0340208 | 3300049568 | Bacteria | 971 |
| 719 | Ga0501032_0047866 | 3300049569 | Bacteria | 2887 |
| 720 | Ga0501034_0440837 | 3300049571 | Bacteria | 1221 |
| 721 | Ga0501034_0517336 | 3300049571 | Bacteria | 1106 |
| 722 | Ga0501036_0400352 | 3300049572 | Bacteria | 1145 |
| 723 | Ga0501037_0190213 | 3300049573 | Bacteria | 1453 |
| 724 | Ga0501038_0039540 | 3300049574 | Bacteria | 4125 |
| 725 | Ga0501038_0394583 | 3300049574 | Bacteria | 1071 |
| 726 | Ga0501039_0436604 | 3300049575 | Bacteria | 1028 |
| 727 | Ga0501042_0132542 | 3300049578 | Bacteria | 1796 |
| 728 | Ga0501042_0362305 | 3300049578 | Bacteria | 1049 |
| 729 | Ga0501043_0562824 | 3300049579 | Bacteria | 846 |
| 730 | Ga0501046_0179994 | 3300049580 | Bacteria | 1581 |
| 731 | Ga0501047_0033318 | 3300049581 | Bacteria | 4972 |
| 732 | Ga0501047_0223391 | 3300049581 | Bacteria | 1739 |
| 733 | Ga0501047_0579287 | 3300049581 | Bacteria | 945 |
| 734 | Ga0501069_0012874 | 3300049585 | Bacteria | 4454 |
| 735 | Ga0501072_0511399 | 3300049588 | Bacteria | 950 |
| 736 | Ga0501074_0033213 | 3300049590 | Bacteria | 3739 |
| 737 | Ga0501035_0241627 | 3300049822 | Bacteria | 1536 |
| 738 | Ga0501044_0027569 | 3300049823 | Bacteria | 6001 |
| 739 | Ga0501044_0059542 | 3300049823 | Bacteria | 3912 |
| 740 | Ga0501044_0282723 | 3300049823 | Bacteria | 1592 |
| 741 | nmdc:mga00v17_2707_c1 | 3300050491 | Bacteria | 9094 |
| 742 | nmdc:mga00v17_31527_c1 | 3300050491 | Bacteria | 3127 |
| 743 | nmdc:mga06z11_111245_c1 | 3300050494 | Bacteria | 1517 |
| 744 | nmdc:mga07m45_58622_c1 | 3300050496 | Bacteria | 2178 |
| 745 | nmdc:mga05p37_106_c2 | 3300050507 | Bacteria | 31952 |
| 746 | nmdc:mga05p37_119483_c1 | 3300050507 | Bacteria | 3238 |
| 747 | nmdc:mga05p37_374844_c1 | 3300050507 | Bacteria | 1669 |
| 748 | nmdc:mga05p37_466289_c1 | 3300050507 | Bacteria | 1458 |
| 749 | nmdc:mga05p37_500100_c1 | 3300050507 | Bacteria | 1395 |
| 750 | nmdc:mga05p37_720_c1 | 3300050507 | Bacteria | 36593 |
| 751 | nmdc:mga05p37_8792_c1 | 3300050507 | Bacteria | 11934 |
| 752 | nmdc:mga09592_17727_c1 | 3300050508 | Bacteria | 5836 |
| 753 | nmdc:mga09592_283_c1 | 3300050508 | Bacteria | 37042 |
| 754 | nmdc:mga09592_73481_c1 | 3300050508 | Bacteria | 2905 |
| 755 | nmdc:mga0qj67_18091_c1 | 3300050509 | Bacteria | 5369 |
| 756 | nmdc:mga0qj67_6_c1 | 3300050509 | Bacteria | 17977 |
| 757 | nmdc:mga0qj67_99093_c1 | 3300050509 | Bacteria | 2348 |
| 758 | nmdc:mga0qj67_992_c1 | 3300050509 | Bacteria | 19574 |
| 759 | nmdc:mga06r32_101443_c1 | 3300050510 | Bacteria | 2825 |
| 760 | nmdc:mga06r32_111486_c1 | 3300050510 | Bacteria | 2692 |
| 761 | nmdc:mga06r32_1181_c1 | 3300050510 | Bacteria | 23551 |
| 762 | nmdc:mga06r32_7649_c1 | 3300050510 | Bacteria | 9717 |
| 763 | nmdc:mga08y16_13716_c1 | 3300050511 | Bacteria | 8532 |
| 764 | nmdc:mga08y16_229632_c1 | 3300050511 | Bacteria | 1919 |
| 765 | nmdc:mga08y16_449371_c1 | 3300050511 | Bacteria | 1314 |
| 766 | nmdc:mga0n895_132741_c1 | 3300050512 | Bacteria | 2516 |
| 767 | nmdc:mga0a205_391613_c1 | 3300050515 | Bacteria | 1254 |
| 768 | nmdc:mga0sz30_13101_c1 | 3300050516 | Bacteria | 3240 |
| 769 | nmdc:mga0sz30_34826_c1 | 3300050516 | Bacteria | 2099 |
| 770 | Ga0495601_0158548 | 3300053077 | Bacteria | 1478 |
| 771 | Ga0495612_0025403 | 3300053078 | Bacteria | 2378 |
| 772 | Ga0495595_0003839 | 3300053084 | Bacteria | 5989 |
| 773 | Ga0500644_0029016 | 3300053088 | Bacteria | 1736 |
| 774 | Ga0500583_0046072 | 3300053092 | Bacteria | 2005 |
| 775 | Ga0500641_0017733 | 3300053096 | Bacteria | 2668 |
| 776 | Ga0500660_020708 | 3300053100 | Bacteria | 3505 |
| 777 | Ga0500569_017482 | 3300053109 | Bacteria | 1834 |
| 778 | Ga0500652_047283 | 3300053131 | Bacteria | 1748 |
| 779 | Ga0500568_0003911 | 3300053139 | Bacteria | 8106 |
| 780 | Ga0500588_0002726 | 3300053146 | Bacteria | 3635 |
| 781 | Ga0500600_0066452 | 3300053149 | Bacteria | 1991 |
| 782 | Ga0500630_080537 | 3300053159 | Bacteria | 1524 |
| 783 | Ga0500633_0130479 | 3300053160 | Bacteria | 938 |
| 784 | Ga0466962_0017907 | 3300061719 | Bacteria | 3409 |
| 785 | Ga0466962_0038075 | 3300061719 | Bacteria | 2303 |
| 786 | Ga0466962_0052483 | 3300061719 | Bacteria | 1949 |
| 787 | Ga0466962_0148837 | 3300061719 | Bacteria | 1135 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0579287 | Ga0501047_0579287_242_931 | 211 |
| 2 | 3300009147 | Ga0114129_10513751 | Ga0114129_105137512 | 222 |
| 3 | 3300025942 | Ga0207689_10403599 | Ga0207689_104035992 | 225 |
| 4 | 3300005468 | Ga0070707_100115330 | Ga0070707_1001153302 | 227 |
| 5 | 3300005518 | Ga0070699_100067973 | Ga0070699_1000679732 | 227 |
| 6 | 3300025922 | Ga0207646_10070412 | Ga0207646_100704123 | 227 |
| 7 | iso_pu_bacteria | 8003830390 | 8003831193 | 228 |
| 8 | 3300028800 | Ga0265338_10015126 | Ga0265338_100151262 | 229 |
| 9 | 3300042876 | Ga0451577_0204162 | Ga0451577_0204162_567_1322 | 229 |
| 10 | 3300005445 | Ga0070708_100055287 | Ga0070708_1000552873 | 230 |
| 11 | 3300005467 | Ga0070706_100027827 | Ga0070706_1000278271 | 230 |
| 12 | 3300005467 | Ga0070706_100144106 | Ga0070706_1001441062 | 230 |
| 13 | 3300005468 | Ga0070707_100000256 | Ga0070707_1000002565 | 230 |
| 14 | 3300005468 | Ga0070707_100076895 | Ga0070707_1000768952 | 230 |
| 15 | 3300005471 | Ga0070698_100035045 | Ga0070698_1000350451 | 230 |
| 16 | 3300005471 | Ga0070698_100046972 | Ga0070698_1000469723 | 230 |
| 17 | 3300006028 | Ga0070717_10032743 | Ga0070717_100327434 | 230 |
| 18 | 3300025910 | Ga0207684_10003863 | Ga0207684_100038639 | 230 |
| 19 | 3300025910 | Ga0207684_10028204 | Ga0207684_100282044 | 230 |
| 20 | 3300025922 | Ga0207646_10002655 | Ga0207646_100026557 | 230 |
| 21 | 3300025922 | Ga0207646_10009832 | Ga0207646_100098324 | 230 |
| 22 | 3300025929 | Ga0207664_10005215 | Ga0207664_100052153 | 230 |
| 23 | 3300031090 | Ga0265760_10057539 | Ga0265760_100575392 | 230 |
| 24 | iso_pu_bacteria | 2862507626 | 2862516603 | 232 |
| 25 | 3300038443 | Ga0395901_0004226 | Ga0395901_0004226_11616_12395 | 233 |
| 26 | 3300013296 | Ga0157374_10409088 | Ga0157374_104090882 | 234 |
| 27 | 3300037853 | Ga0436364_0670690 | Ga0436364_0670690_2566_3354 | 234 |
| 28 | 3300045976 | Ga0466967_0000157 | Ga0466967_0000157_4627_5409 | 234 |
| 29 | 3300006175 | Ga0070712_100390913 | Ga0070712_1003909132 | 235 |
| 30 | 3300048911 | Ga0496108_0332328 | Ga0496108_0332328_36_815 | 235 |
| 31 | 3300048912 | Ga0496109_0025238 | Ga0496109_0025238_1450_2229 | 235 |
| 32 | 3300009147 | Ga0114129_10538825 | Ga0114129_105388251 | 236 |
| 33 | 3300025944 | Ga0207661_10575537 | Ga0207661_105755371 | 236 |
| 34 | 3300036401 | Ga0373937_0176641 | Ga0373937_0176641_1036_1812 | 236 |
| 35 | 3300044735 | Ga0466968_0001405 | Ga0466968_0001405_1032_1814 | 236 |
| 36 | 3300046455 | Ga0495603_0004397 | Ga0495603_0004397_460_1221 | 236 |
| 37 | 3300001990 | JGI24737J22298_10052087 | JGI24737J22298_100520871 | 237 |
| 38 | 3300005327 | Ga0070658_10036125 | Ga0070658_100361254 | 237 |
| 39 | 3300005530 | Ga0070679_100202088 | Ga0070679_1002020882 | 237 |
| 40 | 3300005535 | Ga0070684_100241988 | Ga0070684_1002419882 | 237 |
| 41 | 3300009093 | Ga0105240_11075148 | Ga0105240_110751481 | 237 |
| 42 | 3300020069 | Ga0197907_10709708 | Ga0197907_107097081 | 237 |
| 43 | 3300020070 | Ga0206356_10257786 | Ga0206356_102577863 | 237 |
| 44 | 3300020081 | Ga0206354_10154531 | Ga0206354_101545312 | 237 |
| 45 | 3300025904 | Ga0207647_10129932 | Ga0207647_101299322 | 237 |
| 46 | 3300025904 | Ga0207647_10137707 | Ga0207647_101377072 | 237 |
| 47 | 3300025921 | Ga0207652_10128226 | Ga0207652_101282262 | 237 |
| 48 | 3300025944 | Ga0207661_10071480 | Ga0207661_100714803 | 237 |
| 49 | 3300038443 | Ga0395901_0148323 | Ga0395901_0148323_576_1418 | 237 |
| 50 | 3300044706 | Ga0466964_0044015 | Ga0466964_0044015_80_859 | 237 |
| 51 | 3300044901 | Ga0466960_0106934 | Ga0466960_0106934_573_1352 | 237 |
| 52 | 3300045836 | Ga0466958_0089794 | Ga0466958_0089794_607_1386 | 237 |
| 53 | 3300045976 | Ga0466967_0011058 | Ga0466967_0011058_5694_6473 | 237 |
| 54 | 3300045976 | Ga0466967_0132829 | Ga0466967_0132829_769_1548 | 237 |
| 55 | 3300005530 | Ga0070679_100078349 | Ga0070679_1000783493 | 238 |
| 56 | 3300013104 | Ga0157370_10619493 | Ga0157370_106194932 | 238 |
| 57 | 3300020077 | Ga0206351_10870924 | Ga0206351_108709243 | 238 |
| 58 | 3300020080 | Ga0206350_10404111 | Ga0206350_104041111 | 238 |
| 59 | 3300020082 | Ga0206353_11062360 | Ga0206353_110623602 | 238 |
| 60 | 3300020610 | Ga0154015_1193276 | Ga0154015_11932762 | 238 |
