F482761
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 833 | 330 | 1666 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0162319|Ga0501047_0162319_321_743 |
| Length | 140 |
| Sequence | VFERETSHNRRGVAAGMGEGVVLSFTGALKVFLAVQPCDLRKSFNGLHGLVTERLGEDPRSGSLFVFANRRRSRLKVLYWDGTGLWVMTKRLEKGTFSWPAALEPGREKLQLAPEALTLLTDGIDLRGARMRPWYERGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 142 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 177 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 186 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 187 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 188 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 198 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 220 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 224 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 225 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 226 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 227 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 228 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 229 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 230 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 231 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 232 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 308 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.68 |
| Nodule | 0 |
| Rhizoplane | 0.72 |
| Rhizosphere | 94.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 38.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501047_0162319 | 3300049581 | Bacteria | 2106 |
| 2 | LJNas_1029830 | 3300000546 | Bacteria | 586 |
| 3 | JGI24736J21556_1040810 | 3300001904 | Unclassified | 713 |
| 4 | JGI24033J26618_1008457 | 3300002155 | Unclassified | 1185 |
| 5 | JGI24742J22300_10010220 | 3300002244 | Unclassified | 1552 |
| 6 | rootH2_10098933 | 3300003320 | Bacteria | 5108 |
| 7 | rootL2_10243191 | 3300003322 | Unclassified | 1349 |
| 8 | rootH1_10276053 | 3300003323 | Bacteria | 1116 |
| 9 | Ga0065715_10433002 | 3300005293 | Unclassified | 845 |
| 10 | Ga0065707_10012266 | 3300005295 | Bacteria | 1913 |
| 11 | Ga0070658_10070188 | 3300005327 | Unclassified | 2868 |
| 12 | Ga0070658_10167266 | 3300005327 | Bacteria | 1846 |
| 13 | Ga0070658_11396094 | 3300005327 | Bacteria | 608 |
| 14 | Ga0070683_101749724 | 3300005329 | Unclassified | 598 |
| 15 | Ga0070660_100067129 | 3300005339 | Bacteria | 2794 |
| 16 | Ga0070660_100106465 | 3300005339 | Unclassified | 2227 |
| 17 | Ga0070689_100101624 | 3300005340 | Unclassified | 2276 |
| 18 | Ga0070691_10032408 | 3300005341 | Bacteria | 2455 |
| 19 | Ga0070691_10199689 | 3300005341 | Bacteria | 1050 |
| 20 | Ga0070661_100067125 | 3300005344 | Bacteria | 2636 |
| 21 | Ga0070661_100269916 | 3300005344 | Bacteria | 1317 |
| 22 | Ga0070661_100661060 | 3300005344 | Bacteria | 849 |
| 23 | Ga0070674_100821819 | 3300005356 | Unclassified | 804 |
| 24 | Ga0070674_101385921 | 3300005356 | Bacteria | 629 |
| 25 | Ga0070688_100144698 | 3300005365 | Bacteria | 1618 |
| 26 | Ga0070688_100996235 | 3300005365 | Unclassified | 665 |
| 27 | Ga0070659_100203246 | 3300005366 | Bacteria | 1631 |
| 28 | Ga0070659_100430061 | 3300005366 | Unclassified | 1117 |
| 29 | Ga0070659_101173881 | 3300005366 | Bacteria | 678 |
| 30 | Ga0070703_10055786 | 3300005406 | Bacteria | 1277 |
| 31 | Ga0070709_10039187 | 3300005434 | Bacteria | 2907 |
| 32 | Ga0070709_10045133 | 3300005434 | Bacteria | 2733 |
| 33 | Ga0070709_10303258 | 3300005434 | Bacteria | 1167 |
| 34 | Ga0070709_10752401 | 3300005434 | Unclassified | 762 |
| 35 | Ga0070709_10992079 | 3300005434 | Bacteria | 668 |
| 36 | Ga0070714_101931306 | 3300005435 | Unclassified | 576 |
| 37 | Ga0070713_100256374 | 3300005436 | Bacteria | 1597 |
| 38 | Ga0070713_100504298 | 3300005436 | Bacteria | 1142 |
| 39 | Ga0070713_100582276 | 3300005436 | Bacteria | 1062 |
| 40 | Ga0070713_100690867 | 3300005436 | Bacteria | 974 |
| 41 | Ga0070713_101885276 | 3300005436 | Unclassified | 580 |
| 42 | Ga0070710_10100797 | 3300005437 | Bacteria | 1719 |
| 43 | Ga0070710_10136865 | 3300005437 | Bacteria | 1498 |
| 44 | Ga0070710_10749957 | 3300005437 | Unclassified | 693 |
| 45 | Ga0070711_100089316 | 3300005439 | Unclassified | 2216 |
| 46 | Ga0070711_100255124 | 3300005439 | Bacteria | 1377 |
| 47 | Ga0070711_100260124 | 3300005439 | Bacteria | 1365 |
| 48 | Ga0070711_100267570 | 3300005439 | Bacteria | 1347 |
| 49 | Ga0070705_100057469 | 3300005440 | Bacteria | 2295 |
| 50 | Ga0070700_100049567 | 3300005441 | Unclassified | 2608 |
| 51 | Ga0070708_100104289 | 3300005445 | Bacteria | 2600 |
| 52 | Ga0070708_100395068 | 3300005445 | Bacteria | 1304 |
| 53 | Ga0070708_100705840 | 3300005445 | Unclassified | 949 |
| 54 | Ga0070708_101045686 | 3300005445 | Bacteria | 765 |
| 55 | Ga0070708_101179946 | 3300005445 | Bacteria | 716 |
| 56 | Ga0070663_100419360 | 3300005455 | Bacteria | 1098 |
| 57 | Ga0070663_100554978 | 3300005455 | Bacteria | 961 |
| 58 | Ga0070662_100340204 | 3300005457 | Bacteria | 1227 |
| 59 | Ga0070662_100497553 | 3300005457 | Bacteria | 1016 |
| 60 | Ga0070681_10040846 | 3300005458 | Bacteria | 4647 |
| 61 | Ga0070681_10440100 | 3300005458 | Bacteria | 1215 |
| 62 | Ga0070681_10575775 | 3300005458 | Bacteria | 1040 |
| 63 | Ga0070685_10609026 | 3300005466 | Unclassified | 787 |
| 64 | Ga0070685_10767058 | 3300005466 | Unclassified | 708 |
| 65 | Ga0070706_100219011 | 3300005467 | Bacteria | 1777 |
| 66 | Ga0070706_100241852 | 3300005467 | Unclassified | 1685 |
| 67 | Ga0070706_100277690 | 3300005467 | Bacteria | 1563 |
| 68 | Ga0070706_100847754 | 3300005467 | Bacteria | 845 |
| 69 | Ga0070707_100108055 | 3300005468 | Bacteria | 2699 |
| 70 | Ga0070707_100147790 | 3300005468 | Bacteria | 2287 |
| 71 | Ga0070698_100673296 | 3300005471 | Bacteria | 976 |
| 72 | Ga0070699_100676407 | 3300005518 | Unclassified | 942 |
| 73 | Ga0070679_100081616 | 3300005530 | Bacteria | 3223 |
| 74 | Ga0070679_100157712 | 3300005530 | Bacteria | 2244 |
| 75 | Ga0070679_100310225 | 3300005530 | Bacteria | 1527 |
| 76 | Ga0070679_100327756 | 3300005530 | Bacteria | 1480 |
| 77 | Ga0070679_100849020 | 3300005530 | Unclassified | 856 |
| 78 | Ga0070679_100857260 | 3300005530 | Unclassified | 852 |
| 79 | Ga0070684_100156240 | 3300005535 | Bacteria | 2068 |
| 80 | Ga0070684_101909403 | 3300005535 | Unclassified | 560 |
| 81 | Ga0070697_100201424 | 3300005536 | Bacteria | 1692 |
| 82 | Ga0070697_100212599 | 3300005536 | Bacteria | 1647 |
| 83 | Ga0070697_100368588 | 3300005536 | Bacteria | 1242 |
| 84 | Ga0070697_100647192 | 3300005536 | Bacteria | 931 |
| 85 | Ga0068853_100000015 | 3300005539 | Bacteria | 226965 |
| 86 | Ga0068853_100026270 | 3300005539 | Bacteria | 4889 |
| 87 | Ga0068853_100222330 | 3300005539 | Bacteria | 1725 |
| 88 | Ga0068853_100497062 | 3300005539 | Unclassified | 1151 |
| 89 | Ga0068853_101187962 | 3300005539 | Unclassified | 736 |
| 90 | Ga0070672_100997110 | 3300005543 | Bacteria | 742 |
| 91 | Ga0070665_100105108 | 3300005548 | Bacteria | 2825 |
| 92 | Ga0070665_100361777 | 3300005548 | Bacteria | 1457 |
| 93 | Ga0070665_100535790 | 3300005548 | Bacteria | 1183 |
| 94 | Ga0068855_100059098 | 3300005563 | Bacteria | 4487 |
| 95 | Ga0068855_100146684 | 3300005563 | Bacteria | 2685 |
| 96 | Ga0068855_100395191 | 3300005563 | Unclassified | 1516 |
| 97 | Ga0068855_100450818 | 3300005563 | Bacteria | 1404 |
| 98 | Ga0068855_101151695 | 3300005563 | Unclassified | 808 |
| 99 | Ga0068855_101318078 | 3300005563 | Unclassified | 747 |
| 100 | Ga0068854_100432181 | 3300005578 | Bacteria | 1096 |
| 101 | Ga0068856_100113382 | 3300005614 | Bacteria | 2709 |
| 102 | Ga0068856_100118036 | 3300005614 | Bacteria | 2654 |
| 103 | Ga0068856_100122846 | 3300005614 | Bacteria | 2599 |
| 104 | Ga0068856_100779366 | 3300005614 | Bacteria | 976 |
| 105 | Ga0068856_100790421 | 3300005614 | Bacteria | 969 |
| 106 | Ga0068856_100950718 | 3300005614 | Bacteria | 878 |
| 107 | Ga0068856_101012968 | 3300005614 | Unclassified | 849 |
| 108 | Ga0068856_101619461 | 3300005614 | Unclassified | 660 |
| 109 | Ga0068852_100246040 | 3300005616 | Bacteria | 1711 |
| 110 | Ga0068852_100449191 | 3300005616 | Unclassified | 1276 |
| 111 | Ga0068859_100626417 | 3300005617 | Bacteria | 1168 |
| 112 | Ga0068864_100423327 | 3300005618 | Unclassified | 1269 |
| 113 | Ga0068864_100460759 | 3300005618 | Unclassified | 1217 |
| 114 | Ga0068866_10527909 | 3300005718 | Bacteria | 785 |
| 115 | Ga0068861_101347239 | 3300005719 | Unclassified | 695 |
| 116 | Ga0068851_10081788 | 3300005834 | Bacteria | 1688 |
| 117 | Ga0068863_100103606 | 3300005841 | Bacteria | 2706 |
| 118 | Ga0068863_100996538 | 3300005841 | Unclassified | 840 |
| 119 | Ga0068863_102017386 | 3300005841 | Unclassified | 587 |
| 120 | Ga0068858_100307444 | 3300005842 | Unclassified | 1513 |
| 121 | Ga0068858_100550231 | 3300005842 | Unclassified | 1117 |
| 122 | Ga0068858_101918422 | 3300005842 | Unclassified | 585 |
| 123 | Ga0068862_100066210 | 3300005844 | Bacteria | 3113 |
| 124 | Ga0068862_101236293 | 3300005844 | Bacteria | 746 |
| 125 | Ga0081455_10066197 | 3300005937 | Bacteria | 3018 |
| 126 | Ga0081539_10084443 | 3300005985 | Unclassified | 1659 |
| 127 | Ga0070717_10716381 | 3300006028 | Bacteria | 909 |
| 128 | Ga0070715_10008195 | 3300006163 | Bacteria | 3633 |
| 129 | Ga0070715_10019200 | 3300006163 | Bacteria | 2617 |
| 130 | Ga0070716_100035948 | 3300006173 | Bacteria | 2727 |
| 131 | Ga0070716_100059342 | 3300006173 | Bacteria | 2205 |
| 132 | Ga0070716_100228075 | 3300006173 | Unclassified | 1255 |
| 133 | Ga0070716_101336203 | 3300006173 | Unclassified | 581 |
| 134 | Ga0070712_100038263 | 3300006175 | Unclassified | 3277 |
| 135 | Ga0070712_100061258 | 3300006175 | Bacteria | 2658 |
| 136 | Ga0070712_100066737 | 3300006175 | Bacteria | 2558 |
| 137 | Ga0070712_100163666 | 3300006175 | Bacteria | 1720 |
| 138 | Ga0070712_100192131 | 3300006175 | Bacteria | 1598 |
| 139 | Ga0070712_100317541 | 3300006175 | Bacteria | 1266 |
| 140 | Ga0070712_100409655 | 3300006175 | Bacteria | 1121 |
| 141 | Ga0075366_10015713 | 3300006195 | Unclassified | 4344 |
| 142 | Ga0075366_10437857 | 3300006195 | Bacteria | 806 |