| 61 | 3300025921 | Ga0207652_10108368 | Ga0207652_101083682 | 238 |
| 62 | 3300032126 | Ga0307415_100651488 | Ga0307415_1006514882 | 238 |
| 63 | 3300044658 | Ga0466972_0020465 | Ga0466972_0020465_284_1063 | 238 |
| 64 | 3300044694 | Ga0466963_0018365 | Ga0466963_0018365_398_1177 | 238 |
| 65 | 3300044706 | Ga0466964_0046124 | Ga0466964_0046124_102_881 | 238 |
| 66 | 3300044719 | Ga0466971_0008766 | Ga0466971_0008766_272_1051 | 238 |
| 67 | 3300044901 | Ga0466960_0148549 | Ga0466960_0148549_319_1098 | 238 |
| 68 | 3300045976 | Ga0466967_0020903 | Ga0466967_0020903_255_1052 | 238 |
| 69 | 3300049588 | Ga0501072_0511399 | Ga0501072_0511399_124_903 | 238 |
| 70 | 3300049823 | Ga0501044_0282723 | Ga0501044_0282723_478_1257 | 238 |
| 71 | 3300061719 | Ga0466962_0148837 | Ga0466962_0148837_165_944 | 238 |
| 72 | 3300005614 | Ga0068856_100259297 | Ga0068856_1002592972 | 239 |
| 73 | 3300005618 | Ga0068864_100350926 | Ga0068864_1003509262 | 239 |
| 74 | 3300014968 | Ga0157379_10428420 | Ga0157379_104284202 | 239 |
| 75 | 3300026095 | Ga0207676_10655529 | Ga0207676_106555291 | 239 |
| 76 | 3300045836 | Ga0466958_0098827 | Ga0466958_0098827_62_841 | 239 |
| 77 | 3300046690 | Ga0495624_0249828 | Ga0495624_0249828_46_825 | 239 |
| 78 | 3300050511 | nmdc:mga08y16_449371_c1 | nmdc:mga08y16_449371_c1_507_1277 | 239 |
| 79 | iso_pu_bacteria | 2675903059 | 2676480843 | 239 |
| 80 | iso_pu_bacteria | 2816332139 | 2816505041 | 239 |
| 81 | iso_pu_bacteria | 2816332139 | 2816507091 | 239 |
| 82 | 3300031548 | Ga0307408_100182411 | Ga0307408_1001824112 | 240 |
| 83 | 3300031731 | Ga0307405_10224596 | Ga0307405_102245962 | 240 |
| 84 | 3300031838 | Ga0307518_10000118 | Ga0307518_1000011820 | 240 |
| 85 | 3300032126 | Ga0307415_100346009 | Ga0307415_1003460092 | 240 |
| 86 | iso_pu_bacteria | 2515154088 | 2515496124 | 240 |
| 87 | iso_pu_bacteria | 2515154129 | 2515719894 | 240 |
| 88 | iso_pu_bacteria | 2515154137 | 2515758431 | 240 |
| 89 | iso_pu_bacteria | 2515154202 | 2516082443 | 240 |
| 90 | iso_pu_bacteria | 2515154203 | 2516090388 | 240 |
| 91 | iso_pu_bacteria | 2558860112 | 2558910766 | 240 |
| 92 | iso_pu_bacteria | 2558860280 | 2559429469 | 240 |
| 93 | iso_pu_bacteria | 2622736605 | 2623501224 | 240 |
| 94 | iso_pu_bacteria | 2622736626 | 2623587109 | 240 |
| 95 | iso_pu_bacteria | 2622736626 | 2623588246 | 240 |
| 96 | iso_pu_bacteria | 2751185782 | 2753264849 | 240 |
| 97 | iso_pu_bacteria | 2772190715 | 2772642507 | 240 |
| 98 | iso_pu_bacteria | 2775506925 | 2776370061 | 240 |
| 99 | iso_pu_bacteria | 2831935698 | 2831937754 | 240 |
| 100 | iso_pu_bacteria | 2832004796 | 2832007437 | 240 |
| 101 | iso_pu_bacteria | 2855670206 | 2855671195 | 240 |
| 102 | iso_pu_bacteria | 2855676851 | 2855682395 | 240 |
| 103 | iso_pu_bacteria | 2855683550 | 2855689574 | 240 |
| 104 | iso_pu_bacteria | 2856858025 | 2856860922 | 240 |
| 105 | iso_pu_bacteria | 2857288857 | 2857295528 | 240 |
| 106 | iso_pu_bacteria | 2858848962 | 2858850681 | 240 |
| 107 | iso_pu_bacteria | 2858868258 | 2858874568 | 240 |
| 108 | iso_pu_bacteria | 2858882152 | 2858883948 | 240 |
| 109 | iso_pu_bacteria | 2858888857 | 2858889901 | 240 |
| 110 | iso_pu_bacteria | 2858895516 | 2858900752 | 240 |
| 111 | iso_pu_bacteria | 2858902515 | 2858903638 | 240 |
| 112 | iso_pu_bacteria | 2863067949 | 2863072918 | 240 |
| 113 | iso_pu_bacteria | 2866065130 | 2866067453 | 240 |
| 114 | iso_pu_bacteria | 2867302475 | 2867304984 | 240 |
| 115 | iso_pu_bacteria | 2867312974 | 2867315764 | 240 |
| 116 | iso_pu_bacteria | 2867319477 | 2867323770 | 240 |
| 117 | iso_pu_bacteria | 2869048445 | 2869050866 | 240 |
| 118 | iso_pu_bacteria | 2869061728 | 2869068169 | 240 |
| 119 | iso_pu_bacteria | 2869068681 | 2869071356 | 240 |
| 120 | iso_pu_bacteria | 2880489317 | 2880493191 | 240 |
| 121 | iso_pu_bacteria | 2880495981 | 2880499119 | 240 |
| 122 | iso_pu_bacteria | 2884693830 | 2884702614 | 240 |
| 123 | iso_pu_bacteria | 2895427314 | 2895429397 | 240 |
| 124 | iso_pu_bacteria | 2895442618 | 2895452114 | 240 |
| 125 | iso_pu_bacteria | 2902582711 | 2902587130 | 240 |
| 126 | iso_pu_bacteria | 2915358134 | 2915362932 | 240 |
| 127 | iso_pu_bacteria | 2929219909 | 2929221114 | 240 |
| 128 | iso_pu_bacteria | 2929226422 | 2929227707 | 240 |
| 129 | iso_pu_bacteria | 2996221748 | 2996222654 | 240 |
| 130 | iso_pu_bacteria | 3002998708 | 3002999884 | 240 |
| 131 | iso_pu_bacteria | 649633069 | 649811674 | 240 |
| 132 | iso_pu_bacteria | 8003856774 | 8003863880 | 240 |
| 133 | iso_pu_bacteria | 8003870546 | 8003876045 | 240 |
| 134 | iso_pu_bacteria | 8053945823 | 8053946644 | 240 |
| 135 | iso_pu_bacteria | 8054472261 | 8054476772 | 240 |
| 136 | iso_pu_bacteria | 8054704163 | 8054705120 | 240 |
| 137 | iso_pu_bacteria | 8054727385 | 8054730726 | 240 |
| 138 | iso_pu_bacteria | 8054734606 | 8054736344 | 240 |
| 139 | iso_pu_bacteria | 8055066027 | 8055072846 | 240 |
| 140 | iso_pu_bacteria | 8055172936 | 8055173044 | 240 |
| 141 | iso_pu_bacteria | 8055412473 | 8055418296 | 240 |
| 142 | 3300006051 | Ga0075364_10244467 | Ga0075364_102444672 | 241 |
| 143 | 3300026121 | Ga0207683_10182028 | Ga0207683_101820282 | 241 |
| 144 | 3300049823 | Ga0501044_0027569 | Ga0501044_0027569_4361_5134 | 241 |
| 145 | iso_pu_bacteria | 2523231044 | 2523386673 | 241 |
| 146 | iso_pu_bacteria | 2551306166 | 2552109708 | 241 |
| 147 | iso_pu_bacteria | 2585427649 | 2586058962 | 241 |
| 148 | iso_pu_bacteria | 2751185725 | 2753038392 | 241 |
| 149 | iso_pu_bacteria | 2751185792 | 2753326903 | 241 |
| 150 | iso_pu_bacteria | 2795385472 | 2795794263 | 241 |
| 151 | iso_pu_bacteria | 2808606522 | 2809592286 | 241 |
| 152 | iso_pu_bacteria | 2915768154 | 2915772917 | 241 |
| 153 | iso_pu_bacteria | 2932398195 | 2932399380 | 241 |
| 154 | iso_pu_bacteria | 2956939328 | 2956939348 | 241 |
| 155 | iso_pu_bacteria | 3001119090 | 3001122140 | 241 |
| 156 | 3300005330 | Ga0070690_100160073 | Ga0070690_1001600732 | 242 |
| 157 | 3300005334 | Ga0068869_100001538 | Ga0068869_10000153813 | 242 |
| 158 | 3300005338 | Ga0068868_100086561 | Ga0068868_1000865611 | 242 |
| 159 | 3300005345 | Ga0070692_10010017 | Ga0070692_100100172 | 242 |
| 160 | 3300005347 | Ga0070668_100172447 | Ga0070668_1001724472 | 242 |
| 161 | 3300005354 | Ga0070675_100006710 | Ga0070675_1000067105 | 242 |
| 162 | 3300005366 | Ga0070659_100082176 | Ga0070659_1000821762 | 242 |
| 163 | 3300005441 | Ga0070700_100572294 | Ga0070700_1005722941 | 242 |
| 164 | 3300005455 | Ga0070663_100097814 | Ga0070663_1000978143 | 242 |
| 165 | 3300005456 | Ga0070678_100174495 | Ga0070678_1001744952 | 242 |
| 166 | 3300005457 | Ga0070662_100028424 | Ga0070662_1000284245 | 242 |
| 167 | 3300005535 | Ga0070684_100138184 | Ga0070684_1001381844 | 242 |
| 168 | 3300005547 | Ga0070693_100100901 | Ga0070693_1001009013 | 242 |
| 169 | 3300005564 | Ga0070664_100005365 | Ga0070664_10000536510 | 242 |
| 170 | 3300005577 | Ga0068857_100127700 | Ga0068857_1001277002 | 242 |
| 171 | 3300005577 | Ga0068857_100285451 | Ga0068857_1002854512 | 242 |
| 172 | 3300005618 | Ga0068864_100234324 | Ga0068864_1002343242 | 242 |
| 173 | 3300005843 | Ga0068860_100270666 | Ga0068860_1002706662 | 242 |
| 174 | 3300005937 | Ga0081455_10004297 | Ga0081455_100042975 | 242 |
| 175 | 3300006844 | Ga0075428_100013229 | Ga0075428_10001322910 | 242 |
| 176 | 3300006844 | Ga0075428_100127004 | Ga0075428_1001270042 | 242 |
| 177 | 3300006844 | Ga0075428_100395764 | Ga0075428_1003957642 | 242 |
| 178 | 3300006844 | Ga0075428_100613417 | Ga0075428_1006134171 | 242 |
| 179 | 3300006846 | Ga0075430_100047945 | Ga0075430_1000479452 | 242 |
| 180 | 3300006846 | Ga0075430_100050293 | Ga0075430_1000502933 | 242 |
| 181 | 3300006846 | Ga0075430_100120536 | Ga0075430_1001205362 | 242 |
| 182 | 3300006846 | Ga0075430_100148082 | Ga0075430_1001480821 | 242 |
| 183 | 3300006847 | Ga0075431_100014192 | Ga0075431_1000141923 | 242 |
| 184 | 3300006847 | Ga0075431_100186681 | Ga0075431_1001866812 | 242 |
| 185 | 3300006880 | Ga0075429_100002268 | Ga0075429_1000022686 | 242 |
| 186 | 3300009094 | Ga0111539_10036267 | Ga0111539_100362675 | 242 |
| 187 | 3300009098 | Ga0105245_10015094 | Ga0105245_100150945 | 242 |
| 188 | 3300009147 | Ga0114129_10000056 | Ga0114129_1000005674 | 242 |
| 189 | 3300009147 | Ga0114129_10001563 | Ga0114129_1000156310 | 242 |
| 190 | 3300009147 | Ga0114129_10001688 | Ga0114129_1000168820 | 242 |
| 191 | 3300009147 | Ga0114129_10580775 | Ga0114129_105807752 | 242 |
| 192 | 3300009147 | Ga0114129_10622621 | Ga0114129_106226212 | 242 |
| 193 | 3300009148 | Ga0105243_10045363 | Ga0105243_100453634 | 242 |
| 194 | 3300009177 | Ga0105248_10185066 | Ga0105248_101850662 | 242 |
| 195 | 3300010375 | Ga0105239_10271523 | Ga0105239_102715233 | 242 |
| 196 | 3300013102 | Ga0157371_10207633 | Ga0157371_102076332 | 242 |
| 197 | 3300013308 | Ga0157375_10759211 | Ga0157375_107592111 | 242 |
| 198 | 3300025901 | Ga0207688_10110888 | Ga0207688_101108882 | 242 |
| 199 | 3300025926 | Ga0207659_10003058 | Ga0207659_100030583 | 242 |
| 200 | 3300025927 | Ga0207687_10009213 | Ga0207687_100092133 | 242 |
| 201 | 3300025932 | Ga0207690_10013887 | Ga0207690_100138875 | 242 |
| 202 | 3300025935 | Ga0207709_10075520 | Ga0207709_100755202 | 242 |
| 203 | 3300025942 | Ga0207689_10023976 | Ga0207689_100239765 | 242 |
| 204 | 3300025945 | Ga0207679_10016844 | Ga0207679_100168445 | 242 |
| 205 | 3300026023 | Ga0207677_10157675 | Ga0207677_101576752 | 242 |
| 206 | 3300026067 | Ga0207678_10034977 | Ga0207678_100349774 | 242 |
| 207 | 3300026067 | Ga0207678_10061476 | Ga0207678_100614763 | 242 |
| 208 | 3300026095 | Ga0207676_10107617 | Ga0207676_101076173 | 242 |
| 209 | 3300026116 | Ga0207674_10312621 | Ga0207674_103126212 | 242 |
| 210 | 3300028381 | Ga0268264_10118601 | Ga0268264_101186011 | 242 |
| 211 | 3300031548 | Ga0307408_100159898 | Ga0307408_1001598982 | 242 |
| 212 | 3300031852 | Ga0307410_10311146 | Ga0307410_103111462 | 242 |
| 213 | 3300031852 | Ga0307410_10334407 | Ga0307410_103344072 | 242 |
| 214 | 3300031901 | Ga0307406_10227162 | Ga0307406_102271622 | 242 |
| 215 | 3300031903 | Ga0307407_10192437 | Ga0307407_101924372 | 242 |
| 216 | 3300031911 | Ga0307412_10174559 | Ga0307412_101745592 | 242 |
| 217 | 3300031995 | Ga0307409_100019676 | Ga0307409_1000196762 | 242 |
| 218 | 3300031995 | Ga0307409_100342483 | Ga0307409_1003424832 | 242 |
| 219 | 3300032002 | Ga0307416_100201766 | Ga0307416_1002017662 | 242 |
| 220 | 3300032002 | Ga0307416_100253221 | Ga0307416_1002532212 | 242 |
| 221 | 3300032126 | Ga0307415_100021582 | Ga0307415_1000215822 | 242 |
| 222 | 3300037312 | Ga0395899_0030023 | Ga0395899_0030023_798_1577 | 242 |
| 223 | 3300037418 | Ga0395900_0031488 | Ga0395900_0031488_2863_3642 | 242 |
| 224 | 3300037466 | Ga0395898_0004336 | Ga0395898_0004336_6609_7388 | 242 |
| 225 | 3300037471 | Ga0395905_0025917 | Ga0395905_0025917_2811_3590 | 242 |
| 226 | 3300044684 | Ga0466966_0273852 | Ga0466966_0273852_95_877 | 242 |
| 227 | 3300045976 | Ga0466967_0051461 | Ga0466967_0051461_1882_2661 | 242 |
| 228 | 3300046455 | Ga0495603_0182245 | Ga0495603_0182245_372_1151 | 242 |
| 229 | 3300047320 | Ga0495672_0070041 | Ga0495672_0070041_727_1518 | 242 |
| 230 | 3300048912 | Ga0496109_0486518 | Ga0496109_0486518_65_844 | 242 |
| 231 | 3300049571 | Ga0501034_0517336 | Ga0501034_0517336_226_1005 | 242 |
| 232 | 3300049578 | Ga0501042_0362305 | Ga0501042_0362305_211_990 | 242 |
| 233 | 3300050507 | nmdc:mga05p37_106_c2 | nmdc:mga05p37_106_c2_11142_11921 | 242 |
| 234 | 3300050507 | nmdc:mga05p37_466289_c1 | nmdc:mga05p37_466289_c1_181_960 | 242 |
| 235 | 3300050507 | nmdc:mga05p37_500100_c1 | nmdc:mga05p37_500100_c1_57_836 | 242 |
| 236 | 3300050507 | nmdc:mga05p37_720_c1 | nmdc:mga05p37_720_c1_17353_18132 | 242 |
| 237 | 3300050507 | nmdc:mga05p37_8792_c1 | nmdc:mga05p37_8792_c1_2803_3582 | 242 |
| 238 | 3300050508 | nmdc:mga09592_17727_c1 | nmdc:mga09592_17727_c1_4871_5650 | 242 |
| 239 | 3300050508 | nmdc:mga09592_283_c1 | nmdc:mga09592_283_c1_20787_21566 | 242 |
| 240 | 3300050508 | nmdc:mga09592_73481_c1 | nmdc:mga09592_73481_c1_1750_2529 | 242 |
| 241 | 3300050509 | nmdc:mga0qj67_18091_c1 | nmdc:mga0qj67_18091_c1_3201_3980 | 242 |
| 242 | 3300050509 | nmdc:mga0qj67_6_c1 | nmdc:mga0qj67_6_c1_16065_16844 | 242 |
| 243 | 3300050509 | nmdc:mga0qj67_99093_c1 | nmdc:mga0qj67_99093_c1_706_1485 | 242 |
| 244 | 3300050510 | nmdc:mga06r32_101443_c1 | nmdc:mga06r32_101443_c1_23_802 | 242 |
| 245 | 3300050510 | nmdc:mga06r32_7649_c1 | nmdc:mga06r32_7649_c1_8059_8838 | 242 |
| 246 | 3300050511 | nmdc:mga08y16_13716_c1 | nmdc:mga08y16_13716_c1_3886_4665 | 242 |
| 247 | 3300053100 | Ga0500660_020708 | Ga0500660_020708_2521_3300 | 242 |
| 248 | 3300005548 | Ga0070665_100232216 | Ga0070665_1002322162 | 243 |
| 249 | 3300006847 | Ga0075431_100038656 | Ga0075431_1000386567 | 243 |
| 250 | 3300025928 | Ga0207700_10004366 | Ga0207700_100043666 | 243 |
| 251 | 3300045976 | Ga0466967_0060861 | Ga0466967_0060861_2040_2816 | 243 |
| 252 | 3300048911 | Ga0496108_0000111 | Ga0496108_0000111_49125_49901 | 243 |
| 253 | 3300048911 | Ga0496108_0018306 | Ga0496108_0018306_4688_5479 | 243 |
| 254 | 3300049572 | Ga0501036_0400352 | Ga0501036_0400352_163_942 | 243 |
| 255 | 3300050510 | nmdc:mga06r32_1181_c1 | nmdc:mga06r32_1181_c1_4060_4836 | 243 |
| 256 | 3300000549 | LJQas_1007256 | LJQas_10072561 | 244 |
| 257 | 3300002077 | JGI24744J21845_10001881 | JGI24744J21845_100018813 | 244 |
| 258 | 3300002077 | JGI24744J21845_10009849 | JGI24744J21845_100098492 | 244 |
| 259 | 3300002244 | JGI24742J22300_10001138 | JGI24742J22300_100011383 | 244 |
| 260 | 3300003162 | Ga0006778J45830_1043793 | Ga0006778J45830_10437931 | 244 |
| 261 | 3300003203 | JGI25406J46586_10007522 | JGI25406J46586_100075226 | 244 |
| 262 | 3300003203 | JGI25406J46586_10026569 | JGI25406J46586_100265691 | 244 |
| 263 | 3300003203 | JGI25406J46586_10036226 | JGI25406J46586_100362262 | 244 |
| 264 | 3300003203 | JGI25406J46586_10046149 | JGI25406J46586_100461491 | 244 |
| 265 | 3300004798 | Ga0058859_11209305 | Ga0058859_112093051 | 244 |
| 266 | 3300005328 | Ga0070676_10034665 | Ga0070676_100346652 | 244 |
| 267 | 3300005328 | Ga0070676_10192469 | Ga0070676_101924691 | 244 |
| 268 | 3300005330 | Ga0070690_100010751 | Ga0070690_1000107511 | 244 |
| 269 | 3300005330 | Ga0070690_100077738 | Ga0070690_1000777382 | 244 |
| 270 | 3300005333 | Ga0070677_10131241 | Ga0070677_101312412 | 244 |
| 271 | 3300005334 | Ga0068869_100102748 | Ga0068869_1001027482 | 244 |
| 272 | 3300005334 | Ga0068869_100288990 | Ga0068869_1002889901 | 244 |
| 273 | 3300005336 | Ga0070680_100005701 | Ga0070680_1000057013 | 244 |
| 274 | 3300005336 | Ga0070680_100183315 | Ga0070680_1001833152 | 244 |
| 275 | 3300005337 | Ga0070682_100109494 | Ga0070682_1001094942 | 244 |
| 276 | 3300005338 | Ga0068868_100002112 | Ga0068868_1000021122 | 244 |
| 277 | 3300005339 | Ga0070660_100488367 | Ga0070660_1004883671 | 244 |
| 278 | 3300005340 | Ga0070689_100007064 | Ga0070689_1000070643 | 244 |
| 279 | 3300005341 | Ga0070691_10044583 | Ga0070691_100445831 | 244 |
| 280 | 3300005341 | Ga0070691_10077057 | Ga0070691_100770572 | 244 |
| 281 | 3300005345 | Ga0070692_10165194 | Ga0070692_101651942 | 244 |
| 282 | 3300005347 | Ga0070668_100010272 | Ga0070668_1000102724 | 244 |
| 283 | 3300005347 | Ga0070668_100073553 | Ga0070668_1000735533 | 244 |
| 284 | 3300005347 | Ga0070668_100215450 | Ga0070668_1002154502 | 244 |
| 285 | 3300005347 | Ga0070668_100534304 | Ga0070668_1005343041 | 244 |
| 286 | 3300005353 | Ga0070669_100093801 | Ga0070669_1000938012 | 244 |
| 287 | 3300005355 | Ga0070671_100000660 | Ga0070671_10000066024 | 244 |
| 288 | 3300005356 | Ga0070674_100145139 | Ga0070674_1001451392 | 244 |
| 289 | 3300005364 | Ga0070673_100209720 | Ga0070673_1002097202 | 244 |
| 290 | 3300005365 | Ga0070688_100015773 | Ga0070688_1000157734 | 244 |
| 291 | 3300005367 | Ga0070667_100002279 | Ga0070667_1000022799 | 244 |
| 292 | 3300005367 | Ga0070667_100030108 | Ga0070667_1000301083 | 244 |
| 293 | 3300005367 | Ga0070667_100258142 | Ga0070667_1002581422 | 244 |
| 294 | 3300005435 | Ga0070714_100080473 | Ga0070714_1000804731 | 244 |
| 295 | 3300005436 | Ga0070713_100375416 | Ga0070713_1003754162 | 244 |
| 296 | 3300005436 | Ga0070713_100452587 | Ga0070713_1004525871 | 244 |
| 297 | 3300005437 | Ga0070710_10001277 | Ga0070710_100012778 | 244 |
| 298 | 3300005437 | Ga0070710_10166698 | Ga0070710_101666981 | 244 |
| 299 | 3300005437 | Ga0070710_10284799 | Ga0070710_102847991 | 244 |
| 300 | 3300005438 | Ga0070701_10034555 | Ga0070701_100345551 | 244 |
| 301 | 3300005439 | Ga0070711_100001571 | Ga0070711_1000015715 | 244 |
| 302 | 3300005439 | Ga0070711_100015196 | Ga0070711_1000151964 | 244 |
| 303 | 3300005439 | Ga0070711_100587608 | Ga0070711_1005876081 | 244 |
| 304 | 3300005440 | Ga0070705_100017669 | Ga0070705_1000176694 | 244 |
| 305 | 3300005440 | Ga0070705_100065015 | Ga0070705_1000650152 | 244 |