| 143 | Ga0097621_100199158 | 3300006237 | Unclassified | 1738 |
| 144 | Ga0068871_100409171 | 3300006358 | Unclassified | 1209 |
| 145 | Ga0075428_100283567 | 3300006844 | Bacteria | 1782 |
| 146 | Ga0075431_100419225 | 3300006847 | Bacteria | 1338 |
| 147 | Ga0075429_100146070 | 3300006880 | Bacteria | 2070 |
| 148 | Ga0097620_100626498 | 3300006931 | Bacteria | 1168 |
| 149 | Ga0075435_100617688 | 3300007076 | Bacteria | 940 |
| 150 | Ga0075435_101132274 | 3300007076 | Bacteria | 684 |
| 151 | Ga0099794_10129730 | 3300007265 | Bacteria | 1272 |
| 152 | Ga0099794_10221380 | 3300007265 | Bacteria | 972 |
| 153 | Ga0099795_10019340 | 3300007788 | Bacteria | 2203 |
| 154 | Ga0099795_10157263 | 3300007788 | Bacteria | 935 |
| 155 | Ga0105240_10094737 | 3300009093 | Bacteria | 3641 |
| 156 | Ga0105240_10160191 | 3300009093 | Bacteria | 2674 |
| 157 | Ga0105240_10207327 | 3300009093 | Bacteria | 2293 |
| 158 | Ga0105240_10440484 | 3300009093 | Bacteria | 1460 |
| 159 | Ga0105240_10671519 | 3300009093 | Bacteria | 1134 |
| 160 | Ga0105240_11016752 | 3300009093 | Unclassified | 886 |
| 161 | Ga0105247_11866406 | 3300009101 | Unclassified | 502 |
| 162 | Ga0114129_11552664 | 3300009147 | Bacteria | 812 |
| 163 | Ga0105241_10064896 | 3300009174 | Bacteria | 2820 |
| 164 | Ga0105241_10624952 | 3300009174 | Bacteria | 976 |
| 165 | Ga0105241_11162407 | 3300009174 | Unclassified | 729 |
| 166 | Ga0105237_10063879 | 3300009545 | Bacteria | 3678 |
| 167 | Ga0105237_10106734 | 3300009545 | Bacteria | 2792 |
| 168 | Ga0105237_10132884 | 3300009545 | Unclassified | 2483 |
| 169 | Ga0105237_10696421 | 3300009545 | Bacteria | 1023 |
| 170 | Ga0105237_10794811 | 3300009545 | Bacteria | 953 |
| 171 | Ga0105237_11088853 | 3300009545 | Unclassified | 806 |
| 172 | Ga0105237_11584450 | 3300009545 | Unclassified | 662 |
| 173 | Ga0105238_10067969 | 3300009551 | Bacteria | 3564 |
| 174 | Ga0105238_10071861 | 3300009551 | Unclassified | 3457 |
| 175 | Ga0105238_10107665 | 3300009551 | Unclassified | 2768 |
| 176 | Ga0105238_10133648 | 3300009551 | Bacteria | 2459 |
| 177 | Ga0105238_10294466 | 3300009551 | Bacteria | 1606 |
| 178 | Ga0105238_10521138 | 3300009551 | Bacteria | 1191 |
| 179 | Ga0105238_11299597 | 3300009551 | Unclassified | 753 |
| 180 | Ga0105238_11472895 | 3300009551 | Unclassified | 709 |
| 181 | Ga0099796_10036351 | 3300010159 | Bacteria | 1640 |
| 182 | Ga0099796_10091236 | 3300010159 | Unclassified | 1133 |
| 183 | Ga0105239_10030748 | 3300010375 | Bacteria | 5905 |
| 184 | Ga0105239_10116419 | 3300010375 | Unclassified | 2966 |
| 185 | Ga0105239_10592577 | 3300010375 | Bacteria | 1264 |
| 186 | Ga0105239_11150443 | 3300010375 | Unclassified | 894 |
| 187 | Ga0105239_11303840 | 3300010375 | Bacteria | 838 |
| 188 | Ga0105239_13315945 | 3300010375 | Bacteria | 524 |
| 189 | Ga0157373_10042523 | 3300013100 | Bacteria | 3247 |
| 190 | Ga0157371_10352684 | 3300013102 | Unclassified | 1071 |
| 191 | Ga0157370_10565186 | 3300013104 | Bacteria | 1042 |
| 192 | Ga0157370_10578328 | 3300013104 | Unclassified | 1029 |
| 193 | Ga0157370_10623590 | 3300013104 | Bacteria | 986 |
| 194 | Ga0157370_11082950 | 3300013104 | Unclassified | 724 |
| 195 | Ga0157369_10116623 | 3300013105 | Bacteria | 2835 |
| 196 | Ga0157369_10128697 | 3300013105 | Unclassified | 2684 |
| 197 | Ga0157369_11145519 | 3300013105 | Unclassified | 794 |
| 198 | Ga0157369_11375856 | 3300013105 | Bacteria | 719 |
| 199 | Ga0157369_11450056 | 3300013105 | Bacteria | 699 |
| 200 | Ga0157374_10143823 | 3300013296 | Unclassified | 2316 |
| 201 | Ga0157374_11802992 | 3300013296 | Unclassified | 637 |
| 202 | Ga0157378_13273684 | 3300013297 | Unclassified | 503 |
| 203 | Ga0163162_10405019 | 3300013306 | Unclassified | 1497 |
| 204 | Ga0163162_10588039 | 3300013306 | Unclassified | 1240 |
| 205 | Ga0163162_11271451 | 3300013306 | Unclassified | 836 |
| 206 | Ga0157372_10380420 | 3300013307 | Bacteria | 1645 |
| 207 | Ga0157372_10619794 | 3300013307 | Bacteria | 1261 |
| 208 | Ga0163163_10080806 | 3300014325 | Bacteria | 3251 |
| 209 | Ga0163163_10886703 | 3300014325 | Bacteria | 955 |
| 210 | Ga0157380_10321813 | 3300014326 | Unclassified | 1434 |
| 211 | Ga0157380_12257735 | 3300014326 | Bacteria | 608 |
| 212 | Ga0157379_10523874 | 3300014968 | Unclassified | 1100 |
| 213 | Ga0157379_10546973 | 3300014968 | Bacteria | 1077 |
| 214 | Ga0157379_11213750 | 3300014968 | Unclassified | 726 |
| 215 | Ga0157376_10481330 | 3300014969 | Bacteria | 1216 |
| 216 | Ga0157376_10810996 | 3300014969 | Unclassified | 949 |
| 217 | Ga0182007_10134047 | 3300015262 | Unclassified | 835 |
| 218 | Ga0182005_1061062 | 3300015265 | Unclassified | 1030 |
| 219 | Ga0213872_10035798 | 3300021361 | Bacteria | 2269 |
| 220 | Ga0213876_10026875 | 3300021384 | Bacteria | 3036 |
| 221 | Ga0213876_10108000 | 3300021384 | Bacteria | 1476 |
| 222 | Ga0213876_10135152 | 3300021384 | Unclassified | 1311 |
| 223 | Ga0213875_10334508 | 3300021388 | Bacteria | 718 |
| 224 | Ga0207656_10058201 | 3300025321 | Bacteria | 1688 |
| 225 | Ga0207653_10013824 | 3300025885 | Unclassified | 2530 |
| 226 | Ga0207692_10031864 | 3300025898 | Bacteria | 2528 |
| 227 | Ga0207692_10033183 | 3300025898 | Bacteria | 2488 |
| 228 | Ga0207692_10347802 | 3300025898 | Bacteria | 913 |
| 229 | Ga0207642_11112232 | 3300025899 | Unclassified | 511 |
| 230 | Ga0207647_10027561 | 3300025904 | Unclassified | 3703 |
| 231 | Ga0207647_10084421 | 3300025904 | Bacteria | 1901 |
| 232 | Ga0207685_10014064 | 3300025905 | Bacteria | 2495 |
| 233 | Ga0207699_10041259 | 3300025906 | Bacteria | 2664 |
| 234 | Ga0207699_10042640 | 3300025906 | Bacteria | 2631 |
| 235 | Ga0207699_10170612 | 3300025906 | Bacteria | 1455 |
| 236 | Ga0207699_10248571 | 3300025906 | Bacteria | 1225 |
| 237 | Ga0207699_10363033 | 3300025906 | Unclassified | 1024 |
| 238 | Ga0207699_10631515 | 3300025906 | Unclassified | 781 |
| 239 | Ga0207705_10018614 | 3300025909 | Bacteria | 4965 |
| 240 | Ga0207705_10063072 | 3300025909 | Unclassified | 2677 |
| 241 | Ga0207684_10069887 | 3300025910 | Bacteria | 2984 |
| 242 | Ga0207684_10074540 | 3300025910 | Bacteria | 2883 |
| 243 | Ga0207684_10093671 | 3300025910 | Bacteria | 2562 |
| 244 | Ga0207684_10210491 | 3300025910 | Unclassified | 1677 |
| 245 | Ga0207684_10574116 | 3300025910 | Bacteria | 964 |
| 246 | Ga0207654_10056482 | 3300025911 | Bacteria | 2277 |
| 247 | Ga0207707_10038351 | 3300025912 | Bacteria | 4186 |
| 248 | Ga0207707_10064624 | 3300025912 | Bacteria | 3185 |
| 249 | Ga0207707_10250919 | 3300025912 | Bacteria | 1537 |
| 250 | Ga0207695_10045079 | 3300025913 | Plasmid | 4684 |
| 251 | Ga0207695_10075993 | 3300025913 | Bacteria | 3416 |
| 252 | Ga0207695_10092001 | 3300025913 | Bacteria | 3045 |
| 253 | Ga0207695_10156666 | 3300025913 | Bacteria | 2212 |
| 254 | Ga0207671_10061455 | 3300025914 | Unclassified | 2787 |
| 255 | Ga0207671_10071111 | 3300025914 | Bacteria | 2595 |
| 256 | Ga0207671_10076639 | 3300025914 | Unclassified | 2503 |
| 257 | Ga0207671_10744722 | 3300025914 | Bacteria | 778 |
| 258 | Ga0207693_10075748 | 3300025915 | Bacteria | 2635 |
| 259 | Ga0207693_10082331 | 3300025915 | Unclassified | 2520 |
| 260 | Ga0207693_10185488 | 3300025915 | Bacteria | 1638 |
| 261 | Ga0207693_10600720 | 3300025915 | Bacteria | 857 |
| 262 | Ga0207663_10023717 | 3300025916 | Bacteria | 3525 |
| 263 | Ga0207663_10035884 | 3300025916 | Bacteria | 2978 |
| 264 | Ga0207663_10237026 | 3300025916 | Bacteria | 1336 |
| 265 | Ga0207663_10315411 | 3300025916 | Bacteria | 1173 |
| 266 | Ga0207660_10063920 | 3300025917 | Bacteria | 2655 |
| 267 | Ga0207660_11018015 | 3300025917 | Bacteria | 675 |
| 268 | Ga0207657_10046152 | 3300025919 | Bacteria | 3817 |
| 269 | Ga0207657_11361576 | 3300025919 | Unclassified | 534 |
| 270 | Ga0207649_10499778 | 3300025920 | Bacteria | 925 |
| 271 | Ga0207649_10527059 | 3300025920 | Bacteria | 901 |
| 272 | Ga0207652_10126523 | 3300025921 | Bacteria | 2277 |
| 273 | Ga0207652_10239301 | 3300025921 | Bacteria | 1636 |
| 274 | Ga0207652_10352131 | 3300025921 | Bacteria | 1329 |
| 275 | Ga0207646_10110835 | 3300025922 | Bacteria | 2462 |
| 276 | Ga0207681_10581265 | 3300025923 | Unclassified | 924 |
| 277 | Ga0207681_10752568 | 3300025923 | Unclassified | 812 |
| 278 | Ga0207694_10006750 | 3300025924 | Bacteria | 8718 |
| 279 | Ga0207694_10033457 | 3300025924 | Unclassified | 3938 |
| 280 | Ga0207694_10085983 | 3300025924 | Unclassified | 2475 |
| 281 | Ga0207694_10089933 | 3300025924 | Bacteria | 2422 |
| 282 | Ga0207694_10118625 | 3300025924 | Bacteria | 2111 |
| 283 | Ga0207694_10219221 | 3300025924 | Unclassified | 1551 |
| 284 | Ga0207694_11440904 | 3300025924 | Unclassified | 582 |
| 285 | Ga0207659_11280612 | 3300025926 | Bacteria | 629 |
| 286 | Ga0207687_11125609 | 3300025927 | Bacteria | 674 |
| 287 | Ga0207700_10080540 | 3300025928 | Bacteria | 2540 |
| 288 | Ga0207700_10652121 | 3300025928 | Unclassified | 938 |
| 289 | Ga0207700_11326386 | 3300025928 | Unclassified | 641 |
| 290 | Ga0207700_11405028 | 3300025928 | Unclassified | 621 |
| 291 | Ga0207664_10057891 | 3300025929 | Bacteria | 3082 |
| 292 | Ga0207664_10134392 | 3300025929 | Bacteria | 2085 |
| 293 | Ga0207664_10844047 | 3300025929 | Bacteria | 823 |
| 294 | Ga0207690_10103900 | 3300025932 | Bacteria | 2034 |
| 295 | Ga0207690_10375205 | 3300025932 | Unclassified | 1129 |
| 296 | Ga0207706_10067417 | 3300025933 | Bacteria | 3148 |
| 297 | Ga0207706_10077000 | 3300025933 | Bacteria | 2934 |
| 298 | Ga0207706_10375142 | 3300025933 | Bacteria | 1235 |
| 299 | Ga0207670_10208157 | 3300025936 | Bacteria | 1490 |
| 300 | Ga0207670_10494356 | 3300025936 | Unclassified | 992 |
| 301 | Ga0207665_10050235 | 3300025939 | Bacteria | 2804 |
| 302 | Ga0207665_10255847 | 3300025939 | Unclassified | 1295 |
| 303 | Ga0207665_10326510 | 3300025939 | Bacteria | 1153 |
| 304 | Ga0207665_10516156 | 3300025939 | Bacteria | 925 |
| 305 | Ga0207665_10570403 | 3300025939 | Bacteria | 881 |
| 306 | Ga0207661_10101283 | 3300025944 | Unclassified | 2419 |
| 307 | Ga0207661_10735454 | 3300025944 | Unclassified | 908 |
| 308 | Ga0207661_10975966 | 3300025944 | Unclassified | 780 |
| 309 | Ga0207667_10017451 | 3300025949 | Bacteria | 8076 |
| 310 | Ga0207667_10075482 | 3300025949 | Bacteria | 3500 |