| 306 | 3300005441 | Ga0070700_100000088 | Ga0070700_1000000887 | 244 |
| 307 | 3300005441 | Ga0070700_100001394 | Ga0070700_1000013943 | 244 |
| 308 | 3300005444 | Ga0070694_100104870 | Ga0070694_1001048702 | 244 |
| 309 | 3300005444 | Ga0070694_100374745 | Ga0070694_1003747451 | 244 |
| 310 | 3300005455 | Ga0070663_100018971 | Ga0070663_1000189712 | 244 |
| 311 | 3300005456 | Ga0070678_100000985 | Ga0070678_10000098513 | 244 |
| 312 | 3300005456 | Ga0070678_100463256 | Ga0070678_1004632562 | 244 |
| 313 | 3300005457 | Ga0070662_100022956 | Ga0070662_1000229561 | 244 |
| 314 | 3300005457 | Ga0070662_100172251 | Ga0070662_1001722511 | 244 |
| 315 | 3300005458 | Ga0070681_10004253 | Ga0070681_100042537 | 244 |
| 316 | 3300005459 | Ga0068867_100000404 | Ga0068867_1000004044 | 244 |
| 317 | 3300005459 | Ga0068867_100128950 | Ga0068867_1001289502 | 244 |
| 318 | 3300005466 | Ga0070685_10152033 | Ga0070685_101520332 | 244 |
| 319 | 3300005466 | Ga0070685_10412754 | Ga0070685_104127541 | 244 |
| 320 | 3300005467 | Ga0070706_100011901 | Ga0070706_1000119016 | 244 |
| 321 | 3300005467 | Ga0070706_100292841 | Ga0070706_1002928412 | 244 |
| 322 | 3300005468 | Ga0070707_100008621 | Ga0070707_1000086218 | 244 |
| 323 | 3300005468 | Ga0070707_100420591 | Ga0070707_1004205911 | 244 |
| 324 | 3300005471 | Ga0070698_100033546 | Ga0070698_1000335464 | 244 |
| 325 | 3300005530 | Ga0070679_100007103 | Ga0070679_1000071034 | 244 |
| 326 | 3300005539 | Ga0068853_100157482 | Ga0068853_1001574822 | 244 |
| 327 | 3300005539 | Ga0068853_100227962 | Ga0068853_1002279622 | 244 |
| 328 | 3300005543 | Ga0070672_100174187 | Ga0070672_1001741872 | 244 |
| 329 | 3300005545 | Ga0070695_100080722 | Ga0070695_1000807222 | 244 |
| 330 | 3300005546 | Ga0070696_100104220 | Ga0070696_1001042202 | 244 |
| 331 | 3300005547 | Ga0070693_100295719 | Ga0070693_1002957191 | 244 |
| 332 | 3300005548 | Ga0070665_100006667 | Ga0070665_10000666712 | 244 |
| 333 | 3300005548 | Ga0070665_100036041 | Ga0070665_1000360416 | 244 |
| 334 | 3300005548 | Ga0070665_100207197 | Ga0070665_1002071971 | 244 |
| 335 | 3300005549 | Ga0070704_100001226 | Ga0070704_1000012265 | 244 |
| 336 | 3300005549 | Ga0070704_100187582 | Ga0070704_1001875821 | 244 |
| 337 | 3300005563 | Ga0068855_100106991 | Ga0068855_1001069913 | 244 |
| 338 | 3300005563 | Ga0068855_100456480 | Ga0068855_1004564802 | 244 |
| 339 | 3300005577 | Ga0068857_100130327 | Ga0068857_1001303274 | 244 |
| 340 | 3300005577 | Ga0068857_100389631 | Ga0068857_1003896312 | 244 |
| 341 | 3300005577 | Ga0068857_100439471 | Ga0068857_1004394712 | 244 |
| 342 | 3300005578 | Ga0068854_100001406 | Ga0068854_10000140610 | 244 |
| 343 | 3300005578 | Ga0068854_100167135 | Ga0068854_1001671351 | 244 |
| 344 | 3300005614 | Ga0068856_100003019 | Ga0068856_1000030198 | 244 |
| 345 | 3300005614 | Ga0068856_100094781 | Ga0068856_1000947811 | 244 |
| 346 | 3300005615 | Ga0070702_100000347 | Ga0070702_10000034719 | 244 |
| 347 | 3300005615 | Ga0070702_100192079 | Ga0070702_1001920792 | 244 |
| 348 | 3300005616 | Ga0068852_100152494 | Ga0068852_1001524943 | 244 |
| 349 | 3300005616 | Ga0068852_100204692 | Ga0068852_1002046922 | 244 |
| 350 | 3300005617 | Ga0068859_100079740 | Ga0068859_1000797405 | 244 |
| 351 | 3300005618 | Ga0068864_100008230 | Ga0068864_1000082309 | 244 |
| 352 | 3300005618 | Ga0068864_100125656 | Ga0068864_1001256562 | 244 |
| 353 | 3300005718 | Ga0068866_10001788 | Ga0068866_100017883 | 244 |
| 354 | 3300005718 | Ga0068866_10144847 | Ga0068866_101448471 | 244 |
| 355 | 3300005719 | Ga0068861_100032541 | Ga0068861_1000325411 | 244 |
| 356 | 3300005719 | Ga0068861_100325692 | Ga0068861_1003256922 | 244 |
| 357 | 3300005841 | Ga0068863_100014312 | Ga0068863_1000143127 | 244 |
| 358 | 3300005841 | Ga0068863_100031833 | Ga0068863_1000318334 | 244 |
| 359 | 3300005841 | Ga0068863_100086939 | Ga0068863_1000869392 | 244 |
| 360 | 3300005841 | Ga0068863_100095166 | Ga0068863_1000951665 | 244 |
| 361 | 3300005842 | Ga0068858_100006025 | Ga0068858_10000602510 | 244 |
| 362 | 3300005842 | Ga0068858_100015931 | Ga0068858_1000159316 | 244 |
| 363 | 3300005842 | Ga0068858_100105269 | Ga0068858_1001052693 | 244 |
| 364 | 3300005842 | Ga0068858_100280519 | Ga0068858_1002805192 | 244 |
| 365 | 3300005843 | Ga0068860_100004983 | Ga0068860_10000498311 | 244 |
| 366 | 3300005843 | Ga0068860_100041810 | Ga0068860_1000418106 | 244 |
| 367 | 3300005844 | Ga0068862_100011571 | Ga0068862_1000115716 | 244 |
| 368 | 3300005844 | Ga0068862_100064458 | Ga0068862_1000644585 | 244 |
| 369 | 3300005981 | Ga0081538_10066848 | Ga0081538_100668482 | 244 |
| 370 | 3300005983 | Ga0081540_1031200 | Ga0081540_10312002 | 244 |
| 371 | 3300005983 | Ga0081540_1056257 | Ga0081540_10562572 | 244 |
| 372 | 3300005985 | Ga0081539_10000706 | Ga0081539_1000070617 | 244 |
| 373 | 3300005985 | Ga0081539_10001346 | Ga0081539_1000134618 | 244 |
| 374 | 3300005985 | Ga0081539_10004243 | Ga0081539_100042437 | 244 |
| 375 | 3300005985 | Ga0081539_10008166 | Ga0081539_100081669 | 244 |
| 376 | 3300005985 | Ga0081539_10010521 | Ga0081539_100105216 | 244 |
| 377 | 3300006028 | Ga0070717_10002691 | Ga0070717_100026913 | 244 |
| 378 | 3300006051 | Ga0075364_10003109 | Ga0075364_100031096 | 244 |
| 379 | 3300006163 | Ga0070715_10044225 | Ga0070715_100442252 | 244 |
| 380 | 3300006163 | Ga0070715_10051233 | Ga0070715_100512332 | 244 |
| 381 | 3300006163 | Ga0070715_10103097 | Ga0070715_101030972 | 244 |
| 382 | 3300006173 | Ga0070716_100047995 | Ga0070716_1000479952 | 244 |
| 383 | 3300006173 | Ga0070716_100050887 | Ga0070716_1000508872 | 244 |
| 384 | 3300006175 | Ga0070712_100001155 | Ga0070712_1000011551 | 244 |
| 385 | 3300006175 | Ga0070712_100115740 | Ga0070712_1001157402 | 244 |
| 386 | 3300006175 | Ga0070712_100270310 | Ga0070712_1002703101 | 244 |
| 387 | 3300006186 | Ga0075369_10008069 | Ga0075369_100080692 | 244 |
| 388 | 3300006237 | Ga0097621_100028126 | Ga0097621_1000281263 | 244 |
| 389 | 3300006237 | Ga0097621_100073376 | Ga0097621_1000733763 | 244 |
| 390 | 3300006358 | Ga0068871_100192239 | Ga0068871_1001922392 | 244 |
| 391 | 3300006844 | Ga0075428_100019167 | Ga0075428_1000191677 | 244 |
| 392 | 3300006844 | Ga0075428_100538251 | Ga0075428_1005382511 | 244 |
| 393 | 3300006846 | Ga0075430_100000172 | Ga0075430_1000001726 | 244 |
| 394 | 3300006847 | Ga0075431_100089627 | Ga0075431_1000896273 | 244 |
| 395 | 3300006847 | Ga0075431_100218855 | Ga0075431_1002188552 | 244 |
| 396 | 3300006852 | Ga0075433_10106479 | Ga0075433_101064792 | 244 |
| 397 | 3300006880 | Ga0075429_100014921 | Ga0075429_1000149216 | 244 |
| 398 | 3300006881 | Ga0068865_100008010 | Ga0068865_1000080106 | 244 |
| 399 | 3300006881 | Ga0068865_100077216 | Ga0068865_1000772162 | 244 |
| 400 | 3300006931 | Ga0097620_100079742 | Ga0097620_1000797421 | 244 |
| 401 | 3300007788 | Ga0099795_10006768 | Ga0099795_100067682 | 244 |
| 402 | 3300009093 | Ga0105240_10379487 | Ga0105240_103794872 | 244 |
| 403 | 3300009094 | Ga0111539_10442320 | Ga0111539_104423202 | 244 |
| 404 | 3300009094 | Ga0111539_10602207 | Ga0111539_106022072 | 244 |
| 405 | 3300009098 | Ga0105245_10000730 | Ga0105245_100007309 | 244 |
| 406 | 3300009101 | Ga0105247_10005433 | Ga0105247_100054331 | 244 |
| 407 | 3300009101 | Ga0105247_10067807 | Ga0105247_100678072 | 244 |
| 408 | 3300009101 | Ga0105247_10301526 | Ga0105247_103015262 | 244 |
| 409 | 3300009147 | Ga0114129_10221450 | Ga0114129_102214502 | 244 |
| 410 | 3300009147 | Ga0114129_10497595 | Ga0114129_104975951 | 244 |
| 411 | 3300009148 | Ga0105243_10000504 | Ga0105243_1000050413 | 244 |
| 412 | 3300009148 | Ga0105243_10642111 | Ga0105243_106421111 | 244 |
| 413 | 3300009174 | Ga0105241_10146323 | Ga0105241_101463231 | 244 |
| 414 | 3300009174 | Ga0105241_10614491 | Ga0105241_106144912 | 244 |
| 415 | 3300009176 | Ga0105242_10000385 | Ga0105242_1000038515 | 244 |
| 416 | 3300009176 | Ga0105242_10388218 | Ga0105242_103882181 | 244 |
| 417 | 3300009177 | Ga0105248_10523977 | Ga0105248_105239772 | 244 |
| 418 | 3300009545 | Ga0105237_10848340 | Ga0105237_108483401 | 244 |
| 419 | 3300009551 | Ga0105238_10029759 | Ga0105238_100297594 | 244 |
| 420 | 3300009551 | Ga0105238_10378008 | Ga0105238_103780082 | 244 |
| 421 | 3300009553 | Ga0105249_10191833 | Ga0105249_101918331 | 244 |
| 422 | 3300009553 | Ga0105249_10643001 | Ga0105249_106430012 | 244 |
| 423 | 3300010375 | Ga0105239_10005637 | Ga0105239_100056378 | 244 |
| 424 | 3300011119 | Ga0105246_10112244 | Ga0105246_101122442 | 244 |