| 311 | Ga0207667_10090250 | 3300025949 | Bacteria | 3167 |
| 312 | Ga0207667_10116788 | 3300025949 | Bacteria | 2749 |
| 313 | Ga0207667_10269811 | 3300025949 | Unclassified | 1740 |
| 314 | Ga0207667_10526857 | 3300025949 | Bacteria | 1197 |
| 315 | Ga0207667_10569919 | 3300025949 | Unclassified | 1144 |
| 316 | Ga0207667_10722397 | 3300025949 | Bacteria | 997 |
| 317 | Ga0207668_10182864 | 3300025972 | Unclassified | 1655 |
| 318 | Ga0207668_10682405 | 3300025972 | Unclassified | 901 |
| 319 | Ga0207640_10075093 | 3300025981 | Unclassified | 2290 |
| 320 | Ga0207640_10520106 | 3300025981 | Unclassified | 994 |
| 321 | Ga0207658_10696932 | 3300025986 | Unclassified | 918 |
| 322 | Ga0207703_10039240 | 3300026035 | Unclassified | 3783 |
| 323 | Ga0207639_10000022 | 3300026041 | Bacteria | 226983 |
| 324 | Ga0207639_10045594 | 3300026041 | Bacteria | 3303 |
| 325 | Ga0207639_10307665 | 3300026041 | Unclassified | 1403 |
| 326 | Ga0207639_11114040 | 3300026041 | Unclassified | 740 |
| 327 | Ga0207678_10655876 | 3300026067 | Bacteria | 922 |
| 328 | Ga0207708_10040210 | 3300026075 | Unclassified | 3564 |
| 329 | Ga0207702_10064790 | 3300026078 | Unclassified | 3128 |
| 330 | Ga0207702_10132943 | 3300026078 | Bacteria | 2241 |
| 331 | Ga0207702_10150500 | 3300026078 | Bacteria | 2116 |
| 332 | Ga0207702_10875975 | 3300026078 | Unclassified | 889 |
| 333 | Ga0207702_11566657 | 3300026078 | Unclassified | 652 |
| 334 | Ga0207702_11967047 | 3300026078 | Bacteria | 575 |
| 335 | Ga0207641_10109589 | 3300026088 | Bacteria | 2445 |
| 336 | Ga0207641_10650486 | 3300026088 | Unclassified | 1035 |
| 337 | Ga0207641_11145171 | 3300026088 | Bacteria | 777 |
| 338 | Ga0207676_10366258 | 3300026095 | Unclassified | 1337 |
| 339 | Ga0207676_10642682 | 3300026095 | Bacteria | 1023 |
| 340 | Ga0207675_101006082 | 3300026118 | Bacteria | 852 |
| 341 | Ga0207675_102035323 | 3300026118 | Unclassified | 591 |
| 342 | Ga0207698_11101587 | 3300026142 | Unclassified | 807 |
| 343 | Ga0207698_12251951 | 3300026142 | Unclassified | 557 |
| 344 | Ga0209179_1008437 | 3300027512 | Unclassified | 1737 |
| 345 | Ga0265354_1021326 | 3300028016 | Bacteria | 616 |
| 346 | Ga0265355_1000256 | 3300028036 | Unclassified | 2508 |
| 347 | Ga0265355_1002675 | 3300028036 | Bacteria | 1262 |
| 348 | Ga0268266_10261797 | 3300028379 | Unclassified | 1603 |
| 349 | Ga0268266_10324352 | 3300028379 | Bacteria | 1442 |
| 350 | Ga0268266_10682628 | 3300028379 | Bacteria | 989 |
| 351 | Ga0268266_11983635 | 3300028379 | Bacteria | 556 |
| 352 | Ga0268265_10412064 | 3300028380 | Unclassified | 1252 |
| 353 | Ga0268265_11233056 | 3300028380 | Bacteria | 746 |
| 354 | Ga0268264_10100311 | 3300028381 | Bacteria | 2514 |
| 355 | Ga0265337_1014946 | 3300028556 | Bacteria | 2558 |
| 356 | Ga0265337_1057656 | 3300028556 | Bacteria | 1081 |
| 357 | Ga0265337_1123859 | 3300028556 | Bacteria | 701 |
| 358 | Ga0265326_10010471 | 3300028558 | Bacteria | 2747 |
| 359 | Ga0265326_10010543 | 3300028558 | Bacteria | 2738 |
| 360 | Ga0265319_1026190 | 3300028563 | Unclassified | 2080 |
| 361 | Ga0265319_1046775 | 3300028563 | Bacteria | 1441 |
| 362 | Ga0265319_1093310 | 3300028563 | Unclassified | 949 |
| 363 | Ga0265334_10023613 | 3300028573 | Unclassified | 2499 |
| 364 | Ga0265334_10108424 | 3300028573 | Bacteria | 999 |
| 365 | Ga0265334_10140262 | 3300028573 | Bacteria | 856 |
| 366 | Ga0265318_10014974 | 3300028577 | Unclassified | 3240 |
| 367 | Ga0265318_10029252 | 3300028577 | Unclassified | 2149 |
| 368 | Ga0265318_10081834 | 3300028577 | Bacteria | 1192 |
| 369 | Ga0265318_10130923 | 3300028577 | Bacteria | 922 |
| 370 | Ga0265318_10357799 | 3300028577 | Unclassified | 533 |
| 371 | Ga0265323_10030796 | 3300028653 | Bacteria | 1996 |
| 372 | Ga0265323_10060805 | 3300028653 | Bacteria | 1314 |
| 373 | Ga0265323_10167924 | 3300028653 | Unclassified | 698 |
| 374 | Ga0265336_10014096 | 3300028666 | Bacteria | 2653 |
| 375 | Ga0265336_10036408 | 3300028666 | Unclassified | 1515 |
| 376 | Ga0265336_10038702 | 3300028666 | Unclassified | 1463 |
| 377 | Ga0307515_10379675 | 3300028794 | Unclassified | 1046 |
| 378 | Ga0265338_10011235 | 3300028800 | Bacteria | 10372 |
| 379 | Ga0265338_10078795 | 3300028800 | Bacteria | 2776 |
| 380 | Ga0265338_10079222 | 3300028800 | Bacteria | 2765 |
| 381 | Ga0265338_10086502 | 3300028800 | Bacteria | 2608 |
| 382 | Ga0265338_10086591 | 3300028800 | Bacteria | 2606 |
| 383 | Ga0265338_10087220 | 3300028800 | Unclassified | 2593 |
| 384 | Ga0265338_10092331 | 3300028800 | Bacteria | 2497 |
| 385 | Ga0265338_10098441 | 3300028800 | Bacteria | 2393 |
| 386 | Ga0265338_10103883 | 3300028800 | Bacteria | 2307 |
| 387 | Ga0265338_10112494 | 3300028800 | Bacteria | 2189 |
| 388 | Ga0265338_10114465 | 3300028800 | Unclassified | 2164 |
| 389 | Ga0265338_10139602 | 3300028800 | Unclassified | 1900 |
| 390 | Ga0265338_10172158 | 3300028800 | Bacteria | 1659 |
| 391 | Ga0265338_10178288 | 3300028800 | Bacteria | 1622 |
| 392 | Ga0265338_10486370 | 3300028800 | Unclassified | 870 |
| 393 | Ga0265338_10581702 | 3300028800 | Bacteria | 781 |
| 394 | Ga0265338_10628485 | 3300028800 | Unclassified | 746 |
| 395 | Ga0265324_10008506 | 3300029957 | Bacteria | 4074 |
| 396 | Ga0265324_10014281 | 3300029957 | Plasmid | 2942 |
| 397 | Ga0265324_10017825 | 3300029957 | Unclassified | 2579 |
| 398 | Ga0265324_10040721 | 3300029957 | Unclassified | 1609 |
| 399 | Ga0265324_10135357 | 3300029957 | Unclassified | 837 |
| 400 | Ga0265770_1088965 | 3300030878 | Unclassified | 614 |
| 401 | Ga0265771_1000311 | 3300031010 | Unclassified | 1635 |
| 402 | Ga0265771_1029334 | 3300031010 | Unclassified | 519 |
| 403 | Ga0265760_10079832 | 3300031090 | Bacteria | 1012 |
| 404 | Ga0265330_10032010 | 3300031235 | Bacteria | 2357 |
| 405 | Ga0265330_10183542 | 3300031235 | Unclassified | 886 |
| 406 | Ga0265332_10019918 | 3300031238 | Unclassified | 2962 |
| 407 | Ga0265332_10026070 | 3300031238 | Unclassified | 2565 |
| 408 | Ga0265332_10103898 | 3300031238 | Bacteria | 1198 |
| 409 | Ga0265332_10200073 | 3300031238 | Bacteria | 830 |
| 410 | Ga0265332_10449552 | 3300031238 | Unclassified | 533 |
| 411 | Ga0265320_10028645 | 3300031240 | Bacteria | 2890 |
| 412 | Ga0265320_10029975 | 3300031240 | Bacteria | 2811 |
| 413 | Ga0265320_10032490 | 3300031240 | Bacteria | 2670 |
| 414 | Ga0265320_10032615 | 3300031240 | Bacteria | 2663 |
| 415 | Ga0265320_10177520 | 3300031240 | Unclassified | 955 |
| 416 | Ga0265320_10221133 | 3300031240 | Bacteria | 843 |
| 417 | Ga0265325_10023162 | 3300031241 | Bacteria | 3395 |
| 418 | Ga0265325_10028199 | 3300031241 | Unclassified | 3028 |
| 419 | Ga0265325_10283780 | 3300031241 | Bacteria | 742 |
| 420 | Ga0265329_10228853 | 3300031242 | Unclassified | 616 |
| 421 | Ga0265340_10034175 | 3300031247 | Unclassified | 2529 |
| 422 | Ga0265340_10034944 | 3300031247 | Bacteria | 2497 |
| 423 | Ga0265340_10103464 | 3300031247 | Unclassified | 1322 |
| 424 | Ga0265340_10106696 | 3300031247 | Bacteria | 1298 |
| 425 | Ga0265339_10057900 | 3300031249 | Bacteria | 2094 |
| 426 | Ga0265331_10135516 | 3300031250 | Bacteria | 1121 |
| 427 | Ga0265331_10283290 | 3300031250 | Bacteria | 743 |
| 428 | Ga0265327_10016597 | 3300031251 | Bacteria | 4665 |
| 429 | Ga0265327_10034142 | 3300031251 | Bacteria | 2826 |
| 430 | Ga0265327_10035475 | 3300031251 | Bacteria | 2756 |
| 431 | Ga0265327_10119606 | 3300031251 | Unclassified | 1249 |
| 432 | Ga0265327_10134424 | 3300031251 | Unclassified | 1161 |
| 433 | Ga0265316_10051435 | 3300031344 | Bacteria | 3236 |
| 434 | Ga0265316_10095039 | 3300031344 | Bacteria | 2270 |
| 435 | Ga0265316_10149645 | 3300031344 | Unclassified | 1749 |
| 436 | Ga0265316_10287109 | 3300031344 | Unclassified | 1201 |
| 437 | Ga0265316_10989023 | 3300031344 | Bacteria | 586 |
| 438 | Ga0307513_10106060 | 3300031456 | Bacteria | 2817 |
| 439 | Ga0307408_100641228 | 3300031548 | Unclassified | 949 |
| 440 | Ga0265313_10033666 | 3300031595 | Unclassified | 2601 |
| 441 | Ga0265313_10235177 | 3300031595 | Unclassified | 751 |
| 442 | Ga0307508_10261021 | 3300031616 | Unclassified | 1327 |
| 443 | Ga0307508_10409184 | 3300031616 | Bacteria | 948 |
| 444 | Ga0316575_10128194 | 3300031665 | Unclassified | 1040 |
| 445 | Ga0316575_10130215 | 3300031665 | Bacteria | 1032 |
| 446 | Ga0316575_10498920 | 3300031665 | Unclassified | 528 |
| 447 | Ga0265314_10060492 | 3300031711 | Bacteria | 2585 |
| 448 | Ga0265314_10116033 | 3300031711 | Unclassified | 1693 |
| 449 | Ga0265314_10200831 | 3300031711 | Unclassified | 1179 |
| 450 | Ga0265314_10205307 | 3300031711 | Bacteria | 1161 |
| 451 | Ga0265314_10233783 | 3300031711 | Unclassified | 1064 |
| 452 | Ga0265314_10283283 | 3300031711 | Unclassified | 936 |
| 453 | Ga0265314_10464390 | 3300031711 | Unclassified | 672 |
| 454 | Ga0265342_10024049 | 3300031712 | Bacteria | 3848 |
| 455 | Ga0265342_10050695 | 3300031712 | Unclassified | 2478 |
| 456 | Ga0265342_10055715 | 3300031712 | Bacteria | 2346 |
| 457 | Ga0265342_10185849 | 3300031712 | Unclassified | 1136 |
| 458 | Ga0265342_10326517 | 3300031712 | Unclassified | 803 |
| 459 | Ga0316576_11069282 | 3300031727 | Unclassified | 573 |
| 460 | Ga0316578_10474359 | 3300031728 | Unclassified | 738 |
| 461 | Ga0307516_10211245 | 3300031730 | Bacteria | 1655 |
| 462 | Ga0307516_10349251 | 3300031730 | Bacteria | 1145 |
| 463 | Ga0307410_10395993 | 3300031852 | Bacteria | 1115 |
| 464 | Ga0307410_10597032 | 3300031852 | Bacteria | 920 |
| 465 | Ga0307407_10019927 | 3300031903 | Bacteria | 3424 |
| 466 | Ga0307407_10275402 | 3300031903 | Bacteria | 1163 |
| 467 | Ga0307412_10055358 | 3300031911 | Bacteria | 2638 |
| 468 | Ga0307416_100095981 | 3300032002 | Bacteria | 2562 |
| 469 | Ga0307416_101670125 | 3300032002 | Bacteria | 742 |
| 470 | Ga0307414_10091542 | 3300032004 | Bacteria | 2260 |
| 471 | Ga0307411_11942427 | 3300032005 | Unclassified | 548 |
| 472 | Ga0316583_10123824 | 3300032133 | Bacteria | 901 |
| 473 | Ga0316214_1001884 | 3300033545 | Bacteria | 2522 |
| 474 | Ga0316212_1017413 | 3300033547 | Bacteria | 1010 |
| 475 | Ga0373930_0181689 | 3300034816 | Unclassified | 540 |
| 476 | Ga0373934_0015604 | 3300035086 | Bacteria | 2883 |
| 477 | Ga0373934_0148286 | 3300035086 | Bacteria | 960 |
| 478 | Ga0373923_0040331 | 3300035111 | Bacteria | 1921 |
| 479 | Ga0373932_0307432 | 3300035112 | Unclassified | 593 |
| 480 | Ga0373936_0398856 | 3300035113 | Unclassified | 631 |
| 481 | Ga0373945_0060529 | 3300035116 | Unclassified | 1412 |
| 482 | Ga0373953_0056925 | 3300035117 | Bacteria | 1591 |
| 483 | Ga0373953_0160132 | 3300035117 | Bacteria | 967 |
| 484 | Ga0373954_0045670 | 3300035118 | Bacteria | 2047 |
| 485 | Ga0373954_0295138 | 3300035118 | Unclassified | 799 |
| 486 | Ga0373956_0030637 | 3300035119 | Bacteria | 2353 |
| 487 | Ga0373957_0018041 | 3300035120 | Bacteria | 2466 |
| 488 | Ga0373957_0047980 | 3300035120 | Bacteria | 1626 |
| 489 | Ga0373960_0301239 | 3300035121 | Unclassified | 596 |
| 490 | Ga0373943_0170765 | 3300035170 | Bacteria | 1190 |
| 491 | Ga0373955_0079558 | 3300035172 | Unclassified | 1849 |
| 492 | Ga0373955_0269955 | 3300035172 | Bacteria | 1022 |
| 493 | Ga0373955_0304641 | 3300035172 | Unclassified | 961 |
| 494 | Ga0316574_0322674 | 3300035398 | Unclassified | 980 |
| 495 | Ga0373924_0018935 | 3300035410 | Bacteria | 2661 |
| 496 | Ga0373931_0125502 | 3300035691 | Bacteria | 1471 |
| 497 | Ga0373935_0083207 | 3300035692 | Bacteria | 2083 |
| 498 | Ga0373935_0584641 | 3300035692 | Bacteria | 816 |
| 499 | Ga0373927_0408202 | 3300035695 | Bacteria | 896 |
| 500 | Ga0373927_0502066 | 3300035695 | Unclassified | 801 |
| 501 | Ga0373933_0041009 | 3300035724 | Bacteria | 2730 |
| 502 | Ga0373947_1013693 | 3300035725 | Unclassified | 566 |
| 503 | Ga0373937_0039653 | 3300036401 | Bacteria | 4292 |
| 504 | Ga0373937_0068401 | 3300036401 | Bacteria | 3274 |
| 505 | Ga0373937_0109445 | 3300036401 | Bacteria | 2569 |
| 506 | Ga0373937_0795411 | 3300036401 | Bacteria | 893 |
| 507 | Ga0373937_1370646 | 3300036401 | Bacteria | 655 |
| 508 | Ga0316582_0169996 | 3300036647 | Unclassified | 1479 |
| 509 | Ga0316584_0084127 | 3300036712 | Unclassified | 2383 |
| 510 | Ga0373925_0083253 | 3300037068 | Bacteria | 2436 |
| 511 | Ga0373925_0333019 | 3300037068 | Unclassified | 1230 |
| 512 | Ga0373925_0818214 | 3300037068 | Unclassified | 768 |
| 513 | Ga0395905_0128200 | 3300037471 | Bacteria | 2386 |
| 514 | Ga0395905_0389413 | 3300037471 | Unclassified | 1288 |
| 515 | Ga0395905_0634630 | 3300037471 | Unclassified | 970 |
| 516 | Ga0395905_0726711 | 3300037471 | Unclassified | 895 |
| 517 | Ga0436364_0146368 | 3300037853 | Bacteria | 1557 |
| 518 | Ga0436364_0898552 | 3300037853 | Unclassified | 770 |
| 519 | Ga0436364_0964109 | 3300037853 | Bacteria | 660 |
| 520 | Ga0436364_1138300 | 3300037853 | Unclassified | 1449 |
| 521 | Ga0436365_0025447 | 3300039437 | Bacteria | 607 |
| 522 | Ga0436365_0650435 | 3300039437 | Unclassified | 1544 |
| 523 | Ga0436365_0673797 | 3300039437 | Unclassified | 2450 |
| 524 | Ga0436365_1803750 | 3300039437 | Bacteria | 1907 |
| 525 | Ga0436360_1192305 | 3300039438 | Bacteria | 1384 |
| 526 | Ga0436361_0310241 | 3300039447 | Bacteria | 2931 |
| 527 | Ga0436361_0601301 | 3300039447 | Bacteria | 4582 |
| 528 | Ga0436361_0615773 | 3300039447 | Unclassified | 4098 |
| 529 | Ga0436363_1537784 | 3300039450 | Unclassified | 3810 |
| 530 | Ga0436362_0180676 | 3300039453 | Unclassified | 965 |
| 531 | Ga0439453_0000522 | 3300041408 | Unclassified | 4259 |
| 532 | Ga0451798_0867429 | 3300041458 | Unclassified | 681 |
| 533 | Ga0451807_1323642 | 3300041486 | Unclassified | 526 |
| 534 | Ga0451853_3053569 | 3300041512 | Unclassified | 508 |
| 535 | Ga0439441_024687 | 3300042001 | Unclassified | 1130 |
| 536 | Ga0450888_010217 | 3300042126 | Bacteria | 1084 |
| 537 | Ga0450892_000500 | 3300042130 | Unclassified | 4541 |
| 538 | Ga0450895_001738 | 3300042132 | Bacteria | 1551 |
| 539 | Ga0450896_004257 | 3300042133 | Bacteria | 1939 |
| 540 | Ga0450904_011416 | 3300042139 | Unclassified | 878 |
| 541 | Ga0439435_0238307 | 3300042436 | Unclassified | 609 |
| 542 | Ga0450918_042152 | 3300042531 | Bacteria | 821 |
| 543 | Ga0450918_050323 | 3300042531 | Unclassified | 758 |
| 544 | Ga0450893_0000466 | 3300042532 | Bacteria | 5708 |
| 545 | Ga0450901_016899 | 3300042533 | Unclassified | 770 |
| 546 | Ga0451577_0001638 | 3300042876 | Bacteria | 29014 |
| 547 | Ga0451577_0007812 | 3300042876 | Bacteria | 10470 |
| 548 | Ga0451577_0094552 | 3300042876 | Bacteria | 2669 |
| 549 | Ga0451577_0098413 | 3300042876 | Bacteria | 2612 |
| 550 | Ga0451577_0177552 | 3300042876 | Bacteria | 1920 |
| 551 | Ga0451577_1425604 | 3300042876 | Bacteria | 614 |
| 552 | Ga0451577_1724206 | 3300042876 | Bacteria | 551 |
| 553 | Ga0453683_0230318 | 3300044673 | Unclassified | 1179 |
| 554 | Ga0466966_0054841 | 3300044684 | Bacteria | 2524 |
| 555 | Ga0466961_0196659 | 3300044693 | Bacteria | 1248 |
| 556 | Ga0453684_0020537 | 3300044712 | Bacteria | 9951 |
| 557 | Ga0453684_0068400 | 3300044712 | Bacteria | 4510 |
| 558 | Ga0453684_0113294 | 3300044712 | Bacteria | 3290 |
| 559 | Ga0453684_0768730 | 3300044712 | Bacteria | 1041 |
| 560 | Ga0453684_0915901 | 3300044712 | Bacteria | 938 |
| 561 | Ga0453684_2305093 | 3300044712 | Unclassified | 535 |
| 562 | Ga0466957_0653874 | 3300044842 | Bacteria | 739 |
| 563 | Ga0451576_0058087 | 3300045051 | Bacteria | 4043 |
| 564 | Ga0451576_0092643 | 3300045051 | Bacteria | 3143 |
| 565 | Ga0451576_0098623 | 3300045051 | Bacteria | 3039 |
| 566 | Ga0451576_0140739 | 3300045051 | Bacteria | 2516 |
| 567 | Ga0451576_0246277 | 3300045051 | Bacteria | 1868 |
| 568 | Ga0451576_0453345 | 3300045051 | Bacteria | 1347 |
| 569 | Ga0451576_0580757 | 3300045051 | Bacteria | 1178 |
| 570 | Ga0451576_0600892 | 3300045051 | Bacteria | 1156 |
| 571 | Ga0495592_0122352 | 3300046454 | Bacteria | 1829 |
| 572 | Ga0495651_0071738 | 3300046462 | Unclassified | 2632 |
| 573 | Ga0495651_0173177 | 3300046462 | Unclassified | 1535 |
| 574 | Ga0495651_0247805 | 3300046462 | Bacteria | 1218 |
| 575 | Ga0495651_0623667 | 3300046462 | Unclassified | 678 |
| 576 | Ga0495651_1012986 | 3300046462 | Bacteria | 503 |
| 577 | Ga0495653_0098575 | 3300046463 | Bacteria | 2122 |
| 578 | Ga0495653_0246050 | 3300046463 | Unclassified | 1189 |
| 579 | Ga0495580_0146577 | 3300046472 | Bacteria | 1636 |
| 580 | Ga0495580_0755071 | 3300046472 | Bacteria | 633 |
| 581 | Ga0495664_0294943 | 3300046477 | Bacteria | 979 |
| 582 | Ga0495664_0374917 | 3300046477 | Bacteria | 856 |
| 583 | Ga0495594_0065183 | 3300046499 | Unclassified | 2020 |
| 584 | Ga0495607_0425821 | 3300046501 | Unclassified | 600 |
| 585 | Ga0495583_0332483 | 3300046506 | Unclassified | 601 |
| 586 | Ga0495608_0268775 | 3300046511 | Bacteria | 1060 |
| 587 | Ga0495618_0054083 | 3300046514 | Unclassified | 2539 |
| 588 | Ga0495618_0135879 | 3300046514 | Bacteria | 1573 |
| 589 | Ga0495628_0068561 | 3300046516 | Unclassified | 2767 |
| 590 | Ga0495628_0083597 | 3300046516 | Bacteria | 2478 |
| 591 | Ga0495628_0108620 | 3300046516 | Bacteria | 2136 |
| 592 | Ga0495628_0156201 | 3300046516 | Bacteria | 1735 |
| 593 | Ga0495628_0569485 | 3300046516 | Unclassified | 812 |
| 594 | Ga0495628_1224649 | 3300046516 | Unclassified | 508 |
| 595 | Ga0495630_0028250 | 3300046517 | Bacteria | 4168 |
| 596 | Ga0495630_0053978 | 3300046517 | Bacteria | 3010 |
| 597 | Ga0495630_0531846 | 3300046517 | Bacteria | 901 |
| 598 | Ga0495630_0759646 | 3300046517 | Unclassified | 741 |
| 599 | Ga0495630_1159035 | 3300046517 | Bacteria | 585 |
| 600 | Ga0495630_1449707 | 3300046517 | Unclassified | 516 |
| 601 | Ga0495652_0103322 | 3300046529 | Unclassified | 2307 |
| 602 | Ga0495652_0788090 | 3300046529 | Bacteria | 634 |
| 603 | Ga0495640_0077183 | 3300046533 | Bacteria | 2221 |
| 604 | Ga0495640_0792020 | 3300046533 | Unclassified | 565 |
| 605 | Ga0495586_0073401 | 3300046535 | Unclassified | 1871 |
| 606 | Ga0495586_0080975 | 3300046535 | Bacteria | 1784 |
| 607 | Ga0495586_0121548 | 3300046535 | Bacteria | 1459 |
| 608 | Ga0495586_0127834 | 3300046535 | Unclassified | 1422 |
| 609 | Ga0495587_0043076 | 3300046536 | Unclassified | 2689 |
| 610 | Ga0495587_0489702 | 3300046536 | Bacteria | 680 |
| 611 | Ga0495621_0445293 | 3300046539 | Unclassified | 554 |
| 612 | Ga0495645_0045499 | 3300046543 | Bacteria | 3202 |
| 613 | Ga0495645_0068508 | 3300046543 | Bacteria | 2561 |
| 614 | Ga0495645_0268644 | 3300046543 | Unclassified | 1126 |
| 615 | Ga0495645_0422343 | 3300046543 | Unclassified | 846 |
| 616 | Ga0495645_0477156 | 3300046543 | Unclassified | 783 |
| 617 | Ga0495667_0073749 | 3300046559 | Unclassified | 2223 |
| 618 | Ga0495667_0663545 | 3300046559 | Bacteria | 647 |
| 619 | Ga0495667_0967235 | 3300046559 | Unclassified | 520 |
| 620 | Ga0495656_0023070 | 3300046615 | Unclassified | 2445 |
| 621 | Ga0495656_0224846 | 3300046615 | Bacteria | 940 |
| 622 | Ga0495634_0389674 | 3300046642 | Unclassified | 829 |
| 623 | Ga0495634_0607933 | 3300046642 | Unclassified | 634 |
| 624 | Ga0495634_0735946 | 3300046642 | Bacteria | 565 |
| 625 | Ga0495635_0217129 | 3300046663 | Bacteria | 1294 |
| 626 | Ga0495635_0239447 | 3300046663 | Bacteria | 1225 |
| 627 | Ga0495635_0380080 | 3300046663 | Unclassified | 940 |
| 628 | Ga0495635_1068350 | 3300046663 | Bacteria | 512 |
| 629 | Ga0495661_0336152 | 3300046665 | Unclassified | 747 |
| 630 | Ga0495657_0072231 | 3300046675 | Unclassified | 2251 |
| 631 | Ga0495657_0153302 | 3300046675 | Bacteria | 1430 |
| 632 | Ga0495657_0267186 | 3300046675 | Unclassified | 1026 |
| 633 | Ga0495599_0335945 | 3300046678 | Bacteria | 907 |
| 634 | Ga0495599_0633947 | 3300046678 | Unclassified | 620 |
| 635 | Ga0495599_0706094 | 3300046678 | Bacteria | 581 |
| 636 | Ga0495599_0807181 | 3300046678 | Unclassified | 536 |
| 637 | Ga0495646_0055710 | 3300046680 | Bacteria | 2373 |
| 638 | Ga0495646_0329082 | 3300046680 | Unclassified | 803 |
| 639 | Ga0495658_0227371 | 3300046683 | Unclassified | 1169 |
| 640 | Ga0495658_0413787 | 3300046683 | Unclassified | 860 |
| 641 | Ga0495613_0155815 | 3300046689 | Unclassified | 1627 |
| 642 | Ga0495613_0282926 | 3300046689 | Bacteria | 1151 |
| 643 | Ga0495613_0289732 | 3300046689 | Bacteria | 1135 |
| 644 | Ga0495613_0512924 | 3300046689 | Unclassified | 806 |
| 645 | Ga0495613_0561229 | 3300046689 | Bacteria | 763 |
| 646 | Ga0495670_0142962 | 3300046691 | Bacteria | 1252 |
| 647 | Ga0495670_0224603 | 3300046691 | Unclassified | 998 |
| 648 | Ga0495671_0377130 | 3300046692 | Unclassified | 680 |
| 649 | Ga0495600_0046443 | 3300046809 | Unclassified | 2833 |
| 650 | Ga0495600_0194060 | 3300046809 | Bacteria | 1305 |
| 651 | Ga0495600_0236221 | 3300046809 | Bacteria | 1166 |
| 652 | Ga0495600_0259843 | 3300046809 | Bacteria | 1103 |
| 653 | Ga0495581_0387630 | 3300047315 | Unclassified | 815 |
| 654 | Ga0495604_0051354 | 3300047317 | Bacteria | 3197 |
| 655 | Ga0495604_0085271 | 3300047317 | Unclassified | 2357 |
| 656 | Ga0495604_0094068 | 3300047317 | Bacteria | 2216 |
| 657 | Ga0495604_0973283 | 3300047317 | Unclassified | 526 |
| 658 | Ga0495636_0023278 | 3300047318 | Unclassified | 2507 |
| 659 | Ga0495636_0033067 | 3300047318 | Bacteria | 2123 |
| 660 | Ga0495636_0099149 | 3300047318 | Unclassified | 1272 |
| 661 | Ga0495636_0172526 | 3300047318 | Unclassified | 978 |
| 662 | Ga0495636_0367915 | 3300047318 | Bacteria | 681 |
| 663 | Ga0495674_0043876 | 3300047319 | Bacteria | 3977 |
| 664 | Ga0495674_0090300 | 3300047319 | Bacteria | 2618 |
| 665 | Ga0495674_0120905 | 3300047319 | Bacteria | 2212 |
| 666 | Ga0495674_0451209 | 3300047319 | Unclassified | 1033 |
| 667 | Ga0495680_0126294 | 3300047322 | Unclassified | 1883 |
| 668 | Ga0495680_0145681 | 3300047322 | Unclassified | 1730 |
| 669 | Ga0495675_0117805 | 3300047444 | Unclassified | 1655 |
| 670 | Ga0495675_0308399 | 3300047444 | Bacteria | 938 |
| 671 | Ga0495675_0324316 | 3300047444 | Bacteria | 910 |
| 672 | Ga0495685_209329 | 3300047447 | Unclassified | 624 |
| 673 | Ga0495681_0230211 | 3300047470 | Unclassified | 740 |
| 674 | Ga0495684_0111133 | 3300047471 | Bacteria | 2068 |
| 675 | Ga0495684_0179269 | 3300047471 | Bacteria | 1571 |
| 676 | Ga0495684_0290506 | 3300047471 | Bacteria | 1177 |
| 677 | Ga0495684_0470074 | 3300047471 | Unclassified | 870 |
| 678 | Ga0495684_0482049 | 3300047471 | Bacteria | 856 |
| 679 | Ga0495684_0967094 | 3300047471 | Unclassified | 543 |
| 680 | Ga0495686_0515159 | 3300047472 | Unclassified | 628 |
| 681 | Ga0495602_0338123 | 3300048088 | Bacteria | 1090 |
| 682 | Ga0495602_0771661 | 3300048088 | Unclassified | 647 |
| 683 | Ga0496102_0233983 | 3300048905 | Bacteria | 1732 |
| 684 | Ga0496102_1607663 | 3300048905 | Unclassified | 568 |
| 685 | Ga0496104_1859233 | 3300048907 | Unclassified | 504 |
| 686 | Ga0496115_0845969 | 3300048918 | Unclassified | 709 |
| 687 | Ga0496123_0418399 | 3300048926 | Bacteria | 605 |
| 688 | Ga0501031_0000715 | 3300049568 | Bacteria | 19859 |
| 689 | Ga0501031_0044721 | 3300049568 | Bacteria | 2889 |
| 690 | Ga0501031_0049974 | 3300049568 | Bacteria | 2725 |
| 691 | Ga0501031_0058864 | 3300049568 | Bacteria | 2504 |
| 692 | Ga0501032_0051389 | 3300049569 | Bacteria | 2779 |
| 693 | Ga0501032_0057158 | 3300049569 | Bacteria | 2621 |
| 694 | Ga0501032_0060207 | 3300049569 | Bacteria | 2546 |
| 695 | Ga0501033_0004367 | 3300049570 | Bacteria | 11334 |
| 696 | Ga0501033_0015438 | 3300049570 | Bacteria | 5794 |
| 697 | Ga0501033_0046759 | 3300049570 | Bacteria | 3217 |
| 698 | Ga0501033_0049683 | 3300049570 | Bacteria | 3113 |
| 699 | Ga0501033_0060002 | 3300049570 | Bacteria | 2807 |
| 700 | Ga0501033_0073713 | 3300049570 | Bacteria | 2506 |
| 701 | Ga0501033_0083364 | 3300049570 | Bacteria | 2344 |
| 702 | Ga0501033_0524049 | 3300049570 | Bacteria | 818 |
| 703 | Ga0501034_0076343 | 3300049571 | Bacteria | 3357 |
| 704 | Ga0501034_0090390 | 3300049571 | Bacteria | 3059 |
| 705 | Ga0501034_0102448 | 3300049571 | Bacteria | 2856 |
| 706 | Ga0501034_0121405 | 3300049571 | Bacteria | 2599 |
| 707 | Ga0501034_0159557 | 3300049571 | Bacteria | 2227 |
| 708 | Ga0501034_0160532 | 3300049571 | Bacteria | 2219 |
| 709 | Ga0501034_0264109 | 3300049571 | Bacteria | 1663 |
| 710 | Ga0501034_0502308 | 3300049571 | Bacteria | 1126 |
| 711 | Ga0501034_0937950 | 3300049571 | Bacteria | 752 |
| 712 | Ga0501036_0064285 | 3300049572 | Bacteria | 3105 |
| 713 | Ga0501036_0067161 | 3300049572 | Bacteria | 3033 |
| 714 | Ga0501036_0089743 | 3300049572 | Unclassified | 2597 |
| 715 | Ga0501036_0445922 | 3300049572 | Bacteria | 1078 |
| 716 | Ga0501036_1525838 | 3300049572 | Unclassified | 540 |
| 717 | Ga0501037_0018510 | 3300049573 | Bacteria | 5133 |
| 718 | Ga0501037_0056225 | 3300049573 | Bacteria | 2874 |
| 719 | Ga0501037_0068567 | 3300049573 | Bacteria | 2582 |
| 720 | Ga0501037_0229301 | 3300049573 | Bacteria | 1304 |
| 721 | Ga0501038_0089121 | 3300049574 | Bacteria | 2588 |
| 722 | Ga0501038_0129490 | 3300049574 | Bacteria | 2074 |
| 723 | Ga0501038_0282561 | 3300049574 | Unclassified | 1306 |
| 724 | Ga0501038_0471553 | 3300049574 | Bacteria | 963 |
| 725 | Ga0501039_0057627 | 3300049575 | Unclassified | 3008 |
| 726 | Ga0501039_0061514 | 3300049575 | Bacteria | 2908 |
| 727 | Ga0501039_0071406 | 3300049575 | Bacteria | 2697 |
| 728 | Ga0501039_0077712 | 3300049575 | Bacteria | 2581 |
| 729 | Ga0501039_0437487 | 3300049575 | Unclassified | 1027 |
| 730 | Ga0501040_0669122 | 3300049576 | Unclassified | 750 |
| 731 | Ga0501041_0248957 | 3300049577 | Unclassified | 1117 |
| 732 | Ga0501042_0094158 | 3300049578 | Unclassified | 2151 |
| 733 | Ga0501043_0000189 | 3300049579 | Bacteria | 56045 |
| 734 | Ga0501043_0002688 | 3300049579 | Bacteria | 14904 |
| 735 | Ga0501043_0021478 | 3300049579 | Bacteria | 5061 |
| 736 | Ga0501043_0051443 | 3300049579 | Bacteria | 3236 |
| 737 | Ga0501043_0081868 | 3300049579 | Bacteria | 2536 |
| 738 | Ga0501043_0113691 | 3300049579 | Unclassified | 2126 |
| 739 | Ga0501043_0281455 | 3300049579 | Unclassified | 1275 |
| 740 | Ga0501043_0282905 | 3300049579 | Unclassified | 1271 |
| 741 | Ga0501043_0566817 | 3300049579 | Unclassified | 842 |
| 742 | Ga0501046_0039573 | 3300049580 | Unclassified | 3774 |
| 743 | Ga0501046_0053966 | 3300049580 | Unclassified | 3163 |
| 744 | Ga0501046_0074034 | 3300049580 | Bacteria | 2642 |
| 745 | Ga0501046_0083225 | 3300049580 | Bacteria | 2470 |
| 746 | Ga0501046_0107451 | 3300049580 | Bacteria | 2135 |
| 747 | Ga0501046_0572603 | 3300049580 | Unclassified | 803 |
| 748 | Ga0501047_0013091 | 3300049581 | Bacteria | 7857 |
| 749 | Ga0501047_0037391 | 3300049581 | Bacteria | 4694 |
| 750 | Ga0501047_0091477 | 3300049581 | Bacteria | 2920 |
| 751 | Ga0501047_0122572 | 3300049581 | Bacteria | 2480 |
| 752 | Ga0501047_0223233 | 3300049581 | Bacteria | 1740 |
| 753 | Ga0501048_0032719 | 3300049582 | Bacteria | 3757 |
| 754 | Ga0501048_0061559 | 3300049582 | Bacteria | 2657 |
| 755 | Ga0501048_0067565 | 3300049582 | Bacteria | 2526 |
| 756 | Ga0501048_0281301 | 3300049582 | Unclassified | 1183 |
| 757 | Ga0501048_0637312 | 3300049582 | Unclassified | 765 |
| 758 | Ga0501048_0708104 | 3300049582 | Bacteria | 723 |
| 759 | Ga0501067_0198052 | 3300049583 | Unclassified | 1119 |
| 760 | Ga0501067_0435705 | 3300049583 | Unclassified | 732 |
| 761 | Ga0501067_0521771 | 3300049583 | Unclassified | 665 |
| 762 | Ga0501068_0321631 | 3300049584 | Bacteria | 992 |
| 763 | Ga0501069_0042248 | 3300049585 | Bacteria | 2522 |
| 764 | Ga0501069_0753865 | 3300049585 | Unclassified | 589 |
| 765 | Ga0501070_0048669 | 3300049586 | Unclassified | 3521 |
| 766 | Ga0501070_0057403 | 3300049586 | Bacteria | 3226 |
| 767 | Ga0501070_0099218 | 3300049586 | Bacteria | 2409 |
| 768 | Ga0501070_0111484 | 3300049586 | Bacteria | 2261 |
| 769 | Ga0501071_0151033 | 3300049587 | Bacteria | 1733 |
| 770 | Ga0501071_0709187 | 3300049587 | Bacteria | 775 |
| 771 | Ga0501073_0051422 | 3300049589 | Bacteria | 2886 |
| 772 | Ga0501073_0069427 | 3300049589 | Bacteria | 2455 |
| 773 | Ga0501073_0380634 | 3300049589 | Bacteria | 975 |
| 774 | Ga0501074_0061034 | 3300049590 | Bacteria | 2716 |
| 775 | Ga0501074_0061327 | 3300049590 | Unclassified | 2709 |
| 776 | Ga0501198_011473 | 3300049649 | Bacteria | 1322 |
| 777 | Ga0501198_027510 | 3300049649 | Bacteria | 934 |
| 778 | Ga0501079_0197484 | 3300049741 | Bacteria | 1571 |
| 779 | Ga0501080_0095680 | 3300049742 | Bacteria | 2757 |
| 780 | Ga0501080_0105524 | 3300049742 | Bacteria | 2612 |
| 781 | Ga0501080_0117292 | 3300049742 | Bacteria | 2467 |
| 782 | Ga0501083_0061178 | 3300049744 | Bacteria | 2514 |
| 783 | Ga0501269_033113 | 3300049766 | Unclassified | 669 |
| 784 | Ga0501035_0000261 | 3300049822 | Bacteria | 62560 |
| 785 | Ga0501035_0022326 | 3300049822 | Bacteria | 5811 |
| 786 | Ga0501035_0069397 | 3300049822 | Unclassified | 3124 |
| 787 | Ga0501035_0077254 | 3300049822 | Bacteria | 2942 |
| 788 | Ga0501035_0431938 | 3300049822 | Unclassified | 1092 |
| 789 | Ga0501035_1086990 | 3300049822 | Unclassified | 625 |
| 790 | Ga0501044_0000518 | 3300049823 | Bacteria | 46924 |
| 791 | Ga0501044_0122761 | 3300049823 | Bacteria | 2596 |
| 792 | Ga0501044_0139269 | 3300049823 | Bacteria | 2415 |
| 793 | Ga0501044_0234967 | 3300049823 | Bacteria | 1779 |
| 794 | Ga0501045_0067785 | 3300049824 | Bacteria | 2621 |
| 795 | Ga0501045_0758024 | 3300049824 | Unclassified | 715 |
| 796 | nmdc:mga03n38_588871_c1 | 3300050490 | Unclassified | 632 |
| 797 | nmdc:mga0k408_43843_c1 | 3300050493 | Unclassified | 2579 |
| 798 | nmdc:mga0k408_478904_c1 | 3300050493 | Bacteria | 738 |
| 799 | nmdc:mga0k408_537835_c1 | 3300050493 | Bacteria | 691 |
| 800 | nmdc:mga07m45_100458_c1 | 3300050496 | Bacteria | 1661 |
| 801 | nmdc:mga05p37_1140147_c1 | 3300050507 | Bacteria | 812 |
| 802 | nmdc:mga09592_137873_c1 | 3300050508 | Bacteria | 2102 |
| 803 | nmdc:mga0rr50_551904_c1 | 3300050513 | Bacteria | 981 |
| 804 | Ga0495601_0048358 | 3300053077 | Bacteria | 2678 |
| 805 | Ga0495601_0084379 | 3300053077 | Bacteria | 2040 |
| 806 | Ga0495601_0112445 | 3300053077 | Unclassified | 1764 |
| 807 | Ga0495601_0278278 | 3300053077 | Bacteria | 1091 |
| 808 | Ga0495601_0354996 | 3300053077 | Unclassified | 953 |
| 809 | Ga0495612_0023440 | 3300053078 | Bacteria | 2477 |
| 810 | Ga0495612_0073051 | 3300053078 | Unclassified | 1433 |
| 811 | Ga0495612_0143422 | 3300053078 | Bacteria | 1037 |
| 812 | Ga0495612_0185591 | 3300053078 | Unclassified | 914 |
| 813 | Ga0495612_0339850 | 3300053078 | Unclassified | 677 |
| 814 | Ga0495612_0355029 | 3300053078 | Bacteria | 662 |
| 815 | Ga0495612_0529530 | 3300053078 | Bacteria | 542 |
| 816 | Ga0495595_0078201 | 3300053084 | Bacteria | 1572 |
| 817 | Ga0495595_0086546 | 3300053084 | Unclassified | 1499 |
| 818 | Ga0495595_0127907 | 3300053084 | Bacteria | 1240 |
| 819 | Ga0495595_0171015 | 3300053084 | Bacteria | 1075 |
| 820 | Ga0495619_0040071 | 3300053085 | Unclassified | 3061 |
| 821 | Ga0495619_0044064 | 3300053085 | Bacteria | 2927 |
| 822 | Ga0500566_0210957 | 3300053094 | Unclassified | 973 |
| 823 | Ga0500566_0307261 | 3300053094 | Unclassified | 744 |
| 824 | Ga0500608_047379 | 3300053122 | Bacteria | 2065 |
| 825 | Ga0500559_0003706 | 3300053136 | Bacteria | 7450 |
| 826 | Ga0500559_0004203 | 3300053136 | Bacteria | 6900 |
| 827 | Ga0500559_0114440 | 3300053136 | Bacteria | 1251 |
| 828 | Ga0500568_0254896 | 3300053139 | Bacteria | 639 |
| 829 | Ga0501084_0085348 | 3300054114 | Bacteria | 2650 |
| 830 | Ga0501084_0109944 | 3300054114 | Unclassified | 2316 |
| 831 | Ga0501084_0454978 | 3300054114 | Bacteria | 1082 |
| 832 | Ga0501082_0103371 | 3300060353 | Bacteria | 2464 |
| 833 | Ga0501082_0329005 | 3300060353 | Bacteria | 1331 |
| 834 | Ga0501047_0162319 | |||
| 835 | LJNas_1029830 | |||
| 836 | JGI24736J21556_1040810 | |||
| 837 | JGI24033J26618_1008457 | |||
| 838 | JGI24742J22300_10010220 | |||
| 839 | rootH2_10098933 | |||
| 840 | rootL2_10243191 | |||
| 841 | rootH1_10276053 | |||
| 842 | Ga0065715_10433002 | |||
| 843 | Ga0065707_10012266 | |||
| 844 | Ga0070658_10070188 | |||
| 845 | Ga0070658_10167266 | |||
| 846 | Ga0070658_11396094 | |||
| 847 | Ga0070683_101749724 | |||
| 848 | Ga0070660_100067129 | |||
| 849 | Ga0070660_100106465 | |||
| 850 | Ga0070689_100101624 | |||
| 851 | Ga0070691_10032408 | |||
| 852 | Ga0070691_10199689 | |||
| 853 | Ga0070661_100067125 | |||
| 854 | Ga0070661_100269916 | |||
| 855 | Ga0070661_100661060 | |||
| 856 | Ga0070674_100821819 | |||
| 857 | Ga0070674_101385921 | |||
| 858 | Ga0070688_100144698 | |||
| 859 | Ga0070688_100996235 | |||
| 860 | Ga0070659_100203246 | |||
| 861 | Ga0070659_100430061 | |||
| 862 | Ga0070659_101173881 | |||
| 863 | Ga0070703_10055786 | |||
| 864 | Ga0070709_10039187 | |||
| 865 | Ga0070709_10045133 | |||
| 866 | Ga0070709_10303258 | |||
| 867 | Ga0070709_10752401 | |||
| 868 | Ga0070709_10992079 | |||
| 869 | Ga0070714_101931306 | |||
| 870 | Ga0070713_100256374 | |||
| 871 | Ga0070713_100504298 | |||
| 872 | Ga0070713_100582276 | |||
| 873 | Ga0070713_100690867 | |||
| 874 | Ga0070713_101885276 | |||
| 875 | Ga0070710_10100797 | |||
| 876 | Ga0070710_10136865 | |||
| 877 | Ga0070710_10749957 | |||
| 878 | Ga0070711_100089316 | |||
| 879 | Ga0070711_100255124 | |||
| 880 | Ga0070711_100260124 | |||
| 881 | Ga0070711_100267570 | |||
| 882 | Ga0070705_100057469 | |||
| 883 | Ga0070700_100049567 | |||
| 884 | Ga0070708_100104289 | |||
| 885 | Ga0070708_100395068 | |||
| 886 | Ga0070708_100705840 | |||
| 887 | Ga0070708_101045686 | |||
| 888 | Ga0070708_101179946 | |||
| 889 | Ga0070663_100419360 | |||
| 890 | Ga0070663_100554978 | |||
| 891 | Ga0070662_100340204 | |||
| 892 | Ga0070662_100497553 | |||
| 893 | Ga0070681_10040846 | |||
| 894 | Ga0070681_10440100 | |||
| 895 | Ga0070681_10575775 | |||
| 896 | Ga0070685_10609026 | |||
| 897 | Ga0070685_10767058 | |||
| 898 | Ga0070706_100219011 | |||
| 899 | Ga0070706_100241852 | |||
| 900 | Ga0070706_100277690 | |||
| 901 | Ga0070706_100847754 | |||
| 902 | Ga0070707_100108055 | |||
| 903 | Ga0070707_100147790 | |||
| 904 | Ga0070698_100673296 | |||
| 905 | Ga0070699_100676407 | |||
| 906 | Ga0070679_100081616 | |||
| 907 | Ga0070679_100157712 | |||
| 908 | Ga0070679_100310225 | |||
| 909 | Ga0070679_100327756 | |||
| 910 | Ga0070679_100849020 | |||
| 911 | Ga0070679_100857260 | |||
| 912 | Ga0070684_100156240 | |||
| 913 | Ga0070684_101909403 | |||
| 914 | Ga0070697_100201424 | |||
| 915 | Ga0070697_100212599 | |||
| 916 | Ga0070697_100368588 | |||
| 917 | Ga0070697_100647192 | |||
| 918 | Ga0068853_100000015 | |||
| 919 | Ga0068853_100026270 | |||
| 920 | Ga0068853_100222330 | |||
| 921 | Ga0068853_100497062 | |||
| 922 | Ga0068853_101187962 | |||
| 923 | Ga0070672_100997110 | |||
| 924 | Ga0070665_100105108 | |||
| 925 | Ga0070665_100361777 | |||
| 926 | Ga0070665_100535790 | |||
| 927 | Ga0068855_100059098 | |||
| 928 | Ga0068855_100146684 | |||
| 929 | Ga0068855_100395191 | |||
| 930 | Ga0068855_100450818 | |||
| 931 | Ga0068855_101151695 | |||
| 932 | Ga0068855_101318078 | |||
| 933 | Ga0068854_100432181 | |||
| 934 | Ga0068856_100113382 | |||
| 935 | Ga0068856_100118036 | |||
| 936 | Ga0068856_100122846 | |||
| 937 | Ga0068856_100779366 | |||
| 938 | Ga0068856_100790421 | |||
| 939 | Ga0068856_100950718 | |||
| 940 | Ga0068856_101012968 | |||
| 941 | Ga0068856_101619461 | |||
| 942 | Ga0068852_100246040 | |||
| 943 | Ga0068852_100449191 | |||
| 944 | Ga0068859_100626417 | |||
| 945 | Ga0068864_100423327 | |||
| 946 | Ga0068864_100460759 | |||
| 947 | Ga0068866_10527909 | |||
| 948 | Ga0068861_101347239 | |||
| 949 | Ga0068851_10081788 | |||
| 950 | Ga0068863_100103606 | |||
| 951 | Ga0068863_100996538 | |||
| 952 | Ga0068863_102017386 | |||
| 953 | Ga0068858_100307444 | |||
| 954 | Ga0068858_100550231 | |||
| 955 | Ga0068858_101918422 | |||
| 956 | Ga0068862_100066210 | |||
| 957 | Ga0068862_101236293 | |||
| 958 | Ga0081455_10066197 | |||
| 959 | Ga0081539_10084443 | |||
| 960 | Ga0070717_10716381 | |||
| 961 | Ga0070715_10008195 | |||
| 962 | Ga0070715_10019200 | |||
| 963 | Ga0070716_100035948 | |||
| 964 | Ga0070716_100059342 | |||
| 965 | Ga0070716_100228075 | |||
| 966 | Ga0070716_101336203 | |||
| 967 | Ga0070712_100038263 | |||
| 968 | Ga0070712_100061258 | |||
| 969 | Ga0070712_100066737 | |||
| 970 | Ga0070712_100163666 | |||
| 971 | Ga0070712_100192131 | |||
| 972 | Ga0070712_100317541 | |||
| 973 | Ga0070712_100409655 | |||
| 974 | Ga0075366_10015713 | |||
| 975 | Ga0075366_10437857 | |||
| 976 | Ga0097621_100199158 | |||
| 977 | Ga0068871_100409171 | |||
| 978 | Ga0075428_100283567 | |||
| 979 | Ga0075431_100419225 | |||
| 980 | Ga0075429_100146070 | |||
| 981 | Ga0097620_100626498 | |||
| 982 | Ga0075435_100617688 | |||
| 983 | Ga0075435_101132274 | |||
| 984 | Ga0099794_10129730 | |||
| 985 | Ga0099794_10221380 | |||
| 986 | Ga0099795_10019340 | |||
| 987 | Ga0099795_10157263 | |||
| 988 | Ga0105240_10094737 | |||
| 989 | Ga0105240_10160191 | |||
| 990 | Ga0105240_10207327 | |||
| 991 | Ga0105240_10440484 | |||
| 992 | Ga0105240_10671519 | |||
| 993 | Ga0105240_11016752 | |||
| 994 | Ga0105247_11866406 | |||
| 995 | Ga0114129_11552664 | |||
| 996 | Ga0105241_10064896 | |||
| 997 | Ga0105241_10624952 | |||
| 998 | Ga0105241_11162407 | |||
| 999 | Ga0105237_10063879 | |||
| 1000 | Ga0105237_10106734 | |||
| 1001 | Ga0105237_10132884 | |||
| 1002 | Ga0105237_10696421 | |||
| 1003 | Ga0105237_10794811 | |||
| 1004 | Ga0105237_11088853 | |||
| 1005 | Ga0105237_11584450 | |||
| 1006 | Ga0105238_10067969 | |||
| 1007 | Ga0105238_10071861 | |||
| 1008 | Ga0105238_10107665 | |||
| 1009 | Ga0105238_10133648 | |||
| 1010 | Ga0105238_10294466 | |||
| 1011 | Ga0105238_10521138 | |||
| 1012 | Ga0105238_11299597 | |||
| 1013 | Ga0105238_11472895 | |||
| 1014 | Ga0099796_10036351 | |||
| 1015 | Ga0099796_10091236 | |||
| 1016 | Ga0105239_10030748 | |||
| 1017 | Ga0105239_10116419 | |||
| 1018 | Ga0105239_10592577 | |||
| 1019 | Ga0105239_11150443 | |||
| 1020 | Ga0105239_11303840 | |||
| 1021 | Ga0105239_13315945 | |||
| 1022 | Ga0157373_10042523 | |||
| 1023 | Ga0157371_10352684 | |||
| 1024 | Ga0157370_10565186 | |||
| 1025 | Ga0157370_10578328 | |||
| 1026 | Ga0157370_10623590 | |||
| 1027 | Ga0157370_11082950 | |||
| 1028 | Ga0157369_10116623 | |||
| 1029 | Ga0157369_10128697 | |||
| 1030 | Ga0157369_11145519 | |||
| 1031 | Ga0157369_11375856 | |||
| 1032 | Ga0157369_11450056 | |||
| 1033 | Ga0157374_10143823 | |||
| 1034 | Ga0157374_11802992 | |||
| 1035 | Ga0157378_13273684 | |||
| 1036 | Ga0163162_10405019 | |||
| 1037 | Ga0163162_10588039 | |||
| 1038 | Ga0163162_11271451 | |||
| 1039 | Ga0157372_10380420 | |||
| 1040 | Ga0157372_10619794 | |||
| 1041 | Ga0163163_10080806 | |||
| 1042 | Ga0163163_10886703 | |||
| 1043 | Ga0157380_10321813 | |||
| 1044 | Ga0157380_12257735 | |||
| 1045 | Ga0157379_10523874 | |||
| 1046 | Ga0157379_10546973 | |||
| 1047 | Ga0157379_11213750 | |||
| 1048 | Ga0157376_10481330 | |||
| 1049 | Ga0157376_10810996 | |||
| 1050 | Ga0182007_10134047 | |||
| 1051 | Ga0182005_1061062 | |||
| 1052 | Ga0213872_10035798 | |||
| 1053 | Ga0213876_10026875 | |||
| 1054 | Ga0213876_10108000 | |||
| 1055 | Ga0213876_10135152 | |||
| 1056 | Ga0213875_10334508 | |||
| 1057 | Ga0207656_10058201 | |||
| 1058 | Ga0207653_10013824 | |||
| 1059 | Ga0207692_10031864 | |||
| 1060 | Ga0207692_10033183 | |||
| 1061 | Ga0207692_10347802 | |||
| 1062 | Ga0207642_11112232 | |||
| 1063 | Ga0207647_10027561 | |||
| 1064 | Ga0207647_10084421 | |||
| 1065 | Ga0207685_10014064 | |||
| 1066 | Ga0207699_10041259 | |||
| 1067 | Ga0207699_10042640 | |||
| 1068 | Ga0207699_10170612 | |||
| 1069 | Ga0207699_10248571 | |||
| 1070 | Ga0207699_10363033 | |||
| 1071 | Ga0207699_10631515 | |||
| 1072 | Ga0207705_10018614 | |||
| 1073 | Ga0207705_10063072 | |||
| 1074 | Ga0207684_10069887 | |||
| 1075 | Ga0207684_10074540 | |||
| 1076 | Ga0207684_10093671 | |||
| 1077 | Ga0207684_10210491 | |||
| 1078 | Ga0207684_10574116 | |||
| 1079 | Ga0207654_10056482 | |||
| 1080 | Ga0207707_10038351 | |||
| 1081 | Ga0207707_10064624 | |||
| 1082 | Ga0207707_10250919 | |||
| 1083 | Ga0207695_10045079 | |||
| 1084 | Ga0207695_10075993 | |||
| 1085 | Ga0207695_10092001 | |||
| 1086 | Ga0207695_10156666 | |||
| 1087 | Ga0207671_10061455 | |||
| 1088 | Ga0207671_10071111 | |||
| 1089 | Ga0207671_10076639 | |||
| 1090 | Ga0207671_10744722 | |||
| 1091 | Ga0207693_10075748 | |||
| 1092 | Ga0207693_10082331 | |||
| 1093 | Ga0207693_10185488 | |||
| 1094 | Ga0207693_10600720 | |||
| 1095 | Ga0207663_10023717 | |||
| 1096 | Ga0207663_10035884 | |||
| 1097 | Ga0207663_10237026 | |||
| 1098 | Ga0207663_10315411 | |||
| 1099 | Ga0207660_10063920 | |||
| 1100 | Ga0207660_11018015 | |||
| 1101 | Ga0207657_10046152 | |||
| 1102 | Ga0207657_11361576 | |||
| 1103 | Ga0207649_10499778 | |||
| 1104 | Ga0207649_10527059 | |||
| 1105 | Ga0207652_10126523 | |||
| 1106 | Ga0207652_10239301 | |||
| 1107 | Ga0207652_10352131 | |||
| 1108 | Ga0207646_10110835 | |||
| 1109 | Ga0207681_10581265 | |||
| 1110 | Ga0207681_10752568 | |||
| 1111 | Ga0207694_10006750 | |||
| 1112 | Ga0207694_10033457 | |||
| 1113 | Ga0207694_10085983 | |||
| 1114 | Ga0207694_10089933 | |||
| 1115 | Ga0207694_10118625 | |||
| 1116 | Ga0207694_10219221 | |||
| 1117 | Ga0207694_11440904 | |||
| 1118 | Ga0207659_11280612 | |||
| 1119 | Ga0207687_11125609 | |||
| 1120 | Ga0207700_10080540 | |||
| 1121 | Ga0207700_10652121 | |||
| 1122 | Ga0207700_11326386 | |||
| 1123 | Ga0207700_11405028 | |||
| 1124 | Ga0207664_10057891 | |||
| 1125 | Ga0207664_10134392 | |||
| 1126 | Ga0207664_10844047 | |||
| 1127 | Ga0207690_10103900 | |||
| 1128 | Ga0207690_10375205 | |||
| 1129 | Ga0207706_10067417 | |||
| 1130 | Ga0207706_10077000 | |||
| 1131 | Ga0207706_10375142 | |||
| 1132 | Ga0207670_10208157 | |||
| 1133 | Ga0207670_10494356 | |||
| 1134 | Ga0207665_10050235 | |||
| 1135 | Ga0207665_10255847 | |||
| 1136 | Ga0207665_10326510 | |||
| 1137 | Ga0207665_10516156 | |||
| 1138 | Ga0207665_10570403 | |||
| 1139 | Ga0207661_10101283 | |||
| 1140 | Ga0207661_10735454 | |||
| 1141 | Ga0207661_10975966 | |||
| 1142 | Ga0207667_10017451 | |||
| 1143 | Ga0207667_10075482 | |||
| 1144 | Ga0207667_10090250 | |||
| 1145 | Ga0207667_10116788 | |||
| 1146 | Ga0207667_10269811 | |||
| 1147 | Ga0207667_10526857 | |||
| 1148 | Ga0207667_10569919 | |||
| 1149 | Ga0207667_10722397 | |||
| 1150 | Ga0207668_10182864 | |||
| 1151 | Ga0207668_10682405 | |||
| 1152 | Ga0207640_10075093 | |||
| 1153 | Ga0207640_10520106 | |||
| 1154 | Ga0207658_10696932 | |||
| 1155 | Ga0207703_10039240 | |||
| 1156 | Ga0207639_10000022 | |||
| 1157 | Ga0207639_10045594 | |||
| 1158 | Ga0207639_10307665 | |||
| 1159 | Ga0207639_11114040 | |||
| 1160 | Ga0207678_10655876 | |||
| 1161 | Ga0207708_10040210 | |||
| 1162 | Ga0207702_10064790 | |||
| 1163 | Ga0207702_10132943 | |||
| 1164 | Ga0207702_10150500 | |||
| 1165 | Ga0207702_10875975 | |||
| 1166 | Ga0207702_11566657 | |||
| 1167 | Ga0207702_11967047 | |||
| 1168 | Ga0207641_10109589 | |||
| 1169 | Ga0207641_10650486 | |||
| 1170 | Ga0207641_11145171 | |||
| 1171 | Ga0207676_10366258 | |||
| 1172 | Ga0207676_10642682 | |||
| 1173 | Ga0207675_101006082 | |||
| 1174 | Ga0207675_102035323 | |||
| 1175 | Ga0207698_11101587 | |||
| 1176 | Ga0207698_12251951 | |||
| 1177 | Ga0209179_1008437 | |||
| 1178 | Ga0265354_1021326 | |||
| 1179 | Ga0265355_1000256 | |||
| 1180 | Ga0265355_1002675 | |||
| 1181 | Ga0268266_10261797 | |||
| 1182 | Ga0268266_10324352 | |||
| 1183 | Ga0268266_10682628 | |||
| 1184 | Ga0268266_11983635 | |||
| 1185 | Ga0268265_10412064 | |||
| 1186 | Ga0268265_11233056 | |||
| 1187 | Ga0268264_10100311 | |||
| 1188 | Ga0265337_1014946 | |||
| 1189 | Ga0265337_1057656 | |||
| 1190 | Ga0265337_1123859 | |||
| 1191 | Ga0265326_10010471 | |||
| 1192 | Ga0265326_10010543 | |||
| 1193 | Ga0265319_1026190 | |||
| 1194 | Ga0265319_1046775 | |||
| 1195 | Ga0265319_1093310 | |||
| 1196 | Ga0265334_10023613 | |||
| 1197 | Ga0265334_10108424 | |||
| 1198 | Ga0265334_10140262 | |||
| 1199 | Ga0265318_10014974 | |||
| 1200 | Ga0265318_10029252 | |||
| 1201 | Ga0265318_10081834 | |||
| 1202 | Ga0265318_10130923 | |||
| 1203 | Ga0265318_10357799 | |||
| 1204 | Ga0265323_10030796 | |||
| 1205 | Ga0265323_10060805 | |||
| 1206 | Ga0265323_10167924 | |||
| 1207 | Ga0265336_10014096 | |||
| 1208 | Ga0265336_10036408 | |||
| 1209 | Ga0265336_10038702 | |||
| 1210 | Ga0307515_10379675 | |||
| 1211 | Ga0265338_10011235 | |||
| 1212 | Ga0265338_10078795 | |||
| 1213 | Ga0265338_10079222 | |||
| 1214 | Ga0265338_10086502 | |||
| 1215 | Ga0265338_10086591 | |||
| 1216 | Ga0265338_10087220 | |||
| 1217 | Ga0265338_10092331 | |||
| 1218 | Ga0265338_10098441 | |||
| 1219 | Ga0265338_10103883 | |||
| 1220 | Ga0265338_10112494 | |||
| 1221 | Ga0265338_10114465 | |||
| 1222 | Ga0265338_10139602 | |||
| 1223 | Ga0265338_10172158 | |||
| 1224 | Ga0265338_10178288 | |||
| 1225 | Ga0265338_10486370 | |||
| 1226 | Ga0265338_10581702 | |||
| 1227 | Ga0265338_10628485 | |||
| 1228 | Ga0265324_10008506 | |||
| 1229 | Ga0265324_10014281 | |||
| 1230 | Ga0265324_10017825 | |||
| 1231 | Ga0265324_10040721 | |||
| 1232 | Ga0265324_10135357 | |||
| 1233 | Ga0265770_1088965 | |||
| 1234 | Ga0265771_1000311 | |||
| 1235 | Ga0265771_1029334 | |||
| 1236 | Ga0265760_10079832 | |||
| 1237 | Ga0265330_10032010 | |||
| 1238 | Ga0265330_10183542 | |||
| 1239 | Ga0265332_10019918 | |||
| 1240 | Ga0265332_10026070 | |||
| 1241 | Ga0265332_10103898 | |||
| 1242 | Ga0265332_10200073 | |||
| 1243 | Ga0265332_10449552 | |||
| 1244 | Ga0265320_10028645 | |||
| 1245 | Ga0265320_10029975 | |||
| 1246 | Ga0265320_10032490 | |||
| 1247 | Ga0265320_10032615 | |||
| 1248 | Ga0265320_10177520 | |||
| 1249 | Ga0265320_10221133 | |||
| 1250 | Ga0265325_10023162 | |||
| 1251 | Ga0265325_10028199 | |||
| 1252 | Ga0265325_10283780 | |||
| 1253 | Ga0265329_10228853 | |||
| 1254 | Ga0265340_10034175 | |||
| 1255 | Ga0265340_10034944 | |||
| 1256 | Ga0265340_10103464 | |||
| 1257 | Ga0265340_10106696 | |||
| 1258 | Ga0265339_10057900 | |||
| 1259 | Ga0265331_10135516 | |||
| 1260 | Ga0265331_10283290 | |||
| 1261 | Ga0265327_10016597 | |||
| 1262 | Ga0265327_10034142 | |||
| 1263 | Ga0265327_10035475 | |||
| 1264 | Ga0265327_10119606 | |||
| 1265 | Ga0265327_10134424 | |||
| 1266 | Ga0265316_10051435 | |||
| 1267 | Ga0265316_10095039 | |||
| 1268 | Ga0265316_10149645 | |||
| 1269 | Ga0265316_10287109 | |||
| 1270 | Ga0265316_10989023 | |||
| 1271 | Ga0307513_10106060 | |||
| 1272 | Ga0307408_100641228 | |||
| 1273 | Ga0265313_10033666 | |||
| 1274 | Ga0265313_10235177 | |||
| 1275 | Ga0307508_10261021 | |||
| 1276 | Ga0307508_10409184 | |||
| 1277 | Ga0316575_10128194 | |||
| 1278 | Ga0316575_10130215 | |||
| 1279 | Ga0316575_10498920 | |||
| 1280 | Ga0265314_10060492 | |||
| 1281 | Ga0265314_10116033 | |||
| 1282 | Ga0265314_10200831 | |||
| 1283 | Ga0265314_10205307 | |||
| 1284 | Ga0265314_10233783 | |||
| 1285 | Ga0265314_10283283 | |||
| 1286 | Ga0265314_10464390 | |||
| 1287 | Ga0265342_10024049 | |||
| 1288 | Ga0265342_10050695 | |||
| 1289 | Ga0265342_10055715 | |||
| 1290 | Ga0265342_10185849 | |||
| 1291 | Ga0265342_10326517 | |||
| 1292 | Ga0316576_11069282 | |||
| 1293 | Ga0316578_10474359 | |||
| 1294 | Ga0307516_10211245 | |||
| 1295 | Ga0307516_10349251 | |||
| 1296 | Ga0307410_10395993 | |||
| 1297 | Ga0307410_10597032 | |||
| 1298 | Ga0307407_10019927 | |||
| 1299 | Ga0307407_10275402 | |||
| 1300 | Ga0307412_10055358 | |||
| 1301 | Ga0307416_100095981 | |||
| 1302 | Ga0307416_101670125 | |||
| 1303 | Ga0307414_10091542 | |||
| 1304 | Ga0307411_11942427 | |||
| 1305 | Ga0316583_10123824 | |||
| 1306 | Ga0316214_1001884 | |||
| 1307 | Ga0316212_1017413 | |||
| 1308 | Ga0373930_0181689 | |||
| 1309 | Ga0373934_0015604 | |||
| 1310 | Ga0373934_0148286 | |||
| 1311 | Ga0373923_0040331 | |||
| 1312 | Ga0373932_0307432 | |||
| 1313 | Ga0373936_0398856 | |||
| 1314 | Ga0373945_0060529 | |||
| 1315 | Ga0373953_0056925 | |||
| 1316 | Ga0373953_0160132 | |||
| 1317 | Ga0373954_0045670 | |||
| 1318 | Ga0373954_0295138 | |||
| 1319 | Ga0373956_0030637 | |||
| 1320 | Ga0373957_0018041 | |||
| 1321 | Ga0373957_0047980 | |||
| 1322 | Ga0373960_0301239 | |||
| 1323 | Ga0373943_0170765 | |||
| 1324 | Ga0373955_0079558 | |||
| 1325 | Ga0373955_0269955 | |||
| 1326 | Ga0373955_0304641 | |||
| 1327 | Ga0316574_0322674 | |||
| 1328 | Ga0373924_0018935 | |||
| 1329 | Ga0373931_0125502 | |||
| 1330 | Ga0373935_0083207 | |||
| 1331 | Ga0373935_0584641 | |||
| 1332 | Ga0373927_0408202 | |||
| 1333 | Ga0373927_0502066 | |||
| 1334 | Ga0373933_0041009 | |||
| 1335 | Ga0373947_1013693 | |||
| 1336 | Ga0373937_0039653 | |||
| 1337 | Ga0373937_0068401 | |||
| 1338 | Ga0373937_0109445 | |||
| 1339 | Ga0373937_0795411 | |||
| 1340 | Ga0373937_1370646 | |||
| 1341 | Ga0316582_0169996 | |||
| 1342 | Ga0316584_0084127 | |||
| 1343 | Ga0373925_0083253 | |||
| 1344 | Ga0373925_0333019 | |||
| 1345 | Ga0373925_0818214 | |||
| 1346 | Ga0395905_0128200 | |||
| 1347 | Ga0395905_0389413 | |||
| 1348 | Ga0395905_0634630 | |||
| 1349 | Ga0395905_0726711 | |||
| 1350 | Ga0436364_0146368 | |||
| 1351 | Ga0436364_0898552 | |||
| 1352 | Ga0436364_0964109 | |||
| 1353 | Ga0436364_1138300 | |||
| 1354 | Ga0436365_0025447 | |||
| 1355 | Ga0436365_0650435 | |||
| 1356 | Ga0436365_0673797 | |||
| 1357 | Ga0436365_1803750 | |||
| 1358 | Ga0436360_1192305 | |||
| 1359 | Ga0436361_0310241 | |||
| 1360 | Ga0436361_0601301 | |||
| 1361 | Ga0436361_0615773 | |||
| 1362 | Ga0436363_1537784 | |||
| 1363 | Ga0436362_0180676 | |||
| 1364 | Ga0439453_0000522 | |||
| 1365 | Ga0451798_0867429 | |||
| 1366 | Ga0451807_1323642 | |||
| 1367 | Ga0451853_3053569 | |||
| 1368 | Ga0439441_024687 | |||
| 1369 | Ga0450888_010217 | |||
| 1370 | Ga0450892_000500 | |||
| 1371 | Ga0450895_001738 | |||
| 1372 | Ga0450896_004257 | |||
| 1373 | Ga0450904_011416 | |||
| 1374 | Ga0439435_0238307 | |||
| 1375 | Ga0450918_042152 | |||
| 1376 | Ga0450918_050323 | |||
| 1377 | Ga0450893_0000466 | |||
| 1378 | Ga0450901_016899 | |||
| 1379 | Ga0451577_0001638 | |||
| 1380 | Ga0451577_0007812 | |||
| 1381 | Ga0451577_0094552 | |||
| 1382 | Ga0451577_0098413 | |||
| 1383 | Ga0451577_0177552 | |||
| 1384 | Ga0451577_1425604 | |||
| 1385 | Ga0451577_1724206 | |||
| 1386 | Ga0453683_0230318 | |||
| 1387 | Ga0466966_0054841 | |||
| 1388 | Ga0466961_0196659 | |||
| 1389 | Ga0453684_0020537 | |||
| 1390 | Ga0453684_0068400 | |||
| 1391 | Ga0453684_0113294 | |||
| 1392 | Ga0453684_0768730 | |||
| 1393 | Ga0453684_0915901 | |||
| 1394 | Ga0453684_2305093 | |||
| 1395 | Ga0466957_0653874 | |||
| 1396 | Ga0451576_0058087 | |||
| 1397 | Ga0451576_0092643 | |||
| 1398 | Ga0451576_0098623 | |||
| 1399 | Ga0451576_0140739 | |||
| 1400 | Ga0451576_0246277 | |||
| 1401 | Ga0451576_0453345 | |||
| 1402 | Ga0451576_0580757 | |||
| 1403 | Ga0451576_0600892 | |||
| 1404 | Ga0495592_0122352 | |||
| 1405 | Ga0495651_0071738 | |||
| 1406 | Ga0495651_0173177 | |||
| 1407 | Ga0495651_0247805 | |||
| 1408 | Ga0495651_0623667 | |||
| 1409 | Ga0495651_1012986 | |||
| 1410 | Ga0495653_0098575 | |||
| 1411 | Ga0495653_0246050 | |||
| 1412 | Ga0495580_0146577 | |||
| 1413 | Ga0495580_0755071 | |||
| 1414 | Ga0495664_0294943 | |||
| 1415 | Ga0495664_0374917 | |||
| 1416 | Ga0495594_0065183 | |||
| 1417 | Ga0495607_0425821 | |||
| 1418 | Ga0495583_0332483 | |||
| 1419 | Ga0495608_0268775 | |||
| 1420 | Ga0495618_0054083 | |||
| 1421 | Ga0495618_0135879 | |||
| 1422 | Ga0495628_0068561 | |||
| 1423 | Ga0495628_0083597 | |||
| 1424 | Ga0495628_0108620 | |||
| 1425 | Ga0495628_0156201 | |||
| 1426 | Ga0495628_0569485 | |||
| 1427 | Ga0495628_1224649 | |||
| 1428 | Ga0495630_0028250 | |||
| 1429 | Ga0495630_0053978 | |||
| 1430 | Ga0495630_0531846 | |||
| 1431 | Ga0495630_0759646 | |||
| 1432 | Ga0495630_1159035 | |||
| 1433 | Ga0495630_1449707 | |||
| 1434 | Ga0495652_0103322 | |||
| 1435 | Ga0495652_0788090 | |||
| 1436 | Ga0495640_0077183 | |||
| 1437 | Ga0495640_0792020 | |||
| 1438 | Ga0495586_0073401 | |||
| 1439 | Ga0495586_0080975 | |||
| 1440 | Ga0495586_0121548 | |||
| 1441 | Ga0495586_0127834 | |||
| 1442 | Ga0495587_0043076 | |||
| 1443 | Ga0495587_0489702 | |||
| 1444 | Ga0495621_0445293 | |||
| 1445 | Ga0495645_0045499 | |||
| 1446 | Ga0495645_0068508 | |||
| 1447 | Ga0495645_0268644 | |||
| 1448 | Ga0495645_0422343 | |||
| 1449 | Ga0495645_0477156 | |||
| 1450 | Ga0495667_0073749 | |||
| 1451 | Ga0495667_0663545 | |||
| 1452 | Ga0495667_0967235 | |||
| 1453 | Ga0495656_0023070 | |||
| 1454 | Ga0495656_0224846 | |||
| 1455 | Ga0495634_0389674 | |||
| 1456 | Ga0495634_0607933 | |||
| 1457 | Ga0495634_0735946 | |||
| 1458 | Ga0495635_0217129 | |||
| 1459 | Ga0495635_0239447 | |||
| 1460 | Ga0495635_0380080 | |||
| 1461 | Ga0495635_1068350 | |||
| 1462 | Ga0495661_0336152 | |||
| 1463 | Ga0495657_0072231 | |||
| 1464 | Ga0495657_0153302 | |||
| 1465 | Ga0495657_0267186 | |||
| 1466 | Ga0495599_0335945 | |||
| 1467 | Ga0495599_0633947 | |||
| 1468 | Ga0495599_0706094 | |||
| 1469 | Ga0495599_0807181 | |||
| 1470 | Ga0495646_0055710 | |||
| 1471 | Ga0495646_0329082 | |||
| 1472 | Ga0495658_0227371 | |||
| 1473 | Ga0495658_0413787 | |||
| 1474 | Ga0495613_0155815 | |||
| 1475 | Ga0495613_0282926 | |||
| 1476 | Ga0495613_0289732 | |||
| 1477 | Ga0495613_0512924 | |||
| 1478 | Ga0495613_0561229 | |||
| 1479 | Ga0495670_0142962 | |||
| 1480 | Ga0495670_0224603 | |||
| 1481 | Ga0495671_0377130 | |||
| 1482 | Ga0495600_0046443 | |||
| 1483 | Ga0495600_0194060 | |||
| 1484 | Ga0495600_0236221 | |||
| 1485 | Ga0495600_0259843 | |||
| 1486 | Ga0495581_0387630 | |||
| 1487 | Ga0495604_0051354 | |||
| 1488 | Ga0495604_0085271 | |||
| 1489 | Ga0495604_0094068 | |||
| 1490 | Ga0495604_0973283 | |||
| 1491 | Ga0495636_0023278 | |||
| 1492 | Ga0495636_0033067 | |||
| 1493 | Ga0495636_0099149 | |||
| 1494 | Ga0495636_0172526 | |||
| 1495 | Ga0495636_0367915 | |||
| 1496 | Ga0495674_0043876 | |||
| 1497 | Ga0495674_0090300 | |||
| 1498 | Ga0495674_0120905 | |||
| 1499 | Ga0495674_0451209 | |||
| 1500 | Ga0495680_0126294 | |||
| 1501 | Ga0495680_0145681 | |||
| 1502 | Ga0495675_0117805 | |||
| 1503 | Ga0495675_0308399 | |||
| 1504 | Ga0495675_0324316 | |||
| 1505 | Ga0495685_209329 | |||
| 1506 | Ga0495681_0230211 | |||
| 1507 | Ga0495684_0111133 | |||
| 1508 | Ga0495684_0179269 | |||
| 1509 | Ga0495684_0290506 | |||
| 1510 | Ga0495684_0470074 | |||
| 1511 | Ga0495684_0482049 | |||
| 1512 | Ga0495684_0967094 | |||
| 1513 | Ga0495686_0515159 | |||
| 1514 | Ga0495602_0338123 | |||
| 1515 | Ga0495602_0771661 | |||
| 1516 | Ga0496102_0233983 | |||
| 1517 | Ga0496102_1607663 | |||
| 1518 | Ga0496104_1859233 | |||
| 1519 | Ga0496115_0845969 | |||
| 1520 | Ga0496123_0418399 | |||
| 1521 | Ga0501031_0000715 | |||
| 1522 | Ga0501031_0044721 | |||
| 1523 | Ga0501031_0049974 | |||
| 1524 | Ga0501031_0058864 | |||
| 1525 | Ga0501032_0051389 | |||
| 1526 | Ga0501032_0057158 | |||
| 1527 | Ga0501032_0060207 | |||
| 1528 | Ga0501033_0004367 | |||
| 1529 | Ga0501033_0015438 | |||
| 1530 | Ga0501033_0046759 | |||
| 1531 | Ga0501033_0049683 | |||
| 1532 | Ga0501033_0060002 | |||
| 1533 | Ga0501033_0073713 | |||
| 1534 | Ga0501033_0083364 | |||
| 1535 | Ga0501033_0524049 | |||
| 1536 | Ga0501034_0076343 | |||
| 1537 | Ga0501034_0090390 | |||
| 1538 | Ga0501034_0102448 | |||
| 1539 | Ga0501034_0121405 | |||
| 1540 | Ga0501034_0159557 | |||
| 1541 | Ga0501034_0160532 | |||
| 1542 | Ga0501034_0264109 | |||
| 1543 | Ga0501034_0502308 | |||
| 1544 | Ga0501034_0937950 | |||
| 1545 | Ga0501036_0064285 | |||
| 1546 | Ga0501036_0067161 | |||
| 1547 | Ga0501036_0089743 | |||
| 1548 | Ga0501036_0445922 | |||
| 1549 | Ga0501036_1525838 | |||
| 1550 | Ga0501037_0018510 | |||
| 1551 | Ga0501037_0056225 | |||
| 1552 | Ga0501037_0068567 | |||
| 1553 | Ga0501037_0229301 | |||
| 1554 | Ga0501038_0089121 | |||
| 1555 | Ga0501038_0129490 | |||
| 1556 | Ga0501038_0282561 | |||
| 1557 | Ga0501038_0471553 | |||
| 1558 | Ga0501039_0057627 | |||
| 1559 | Ga0501039_0061514 | |||
| 1560 | Ga0501039_0071406 | |||
| 1561 | Ga0501039_0077712 | |||
| 1562 | Ga0501039_0437487 | |||
| 1563 | Ga0501040_0669122 | |||
| 1564 | Ga0501041_0248957 | |||
| 1565 | Ga0501042_0094158 | |||
| 1566 | Ga0501043_0000189 | |||
| 1567 | Ga0501043_0002688 | |||
| 1568 | Ga0501043_0021478 | |||
| 1569 | Ga0501043_0051443 | |||
| 1570 | Ga0501043_0081868 | |||
| 1571 | Ga0501043_0113691 | |||
| 1572 | Ga0501043_0281455 | |||
| 1573 | Ga0501043_0282905 | |||
| 1574 | Ga0501043_0566817 | |||
| 1575 | Ga0501046_0039573 | |||
| 1576 | Ga0501046_0053966 | |||
| 1577 | Ga0501046_0074034 | |||
| 1578 | Ga0501046_0083225 | |||
| 1579 | Ga0501046_0107451 | |||
| 1580 | Ga0501046_0572603 | |||
| 1581 | Ga0501047_0013091 | |||
| 1582 | Ga0501047_0037391 | |||
| 1583 | Ga0501047_0091477 | |||
| 1584 | Ga0501047_0122572 | |||
| 1585 | Ga0501047_0223233 | |||
| 1586 | Ga0501048_0032719 | |||
| 1587 | Ga0501048_0061559 | |||
| 1588 | Ga0501048_0067565 | |||
| 1589 | Ga0501048_0281301 | |||
| 1590 | Ga0501048_0637312 | |||
| 1591 | Ga0501048_0708104 | |||
| 1592 | Ga0501067_0198052 | |||
| 1593 | Ga0501067_0435705 | |||
| 1594 | Ga0501067_0521771 | |||
| 1595 | Ga0501068_0321631 | |||
| 1596 | Ga0501069_0042248 | |||
| 1597 | Ga0501069_0753865 | |||
| 1598 | Ga0501070_0048669 | |||
| 1599 | Ga0501070_0057403 | |||
| 1600 | Ga0501070_0099218 | |||
| 1601 | Ga0501070_0111484 | |||
| 1602 | Ga0501071_0151033 | |||
| 1603 | Ga0501071_0709187 | |||
| 1604 | Ga0501073_0051422 | |||
| 1605 | Ga0501073_0069427 | |||
| 1606 | Ga0501073_0380634 | |||
| 1607 | Ga0501074_0061034 | |||
| 1608 | Ga0501074_0061327 | |||
| 1609 | Ga0501198_011473 | |||
| 1610 | Ga0501198_027510 | |||
| 1611 | Ga0501079_0197484 | |||
| 1612 | Ga0501080_0095680 | |||
| 1613 | Ga0501080_0105524 | |||
| 1614 | Ga0501080_0117292 | |||
| 1615 | Ga0501083_0061178 | |||
| 1616 | Ga0501269_033113 | |||
| 1617 | Ga0501035_0000261 | |||
| 1618 | Ga0501035_0022326 | |||
| 1619 | Ga0501035_0069397 | |||
| 1620 | Ga0501035_0077254 | |||
| 1621 | Ga0501035_0431938 | |||
| 1622 | Ga0501035_1086990 | |||
| 1623 | Ga0501044_0000518 | |||
| 1624 | Ga0501044_0122761 | |||
| 1625 | Ga0501044_0139269 | |||
| 1626 | Ga0501044_0234967 | |||
| 1627 | Ga0501045_0067785 | |||
| 1628 | Ga0501045_0758024 | |||
| 1629 | nmdc:mga03n38_588871_c1 | |||
| 1630 | nmdc:mga0k408_43843_c1 | |||
| 1631 | nmdc:mga0k408_478904_c1 | |||
| 1632 | nmdc:mga0k408_537835_c1 | |||
| 1633 | nmdc:mga07m45_100458_c1 | |||
| 1634 | nmdc:mga05p37_1140147_c1 | |||
| 1635 | nmdc:mga09592_137873_c1 | |||
| 1636 | nmdc:mga0rr50_551904_c1 | |||
| 1637 | Ga0495601_0048358 | |||
| 1638 | Ga0495601_0084379 | |||
| 1639 | Ga0495601_0112445 | |||
| 1640 | Ga0495601_0278278 | |||
| 1641 | Ga0495601_0354996 | |||
| 1642 | Ga0495612_0023440 | |||
| 1643 | Ga0495612_0073051 | |||
| 1644 | Ga0495612_0143422 | |||
| 1645 | Ga0495612_0185591 | |||
| 1646 | Ga0495612_0339850 | |||
| 1647 | Ga0495612_0355029 | |||
| 1648 | Ga0495612_0529530 | |||
| 1649 | Ga0495595_0078201 | |||
| 1650 | Ga0495595_0086546 | |||
| 1651 | Ga0495595_0127907 | |||
| 1652 | Ga0495595_0171015 | |||
| 1653 | Ga0495619_0040071 | |||
| 1654 | Ga0495619_0044064 | |||
| 1655 | Ga0500566_0210957 | |||
| 1656 | Ga0500566_0307261 | |||
| 1657 | Ga0500608_047379 | |||
| 1658 | Ga0500559_0003706 | |||
| 1659 | Ga0500559_0004203 | |||
| 1660 | Ga0500559_0114440 | |||
| 1661 | Ga0500568_0254896 | |||
| 1662 | Ga0501084_0085348 | |||
| 1663 | Ga0501084_0109944 | |||
| 1664 | Ga0501084_0454978 | |||
| 1665 | Ga0501082_0103371 | |||
| 1666 | Ga0501082_0329005 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sqc-assembly1.cif.gz_R0 | ciliary c1 central pair apparatus isolated from chlamydomonas reinhardtii | 0.8384 | 43 | 70 |
| 1s4u-assembly1.cif.gz_X | crystal structure analysis of the beta-propeller protein ski8p | 0.8088 | 42 | 72 |
| 2onc-assembly1.cif.gz_B | crystal structure of human dpp-4 | 0.8009 | 42 | 70 |
| 7d5s-assembly1.cif.gz_A5 | cryo-em structure of 90s preribosome with inactive utp24 (state a2) | 0.7946 | 45 | 72 |
| 2uzs-assembly1.cif.gz_A | a transforming mutation in the pleckstrin homology domain of akt1 in cancer (akt1-ph_e17k) | 0.7668 | 41 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D9F6_1150_1429_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8673 | 43 | 70 | 2.130.10.10 |
| af_I1KKW7_1_362_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8652 | 45 | 70 | 3.30.70.330 |
| af_G4RXN1_1_175_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.8226 | 43 | 70 | 3.80.10.10 |
| af_F8Y416_51_178_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.7976 | 45 | 70 | 3.80.10.10 |
| af_O62123_289_355_1.20.5.2050 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.7885 | 42 | 70 | 1.20.5.2050 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y4ARR5-F1-model_v4 | Uncharacterized protein | 0.9292 | 8 | 91 |
|
| AF-A0A3A8QNA2-F1-model_v4 | Transposase | 0.9272 | 2 | 74 |
|
| AF-A0A2L0EHZ0-F1-model_v4 | DNA repair protein | 0.9244 | 1 | 80 |
GO:0003700
GO:0006352 GO:0008237 |
| AF-A0A0C5W473-F1-model_v4 | Putative IS66 Orf2 family protein | 0.9235 | 1 | 99 |
|
| AF-G8M296-F1-model_v4 | Transposase | 0.9234 | 7 | 98 |
GO:0003677
GO:0004803 GO:0006313 |