| 425 | 3300013102 | Ga0157371_10271609 | Ga0157371_102716091 | 244 |
| 426 | 3300013104 | Ga0157370_10186250 | Ga0157370_101862502 | 244 |
| 427 | 3300013105 | Ga0157369_10376288 | Ga0157369_103762882 | 244 |
| 428 | 3300013105 | Ga0157369_10545288 | Ga0157369_105452882 | 244 |
| 429 | 3300013296 | Ga0157374_10098956 | Ga0157374_100989562 | 244 |
| 430 | 3300013296 | Ga0157374_10115064 | Ga0157374_101150643 | 244 |
| 431 | 3300013297 | Ga0157378_10002662 | Ga0157378_100026622 | 244 |
| 432 | 3300013297 | Ga0157378_10093403 | Ga0157378_100934031 | 244 |
| 433 | 3300013306 | Ga0163162_10076847 | Ga0163162_100768472 | 244 |
| 434 | 3300013306 | Ga0163162_10682351 | Ga0163162_106823512 | 244 |
| 435 | 3300013307 | Ga0157372_10007432 | Ga0157372_100074322 | 244 |
| 436 | 3300013307 | Ga0157372_10146397 | Ga0157372_101463972 | 244 |
| 437 | 3300013308 | Ga0157375_10001165 | Ga0157375_100011651 | 244 |
| 438 | 3300013308 | Ga0157375_10862045 | Ga0157375_108620452 | 244 |
| 439 | 3300014325 | Ga0163163_10059054 | Ga0163163_100590543 | 244 |
| 440 | 3300014325 | Ga0163163_10216108 | Ga0163163_102161082 | 244 |
| 441 | 3300014325 | Ga0163163_10248278 | Ga0163163_102482782 | 244 |
| 442 | 3300014325 | Ga0163163_10631117 | Ga0163163_106311172 | 244 |
| 443 | 3300014325 | Ga0163163_10702150 | Ga0163163_107021502 | 244 |
| 444 | 3300014325 | Ga0163163_10967724 | Ga0163163_109677242 | 244 |
| 445 | 3300014326 | Ga0157380_10000356 | Ga0157380_1000035613 | 244 |
| 446 | 3300014497 | Ga0182008_10089211 | Ga0182008_100892111 | 244 |
| 447 | 3300014497 | Ga0182008_10100376 | Ga0182008_101003762 | 244 |
| 448 | 3300014745 | Ga0157377_10061763 | Ga0157377_100617632 | 244 |
| 449 | 3300014968 | Ga0157379_10017816 | Ga0157379_100178166 | 244 |
| 450 | 3300014968 | Ga0157379_10059255 | Ga0157379_100592555 | 244 |
| 451 | 3300014968 | Ga0157379_10147831 | Ga0157379_101478312 | 244 |
| 452 | 3300014969 | Ga0157376_10022738 | Ga0157376_100227383 | 244 |
| 453 | 3300014969 | Ga0157376_10378187 | Ga0157376_103781871 | 244 |
| 454 | 3300017792 | Ga0163161_10000586 | Ga0163161_1000058613 | 244 |
| 455 | 3300017792 | Ga0163161_10166940 | Ga0163161_101669402 | 244 |
| 456 | 3300020069 | Ga0197907_11373820 | Ga0197907_113738201 | 244 |
| 457 | 3300020069 | Ga0197907_11471116 | Ga0197907_114711163 | 244 |
| 458 | 3300020070 | Ga0206356_11622265 | Ga0206356_116222653 | 244 |
| 459 | 3300020077 | Ga0206351_10176129 | Ga0206351_101761292 | 244 |
| 460 | 3300020077 | Ga0206351_10298870 | Ga0206351_102988701 | 244 |
| 461 | 3300020078 | Ga0206352_11097006 | Ga0206352_110970062 | 244 |
| 462 | 3300020081 | Ga0206354_10713285 | Ga0206354_107132852 | 244 |
| 463 | 3300020610 | Ga0154015_1446516 | Ga0154015_14465162 | 244 |
| 464 | 3300021358 | Ga0213873_10000139 | Ga0213873_100001398 | 244 |
| 465 | 3300021388 | Ga0213875_10012490 | Ga0213875_100124905 | 244 |
| 466 | 3300025223 | Ga0207672_1003656 | Ga0207672_10036561 | 244 |
| 467 | 3300025885 | Ga0207653_10037313 | Ga0207653_100373132 | 244 |
| 468 | 3300025893 | Ga0207682_10138289 | Ga0207682_101382891 | 244 |
| 469 | 3300025898 | Ga0207692_10001360 | Ga0207692_100013604 | 244 |
| 470 | 3300025898 | Ga0207692_10140779 | Ga0207692_101407792 | 244 |
| 471 | 3300025899 | Ga0207642_10000335 | Ga0207642_100003359 | 244 |
| 472 | 3300025899 | Ga0207642_10117844 | Ga0207642_101178441 | 244 |
| 473 | 3300025900 | Ga0207710_10001367 | Ga0207710_100013675 | 244 |
| 474 | 3300025900 | Ga0207710_10049197 | Ga0207710_100491972 | 244 |
| 475 | 3300025900 | Ga0207710_10078716 | Ga0207710_100787161 | 244 |
| 476 | 3300025901 | Ga0207688_10000291 | Ga0207688_100002911 | 244 |
| 477 | 3300025901 | Ga0207688_10003914 | Ga0207688_1000391410 | 244 |
| 478 | 3300025906 | Ga0207699_10009907 | Ga0207699_100099074 | 244 |
| 479 | 3300025906 | Ga0207699_10250566 | Ga0207699_102505661 | 244 |
| 480 | 3300025906 | Ga0207699_10483297 | Ga0207699_104832971 | 244 |
| 481 | 3300025907 | Ga0207645_10095524 | Ga0207645_100955242 | 244 |
| 482 | 3300025907 | Ga0207645_10185565 | Ga0207645_101855651 | 244 |
| 483 | 3300025909 | Ga0207705_10004958 | Ga0207705_100049586 | 244 |
| 484 | 3300025910 | Ga0207684_10010500 | Ga0207684_100105006 | 244 |
| 485 | 3300025912 | Ga0207707_10004458 | Ga0207707_100044585 | 244 |
| 486 | 3300025913 | Ga0207695_10349510 | Ga0207695_103495102 | 244 |
| 487 | 3300025915 | Ga0207693_10000049 | Ga0207693_100000491 | 244 |
| 488 | 3300025915 | Ga0207693_10036232 | Ga0207693_100362323 | 244 |
| 489 | 3300025915 | Ga0207693_10083768 | Ga0207693_100837681 | 244 |
| 490 | 3300025916 | Ga0207663_10001607 | Ga0207663_100016078 | 244 |
| 491 | 3300025916 | Ga0207663_10028741 | Ga0207663_100287412 | 244 |
| 492 | 3300025917 | Ga0207660_10000423 | Ga0207660_1000042315 | 244 |
| 493 | 3300025917 | Ga0207660_10592632 | Ga0207660_105926321 | 244 |
| 494 | 3300025919 | Ga0207657_10055510 | Ga0207657_100555102 | 244 |
| 495 | 3300025919 | Ga0207657_10438006 | Ga0207657_104380062 | 244 |
| 496 | 3300025921 | Ga0207652_10000455 | Ga0207652_1000045530 | 244 |
| 497 | 3300025922 | Ga0207646_10006235 | Ga0207646_1000623510 | 244 |
| 498 | 3300025922 | Ga0207646_10131225 | Ga0207646_101312252 | 244 |
| 499 | 3300025923 | Ga0207681_10028903 | Ga0207681_100289033 | 244 |
| 500 | 3300025923 | Ga0207681_10237597 | Ga0207681_102375971 | 244 |
| 501 | 3300025924 | Ga0207694_10294048 | Ga0207694_102940481 | 244 |
| 502 | 3300025927 | Ga0207687_10000816 | Ga0207687_1000081610 | 244 |
| 503 | 3300025927 | Ga0207687_10341466 | Ga0207687_103414661 | 244 |
| 504 | 3300025928 | Ga0207700_10008373 | Ga0207700_100083735 | 244 |
| 505 | 3300025928 | Ga0207700_10091515 | Ga0207700_100915153 | 244 |
| 506 | 3300025929 | Ga0207664_10210072 | Ga0207664_102100722 | 244 |
| 507 | 3300025931 | Ga0207644_10003347 | Ga0207644_100033474 | 244 |
| 508 | 3300025931 | Ga0207644_10093464 | Ga0207644_100934643 | 244 |
| 509 | 3300025932 | Ga0207690_10127818 | Ga0207690_101278182 | 244 |
| 510 | 3300025933 | Ga0207706_10408708 | Ga0207706_104087082 | 244 |
| 511 | 3300025934 | Ga0207686_10001914 | Ga0207686_1000191410 | 244 |
| 512 | 3300025935 | Ga0207709_10005434 | Ga0207709_100054345 | 244 |
| 513 | 3300025936 | Ga0207670_10117163 | Ga0207670_101171632 | 244 |
| 514 | 3300025937 | Ga0207669_10013219 | Ga0207669_100132193 | 244 |
| 515 | 3300025938 | Ga0207704_10002624 | Ga0207704_100026248 | 244 |
| 516 | 3300025938 | Ga0207704_10517492 | Ga0207704_105174922 | 244 |
| 517 | 3300025939 | Ga0207665_10133356 | Ga0207665_101333562 | 244 |
| 518 | 3300025939 | Ga0207665_10135293 | Ga0207665_101352931 | 244 |
| 519 | 3300025940 | Ga0207691_10103158 | Ga0207691_101031583 | 244 |
| 520 | 3300025941 | Ga0207711_10320778 | Ga0207711_103207782 | 244 |
| 521 | 3300025942 | Ga0207689_10156631 | Ga0207689_101566312 | 244 |
| 522 | 3300025942 | Ga0207689_10178243 | Ga0207689_101782432 | 244 |
| 523 | 3300025949 | Ga0207667_10310958 | Ga0207667_103109582 | 244 |
| 524 | 3300025961 | Ga0207712_10015701 | Ga0207712_100157014 | 244 |
| 525 | 3300025961 | Ga0207712_10068331 | Ga0207712_100683311 | 244 |
| 526 | 3300025961 | Ga0207712_10476725 | Ga0207712_104767251 | 244 |
| 527 | 3300025972 | Ga0207668_10006205 | Ga0207668_100062055 | 244 |
| 528 | 3300025972 | Ga0207668_10019285 | Ga0207668_100192853 | 244 |
| 529 | 3300025972 | Ga0207668_10134358 | Ga0207668_101343582 | 244 |
| 530 | 3300025981 | Ga0207640_10003447 | Ga0207640_100034472 | 244 |
| 531 | 3300025981 | Ga0207640_10024210 | Ga0207640_100242103 | 244 |
| 532 | 3300025986 | Ga0207658_10068535 | Ga0207658_100685352 | 244 |
| 533 | 3300026023 | Ga0207677_10000712 | Ga0207677_100007129 | 244 |
| 534 | 3300026023 | Ga0207677_10451463 | Ga0207677_104514631 | 244 |
| 535 | 3300026035 | Ga0207703_10013902 | Ga0207703_100139025 | 244 |
| 536 | 3300026035 | Ga0207703_10040056 | Ga0207703_100400563 | 244 |
| 537 | 3300026035 | Ga0207703_10096432 | Ga0207703_100964323 | 244 |
| 538 | 3300026035 | Ga0207703_10165043 | Ga0207703_101650432 | 244 |
| 539 | 3300026035 | Ga0207703_10299283 | Ga0207703_102992832 | 244 |
| 540 | 3300026041 | Ga0207639_10105653 | Ga0207639_101056533 | 244 |
| 541 | 3300026041 | Ga0207639_10305274 | Ga0207639_103052741 | 244 |
| 542 | 3300026041 | Ga0207639_10767491 | Ga0207639_107674911 | 244 |
| 543 | 3300026067 | Ga0207678_10059971 | Ga0207678_100599711 | 244 |
| 544 | 3300026067 | Ga0207678_10098509 | Ga0207678_100985093 | 244 |
| 545 | 3300026075 | Ga0207708_10000079 | Ga0207708_1000007947 | 244 |
| 546 | 3300026075 | Ga0207708_10033556 | Ga0207708_100335561 | 244 |
| 547 | 3300026075 | Ga0207708_10150223 | Ga0207708_101502232 | 244 |
| 548 | 3300026078 | Ga0207702_10001934 | Ga0207702_1000193411 | 244 |
| 549 | 3300026078 | Ga0207702_10162441 | Ga0207702_101624412 | 244 |
| 550 | 3300026088 | Ga0207641_10006415 | Ga0207641_1000641510 | 244 |
| 551 | 3300026088 | Ga0207641_10058708 | Ga0207641_100587081 | 244 |
| 552 | 3300026088 | Ga0207641_10075809 | Ga0207641_100758092 | 244 |
| 553 | 3300026088 | Ga0207641_10102256 | Ga0207641_101022561 | 244 |
| 554 | 3300026088 | Ga0207641_10108139 | Ga0207641_101081392 | 244 |
| 555 | 3300026089 | Ga0207648_10044760 | Ga0207648_100447605 | 244 |
| 556 | 3300026089 | Ga0207648_10201213 | Ga0207648_102012132 | 244 |
| 557 | 3300026095 | Ga0207676_10013384 | Ga0207676_100133844 | 244 |
| 558 | 3300026095 | Ga0207676_10304444 | Ga0207676_103044442 | 244 |
| 559 | 3300026116 | Ga0207674_10045352 | Ga0207674_100453527 | 244 |
| 560 | 3300026116 | Ga0207674_10103805 | Ga0207674_101038053 | 244 |
| 561 | 3300026116 | Ga0207674_10150999 | Ga0207674_101509991 | 244 |
| 562 | 3300026118 | Ga0207675_100050918 | Ga0207675_1000509181 | 244 |
| 563 | 3300026118 | Ga0207675_100117416 | Ga0207675_1001174163 | 244 |
| 564 | 3300026118 | Ga0207675_100470919 | Ga0207675_1004709192 | 244 |
| 565 | 3300026121 | Ga0207683_10000184 | Ga0207683_1000018458 | 244 |
| 566 | 3300026121 | Ga0207683_10228693 | Ga0207683_102286932 | 244 |
| 567 | 3300026142 | Ga0207698_10204557 | Ga0207698_102045572 | 244 |
| 568 | 3300027512 | Ga0209179_1045169 | Ga0209179_10451691 | 244 |
| 569 | 3300028379 | Ga0268266_10006671 | Ga0268266_100066713 | 244 |
| 570 | 3300028379 | Ga0268266_10009625 | Ga0268266_100096258 | 244 |
| 571 | 3300028379 | Ga0268266_10061251 | Ga0268266_100612512 | 244 |
| 572 | 3300028379 | Ga0268266_10084119 | Ga0268266_100841193 | 244 |
| 573 | 3300028379 | Ga0268266_10605798 | Ga0268266_106057981 | 244 |
| 574 | 3300028380 | Ga0268265_10017563 | Ga0268265_100175634 | 244 |
| 575 | 3300028380 | Ga0268265_10209497 | Ga0268265_102094972 | 244 |
| 576 | 3300028380 | Ga0268265_10806604 | Ga0268265_108066041 | 244 |
| 577 | 3300028381 | Ga0268264_10004268 | Ga0268264_100042686 | 244 |
| 578 | 3300028381 | Ga0268264_10016350 | Ga0268264_100163503 | 244 |
| 579 | 3300028381 | Ga0268264_10174511 | Ga0268264_101745112 | 244 |
| 580 | 3300028666 | Ga0265336_10012827 | Ga0265336_100128273 | 244 |
| 581 | 3300028786 | Ga0307517_10031743 | Ga0307517_100317437 | 244 |
| 582 | 3300028794 | Ga0307515_10000045 | Ga0307515_1000004592 | 244 |
| 583 | 3300028794 | Ga0307515_10020864 | Ga0307515_100208645 | 244 |
| 584 | 3300028794 | Ga0307515_10044616 | Ga0307515_100446165 | 244 |
| 585 | 3300028794 | Ga0307515_10075426 | Ga0307515_100754263 | 244 |
| 586 | 3300028800 | Ga0265338_10002382 | Ga0265338_1000238217 | 244 |
| 587 | 3300030521 | Ga0307511_10001243 | Ga0307511_100012432 | 244 |
| 588 | 3300030522 | Ga0307512_10046936 | Ga0307512_100469365 | 244 |
| 589 | 3300031456 | Ga0307513_10041669 | Ga0307513_100416696 | 244 |
| 590 | 3300031456 | Ga0307513_10071510 | Ga0307513_100715105 | 244 |
| 591 | 3300031456 | Ga0307513_10313798 | Ga0307513_103137982 | 244 |
| 592 | 3300031507 | Ga0307509_10023422 | Ga0307509_100234225 | 244 |
| 593 | 3300031507 | Ga0307509_10207234 | Ga0307509_102072341 | 244 |
| 594 | 3300031616 | Ga0307508_10001989 | Ga0307508_1000198914 | 244 |
| 595 | 3300031616 | Ga0307508_10031993 | Ga0307508_100319935 | 244 |
| 596 | 3300031616 | Ga0307508_10037965 | Ga0307508_100379652 | 244 |
| 597 | 3300031616 | Ga0307508_10093582 | Ga0307508_100935822 | 244 |
| 598 | 3300031730 | Ga0307516_10010141 | Ga0307516_100101417 | 244 |
| 599 | 3300031731 | Ga0307405_10070252 | Ga0307405_100702523 | 244 |
| 600 | 3300031731 | Ga0307405_10120831 | Ga0307405_101208312 | 244 |
| 601 | 3300031731 | Ga0307405_10190124 | Ga0307405_101901241 | 244 |
| 602 | 3300031731 | Ga0307405_10216688 | Ga0307405_102166882 | 244 |
| 603 | 3300031731 | Ga0307405_10374818 | Ga0307405_103748181 | 244 |
| 604 | 3300031824 | Ga0307413_10526141 | Ga0307413_105261411 | 244 |
| 605 | 3300031852 | Ga0307410_10009217 | Ga0307410_100092174 | 244 |
| 606 | 3300031852 | Ga0307410_10053139 | Ga0307410_100531393 | 244 |
| 607 | 3300031889 | Ga0326468_10000222 | Ga0326468_100002224 | 244 |
| 608 | 3300031901 | Ga0307406_10001830 | Ga0307406_1000183011 | 244 |
| 609 | 3300031901 | Ga0307406_10261557 | Ga0307406_102615572 | 244 |
| 610 | 3300031911 | Ga0307412_10119184 | Ga0307412_101191842 | 244 |
| 611 | 3300031911 | Ga0307412_10186772 | Ga0307412_101867722 | 244 |
| 612 | 3300031995 | Ga0307409_100000896 | Ga0307409_1000008967 | 244 |
| 613 | 3300031995 | Ga0307409_100118093 | Ga0307409_1001180932 | 244 |
| 614 | 3300031995 | Ga0307409_100158234 | Ga0307409_1001582342 | 244 |
| 615 | 3300031995 | Ga0307409_100245639 | Ga0307409_1002456392 | 244 |
| 616 | 3300031995 | Ga0307409_100333387 | Ga0307409_1003333872 | 244 |
| 617 | 3300031995 | Ga0307409_100483541 | Ga0307409_1004835412 | 244 |
| 618 | 3300031995 | Ga0307409_100540004 | Ga0307409_1005400042 | 244 |
| 619 | 3300031995 | Ga0307409_100686408 | Ga0307409_1006864081 | 244 |
| 620 | 3300032002 | Ga0307416_100016607 | Ga0307416_1000166076 | 244 |
| 621 | 3300032002 | Ga0307416_100142447 | Ga0307416_1001424472 | 244 |
| 622 | 3300032002 | Ga0307416_100195942 | Ga0307416_1001959422 | 244 |
| 623 | 3300032002 | Ga0307416_100325308 | Ga0307416_1003253083 | 244 |
| 624 | 3300032004 | Ga0307414_10045159 | Ga0307414_100451593 | 244 |
| 625 | 3300032004 | Ga0307414_10530623 | Ga0307414_105306231 | 244 |
| 626 | 3300032126 | Ga0307415_100022896 | Ga0307415_1000228963 | 244 |
| 627 | 3300032126 | Ga0307415_100076360 | Ga0307415_1000763603 | 244 |
| 628 | 3300032126 | Ga0307415_100272213 | Ga0307415_1002722132 | 244 |
| 629 | 3300033179 | Ga0307507_10023912 | Ga0307507_100239125 | 244 |
| 630 | 3300033180 | Ga0307510_10156592 | Ga0307510_101565922 | 244 |
| 631 | 3300034957 | Ga0373938_0031597 | Ga0373938_0031597_237_1016 | 244 |
| 632 | 3300035083 | Ga0373926_0000890 | Ga0373926_0000890_1960_2739 | 244 |
| 633 | 3300035083 | Ga0373926_0033009 | Ga0373926_0033009_138_917 | 244 |
| 634 | 3300035088 | Ga0373940_0006757 | Ga0373940_0006757_1516_2295 | 244 |
| 635 | 3300035111 | Ga0373923_0008873 | Ga0373923_0008873_817_1596 | 244 |
| 636 | 3300035113 | Ga0373936_0049895 | Ga0373936_0049895_39_818 | 244 |
| 637 | 3300035115 | Ga0373941_0050561 | Ga0373941_0050561_188_988 | 244 |
| 638 | 3300035117 | Ga0373953_0011143 | Ga0373953_0011143_1556_2335 | 244 |
| 639 | 3300035118 | Ga0373954_0074727 | Ga0373954_0074727_187_966 | 244 |
| 640 | 3300035120 | Ga0373957_0011809 | Ga0373957_0011809_768_1547 | 244 |
| 641 | 3300035121 | Ga0373960_0055161 | Ga0373960_0055161_247_1047 | 244 |
| 642 | 3300035170 | Ga0373943_0061428 | Ga0373943_0061428_1005_1784 | 244 |
| 643 | 3300035171 | Ga0373946_0079777 | Ga0373946_0079777_226_1005 | 244 |
| 644 | 3300035172 | Ga0373955_0013453 | Ga0373955_0013453_2243_3022 | 244 |
| 645 | 3300035207 | Ga0373942_0000264 | Ga0373942_0000264_1965_2744 | 244 |
| 646 | 3300035410 | Ga0373924_0047950 | Ga0373924_0047950_808_1587 | 244 |
| 647 | 3300035691 | Ga0373931_0077729 | Ga0373931_0077729_713_1513 | 244 |
| 648 | 3300035692 | Ga0373935_0001786 | Ga0373935_0001786_2270_3049 | 244 |
| 649 | 3300035692 | Ga0373935_0003202 | Ga0373935_0003202_4095_4874 | 244 |
| 650 | 3300035725 | Ga0373947_0000007 | Ga0373947_0000007_178015_178794 | 244 |
| 651 | 3300036401 | Ga0373937_0055734 | Ga0373937_0055734_54_833 | 244 |
| 652 | 3300036457 | Ga0265778_001357 | Ga0265778_001357_595_1383 | 244 |
| 653 | 3300037068 | Ga0373925_0176117 | Ga0373925_0176117_508_1287 | 244 |
| 654 | 3300037068 | Ga0373925_0334926 | Ga0373925_0334926_76_855 | 244 |
| 655 | 3300037418 | Ga0395900_0019286 | Ga0395900_0019286_5101_5880 | 244 |
| 656 | 3300037466 | Ga0395898_0105664 | Ga0395898_0105664_1028_1807 | 244 |
| 657 | 3300037853 | Ga0436364_0125897 | Ga0436364_0125897_2574_3356 | 244 |
| 658 | 3300037853 | Ga0436364_0170612 | Ga0436364_0170612_121_900 | 244 |
| 659 | 3300037853 | Ga0436364_0881245 | Ga0436364_0881245_1508_2287 | 244 |
| 660 | 3300037853 | Ga0436364_1296832 | Ga0436364_1296832_7151_7933 | 244 |
| 661 | 3300039437 | Ga0436365_1698725 | Ga0436365_1698725_734_1594 | 244 |
| 662 | 3300039453 | Ga0436362_0900593 | Ga0436362_0900593_9517_10377 | 244 |
| 663 | 3300041411 | Ga0439466_0011337 | Ga0439466_0011337_1451_2251 | 244 |
| 664 | 3300041463 | Ga0451804_0081067 | Ga0451804_0081067_143_922 | 244 |
| 665 | 3300041494 | Ga0451837_1036194 | Ga0451837_1036194_104_889 | 244 |
| 666 | 3300041494 | Ga0451837_1701327 | Ga0451837_1701327_103_882 | 244 |
| 667 | 3300041512 | Ga0451853_0366154 | Ga0451853_0366154_7307_8086 | 244 |
| 668 | 3300042002 | Ga0439442_000871 | Ga0439442_000871_3820_4620 | 244 |
| 669 | 3300042438 | Ga0439459_0007460 | Ga0439459_0007460_412_1191 | 244 |
| 670 | 3300044656 | Ga0466969_0051017 | Ga0466969_0051017_887_1669 | 244 |
| 671 | 3300044658 | Ga0466972_0011943 | Ga0466972_0011943_2845_3645 | 244 |
| 672 | 3300044683 | Ga0466965_0082975 | Ga0466965_0082975_242_1021 | 244 |
| 673 | 3300044683 | Ga0466965_0146726 | Ga0466965_0146726_164_943 | 244 |
| 674 | 3300044684 | Ga0466966_0004593 | Ga0466966_0004593_2880_3662 | 244 |
| 675 | 3300044684 | Ga0466966_0018018 | Ga0466966_0018018_501_1280 | 244 |
| 676 | 3300044684 | Ga0466966_0025144 | Ga0466966_0025144_2901_3683 | 244 |
| 677 | 3300044684 | Ga0466966_0039457 | Ga0466966_0039457_468_1247 | 244 |
| 678 | 3300044684 | Ga0466966_0058255 | Ga0466966_0058255_929_1708 | 244 |
| 679 | 3300044684 | Ga0466966_0266512 | Ga0466966_0266512_157_936 | 244 |
| 680 | 3300044693 | Ga0466961_0070421 | Ga0466961_0070421_675_1457 | 244 |
| 681 | 3300044693 | Ga0466961_0070855 | Ga0466961_0070855_471_1250 | 244 |
| 682 | 3300044693 | Ga0466961_0083880 | Ga0466961_0083880_1003_1782 | 244 |
| 683 | 3300044693 | Ga0466961_0147946 | Ga0466961_0147946_229_1008 | 244 |
| 684 | 3300044693 | Ga0466961_0155802 | Ga0466961_0155802_255_1037 | 244 |
| 685 | 3300044694 | Ga0466963_0017279 | Ga0466963_0017279_3659_4438 | 244 |
| 686 | 3300044694 | Ga0466963_0030949 | Ga0466963_0030949_1085_1864 | 244 |
| 687 | 3300044694 | Ga0466963_0051668 | Ga0466963_0051668_1018_1797 | 244 |
| 688 | 3300044694 | Ga0466963_0247655 | Ga0466963_0247655_39_818 | 244 |
| 689 | 3300044694 | Ga0466963_0261392 | Ga0466963_0261392_92_871 | 244 |
| 690 | 3300044706 | Ga0466964_0059660 | Ga0466964_0059660_323_1102 | 244 |
| 691 | 3300044706 | Ga0466964_0107947 | Ga0466964_0107947_183_962 | 244 |
| 692 | 3300044719 | Ga0466971_0011381 | Ga0466971_0011381_1744_2523 | 244 |
| 693 | 3300044719 | Ga0466971_0011508 | Ga0466971_0011508_1900_2679 | 244 |
| 694 | 3300044719 | Ga0466971_0037281 | Ga0466971_0037281_880_1659 | 244 |
| 695 | 3300044719 | Ga0466971_0043046 | Ga0466971_0043046_279_1061 | 244 |
| 696 | 3300044719 | Ga0466971_0044511 | Ga0466971_0044511_127_906 | 244 |
| 697 | 3300044719 | Ga0466971_0123300 | Ga0466971_0123300_65_847 | 244 |
| 698 | 3300044765 | Ga0466970_0031469 | Ga0466970_0031469_1039_1818 | 244 |
| 699 | 3300044765 | Ga0466970_0060040 | Ga0466970_0060040_1217_1999 | 244 |
| 700 | 3300044842 | Ga0466957_0108379 | Ga0466957_0108379_217_999 | 244 |
| 701 | 3300044842 | Ga0466957_0209765 | Ga0466957_0209765_239_1018 | 244 |
| 702 | 3300044842 | Ga0466957_0258149 | Ga0466957_0258149_300_1079 | 244 |
| 703 | 3300044901 | Ga0466960_0006650 | Ga0466960_0006650_74_853 | 244 |
| 704 | 3300044901 | Ga0466960_0042131 | Ga0466960_0042131_706_1485 | 244 |
| 705 | 3300044901 | Ga0466960_0046291 | Ga0466960_0046291_1181_1960 | 244 |
| 706 | 3300044901 | Ga0466960_0054401 | Ga0466960_0054401_191_970 | 244 |
| 707 | 3300044901 | Ga0466960_0071568 | Ga0466960_0071568_500_1369 | 244 |
| 708 | 3300045049 | Ga0466959_0001545 | Ga0466959_0001545_6511_7290 | 244 |
| 709 | 3300045049 | Ga0466959_0020240 | Ga0466959_0020240_3599_4381 | 244 |
| 710 | 3300045049 | Ga0466959_0116879 | Ga0466959_0116879_972_1754 | 244 |
| 711 | 3300045049 | Ga0466959_0284935 | Ga0466959_0284935_74_853 | 244 |
| 712 | 3300045049 | Ga0466959_0418831 | Ga0466959_0418831_38_817 | 244 |
| 713 | 3300045049 | Ga0466959_0455066 | Ga0466959_0455066_40_819 | 244 |
| 714 | 3300045836 | Ga0466958_0006216 | Ga0466958_0006216_1170_1949 | 244 |
| 715 | 3300045836 | Ga0466958_0076215 | Ga0466958_0076215_274_1053 | 244 |
| 716 | 3300045836 | Ga0466958_0088779 | Ga0466958_0088779_282_1061 | 244 |
| 717 | 3300045836 | Ga0466958_0120689 | Ga0466958_0120689_793_1572 | 244 |
| 718 | 3300045976 | Ga0466967_0007460 | Ga0466967_0007460_3409_4188 | 244 |
| 719 | 3300045976 | Ga0466967_0009661 | Ga0466967_0009661_891_1670 | 244 |
| 720 | 3300045976 | Ga0466967_0149197 | Ga0466967_0149197_160_945 | 244 |
| 721 | 3300045976 | Ga0466967_0161062 | Ga0466967_0161062_515_1294 | 244 |
| 722 | 3300045976 | Ga0466967_0176053 | Ga0466967_0176053_442_1224 | 244 |
| 723 | 3300045976 | Ga0466967_0263849 | Ga0466967_0263849_123_902 | 244 |
| 724 | 3300045976 | Ga0466967_0403737 | Ga0466967_0403737_104_883 | 244 |
| 725 | 3300046454 | Ga0495592_0012558 | Ga0495592_0012558_4664_5443 | 244 |
| 726 | 3300046459 | Ga0495629_0041148 | Ga0495629_0041148_947_1726 | 244 |
| 727 | 3300046459 | Ga0495629_0141310 | Ga0495629_0141310_226_1005 | 244 |
| 728 | 3300046459 | Ga0495629_0183981 | Ga0495629_0183981_405_1184 | 244 |
| 729 | 3300046462 | Ga0495651_0009568 | Ga0495651_0009568_2239_3018 | 244 |
| 730 | 3300046472 | Ga0495580_0113823 | Ga0495580_0113823_552_1331 | 244 |
| 731 | 3300046477 | Ga0495664_0017094 | Ga0495664_0017094_1962_2741 | 244 |
| 732 | 3300046499 | Ga0495594_0003426 | Ga0495594_0003426_5999_6778 | 244 |
| 733 | 3300046516 | Ga0495628_0124496 | Ga0495628_0124496_1143_1922 | 244 |
| 734 | 3300046517 | Ga0495630_0144676 | Ga0495630_0144676_457_1236 | 244 |
| 735 | 3300046517 | Ga0495630_0268476 | Ga0495630_0268476_234_1013 | 244 |
| 736 | 3300046519 | Ga0495632_0160106 | Ga0495632_0160106_119_898 | 244 |
| 737 | 3300046526 | Ga0495666_0092176 | Ga0495666_0092176_601_1380 | 244 |
| 738 | 3300046529 | Ga0495652_0149229 | Ga0495652_0149229_524_1303 | 244 |
| 739 | 3300046531 | Ga0495665_0115513 | Ga0495665_0115513_216_995 | 244 |
| 740 | 3300046543 | Ga0495645_0076536 | Ga0495645_0076536_1264_2043 | 244 |
| 741 | 3300046616 | Ga0495668_0280021 | Ga0495668_0280021_43_822 | 244 |
| 742 | 3300046642 | Ga0495634_0033316 | Ga0495634_0033316_1527_2306 | 244 |
| 743 | 3300046675 | Ga0495657_0058106 | Ga0495657_0058106_1124_1903 | 244 |
| 744 | 3300046679 | Ga0495623_0011563 | Ga0495623_0011563_4405_5184 | 244 |
| 745 | 3300046680 | Ga0495646_0053323 | Ga0495646_0053323_666_1445 | 244 |
| 746 | 3300046690 | Ga0495624_0031544 | Ga0495624_0031544_2026_2805 | 244 |
| 747 | 3300046809 | Ga0495600_0113698 | Ga0495600_0113698_110_889 | 244 |
| 748 | 3300047317 | Ga0495604_0232565 | Ga0495604_0232565_127_906 | 244 |
| 749 | 3300047321 | Ga0495676_0184959 | Ga0495676_0184959_262_1041 | 244 |
| 750 | 3300047322 | Ga0495680_0239051 | Ga0495680_0239051_281_1060 | 244 |
| 751 | 3300047444 | Ga0495675_0007693 | Ga0495675_0007693_1189_1968 | 244 |
| 752 | 3300047471 | Ga0495684_0006994 | Ga0495684_0006994_2239_3018 | 244 |
| 753 | 3300047673 | Ga0495593_0078823 | Ga0495593_0078823_201_980 | 244 |
| 754 | 3300048088 | Ga0495602_0081358 | Ga0495602_0081358_203_982 | 244 |
| 755 | 3300048903 | Ga0496100_0006929 | Ga0496100_0006929_4247_5032 | 244 |
| 756 | 3300048903 | Ga0496100_0010164 | Ga0496100_0010164_3026_3826 | 244 |
| 757 | 3300048903 | Ga0496100_0133308 | Ga0496100_0133308_65_865 | 244 |
| 758 | 3300048904 | Ga0496101_0026648 | Ga0496101_0026648_1353_2138 | 244 |
| 759 | 3300048904 | Ga0496101_0074556 | Ga0496101_0074556_984_1784 | 244 |
| 760 | 3300048905 | Ga0496102_0000030 | Ga0496102_0000030_218524_219309 | 244 |
| 761 | 3300048905 | Ga0496102_0000976 | Ga0496102_0000976_18919_19719 | 244 |
| 762 | 3300048905 | Ga0496102_0005338 | Ga0496102_0005338_3022_3822 | 244 |
| 763 | 3300048905 | Ga0496102_0234873 | Ga0496102_0234873_403_1203 | 244 |
| 764 | 3300048906 | Ga0496103_0000068 | Ga0496103_0000068_14801_15586 | 244 |
| 765 | 3300048906 | Ga0496103_0005142 | Ga0496103_0005142_4443_5243 | 244 |
| 766 | 3300048907 | Ga0496104_0004070 | Ga0496104_0004070_1625_2404 | 244 |
| 767 | 3300048907 | Ga0496104_0015707 | Ga0496104_0015707_1910_2695 | 244 |
| 768 | 3300048907 | Ga0496104_0096351 | Ga0496104_0096351_878_1657 | 244 |
| 769 | 3300048907 | Ga0496104_0300003 | Ga0496104_0300003_208_1008 | 244 |
| 770 | 3300048908 | Ga0496105_0018374 | Ga0496105_0018374_3529_4308 | 244 |
| 771 | 3300048908 | Ga0496105_0023416 | Ga0496105_0023416_2230_3009 | 244 |
| 772 | 3300048908 | Ga0496105_0027387 | Ga0496105_0027387_2521_3306 | 244 |
| 773 | 3300048908 | Ga0496105_0181950 | Ga0496105_0181950_279_1079 | 244 |
| 774 | 3300048908 | Ga0496105_0255820 | Ga0496105_0255820_455_1270 | 244 |
| 775 | 3300048909 | Ga0496106_0003384 | Ga0496106_0003384_4058_4858 | 244 |
| 776 | 3300048909 | Ga0496106_0257548 | Ga0496106_0257548_270_1049 | 244 |
| 777 | 3300048910 | Ga0496107_0000383 | Ga0496107_0000383_1067_1867 | 244 |
| 778 | 3300048911 | Ga0496108_0012767 | Ga0496108_0012767_1347_2126 | 244 |
| 779 | 3300048911 | Ga0496108_0031658 | Ga0496108_0031658_2237_3037 | 244 |
| 780 | 3300048911 | Ga0496108_0034906 | Ga0496108_0034906_2938_3738 | 244 |
| 781 | 3300048911 | Ga0496108_0049489 | Ga0496108_0049489_1005_1784 | 244 |
| 782 | 3300048911 | Ga0496108_0348777 | Ga0496108_0348777_92_871 | 244 |
| 783 | 3300048912 | Ga0496109_0045242 | Ga0496109_0045242_765_1565 | 244 |
| 784 | 3300048912 | Ga0496109_0353309 | Ga0496109_0353309_414_1193 | 244 |
| 785 | 3300048913 | Ga0496110_0045802 | Ga0496110_0045802_1025_1804 | 244 |
| 786 | 3300048913 | Ga0496110_0245050 | Ga0496110_0245050_97_897 | 244 |
| 787 | 3300048914 | Ga0496111_0047756 | Ga0496111_0047756_1733_2533 | 244 |
| 788 | 3300048914 | Ga0496111_0081553 | Ga0496111_0081553_750_1529 | 244 |
| 789 | 3300048914 | Ga0496111_0203221 | Ga0496111_0203221_520_1299 | 244 |
| 790 | 3300048915 | Ga0496112_0026180 | Ga0496112_0026180_3415_4230 | 244 |
| 791 | 3300048915 | Ga0496112_0310705 | Ga0496112_0310705_664_1464 | 244 |
| 792 | 3300048915 | Ga0496112_0350995 | Ga0496112_0350995_305_1084 | 244 |
| 793 | 3300048916 | Ga0496113_0104993 | Ga0496113_0104993_369_1184 | 244 |
| 794 | 3300048916 | Ga0496113_0168939 | Ga0496113_0168939_828_1628 | 244 |
| 795 | 3300048916 | Ga0496113_0340373 | Ga0496113_0340373_134_913 | 244 |
| 796 | 3300048917 | Ga0496114_0002030 | Ga0496114_0002030_4259_5059 | 244 |
| 797 | 3300048917 | Ga0496114_0411070 | Ga0496114_0411070_91_891 | 244 |
| 798 | 3300048918 | Ga0496115_0004444 | Ga0496115_0004444_4896_5696 | 244 |
| 799 | 3300048918 | Ga0496115_0186268 | Ga0496115_0186268_56_856 | 244 |
| 800 | 3300048919 | Ga0496116_0000152 | Ga0496116_0000152_7854_8639 | 244 |
| 801 | 3300048920 | Ga0496117_0000059 | Ga0496117_0000059_257427_258212 | 244 |
| 802 | 3300048921 | Ga0496118_0000061 | Ga0496118_0000061_218142_218927 | 244 |
| 803 | 3300048921 | Ga0496118_0203369 | Ga0496118_0203369_267_1067 | 244 |
| 804 | 3300048922 | Ga0496119_0001310 | Ga0496119_0001310_1956_2741 | 244 |
| 805 | 3300048923 | Ga0496120_0022502 | Ga0496120_0022502_2021_2806 | 244 |
| 806 | 3300048924 | Ga0496121_0047196 | Ga0496121_0047196_2568_3350 | 244 |
| 807 | 3300048924 | Ga0496121_0058209 | Ga0496121_0058209_1861_2646 | 244 |
| 808 | 3300048927 | Ga0496124_0020330 | Ga0496124_0020330_2104_2889 | 244 |
| 809 | 3300048928 | Ga0496125_0034873 | Ga0496125_0034873_1601_2386 | 244 |
| 810 | 3300048929 | Ga0496126_0000213 | Ga0496126_0000213_125552_126337 | 244 |
| 811 | 3300048929 | Ga0496126_0021483 | Ga0496126_0021483_2148_2927 | 244 |
| 812 | 3300049534 | Ga0501318_004057 | Ga0501318_004057_42_821 | 244 |
| 813 | 3300049534 | Ga0501318_015052 | Ga0501318_015052_25_804 | 244 |
| 814 | 3300049537 | Ga0501321_008874 | Ga0501321_008874_252_1031 | 244 |
| 815 | 3300049568 | Ga0501031_0340208 | Ga0501031_0340208_60_839 | 244 |
| 816 | 3300049569 | Ga0501032_0047866 | Ga0501032_0047866_723_1502 | 244 |
| 817 | 3300049571 | Ga0501034_0440837 | Ga0501034_0440837_86_874 | 244 |
| 818 | 3300049573 | Ga0501037_0190213 | Ga0501037_0190213_127_906 | 244 |
| 819 | 3300049574 | Ga0501038_0039540 | Ga0501038_0039540_2527_3306 | 244 |
| 820 | 3300049574 | Ga0501038_0394583 | Ga0501038_0394583_197_976 | 244 |
| 821 | 3300049575 | Ga0501039_0436604 | Ga0501039_0436604_42_821 | 244 |
| 822 | 3300049578 | Ga0501042_0132542 | Ga0501042_0132542_196_975 | 244 |
| 823 | 3300049579 | Ga0501043_0562824 | Ga0501043_0562824_46_825 | 244 |
| 824 | 3300049580 | Ga0501046_0179994 | Ga0501046_0179994_255_1034 | 244 |
| 825 | 3300049581 | Ga0501047_0033318 | Ga0501047_0033318_1947_2726 | 244 |
| 826 | 3300049581 | Ga0501047_0223391 | Ga0501047_0223391_471_1250 | 244 |
| 827 | 3300049585 | Ga0501069_0012874 | Ga0501069_0012874_1554_2333 | 244 |
| 828 | 3300049590 | Ga0501074_0033213 | Ga0501074_0033213_2848_3627 | 244 |
| 829 | 3300049822 | Ga0501035_0241627 | Ga0501035_0241627_636_1415 | 244 |
| 830 | 3300049823 | Ga0501044_0059542 | Ga0501044_0059542_589_1368 | 244 |
| 831 | 3300050491 | nmdc:mga00v17_2707_c1 | nmdc:mga00v17_2707_c1_3159_3959 | 244 |
| 832 | 3300050491 | nmdc:mga00v17_31527_c1 | nmdc:mga00v17_31527_c1_1186_1986 | 244 |
| 833 | 3300050494 | nmdc:mga06z11_111245_c1 | nmdc:mga06z11_111245_c1_264_1064 | 244 |
| 834 | 3300050496 | nmdc:mga07m45_58622_c1 | nmdc:mga07m45_58622_c1_979_1764 | 244 |
| 835 | 3300050507 | nmdc:mga05p37_119483_c1 | nmdc:mga05p37_119483_c1_1285_2085 | 244 |
| 836 | 3300050507 | nmdc:mga05p37_374844_c1 | nmdc:mga05p37_374844_c1_209_988 | 244 |
| 837 | 3300050509 | nmdc:mga0qj67_992_c1 | nmdc:mga0qj67_992_c1_6926_7705 | 244 |
| 838 | 3300050510 | nmdc:mga06r32_111486_c1 | nmdc:mga06r32_111486_c1_533_1333 | 244 |
| 839 | 3300050511 | nmdc:mga08y16_229632_c1 | nmdc:mga08y16_229632_c1_1043_1843 | 244 |
| 840 | 3300050512 | nmdc:mga0n895_132741_c1 | nmdc:mga0n895_132741_c1_517_1296 | 244 |
| 841 | 3300050515 | nmdc:mga0a205_391613_c1 | nmdc:mga0a205_391613_c1_159_938 | 244 |
| 842 | 3300050516 | nmdc:mga0sz30_13101_c1 | nmdc:mga0sz30_13101_c1_1314_2114 | 244 |
| 843 | 3300050516 | nmdc:mga0sz30_34826_c1 | nmdc:mga0sz30_34826_c1_1105_1905 | 244 |
| 844 | 3300053077 | Ga0495601_0158548 | Ga0495601_0158548_341_1120 | 244 |
| 845 | 3300053078 | Ga0495612_0025403 | Ga0495612_0025403_199_978 | 244 |
| 846 | 3300053084 | Ga0495595_0003839 | Ga0495595_0003839_2636_3415 | 244 |
| 847 | 3300053088 | Ga0500644_0029016 | Ga0500644_0029016_909_1688 | 244 |
| 848 | 3300053092 | Ga0500583_0046072 | Ga0500583_0046072_520_1299 | 244 |
| 849 | 3300053096 | Ga0500641_0017733 | Ga0500641_0017733_823_1602 | 244 |
| 850 | 3300053109 | Ga0500569_017482 | Ga0500569_017482_192_971 | 244 |
| 851 | 3300053131 | Ga0500652_047283 | Ga0500652_047283_773_1552 | 244 |
| 852 | 3300053139 | Ga0500568_0003911 | Ga0500568_0003911_5751_6530 | 244 |
| 853 | 3300053146 | Ga0500588_0002726 | Ga0500588_0002726_467_1246 | 244 |
| 854 | 3300053149 | Ga0500600_0066452 | Ga0500600_0066452_33_812 | 244 |
| 855 | 3300053159 | Ga0500630_080537 | Ga0500630_080537_493_1272 | 244 |
| 856 | 3300053160 | Ga0500633_0130479 | Ga0500633_0130479_41_820 | 244 |
| 857 | 3300061719 | Ga0466962_0017907 | Ga0466962_0017907_1458_2237 | 244 |
| 858 | 3300061719 | Ga0466962_0038075 | Ga0466962_0038075_437_1216 | 244 |
| 859 | 3300061719 | Ga0466962_0052483 | Ga0466962_0052483_428_1207 | 244 |
| 860 | iso_pu_bacteria | 2867507094 | 2867508357 | 244 |
| 861 | iso_pu_bacteria | 8001781756 | 8001782038 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rln-assembly1.cif.gz_A | structural basis of cytosolic dna recognition by innate immune receptors | 0.8583 | 128 | 156 |
| 3b6y-assembly2.cif.gz_B | crystal structure of the second hin-200 domain of interferon-inducible protein 16 | 0.847 | 128 | 156 |
| 6hhx-assembly1.cif.gz_B | structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine | 0.8451 | 129 | 155 |
| 4cj2-assembly2.cif.gz_D | crystal structure of hewl in complex with affitin h4 | 0.8407 | 132 | 155 |
| 6hhx-assembly1.cif.gz_A | structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine | 0.8404 | 129 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9JLC4_344_670_2.120.10.10 | Mainly Beta;6 Propeller;Neuraminidase; | 0.8537 | 131 | 155 | 2.120.10.10 |
| af_A0A0R0JSL2_58_168_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.8423 | 129 | 155 | 3.60.10.10 |
| 1wydB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8398 | 129 | 153 | 2.40.50.140 |
| af_P0DOV2_527_619_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.839 | 128 | 156 | 2.40.50.140 |
| 1o94C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8389 | 1 | 215 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A348NR47-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9005 | 1 | 166 |
GO:0005829
GO:0009055 |
| AF-A0A0M8TA28-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.8981 | 102 | 168 |
|
| AF-A0A6G3BPL7-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.8947 | 1 | 173 |
GO:0005829
GO:0009055 |
| AF-A0A7K1A1C4-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.8838 | 1 | 174 |
GO:0005829
GO:0009055 |
| AF-A0A7K2ECA5-F1-model_v4 | Electron transfer flavoprotein subunit beta/FixA family protein | 0.8823 | 1 | 209 |
GO:0009055
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar