F482059

General Info

Members Datasets Scaffolds Average Seq Length
816 318 804 266

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000002|Ga0307511_1000000263
Length 321
Sequence MFAGGFAIFLKSESPANLKGWKPFSPTGQTLALCRRCARFLKAHFRHIFLFCSGMSTLTITTIQTALQWEDKAANLLRLAEKIDGIREKTEIVILPEMFSTGFSMKPEILAERMDGPTMEWMKKTAAQKRVILTGSLIIEEEGNYYNRLIWMLPNGEYGYYDKRHRFAYAGENEHYTAGKKRLIASVKGWKINLLVCYDLRFPVWSRQAPNSSEMNSELEYDLLIYVANWPERRSLAWKTLLQARAIENQSYVIGVNRVGEDGNNISHSGDTMIIDPLGEVLYHGLKEEAIFTYTLRKERLEEVRSRFPFWRDADDFSVHP

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
5 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
6 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
7 2818991444 Filimonas endophytica 3197 Isolate Unclassified
8 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
9 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
10 2914759650 Rhizosphaericola mali Isolate Rhizosphere
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
173 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
199 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
200 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
201 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
202 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
286 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
287 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
288 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
289 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
290 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
291 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
292 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
305 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
306 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
307 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
311 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0.25
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.45
Nodule 0.25
Rhizoplane 2.57
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1015358 3300001904 Bacteria 1227
2 JGI24751J29686_10000945 3300002459 Bacteria 6466
3 JGI24751J29686_10001408 3300002459 Bacteria 5040
4 JGI25406J46586_10000387 3300003203 Bacteria 20246
5 rootH2_10061393 3300003320 Bacteria 15275
6 rootH2_10127001 3300003320 Bacteria 7405
7 rootH2_10254154 3300003320 Bacteria 1942
8 rootL2_10012238 3300003322 Unclassified 2660
9 rootL2_10163886 3300003322 Bacteria 2795
10 rootL2_10260109 3300003322 Bacteria 2239
11 rootH1_10290290 3300003323 Bacteria 2510
12 Ga0058692_1002672 3300003856 Bacteria 5869
13 Ga0065165_1000601 3300005262 Bacteria 52747
14 Ga0065714_10109739 3300005288 Bacteria 1495
15 Ga0065712_10098628 3300005290 Bacteria 2114
16 Ga0065707_10114619 3300005295 Bacteria 2292
17 Ga0070658_10000512 3300005327 Bacteria 33597
18 Ga0070658_10165345 3300005327 Unclassified 1857
19 Ga0070676_10000439 3300005328 Bacteria 19781
20 Ga0070676_10054171 3300005328 Bacteria 2364
21 Ga0070683_100011967 3300005329 Bacteria 7527
22 Ga0070683_100013925 3300005329 Bacteria 7026
23 Ga0070683_100546953 3300005329 Unclassified 1107
24 Ga0070690_100053183 3300005330 Bacteria 2590
25 Ga0070690_100204457 3300005330 Bacteria 1376
26 Ga0070670_100045587 3300005331 Bacteria 3770
27 Ga0070670_100065267 3300005331 Unclassified 3123
28 Ga0070670_100315367 3300005331 Unclassified 1369
29 Ga0070670_100325871 3300005331 Bacteria 1346
30 Ga0070670_100387828 3300005331 Unclassified 1231
31 Ga0068869_100106559 3300005334 Unclassified 2127
32 Ga0068869_100169883 3300005334 Bacteria 1703
33 Ga0068869_100216984 3300005334 Bacteria 1515
34 Ga0070666_10000499 3300005335 Bacteria 23607
35 Ga0070666_10003443 3300005335 Bacteria 9589
36 Ga0070666_10096799 3300005335 Bacteria 2032
37 Ga0070680_100000078 3300005336 Bacteria 52994
38 Ga0070680_100010273 3300005336 Bacteria 7216
39 Ga0070680_100022622 3300005336 Bacteria 5009
40 Ga0070680_100311737 3300005336 Unclassified 1335
41 Ga0070682_100000012 3300005337 Bacteria 265658
42 Ga0070682_100006550 3300005337 Bacteria 6533
43 Ga0070682_100026168 3300005337 Bacteria 3489
44 Ga0070682_100035182 3300005337 Bacteria 3056
45 Ga0070682_100484955 3300005337 Unclassified 954
46 Ga0068868_100000119 3300005338 Bacteria 49590
47 Ga0068868_100004028 3300005338 Bacteria 10248
48 Ga0068868_100029982 3300005338 Bacteria 4170
49 Ga0070660_100002935 3300005339 Bacteria 11731
50 Ga0070660_100005349 3300005339 Bacteria 8884
51 Ga0070660_100077428 3300005339 Unclassified 2606
52 Ga0070660_100094125 3300005339 Bacteria 2367
53 Ga0070660_100196454 3300005339 Bacteria 1635
54 Ga0070660_100490826 3300005339 Bacteria 1021
55 Ga0070689_100302398 3300005340 Viruses 1332
56 Ga0070689_100466835 3300005340 Bacteria 1076
57 Ga0070689_100669588 3300005340 Bacteria 904
58 Ga0070691_10000658 3300005341 Bacteria 13391
59 Ga0070691_10097437 3300005341 Bacteria 1457
60 Ga0070661_100003526 3300005344 Bacteria 10774
61 Ga0070668_100005038 3300005347 Bacteria 9783
62 Ga0070669_100109044 3300005353 Bacteria 2099
63 Ga0070675_100111384 3300005354 Bacteria 2316
64 Ga0070675_100294794 3300005354 Bacteria 1428
65 Ga0070675_100361372 3300005354 Bacteria 1289
66 Ga0070671_100001534 3300005355 Bacteria 17343
67 Ga0070671_100066594 3300005355 Bacteria 3002
68 Ga0070673_100000331 3300005364 Bacteria 24760
69 Ga0070659_100002521 3300005366 Bacteria 13007
70 Ga0070659_100012620 3300005366 Bacteria 6266
71 Ga0070659_100169738 3300005366 Unclassified 1786
72 Ga0070659_100267189 3300005366 Bacteria 1420
73 Ga0070667_100001052 3300005367 Bacteria 25199
74 Ga0070667_100013431 3300005367 Bacteria 6770
75 Ga0070667_100019848 3300005367 Bacteria 5577
76 Ga0070667_100066659 3300005367 Bacteria 3059
77 Ga0070703_10074821 3300005406 Bacteria 1139
78 Ga0070714_100247622 3300005435 Bacteria 1647
79 Ga0070713_100002396 3300005436 Bacteria 12225
80 Ga0070713_100135257 3300005436 Bacteria 2177
81 Ga0070710_10003818 3300005437 Bacteria 7128
82 Ga0070711_100002860 3300005439 Bacteria 9931
83 Ga0070711_100166054 3300005439 Bacteria 1678
84 Ga0070678_100001008 3300005456 Bacteria 14634
85 Ga0070678_100022664 3300005456 Bacteria 4167
86 Ga0070678_100114791 3300005456 Unclassified 2113
87 Ga0070678_100116522 3300005456 Bacteria 2099
88 Ga0070678_100365184 3300005456 Unclassified 1245
89 Ga0070662_100011908 3300005457 Bacteria 5750
90 Ga0070681_10001582 3300005458 Bacteria 20207
91 Ga0070681_10004146 3300005458 Bacteria 13709
92 Ga0070681_10007971 3300005458 Bacteria 10366
93 Ga0070681_10010840 3300005458 Bacteria 9008
94 Ga0070681_10011407 3300005458 Bacteria 8795
95 Ga0070681_10026407 3300005458 Bacteria 5836
96 Ga0070681_10029183 3300005458 Bacteria 5538
97 Ga0070681_10103829 3300005458 Bacteria 2786
98 Ga0070681_10139072 3300005458 Unclassified 2358
99 Ga0070681_10179824 3300005458 Bacteria 2037
100 Ga0070681_10338998 3300005458 Bacteria 1413
101 Ga0068867_100002653 3300005459 Bacteria 12624
102 Ga0068867_100003430 3300005459 Bacteria 11147
103 Ga0068867_100028988 3300005459 Bacteria 3987
104 Ga0068867_100049202 3300005459 Bacteria 3103
105 Ga0068867_100108619 3300005459 Bacteria 2128
106 Ga0070679_100000099 3300005530 Bacteria 66873
107 Ga0070679_100000469 3300005530 Bacteria 34407
108 Ga0070679_100007464 3300005530 Bacteria 10219
109 Ga0070679_100048036 3300005530 Bacteria 4253
110 Ga0070679_100120141 3300005530 Unclassified 2613
111 Ga0070679_100290905 3300005530 Bacteria 1585
112 Ga0070684_100036943 3300005535 Bacteria 4188
113 Ga0070684_100038510 3300005535 Unclassified 4107
114 Ga0068853_100000773 3300005539 Bacteria 22203
115 Ga0068853_100001959 3300005539 Bacteria 15174
116 Ga0068853_100003709 3300005539 Bacteria 11729
117 Ga0068853_100008365 3300005539 Bacteria 8308
118 Ga0068853_100047969 3300005539 Bacteria 3666
119 Ga0068853_100291166 3300005539 Bacteria 1507
120 Ga0068853_100317422 3300005539 Bacteria 1444
121 Ga0068853_100360979 3300005539 Bacteria 1353
122 Ga0070672_100000183 3300005543 Bacteria 34362
123 Ga0070672_100141424 3300005543 Bacteria 1985
124 Ga0070672_100383567 3300005543 Bacteria 1202
125 Ga0070686_100005249 3300005544 Bacteria 7155
126 Ga0070665_100000047 3300005548 Bacteria 269702
127 Ga0070665_100001045 3300005548 Bacteria 34668
128 Ga0070665_100002122 3300005548 Bacteria 22146
129 Ga0070665_100556720 3300005548 Bacteria 1159
130 Ga0068855_100000081 3300005563 Bacteria 115707
131 Ga0068855_100000145 3300005563 Bacteria 91452
132 Ga0068855_100000582 3300005563 Bacteria 44891
133 Ga0068855_100001482 3300005563 Bacteria 29366
134 Ga0068855_100004840 3300005563 Bacteria 16434
135 Ga0068855_100007644 3300005563 Bacteria 13072
136 Ga0068855_100057930 3300005563 Bacteria 4540
137 Ga0068855_100079337 3300005563 Bacteria 3807
138 Ga0068855_100140468 3300005563 Bacteria 2754
139 Ga0068855_100189177 3300005563 Unclassified 2323
140 Ga0068855_100211440 3300005563 Bacteria 2179
141 Ga0068855_100425602 3300005563 Bacteria 1452
142 Ga0068855_100435262 3300005563 Bacteria 1433
143 Ga0070664_100008870 3300005564 Bacteria 8150
144 Ga0070664_100107417 3300005564 Unclassified 2433
145 Ga0068857_100111310 3300005577 Bacteria 2461
146 Ga0068857_100145020 3300005577 Bacteria 2148
147 Ga0068857_100189049 3300005577 Unclassified 1875
148 Ga0068857_100196808 3300005577 Bacteria 1836
149 Ga0068854_100015524 3300005578 Bacteria 5048
150 Ga0068854_100269523 3300005578 Bacteria 1366
151 Ga0068856_100009998 3300005614 Bacteria 9212
152 Ga0068856_100018970 3300005614 Bacteria 6673
153 Ga0068856_100036909 3300005614 Bacteria 4793
154 Ga0068856_100064734 3300005614 Bacteria 3612
155 Ga0068856_100147294 3300005614 Unclassified 2362
156 Ga0068856_100205214 3300005614 Bacteria 1985
157 Ga0068852_100002561 3300005616 Bacteria 12525
158 Ga0068852_100002956 3300005616 Bacteria 11806
159 Ga0068852_100041393 3300005616 Bacteria 3893
160 Ga0068852_100062502 3300005616 Unclassified 3239
161 Ga0068852_100077188 3300005616 Bacteria 2944
162 Ga0068852_100148535 3300005616 Bacteria 2177
163 Ga0068852_100163502 3300005616 Bacteria 2080
164 Ga0068852_100338306 3300005616 Bacteria 1466
165 Ga0068852_100408024 3300005616 Unclassified 1338
166 Ga0068859_100000289 3300005617 Bacteria 49979
167 Ga0068859_100002592 3300005617 Bacteria 18396
168 Ga0068859_100020299 3300005617 Bacteria 6669
169 Ga0068859_100080329 3300005617 Viruses 3302
170 Ga0068859_100250444 3300005617 Bacteria 1862
171 Ga0068864_100002400 3300005618 Bacteria 15470
172 Ga0068864_100126611 3300005618 Bacteria 2290
173 Ga0068864_100127682 3300005618 Bacteria 2280
174 Ga0068864_100261792 3300005618 Unclassified 1609
175 Ga0068866_10018494 3300005718 Bacteria 3153
176 Ga0068866_10033356 3300005718 Unclassified 2497
177 Ga0068866_10054316 3300005718 Bacteria 2052
178 Ga0068861_100008556 3300005719 Bacteria 7042
179 Ga0068861_100298212 3300005719 Bacteria 1395
180 Ga0068851_10015042 3300005834 Unclassified 3682
181 Ga0068851_10020590 3300005834 Bacteria 3195
182 Ga0068863_100001935 3300005841 Bacteria 20565
183 Ga0068863_100047532 3300005841 Bacteria 4070
184 Ga0068863_100097977 3300005841 Bacteria 2785
185 Ga0068863_100188840 3300005841 Unclassified 1980
186 Ga0068863_100334638 3300005841 Unclassified 1472
187 Ga0068863_100693072 3300005841 Bacteria 1012
188 Ga0068863_100821084 3300005841 Bacteria 928
189 Ga0068858_100003089 3300005842 Bacteria 16660
190 Ga0068860_100000024 3300005843 Bacteria 271902
191 Ga0068860_100001796 3300005843 Bacteria 22849
192 Ga0068860_100002234 3300005843 Bacteria 20388
193 Ga0068860_100005149 3300005843 Bacteria 13296
194 Ga0068860_100007155 3300005843 Bacteria 11163
195 Ga0068860_100365509 3300005843 Bacteria 1422
196 Ga0081539_10000028 3300005985 Bacteria 328182
197 Ga0081539_10000042 3300005985 Bacteria 289955
198 Ga0070715_10000517 3300006163 Bacteria 10106
199 Ga0070712_100018220 3300006175 Bacteria 4558
200 Ga0097621_100000352 3300006237 Bacteria 31757
201 Ga0097621_100003204 3300006237 Bacteria 11241
202 Ga0097621_100008440 3300006237 Bacteria 7421
203 Ga0097621_100011128 3300006237 Bacteria 6619
204 Ga0097621_100127285 3300006237 Bacteria 2164
205 Ga0068871_100001720 3300006358 Bacteria 14724
206 Ga0068871_100003066 3300006358 Bacteria 11455
207 Ga0068871_100099900 3300006358 Bacteria 2430
208 Ga0068871_100123516 3300006358 Bacteria 2189
209 Ga0068871_100158155 3300006358 Bacteria 1936
210 Ga0068865_100000660 3300006881 Bacteria 19448
211 Ga0068865_100000735 3300006881 Bacteria 18419
212 Ga0068865_100065807 3300006881 Bacteria 2555
213 Ga0097620_100000289 3300006931 Bacteria 49979
214 Ga0097620_100002592 3300006931 Bacteria 18396
215 Ga0097620_100020301 3300006931 Bacteria 6669
216 Ga0097620_100080330 3300006931 Viruses 3302
217 Ga0097620_100250432 3300006931 Bacteria 1862
218 Ga0105251_10001069 3300009011 Bacteria 23983
219 Ga0105250_10000964 3300009092 Bacteria 16866
220 Ga0105240_10000445 3300009093 Bacteria 76036
221 Ga0105240_10000597 3300009093 Bacteria 67036
222 Ga0105240_10001169 3300009093 Bacteria 46003
223 Ga0105240_10002705 3300009093 Bacteria 28172
224 Ga0105240_10002820 3300009093 Bacteria 27478
225 Ga0105240_10003084 3300009093 Bacteria 26189
226 Ga0105240_10003826 3300009093 Bacteria 23268
227 Ga0105240_10014679 3300009093 Bacteria 10689
228 Ga0105240_10067580 3300009093 Unclassified 4430
229 Ga0105240_10122228 3300009093 Unclassified 3134
230 Ga0105240_10156390 3300009093 Bacteria 2711
231 Ga0105240_10184907 3300009093 Unclassified 2455
232 Ga0111539_10020311 3300009094 Bacteria 8182
233 Ga0111539_10089027 3300009094 Bacteria 3627
234 Ga0105245_10007920 3300009098 Bacteria 9291
235 Ga0105247_10000132 3300009101 Bacteria 72520
236 Ga0105247_10000331 3300009101 Bacteria 41671
237 Ga0105247_10031856 3300009101 Bacteria 3201
238 Ga0114129_10017487 3300009147 Bacteria 10210
239 Ga0105241_10000056 3300009174 Bacteria 84758
240 Ga0105241_10000180 3300009174 Bacteria 47089
241 Ga0105241_10058234 3300009174 Bacteria 2967
242 Ga0105242_10005705 3300009176 Bacteria 9604
243 Ga0105242_10035489 3300009176 Bacteria 3999
244 Ga0105242_10078617 3300009176 Bacteria 2754
245 Ga0105248_10005489 3300009177 Bacteria 13923
246 Ga0105248_10033299 3300009177 Bacteria 5756
247 Ga0105237_10000294 3300009545 Bacteria 69126
248 Ga0105237_10000379 3300009545 Bacteria 63367
249 Ga0105237_10002656 3300009545 Bacteria 21976
250 Ga0105237_10058587 3300009545 Unclassified 3855
251 Ga0105237_10065649 3300009545 Unclassified 3625
252 Ga0105237_10094123 3300009545 Bacteria 2985
253 Ga0105237_10507142 3300009545 Bacteria 1213
254 Ga0105238_10001087 3300009551 Bacteria 27427
255 Ga0105238_10008320 3300009551 Bacteria 10374
256 Ga0105238_10128706 3300009551 Bacteria 2510
257 Ga0105238_10137353 3300009551 Bacteria 2422
258 Ga0105238_10629918 3300009551 Bacteria 1082
259 Ga0105249_10001162 3300009553 Bacteria 23270
260 Ga0105249_10003119 3300009553 Bacteria 14328
261 Ga0105249_10006156 3300009553 Bacteria 10408
262 Ga0105249_10108945 3300009553 Bacteria 2615
263 Ga0105249_10377449 3300009553 Unclassified 1443
264 Ga0105239_10000360 3300010375 Bacteria 66494
265 Ga0105239_10000628 3300010375 Bacteria 50293
266 Ga0105239_10001099 3300010375 Bacteria 37369
267 Ga0105239_10003340 3300010375 Bacteria 19725
268 Ga0105239_10038285 3300010375 Bacteria 5255
269 Ga0105239_10148007 3300010375 Bacteria 2620
270 Ga0105239_10423671 3300010375 Bacteria 1508
271 Ga0105239_10453007 3300010375 Unclassified 1456
272 Ga0105246_10313818 3300011119 Bacteria 1271
273 Ga0105246_10413041 3300011119 Bacteria 1124
274 Ga0157373_10001202 3300013100 Bacteria 19803
275 Ga0157373_10019084 3300013100 Bacteria 4991
276 Ga0157373_10176833 3300013100 Bacteria 1502
277 Ga0157371_10001044 3300013102 Bacteria 30377
278 Ga0157371_10002756 3300013102 Bacteria 16506
279 Ga0157371_10002926 3300013102 Bacteria 15940
280 Ga0157371_10010251 3300013102 Bacteria 7316
281 Ga0157371_10012575 3300013102 Bacteria 6465
282 Ga0157371_10016452 3300013102 Bacteria 5519
283 Ga0157371_10050241 3300013102 Unclassified 2962
284 Ga0157371_10084464 3300013102 Bacteria 2249
285 Ga0157371_10111622 3300013102 Bacteria 1940
286 Ga0157371_10120663 3300013102 Unclassified 1864
287 Ga0157370_10000491 3300013104 Bacteria 49237
288 Ga0157370_10000628 3300013104 Bacteria 43950
289 Ga0157370_10000945 3300013104 Bacteria 36860
290 Ga0157370_10001472 3300013104 Bacteria 29117
291 Ga0157370_10004027 3300013104 Bacteria 17072
292 Ga0157370_10018502 3300013104 Bacteria 7003
293 Ga0157370_10019594 3300013104 Bacteria 6779
294 Ga0157370_10019993 3300013104 Bacteria 6698
295 Ga0157370_10180877 3300013104 Bacteria 1959
296 Ga0157370_10481807 3300013104 Bacteria 1140
297 Ga0157369_10020672 3300013105 Bacteria 7360
298 Ga0157369_10023058 3300013105 Bacteria 6938
299 Ga0157369_10036431 3300013105 Bacteria 5389
300 Ga0157369_10055952 3300013105 Unclassified 4257
301 Ga0157369_10231093 3300013105 Bacteria 1934
302 Ga0157369_10477830 3300013105 Bacteria 1290
303 Ga0157374_10000027 3300013296 Bacteria 233444
304 Ga0157374_10000505 3300013296 Bacteria 35194
305 Ga0157374_10009167 3300013296 Bacteria 8484
306 Ga0157374_10034438 3300013296 Bacteria 4626
307 Ga0157374_10035460 3300013296 Bacteria 4564
308 Ga0157374_10039284 3300013296 Bacteria 4355
309 Ga0157374_10078864 3300013296 Bacteria 3120
310 Ga0157374_10132396 3300013296 Bacteria 2414
311 Ga0157374_10238879 3300013296 Bacteria 1786
312 Ga0157378_10004107 3300013297 Bacteria 12854
313 Ga0157378_10004873 3300013297 Bacteria 11772
314 Ga0157378_10035396 3300013297 Unclassified 4416
315 Ga0157378_10044549 3300013297 Bacteria 3940
316 Ga0157378_10162212 3300013297 Unclassified 2091
317 Ga0157378_10428060 3300013297 Unclassified 1309
318 Ga0163162_10000096 3300013306 Bacteria 80090
319 Ga0163162_10000237 3300013306 Bacteria 50279
320 Ga0163162_10001535 3300013306 Bacteria 21544
321 Ga0163162_10017169 3300013306 Bacteria 7082
322 Ga0163162_10043590 3300013306 Bacteria 4493
323 Ga0157372_10001266 3300013307 Bacteria 27333
324 Ga0157372_10002206 3300013307 Bacteria 21137
325 Ga0157372_10033941 3300013307 Bacteria 5607
326 Ga0157372_10043891 3300013307 Bacteria 4953
327 Ga0157372_10082673 3300013307 Bacteria 3636
328 Ga0157372_10087427 3300013307 Bacteria 3537
329 Ga0157372_10088748 3300013307 Unclassified 3511
330 Ga0157372_10133414 3300013307 Bacteria 2859
331 Ga0157372_10141571 3300013307 Bacteria 2771
332 Ga0157372_10147052 3300013307 Bacteria 2717
333 Ga0157372_10161439 3300013307 Bacteria 2590
334 Ga0157372_10191614 3300013307 Bacteria 2368
335 Ga0157372_10289704 3300013307 Bacteria 1904
336 Ga0157372_10441519 3300013307 Bacteria 1517
337 Ga0157372_10485090 3300013307 Bacteria 1441
338 Ga0157372_10526304 3300013307 Bacteria 1378
339 Ga0157372_10602441 3300013307 Bacteria 1280
340 Ga0157372_10714010 3300013307 Bacteria 1166
341 Ga0157372_11051056 3300013307 Bacteria 943
342 Ga0157375_10000599 3300013308 Bacteria 31988
343 Ga0157375_10000622 3300013308 Bacteria 31461
344 Ga0157375_10009700 3300013308 Bacteria 8464
345 Ga0157375_10056438 3300013308 Bacteria 3877
346 Ga0157375_10229802 3300013308 Bacteria 2014
347 Ga0157375_10764967 3300013308 Bacteria 1116
348 Ga0163163_10000251 3300014325 Bacteria 54526
349 Ga0163163_10000703 3300014325 Bacteria 28430
350 Ga0163163_10001228 3300014325 Bacteria 21670
351 Ga0157380_10227853 3300014326 Bacteria 1671
352 Ga0157377_10029766 3300014745 Bacteria 2952
353 Ga0157377_10110211 3300014745 Bacteria 1653
354 Ga0157379_10000128 3300014968 Bacteria 53403
355 Ga0157376_10000334 3300014969 Bacteria 31383
356 Ga0157376_10000971 3300014969 Bacteria 18693
357 Ga0157376_10068087 3300014969 Unclassified 3013
358 Ga0157376_10078346 3300014969 Bacteria 2829
359 Ga0157376_10095468 3300014969 Bacteria 2586
360 Ga0157376_10107897 3300014969 Bacteria 2445
361 Ga0163161_10000052 3300017792 Bacteria 119943
362 Ga0163161_10011663 3300017792 Bacteria 6100
363 Ga0163161_10024797 3300017792 Bacteria 4239
364 Ga0163161_10032265 3300017792 Bacteria 3738
365 Ga0206356_11236474 3300020070 Unclassified 1030
366 Ga0213876_10008793 3300021384 Bacteria 5454
367 Ga0213876_10013593 3300021384 Bacteria 4319
368 Ga0209646_1001958 3300025246 Bacteria 4969
369 Ga0209676_1000485 3300025292 Bacteria 64653
370 Ga0207656_10010828 3300025321 Unclassified 3429
371 Ga0207696_1000014 3300025711 Bacteria 517939
372 Ga0207713_1000109 3300025735 Bacteria 137009
373 Ga0207642_10020063 3300025899 Unclassified 2602
374 Ga0207642_10140733 3300025899 Bacteria 1272
375 Ga0207710_10000007 3300025900 Bacteria 488292
376 Ga0207710_10002459 3300025900 Bacteria 8588
377 Ga0207710_10011647 3300025900 Bacteria 3701
378 Ga0207680_10000223 3300025903 Bacteria 27399
379 Ga0207680_10060636 3300025903 Bacteria 2303
380 Ga0207647_10000358 3300025904 Bacteria 37132
381 Ga0207647_10007138 3300025904 Bacteria 8101
382 Ga0207647_10025085 3300025904 Bacteria 3924
383 Ga0207647_10027722 3300025904 Bacteria 3689
384 Ga0207645_10004116 3300025907 Bacteria 10812
385 Ga0207645_10249609 3300025907 Bacteria 1174
386 Ga0207705_10001296 3300025909 Bacteria 20071
387 Ga0207705_10012281 3300025909 Bacteria 6188
388 Ga0207705_10022510 3300025909 Bacteria 4494
389 Ga0207705_10150612 3300025909 Bacteria 1743
390 Ga0207705_10179697 3300025909 Bacteria 1596
391 Ga0207705_10258906 3300025909 Bacteria 1328
392 Ga0207705_10274608 3300025909 Bacteria 1289
393 Ga0207705_10474639 3300025909 Bacteria 971
394 Ga0207654_10001342 3300025911 Bacteria 13053
395 Ga0207654_10087861 3300025911 Unclassified 1887
396 Ga0207654_10154904 3300025911 Bacteria 1475
397 Ga0207707_10000026 3300025912 Bacteria 175026
398 Ga0207707_10000067 3300025912 Bacteria 105764
399 Ga0207707_10000122 3300025912 Bacteria 80159
400 Ga0207707_10018125 3300025912 Bacteria 6135
401 Ga0207707_10021586 3300025912 Bacteria 5626
402 Ga0207707_10058051 3300025912 Bacteria 3368
403 Ga0207707_10063528 3300025912 Bacteria 3214
404 Ga0207707_10103424 3300025912 Bacteria 2490
405 Ga0207695_10000087 3300025913 Bacteria 276412
406 Ga0207695_10000299 3300025913 Bacteria 122118
407 Ga0207695_10000676 3300025913 Bacteria 67018
408 Ga0207695_10002728 3300025913 Bacteria 25766
409 Ga0207695_10003540 3300025913 Bacteria 21874
410 Ga0207695_10015560 3300025913 Bacteria 8949
411 Ga0207695_10024615 3300025913 Bacteria 6765
412 Ga0207695_10280694 3300025913 Bacteria 1559
413 Ga0207695_10306386 3300025913 Bacteria 1479
414 Ga0207671_10001222 3300025914 Bacteria 30430
415 Ga0207671_10019529 3300025914 Bacteria 5180
416 Ga0207671_10020298 3300025914 Bacteria 5061
417 Ga0207693_10000083 3300025915 Bacteria 84611
418 Ga0207660_10007760 3300025917 Bacteria 6948
419 Ga0207660_10034429 3300025917 Bacteria 3511
420 Ga0207660_10171526 3300025917 Bacteria 1679
421 Ga0207660_10311835 3300025917 Unclassified 1255
422 Ga0207657_10004009 3300025919 Bacteria 15652
423 Ga0207657_10011455 3300025919 Bacteria 8805
424 Ga0207657_10102212 3300025919 Bacteria 2377
425 Ga0207657_10274580 3300025919 Bacteria 1339
426 Ga0207657_10422044 3300025919 Bacteria 1048
427 Ga0207649_10436275 3300025920 Unclassified 986
428 Ga0207652_10000051 3300025921 Bacteria 120327
429 Ga0207652_10000109 3300025921 Bacteria 89337
430 Ga0207652_10000187 3300025921 Bacteria 65282
431 Ga0207652_10001479 3300025921 Bacteria 20778
432 Ga0207652_10036588 3300025921 Bacteria 4150
433 Ga0207652_10079076 3300025921 Bacteria 2872
434 Ga0207652_10094539 3300025921 Bacteria 2632
435 Ga0207652_10230880 3300025921 Unclassified 1668
436 Ga0207652_10285313 3300025921 Bacteria 1489
437 Ga0207652_10299558 3300025921 Bacteria 1451
438 Ga0207681_10034644 3300025923 Bacteria 3321
439 Ga0207694_10003403 3300025924 Bacteria 12669
440 Ga0207694_10035018 3300025924 Bacteria 3850
441 Ga0207694_10420847 3300025924 Bacteria 1113
442 Ga0207650_10001053 3300025925 Bacteria 20514
443 Ga0207650_10025654 3300025925 Unclassified 4199
444 Ga0207650_10049949 3300025925 Unclassified 3091
445 Ga0207650_10156597 3300025925 Bacteria 1802
446 Ga0207650_10227617 3300025925 Bacteria 1503
447 Ga0207659_10048990 3300025926 Bacteria 2995
448 Ga0207659_10087143 3300025926 Bacteria 2323
449 Ga0207644_10065750 3300025931 Unclassified 2638
450 Ga0207690_10036796 3300025932 Bacteria 3172
451 Ga0207690_10173416 3300025932 Bacteria 1617
452 Ga0207690_10231126 3300025932 Bacteria 1420
453 Ga0207706_10014587 3300025933 Bacteria 7117
454 Ga0207686_10015135 3300025934 Bacteria 4308
455 Ga0207686_10032950 3300025934 Bacteria 3088
456 Ga0207669_10329338 3300025937 Unclassified 1172
457 Ga0207704_10001257 3300025938 Bacteria 11322
458 Ga0207704_10366048 3300025938 Bacteria 1127
459 Ga0207704_10428002 3300025938 Bacteria 1051
460 Ga0207691_10000057 3300025940 Bacteria 89823
461 Ga0207691_10109087 3300025940 Bacteria 2463
462 Ga0207691_10364236 3300025940 Bacteria 1236
463 Ga0207711_10204004 3300025941 Unclassified 1805
464 Ga0207689_10027705 3300025942 Bacteria 4742
465 Ga0207689_10319633 3300025942 Bacteria 1288
466 Ga0207689_10352703 3300025942 Bacteria 1223
467 Ga0207689_10424022 3300025942 Unclassified 1110
468 Ga0207661_10034174 3300025944 Unclassified 3952
469 Ga0207661_10076137 3300025944 Unclassified 2755
470 Ga0207661_10324434 3300025944 Bacteria 1385
471 Ga0207679_10027706 3300025945 Unclassified 3922
472 Ga0207679_10242784 3300025945 Bacteria 1527
473 Ga0207667_10000172 3300025949 Bacteria 95455
474 Ga0207667_10000492 3300025949 Bacteria 52207
475 Ga0207667_10000798 3300025949 Bacteria 40876
476 Ga0207667_10001462 3300025949 Bacteria 29619
477 Ga0207667_10001836 3300025949 Bacteria 26673
478 Ga0207667_10005296 3300025949 Bacteria 15731
479 Ga0207667_10010124 3300025949 Bacteria 11044
480 Ga0207667_10019110 3300025949 Bacteria 7661
481 Ga0207667_10024664 3300025949 Bacteria 6597
482 Ga0207667_10127082 3300025949 Bacteria 2626
483 Ga0207667_10174790 3300025949 Unclassified 2207
484 Ga0207651_10000330 3300025960 Bacteria 20100
485 Ga0207651_10089576 3300025960 Bacteria 2247
486 Ga0207712_10188008 3300025961 Bacteria 1628
487 Ga0207712_10336024 3300025961 Bacteria 1251
488 Ga0207668_10000736 3300025972 Bacteria 20067
489 Ga0207658_10002480 3300025986 Bacteria 13457
490 Ga0207658_10004083 3300025986 Bacteria 10178
491 Ga0207658_10021367 3300025986 Bacteria 4492
492 Ga0207658_10162652 3300025986 Bacteria 1831
493 Ga0207677_10002398 3300026023 Bacteria 9824
494 Ga0207677_10035468 3300026023 Unclassified 3240
495 Ga0207677_10036508 3300026023 Bacteria 3204
496 Ga0207703_10001287 3300026035 Bacteria 23239
497 Ga0207639_10001406 3300026041 Bacteria 16243
498 Ga0207639_10006152 3300026041 Bacteria 8149
499 Ga0207639_10006581 3300026041 Bacteria 7902
500 Ga0207639_10030877 3300026041 Bacteria 3933
501 Ga0207639_10055842 3300026041 Bacteria 3024
502 Ga0207639_10344304 3300026041 Bacteria 1330
503 Ga0207678_10224817 3300026067 Bacteria 1607
504 Ga0207702_10015635 3300026078 Bacteria 6282
505 Ga0207702_10018654 3300026078 Bacteria 5739
506 Ga0207702_10038203 3300026078 Bacteria 4021
507 Ga0207702_10090174 3300026078 Bacteria 2682
508 Ga0207702_10119116 3300026078 Bacteria 2360
509 Ga0207702_10159541 3300026078 Bacteria 2059
510 Ga0207702_10166913 3300026078 Bacteria 2015
511 Ga0207702_10173228 3300026078 Bacteria 1981
512 Ga0207641_10005451 3300026088 Bacteria 10856
513 Ga0207641_10071587 3300026088 Bacteria 2983
514 Ga0207641_10100844 3300026088 Bacteria 2543
515 Ga0207648_10003815 3300026089 Bacteria 15758
516 Ga0207648_10004995 3300026089 Bacteria 13479
517 Ga0207648_10044309 3300026089 Bacteria 3903
518 Ga0207648_10068027 3300026089 Unclassified 3104
519 Ga0207676_10002484 3300026095 Bacteria 13139
520 Ga0207676_10362322 3300026095 Unclassified 1344
521 Ga0207676_10581795 3300026095 Unclassified 1073
522 Ga0207674_10007313 3300026116 Bacteria 12866
523 Ga0207674_10063048 3300026116 Bacteria 3742
524 Ga0207674_10092279 3300026116 Bacteria 3018
525 Ga0207674_10101246 3300026116 Bacteria 2862
526 Ga0207674_10372073 3300026116 Bacteria 1381
527 Ga0207674_10582874 3300026116 Bacteria 1080
528 Ga0207675_100074714 3300026118 Bacteria 3172
529 Ga0207675_100171854 3300026118 Bacteria 2072
530 Ga0207675_100286387 3300026118 Unclassified 1602
531 Ga0207683_10004897 3300026121 Bacteria 11526
532 Ga0207683_10038510 3300026121 Bacteria 4168
533 Ga0207683_10143289 3300026121 Unclassified 2154
534 Ga0207683_10435664 3300026121 Unclassified 1208
535 Ga0207698_10025447 3300026142 Bacteria 4170
536 Ga0207698_10033077 3300026142 Bacteria 3754
537 Ga0207698_10035280 3300026142 Bacteria 3657
538 Ga0207698_10047364 3300026142 Unclassified 3256
539 Ga0207698_10100045 3300026142 Bacteria 2400
540 Ga0207698_10157758 3300026142 Bacteria 1980
541 Ga0207698_10199081 3300026142 Bacteria 1792
542 Ga0207698_10403180 3300026142 Bacteria 1307
543 Ga0209371_1000822 3300027312 Bacteria 25564
544 Ga0268266_10000048 3300028379 Bacteria 310336
545 Ga0268266_10005746 3300028379 Bacteria 11482
546 Ga0268265_10405181 3300028380 Bacteria 1262
547 Ga0268265_10407220 3300028380 Unclassified 1259
548 Ga0268264_10000028 3300028381 Bacteria 426662
549 Ga0268264_10002163 3300028381 Bacteria 17523
550 Ga0268264_10002184 3300028381 Bacteria 17393
551 Ga0268264_10004004 3300028381 Bacteria 12611
552 Ga0268264_10086592 3300028381 Bacteria 2692
553 Ga0268264_10300515 3300028381 Bacteria 1511
554 Ga0307517_10016737 3300028786 Bacteria 9612
555 Ga0307517_10115738 3300028786 Bacteria 2011
556 Ga0307515_10000001 3300028794 Bacteria 4259510
557 Ga0307515_10000778 3300028794 Bacteria 73451
558 Ga0307515_10003029 3300028794 Bacteria 35637
559 Ga0307511_10000002 3300030521 Bacteria 199923
560 Ga0316177_1157475 3300030731 Bacteria 8234
561 Ga0316182_1062439 3300030745 Bacteria 3006
562 Ga0265340_10099240 3300031247 Bacteria 1355
563 Ga0265327_10000024 3300031251 Bacteria 382499
564 Ga0265327_10017415 3300031251 Bacteria 4509
565 Ga0265327_10138812 3300031251 Bacteria 1137
566 Ga0265316_10156761 3300031344 Bacteria 1704
567 Ga0307513_10239473 3300031456 Unclassified 1620
568 Ga0307509_10182649 3300031507 Bacteria 1960
569 Ga0265313_10092889 3300031595 Bacteria 1351
570 Ga0307516_10000486 3300031730 Bacteria 52749
571 Ga0307516_10091542 3300031730 Bacteria 2869
572 Ga0307405_10028543 3300031731 Bacteria 3251
573 Ga0307410_10125608 3300031852 Bacteria 1878
574 Ga0307410_10159570 3300031852 Unclassified 1688
575 Ga0307407_10288883 3300031903 Unclassified 1139
576 Ga0307412_10055289 3300031911 Bacteria 2639
577 Ga0307412_10083586 3300031911 Bacteria 2214
578 Ga0307412_10467066 3300031911 Bacteria 1043
579 Ga0307414_10064093 3300032004 Bacteria 2615
580 Ga0307414_10327145 3300032004 Bacteria 1307
581 Ga0307414_10563184 3300032004 Bacteria 1017
582 Ga0307510_10002428 3300033180 Bacteria 21155
583 Ga0373943_0136797 3300035170 Bacteria 1316
584 Ga0373927_0006326 3300035695 Bacteria 8071
585 Ga0373947_0089723 3300035725 Bacteria 1915
586 Ga0373937_0284102 3300036401 Bacteria 1563
587 Ga0316584_0006323 3300036712 Bacteria 8021
588 Ga0373925_0669475 3300037068 Bacteria 855
589 Ga0395899_0006244 3300037312 Bacteria 9230
590 Ga0395900_0011131 3300037418 Bacteria 9194
591 Ga0395900_0091423 3300037418 Unclassified 3127
592 Ga0395900_0309388 3300037418 Bacteria 1563
593 Ga0395900_0693573 3300037418 Unclassified 952
594 Ga0395898_0001425 3300037466 Bacteria 34011
595 Ga0395898_0014579 3300037466 Bacteria 8070
596 Ga0395898_0584194 3300037466 Bacteria 1059
597 Ga0395898_0885958 3300037466 Unclassified 831
598 Ga0395905_0002632 3300037471 Bacteria 19709
599 Ga0395905_0055864 3300037471 Bacteria 3695
600 Ga0395905_0147405 3300037471 Bacteria 2214
601 Ga0395905_0151976 3300037471 Bacteria 2178
602 Ga0395901_0013086 3300038443 Bacteria 8420
603 Ga0395901_0015165 3300038443 Bacteria 7837
604 Ga0395901_0022855 3300038443 Bacteria 6411
605 Ga0395901_0226549 3300038443 Unclassified 1952
606 Ga0395901_0270417 3300038443 Unclassified 1768
607 Ga0400484_14764 3300038725 Bacteria 7948
608 Ga0400490_41645 3300038726 Bacteria 2224
609 Ga0400488_01959 3300038741 Bacteria 14805
610 Ga0400488_49253 3300038741 Unclassified 2427
611 Ga0400483_083912 3300039062 Bacteria 11462
612 Ga0400489_76974 3300039093 Bacteria 25095
613 Ga0436365_1821680 3300039437 Bacteria 4564
614 Ga0436365_1875604 3300039437 Bacteria 17186
615 Ga0439465_0016138 3300041413 Bacteria 2329
616 Ga0451807_0732940 3300041486 Bacteria 1538
617 Ga0451843_0079405 3300041509 Bacteria 2070
618 Ga0439431_0037381 3300041997 Unclassified 1225
619 Ga0439442_008518 3300042002 Unclassified 2070
620 Ga0439445_0008720 3300042004 Unclassified 2378
621 Ga0439449_0035992 3300042007 Unclassified 1841
622 Ga0439449_0099587 3300042007 Bacteria 1074
623 Ga0439457_014457 3300042014 Unclassified 1766
624 Ga0439434_0076203 3300042435 Unclassified 1060
625 Ga0451577_0165277 3300042876 Bacteria 1993
626 Ga0451577_0456291 3300042876 Bacteria 1161
627 Ga0466969_0021061 3300044656 Bacteria 3373
628 Ga0466972_0000001 3300044658 Bacteria 412457
629 Ga0466972_0000044 3300044658 Bacteria 131031
630 Ga0466972_0009913 3300044658 Bacteria 4781
631 Ga0453683_0203415 3300044673 Bacteria 1257
632 Ga0453683_0292019 3300044673 Unclassified 1042
633 Ga0466966_0026346 3300044684 Bacteria 3796
634 Ga0466966_0035229 3300044684 Bacteria 3235
635 Ga0466961_0016877 3300044693 Bacteria 4691
636 Ga0466961_0048369 3300044693 Bacteria 2718
637 Ga0466961_0227683 3300044693 Bacteria 1148
638 Ga0466963_0041077 3300044694 Bacteria 3032
639 Ga0466964_0000208 3300044706 Bacteria 16611
640 Ga0466964_0008038 3300044706 Bacteria 3954
641 Ga0466964_0086505 3300044706 Unclassified 1356
642 Ga0453684_0000311 3300044712 Bacteria 206847
643 Ga0453684_0004045 3300044712 Bacteria 31879
644 Ga0453684_0005017 3300044712 Bacteria 26881
645 Ga0453684_0029545 3300044712 Bacteria 7778
646 Ga0453684_0683921 3300044712 Bacteria 1116
647 Ga0453684_0812534 3300044712 Bacteria 1007
648 Ga0466971_0002696 3300044719 Bacteria 7502
649 Ga0466971_0035320 3300044719 Bacteria 2240
650 Ga0466968_0024864 3300044735 Bacteria 2450
651 Ga0466968_0056525 3300044735 Unclassified 1686
652 Ga0466970_0000486 3300044765 Bacteria 19528
653 Ga0466970_0257209 3300044765 Bacteria 979
654 Ga0466957_0059357 3300044842 Bacteria 2345
655 Ga0466960_0076280 3300044901 Bacteria 1679
656 Ga0466960_0197565 3300044901 Unclassified 1097
657 Ga0466959_0000904 3300045049 Bacteria 17527
658 Ga0466959_0008505 3300045049 Bacteria 7263
659 Ga0466959_0064253 3300045049 Bacteria 2665
660 Ga0466959_0149935 3300045049 Bacteria 1644
661 Ga0451576_0000002 3300045051 Bacteria 1670975
662 Ga0451576_0033300 3300045051 Bacteria 5478
663 Ga0451576_0658158 3300045051 Bacteria 1101
664 Ga0466967_0004457 3300045976 Bacteria 9448
665 Ga0495629_0494799 3300046459 Bacteria 825
666 Ga0495638_0062409 3300046460 Bacteria 2300
667 Ga0495582_0111349 3300046473 Bacteria 1538
668 Ga0495606_0124843 3300046507 Bacteria 1536
669 Ga0495630_0186089 3300046517 Bacteria 1584
670 Ga0495643_0010737 3300046522 Bacteria 5625
671 Ga0495648_0002190 3300046524 Bacteria 18309
672 Ga0495586_0102124 3300046535 Unclassified 1592
673 Ga0495586_0124937 3300046535 Bacteria 1439
674 Ga0495668_0000187 3300046616 Bacteria 92571
675 Ga0495611_0000065 3300046648 Bacteria 74332
676 Ga0495624_0101766 3300046690 Bacteria 1769
677 Ga0495649_0136271 3300046694 Bacteria 1294
678 Ga0495581_0097363 3300047315 Bacteria 1709
679 Ga0495674_0118810 3300047319 Bacteria 2235
680 Ga0495687_000129 3300047443 Bacteria 116030
681 Ga0495684_0178751 3300047471 Bacteria 1574
682 Ga0495686_0110735 3300047472 Bacteria 1647
683 Ga0496100_0035556 3300048903 Bacteria 3134
684 Ga0496100_0073676 3300048903 Bacteria 2286
685 Ga0496101_0016241 3300048904 Bacteria 5024
686 Ga0496102_0006064 3300048905 Bacteria 10305
687 Ga0496103_0025983 3300048906 Bacteria 3543
688 Ga0496103_0029252 3300048906 Bacteria 3348
689 Ga0496104_0253321 3300048907 Bacteria 1673
690 Ga0496104_0461326 3300048907 Unclassified 1182
691 Ga0496107_0001015 3300048910 Bacteria 16758
692 Ga0496108_0005792 3300048911 Bacteria 10014
693 Ga0496109_0032631 3300048912 Bacteria 4682
694 Ga0496109_0064498 3300048912 Bacteria 3352
695 Ga0496110_0000749 3300048913 Bacteria 22420
696 Ga0496112_0011995 3300048915 Bacteria 7946
697 Ga0496113_0079186 3300048916 Bacteria 2515
698 Ga0496114_0004273 3300048917 Bacteria 11058
699 Ga0496114_0154237 3300048917 Bacteria 1993
700 Ga0496115_0001691 3300048918 Bacteria 15816
701 Ga0496115_0206207 3300048918 Bacteria 1624
702 Ga0496116_0000009 3300048919 Bacteria 716119
703 Ga0496117_0001526 3300048920 Bacteria 33056
704 Ga0496118_0002425 3300048921 Bacteria 25126
705 Ga0496118_0016140 3300048921 Bacteria 6868
706 Ga0496119_0012983 3300048922 Bacteria 6693
707 Ga0496120_0100561 3300048923 Bacteria 1529
708 Ga0496124_0059093 3300048927 Bacteria 3222
709 Ga0501031_0012718 3300049568 Bacteria 5497
710 Ga0501032_0000800 3300049569 Bacteria 25544
711 Ga0501032_0001218 3300049569 Bacteria 20593
712 Ga0501032_0001241 3300049569 Bacteria 20473
713 Ga0501033_0000199 3300049570 Bacteria 57341
714 Ga0501033_0147395 3300049570 Bacteria 1699
715 Ga0501034_0000004 3300049571 Bacteria 382255
716 Ga0501034_0000506 3300049571 Bacteria 62858
717 Ga0501034_0012011 3300049571 Bacteria 8950
718 Ga0501034_0093334 3300049571 Bacteria 3006
719 Ga0501034_0094225 3300049571 Bacteria 2991
720 Ga0501034_0307672 3300049571 Bacteria 1520
721 Ga0501034_0357151 3300049571 Bacteria 1389
722 Ga0501036_0096330 3300049572 Bacteria 2501
723 Ga0501036_0612702 3300049572 Bacteria 902
724 Ga0501037_0018322 3300049573 Bacteria 5159
725 Ga0501037_0077497 3300049573 Bacteria 2412
726 Ga0501037_0085574 3300049573 Unclassified 2283
727 Ga0501038_0011233 3300049574 Bacteria 8175
728 Ga0501038_0131985 3300049574 Bacteria 2050
729 Ga0501038_0160766 3300049574 Bacteria 1825
730 Ga0501039_0001671 3300049575 Bacteria 16340
731 Ga0501039_0006315 3300049575 Bacteria 8998
732 Ga0501039_0018039 3300049575 Bacteria 5414
733 Ga0501039_0428723 3300049575 Unclassified 1039
734 Ga0501043_0005572 3300049579 Bacteria 10146
735 Ga0501043_0026745 3300049579 Bacteria 4526
736 Ga0501043_0173560 3300049579 Bacteria 1681
737 Ga0501046_0064362 3300049580 Bacteria 2862
738 Ga0501047_0063396 3300049581 Bacteria 3566
739 Ga0501047_0136410 3300049581 Bacteria 2334
740 Ga0501047_0314816 3300049581 Bacteria 1405
741 Ga0501048_0006736 3300049582 Bacteria 8728
742 Ga0501067_0012669 3300049583 Bacteria 4677
743 Ga0501069_0018408 3300049585 Unclassified 3769
744 Ga0501069_0135406 3300049585 Bacteria 1412
745 Ga0501070_0160549 3300049586 Bacteria 1853
746 Ga0501071_0076790 3300049587 Bacteria 2440
747 Ga0501072_0093041 3300049588 Bacteria 2395
748 Ga0501072_0196146 3300049588 Bacteria 1610
749 Ga0501073_0010622 3300049589 Bacteria 6737
750 Ga0501073_0021790 3300049589 Bacteria 4616
751 Ga0501074_0000935 3300049590 Bacteria 18795
752 Ga0501074_0039165 3300049590 Bacteria 3433
753 Ga0501202_004421 3300049652 Bacteria 2460
754 Ga0501217_019316 3300049661 Bacteria 1590
755 Ga0501223_016511 3300049663 Bacteria 1459
756 Ga0501227_012930 3300049665 Bacteria 1834
757 Ga0501235_037638 3300049669 Unclassified 1101
758 Ga0501242_000505 3300049674 Bacteria 3452
759 Ga0501219_000019 3300049703 Bacteria 25267
760 Ga0501225_0001000 3300049705 Bacteria 8866
761 Ga0501225_0053277 3300049705 Bacteria 1129
762 Ga0501080_0075039 3300049742 Bacteria 3145
763 Ga0501080_0100361 3300049742 Bacteria 2685
764 Ga0501080_0168781 3300049742 Bacteria 2019
765 Ga0501080_0487070 3300049742 Bacteria 1103
766 Ga0501083_0030933 3300049744 Bacteria 3674
767 Ga0501266_001843 3300049763 Bacteria 2674
768 Ga0501035_0001716 3300049822 Bacteria 22138
769 Ga0501035_0043045 3300049822 Bacteria 4071
770 Ga0501035_0043246 3300049822 Bacteria 4060
771 Ga0501035_0338162 3300049822 Unclassified 1262
772 Ga0501044_0009431 3300049823 Bacteria 10631
773 Ga0501044_0018177 3300049823 Bacteria 7540
774 Ga0501044_0018364 3300049823 Bacteria 7494
775 Ga0501044_0032501 3300049823 Bacteria 5486
776 Ga0501045_0000122 3300049824 Bacteria 40414
777 Ga0501045_0039408 3300049824 Bacteria 3438
778 Ga0501284_00007 3300050005 Bacteria 147956
779 nmdc:mga05p37_2990_c1 3300050507 Bacteria 19630
780 nmdc:mga08y16_15141_c1 3300050511 Bacteria 8107
781 Ga0500578_0000026 3300053086 Bacteria 145328
782 Ga0500644_0011243 3300053088 Unclassified 2443
783 Ga0500647_0097511 3300053091 Bacteria 1405
784 Ga0500583_0052500 3300053092 Bacteria 1897
785 Ga0500651_0147083 3300053093 Bacteria 1417
786 Ga0500562_000053 3300053108 Bacteria 58984
787 Ga0500642_0062036 3300053130 Bacteria 1681
788 Ga0500642_0064529 3300053130 Bacteria 1653
789 Ga0500568_0000298 3300053139 Bacteria 40260
790 Ga0500568_0009829 3300053139 Bacteria 4520
791 Ga0500588_0090237 3300053146 Bacteria 1040
792 Ga0500604_0019153 3300053151 Unclassified 1914
793 Ga0500616_0000910 3300053153 Bacteria 32358
794 Ga0500616_0140391 3300053153 Unclassified 1130
795 Ga0500622_0001947 3300053156 Bacteria 15544
796 Ga0500622_0006108 3300053156 Bacteria 7070
797 Ga0500637_0096854 3300053178 Bacteria 1710
798 Ga0500637_0101999 3300053178 Bacteria 1664
799 Ga0501084_0036272 3300054114 Bacteria 4119
800 Ga0587077_006542 3300059493 Bacteria 1655
801 Ga0501082_0069209 3300060353 Bacteria 3038
802 Ga0501082_0244375 3300060353 Bacteria 1562
803 Ga0466962_0024213 3300061719 Bacteria 2917
804 Ga0466962_0276228 3300061719 Bacteria 829

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044719 Ga0466971_0035320 Ga0466971_0035320_1581_2225 210
2 3300044712 Ga0453684_0812534 Ga0453684_0812534_52_696 211
3 3300049824 Ga0501045_0039408 Ga0501045_0039408_18_665 211
4 3300061719 Ga0466962_0276228 Ga0466962_0276228_114_806 222
5 3300037466 Ga0395898_0885958 Ga0395898_0885958_95_796 233
6 3300005295 Ga0065707_10114619 Ga0065707_101146192 235
7 3300005339 Ga0070660_100196454 Ga0070660_1001964542 237
8 3300013306 Ga0163162_10017169 Ga0163162_100171692 237
9 3300013308 Ga0157375_10009700 Ga0157375_100097002 237
10 3300025904 Ga0207647_10007138 Ga0207647_100071384 237
11 3300025909 Ga0207705_10150612 Ga0207705_101506121 237
12 3300025919 Ga0207657_10274580 Ga0207657_102745801 237
13 3300005339 Ga0070660_100077428 Ga0070660_1000774282 238
14 3300005563 Ga0068855_100079337 Ga0068855_1000793372 238
15 3300013102 Ga0157371_10120663 Ga0157371_101206632 238
16 3300025949 Ga0207667_10024664 Ga0207667_100246644 238
17 3300049572 Ga0501036_0612702 Ga0501036_0612702_19_747 238
18 3300017792 Ga0163161_10024797 Ga0163161_100247974 239
19 3300025961 Ga0207712_10336024 Ga0207712_103360242 239
20 3300042007 Ga0439449_0099587 Ga0439449_0099587_255_1064 240
21 3300006237 Ga0097621_100008440 Ga0097621_1000084403 241
22 3300013307 Ga0157372_10141571 Ga0157372_101415714 241
23 3300025925 Ga0207650_10001053 Ga0207650_100010537 241
24 3300049661 Ga0501217_019316 Ga0501217_019316_555_1280 241
25 3300049669 Ga0501235_037638 Ga0501235_037638_264_989 241
26 3300049674 Ga0501242_000505 Ga0501242_000505_1199_1924 241
27 3300049705 Ga0501225_0053277 Ga0501225_0053277_247_972 241
28 3300049763 Ga0501266_001843 Ga0501266_001843_1531_2256 241
29 3300013307 Ga0157372_10001266 Ga0157372_1000126621 242
30 3300025913 Ga0207695_10280694 Ga0207695_102806942 242
31 3300025914 Ga0207671_10020298 Ga0207671_100202982 242
32 3300005577 Ga0068857_100189049 Ga0068857_1001890492 244
33 3300009545 Ga0105237_10507142 Ga0105237_105071421 244
34 3300010375 Ga0105239_10423671 Ga0105239_104236712 244
35 3300059493 Ga0587077_006542 Ga0587077_006542_511_1302 244
36 3300009093 Ga0105240_10067580 Ga0105240_100675802 245
37 3300010375 Ga0105239_10000628 Ga0105239_1000062828 245
38 3300005563 Ga0068855_100000582 Ga0068855_1000005822 246
39 3300005616 Ga0068852_100163502 Ga0068852_1001635022 246
40 3300009093 Ga0105240_10014679 Ga0105240_100146799 246
41 3300009545 Ga0105237_10000379 Ga0105237_100003793 246
42 3300009551 Ga0105238_10137353 Ga0105238_101373532 246
43 3300010375 Ga0105239_10003340 Ga0105239_1000334011 246
44 3300025914 Ga0207671_10019529 Ga0207671_100195293 246
45 3300025949 Ga0207667_10005296 Ga0207667_1000529612 246
46 3300026078 Ga0207702_10173228 Ga0207702_101732281 246
47 3300026142 Ga0207698_10035280 Ga0207698_100352803 246
48 3300044684 Ga0466966_0026346 Ga0466966_0026346_1496_2260 246
49 3300044706 Ga0466964_0000208 Ga0466964_0000208_2500_3279 246
50 3300044719 Ga0466971_0002696 Ga0466971_0002696_2263_3042 246
51 3300005262 Ga0065165_1000601 Ga0065165_100060126 247
52 3300005435 Ga0070714_100247622 Ga0070714_1002476222 247
53 3300021384 Ga0213876_10013593 Ga0213876_100135934 247
54 3300025292 Ga0209676_1000485 Ga0209676_100048529 247
55 3300025904 Ga0207647_10025085 Ga0207647_100250852 247
56 3300039437 Ga0436365_1821680 Ga0436365_1821680_1665_2444 247
57 3300044684 Ga0466966_0035229 Ga0466966_0035229_1284_2069 247
58 3300044694 Ga0466963_0041077 Ga0466963_0041077_2169_2927 247
59 3300044765 Ga0466970_0257209 Ga0466970_0257209_77_841 247
60 3300045049 Ga0466959_0064253 Ga0466959_0064253_241_1005 247
61 3300045049 Ga0466959_0149935 Ga0466959_0149935_374_1159 247
62 3300045976 Ga0466967_0004457 Ga0466967_0004457_727_1485 247
63 3300046535 Ga0495586_0102124 Ga0495586_0102124_244_1023 247
64 3300049581 Ga0501047_0063396 Ga0501047_0063396_1929_2687 247
65 3300005340 Ga0070689_100302398 Ga0070689_1003023981 248
66 3300005458 Ga0070681_10179824 Ga0070681_101798241 248
67 3300005617 Ga0068859_100080329 Ga0068859_1000803294 248
68 3300006931 Ga0097620_100080330 Ga0097620_1000803304 248
69 3300025921 Ga0207652_10299558 Ga0207652_102995582 248
70 3300044693 Ga0466961_0016877 Ga0466961_0016877_2472_3242 248
71 3300047471 Ga0495684_0178751 Ga0495684_0178751_395_1183 248
72 3300005544 Ga0070686_100005249 Ga0070686_1000052492 249
73 3300037471 Ga0395905_0147405 Ga0395905_0147405_821_1594 249
74 3300009092 Ga0105250_10000964 Ga0105250_100009643 250
75 3300005366 Ga0070659_100169738 Ga0070659_1001697381 251
76 3300005539 Ga0068853_100317422 Ga0068853_1003174222 251
77 3300013100 Ga0157373_10176833 Ga0157373_101768332 251
78 3300014969 Ga0157376_10095468 Ga0157376_100954682 251
79 3300031852 Ga0307410_10125608 Ga0307410_101256081 251
80 3300053130 Ga0500642_0062036 Ga0500642_0062036_513_1391 251
81 3300025917 Ga0207660_10171526 Ga0207660_101715261 252
82 3300025921 Ga0207652_10079076 Ga0207652_100790762 252
83 3300005563 Ga0068855_100211440 Ga0068855_1002114402 253
84 3300005577 Ga0068857_100111310 Ga0068857_1001113102 253
85 3300005616 Ga0068852_100002956 Ga0068852_1000029562 253
86 3300009093 Ga0105240_10156390 Ga0105240_101563904 253
87 3300013104 Ga0157370_10004027 Ga0157370_100040272 253
88 3300013307 Ga0157372_10002206 Ga0157372_1000220622 253
89 3300025909 Ga0207705_10274608 Ga0207705_102746081 253
90 3300026041 Ga0207639_10344304 Ga0207639_103443042 253
91 3300026116 Ga0207674_10007313 Ga0207674_1000731313 253
92 3300026116 Ga0207674_10063048 Ga0207674_100630483 253
93 3300026142 Ga0207698_10033077 Ga0207698_100330774 253
94 iso_pu_bacteria 2522125168 2522549124 253
95 3300031731 Ga0307405_10028543 Ga0307405_100285434 254
96 3300031911 Ga0307412_10055289 Ga0307412_100552891 254
97 3300032004 Ga0307414_10563184 Ga0307414_105631841 254
98 3300005327 Ga0070658_10165345 Ga0070658_101653451 255
99 3300013102 Ga0157371_10010251 Ga0157371_100102519 255
100 3300025246 Ga0209646_1001958 Ga0209646_10019586 255
101 3300044712 Ga0453684_0000311 Ga0453684_0000311_57755_58528 255
102 iso_pu_bacteria 2506520007 2506580375 255
103 iso_pu_bacteria 2506520008 2506585514 255
104 iso_pu_bacteria 2599185210 2599603974 255
105 iso_pu_bacteria 2654587920 2656277290 255
106 iso_pu_bacteria 2687453601 2689446929 255
107 iso_pu_bacteria 2841859092 2841859558 255
108 iso_pu_bacteria 2842515876 2842516343 255
109 iso_pu_bacteria 2914759650 2914763140 255
110 iso_pu_bacteria 2933011516 2933013015 255
111 3300005843 Ga0068860_100365509 Ga0068860_1003655092 256
112 3300013104 Ga0157370_10180877 Ga0157370_101808772 256
113 3300028381 Ga0268264_10300515 Ga0268264_103005152 256
114 3300036712 Ga0316584_0006323 Ga0316584_0006323_4941_5723 256
115 3300049569 Ga0501032_0001218 Ga0501032_0001218_8086_8859 256
116 3300049665 Ga0501227_012930 Ga0501227_012930_186_980 256
117 3300005335 Ga0070666_10096799 Ga0070666_100967993 257
118 3300005616 Ga0068852_100062502 Ga0068852_1000625023 257
119 3300013297 Ga0157378_10162212 Ga0157378_101622122 257
120 3300026023 Ga0207677_10035468 Ga0207677_100354681 257
121 3300026142 Ga0207698_10047364 Ga0207698_100473643 257
122 3300044712 Ga0453684_0005017 Ga0453684_0005017_16119_16898 257
123 3300049568 Ga0501031_0012718 Ga0501031_0012718_2740_3513 257
124 3300049569 Ga0501032_0001241 Ga0501032_0001241_10401_11174 257
125 3300049570 Ga0501033_0000199 Ga0501033_0000199_6572_7345 257
126 3300049571 Ga0501034_0000506 Ga0501034_0000506_56608_57381 257
127 3300049572 Ga0501036_0096330 Ga0501036_0096330_1664_2437 257
128 3300049573 Ga0501037_0018322 Ga0501037_0018322_1249_2022 257
129 3300049574 Ga0501038_0160766 Ga0501038_0160766_988_1761 257
130 3300049575 Ga0501039_0001671 Ga0501039_0001671_5614_6387 257
131 3300049579 Ga0501043_0005572 Ga0501043_0005572_224_997 257
132 3300049822 Ga0501035_0001716 Ga0501035_0001716_9169_9942 257
133 3300049823 Ga0501044_0009431 Ga0501044_0009431_3297_4070 257
134 3300049824 Ga0501045_0000122 Ga0501045_0000122_8718_9491 257
135 3300003320 rootH2_10254154 rootH2_102541542 258
136 3300005578 Ga0068854_100269523 Ga0068854_1002695232 258
137 3300005616 Ga0068852_100338306 Ga0068852_1003383062 258
138 3300013105 Ga0157369_10231093 Ga0157369_102310932 258
139 3300013296 Ga0157374_10039284 Ga0157374_100392842 258
140 3300013306 Ga0163162_10043590 Ga0163162_100435903 258
141 3300026142 Ga0207698_10199081 Ga0207698_101990812 258
142 3300028786 Ga0307517_10016737 Ga0307517_100167376 258
143 3300028794 Ga0307515_10003029 Ga0307515_100030293 258
144 3300031507 Ga0307509_10182649 Ga0307509_101826492 258
145 3300031911 Ga0307412_10467066 Ga0307412_104670662 258
146 3300042876 Ga0451577_0165277 Ga0451577_0165277_1077_1865 258
147 3300042876 Ga0451577_0456291 Ga0451577_0456291_307_1101 258
148 3300044673 Ga0453683_0203415 Ga0453683_0203415_434_1222 258
149 3300044712 Ga0453684_0683921 Ga0453684_0683921_153_947 258
150 3300045051 Ga0451576_0033300 Ga0451576_0033300_1692_2480 258
151 3300049571 Ga0501034_0307672 Ga0501034_0307672_364_1158 258
152 3300049573 Ga0501037_0077497 Ga0501037_0077497_997_1791 258
153 3300049585 Ga0501069_0135406 Ga0501069_0135406_186_980 258
154 3300049586 Ga0501070_0160549 Ga0501070_0160549_914_1708 258
155 3300049823 Ga0501044_0032501 Ga0501044_0032501_3209_4003 258
156 3300053091 Ga0500647_0097511 Ga0500647_0097511_440_1225 258
157 3300003856 Ga0058692_1002672 Ga0058692_10026722 259
158 3300005327 Ga0070658_10000512 Ga0070658_1000051229 259
159 3300005328 Ga0070676_10000439 Ga0070676_100004392 259
160 3300005329 Ga0070683_100546953 Ga0070683_1005469531 259
161 3300005334 Ga0068869_100106559 Ga0068869_1001065592 259
162 3300005335 Ga0070666_10000499 Ga0070666_1000049916 259
163 3300005338 Ga0068868_100000119 Ga0068868_1000001197 259
164 3300005340 Ga0070689_100466835 Ga0070689_1004668351 259
165 3300005347 Ga0070668_100005038 Ga0070668_1000050386 259
166 3300005364 Ga0070673_100000331 Ga0070673_10000033128 259
167 3300005367 Ga0070667_100001052 Ga0070667_10000105221 259
168 3300005436 Ga0070713_100135257 Ga0070713_1001352572 259
169 3300005456 Ga0070678_100114791 Ga0070678_1001147913 259
170 3300005458 Ga0070681_10001582 Ga0070681_1000158210 259
171 3300005458 Ga0070681_10139072 Ga0070681_101390721 259
172 3300005459 Ga0068867_100002653 Ga0068867_10000265314 259
173 3300005530 Ga0070679_100048036 Ga0070679_1000480363 259
174 3300005539 Ga0068853_100008365 Ga0068853_1000083652 259
175 3300005543 Ga0070672_100000183 Ga0070672_10000018332 259
176 3300005548 Ga0070665_100001045 Ga0070665_1000010459 259
177 3300005563 Ga0068855_100140468 Ga0068855_1001404682 259
178 3300005563 Ga0068855_100189177 Ga0068855_1001891772 259
179 3300005563 Ga0068855_100435262 Ga0068855_1004352622 259
180 3300005614 Ga0068856_100147294 Ga0068856_1001472944 259
181 3300005618 Ga0068864_100002400 Ga0068864_1000024005 259
182 3300005719 Ga0068861_100008556 Ga0068861_1000085563 259
183 3300005719 Ga0068861_100298212 Ga0068861_1002982122 259
184 3300005834 Ga0068851_10015042 Ga0068851_100150423 259
185 3300005841 Ga0068863_100001935 Ga0068863_1000019358 259
186 3300005842 Ga0068858_100003089 Ga0068858_10000308912 259
187 3300005843 Ga0068860_100002234 Ga0068860_10000223410 259
188 3300005985 Ga0081539_10000028 Ga0081539_10000028263 259
189 3300006237 Ga0097621_100003204 Ga0097621_10000320414 259
190 3300006358 Ga0068871_100003066 Ga0068871_1000030668 259
191 3300006881 Ga0068865_100000660 Ga0068865_10000066014 259
192 3300009011 Ga0105251_10001069 Ga0105251_100010693 259
193 3300009093 Ga0105240_10122228 Ga0105240_101222286 259
194 3300009101 Ga0105247_10000132 Ga0105247_1000013226 259
195 3300009177 Ga0105248_10033299 Ga0105248_100332998 259
196 3300009545 Ga0105237_10058587 Ga0105237_100585872 259
197 3300009551 Ga0105238_10128706 Ga0105238_101287063 259
198 3300009553 Ga0105249_10006156 Ga0105249_1000615610 259
199 3300009553 Ga0105249_10108945 Ga0105249_101089453 259
200 3300010375 Ga0105239_10453007 Ga0105239_104530072 259
201 3300011119 Ga0105246_10413041 Ga0105246_104130412 259
202 3300013296 Ga0157374_10000505 Ga0157374_100005052 259
203 3300013296 Ga0157374_10238879 Ga0157374_102388791 259
204 3300013297 Ga0157378_10035396 Ga0157378_100353966 259
205 3300013306 Ga0163162_10000096 Ga0163162_1000009650 259
206 3300013307 Ga0157372_10191614 Ga0157372_101916142 259
207 3300013308 Ga0157375_10000622 Ga0157375_1000062224 259
208 3300014325 Ga0163163_10000251 Ga0163163_1000025116 259
209 3300014968 Ga0157379_10000128 Ga0157379_1000012816 259
210 3300014969 Ga0157376_10000334 Ga0157376_1000033425 259
211 3300017792 Ga0163161_10000052 Ga0163161_1000005217 259
212 3300017792 Ga0163161_10011663 Ga0163161_100116638 259
213 3300021384 Ga0213876_10008793 Ga0213876_100087934 259
214 3300025321 Ga0207656_10010828 Ga0207656_100108282 259
215 3300025711 Ga0207696_1000014 Ga0207696_1000014117 259
216 3300025735 Ga0207713_1000109 Ga0207713_100010954 259
217 3300025900 Ga0207710_10000007 Ga0207710_10000007320 259
218 3300025903 Ga0207680_10000223 Ga0207680_1000022330 259
219 3300025907 Ga0207645_10004116 Ga0207645_100041164 259
220 3300025909 Ga0207705_10001296 Ga0207705_1000129614 259
221 3300025909 Ga0207705_10179697 Ga0207705_101796972 259
222 3300025913 Ga0207695_10306386 Ga0207695_103063861 259
223 3300025921 Ga0207652_10036588 Ga0207652_100365883 259
224 3300025931 Ga0207644_10065750 Ga0207644_100657503 259
225 3300025938 Ga0207704_10001257 Ga0207704_1000125714 259
226 3300025940 Ga0207691_10000057 Ga0207691_1000005716 259
227 3300025941 Ga0207711_10204004 Ga0207711_102040042 259
228 3300025942 Ga0207689_10352703 Ga0207689_103527032 259
229 3300025942 Ga0207689_10424022 Ga0207689_104240222 259
230 3300025949 Ga0207667_10127082 Ga0207667_101270823 259
231 3300025949 Ga0207667_10174790 Ga0207667_101747902 259
232 3300025960 Ga0207651_10000330 Ga0207651_1000033021 259
233 3300025961 Ga0207712_10188008 Ga0207712_101880082 259
234 3300025972 Ga0207668_10000736 Ga0207668_100007368 259
235 3300025986 Ga0207658_10004083 Ga0207658_100040838 259
236 3300026023 Ga0207677_10002398 Ga0207677_1000239812 259
237 3300026035 Ga0207703_10001287 Ga0207703_1000128710 259
238 3300026041 Ga0207639_10001406 Ga0207639_1000140616 259
239 3300026078 Ga0207702_10166913 Ga0207702_101669132 259
240 3300026088 Ga0207641_10005451 Ga0207641_100054513 259
241 3300026089 Ga0207648_10003815 Ga0207648_1000381516 259
242 3300026095 Ga0207676_10002484 Ga0207676_100024842 259
243 3300026118 Ga0207675_100171854 Ga0207675_1001718542 259
244 3300026118 Ga0207675_100286387 Ga0207675_1002863871 259
245 3300027312 Ga0209371_1000822 Ga0209371_100082215 259
246 3300028379 Ga0268266_10005746 Ga0268266_100057464 259
247 3300028380 Ga0268265_10405181 Ga0268265_104051812 259
248 3300028381 Ga0268264_10004004 Ga0268264_1000400410 259
249 3300028786 Ga0307517_10115738 Ga0307517_101157381 259
250 3300031247 Ga0265340_10099240 Ga0265340_100992402 259
251 3300031251 Ga0265327_10000024 Ga0265327_1000002490 259
252 3300031456 Ga0307513_10239473 Ga0307513_102394732 259
253 3300031595 Ga0265313_10092889 Ga0265313_100928892 259
254 3300038725 Ga0400484_14764 Ga0400484_14764_1415_2206 259
255 3300038726 Ga0400490_41645 Ga0400490_41645_717_1499 259
256 3300038741 Ga0400488_01959 Ga0400488_01959_2492_3274 259
257 3300038741 Ga0400488_49253 Ga0400488_49253_170_961 259
258 3300039062 Ga0400483_083912 Ga0400483_083912_5640_6431 259
259 3300039437 Ga0436365_1875604 Ga0436365_1875604_12995_13795 259
260 3300044712 Ga0453684_0004045 Ga0453684_0004045_25198_25989 259
261 3300045051 Ga0451576_0000002 Ga0451576_0000002_309352_310152 259
262 3300047472 Ga0495686_0110735 Ga0495686_0110735_18_893 259
263 3300048906 Ga0496103_0025983 Ga0496103_0025983_269_1048 259
264 3300048907 Ga0496104_0253321 Ga0496104_0253321_49_828 259
265 3300048912 Ga0496109_0032631 Ga0496109_0032631_2711_3511 259
266 3300048919 Ga0496116_0000009 Ga0496116_0000009_345593_346372 259
267 3300048920 Ga0496117_0001526 Ga0496117_0001526_11220_11999 259
268 3300048921 Ga0496118_0002425 Ga0496118_0002425_14811_15590 259
269 3300048922 Ga0496119_0012983 Ga0496119_0012983_3012_3791 259
270 3300048923 Ga0496120_0100561 Ga0496120_0100561_396_1175 259
271 3300049571 Ga0501034_0000004 Ga0501034_0000004_146554_147363 259
272 3300049588 Ga0501072_0196146 Ga0501072_0196146_211_1020 259
273 3300049705 Ga0501225_0001000 Ga0501225_0001000_5005_5871 259
274 3300049742 Ga0501080_0168781 Ga0501080_0168781_209_1018 259
275 iso_pu_bacteria 2818991444 2819585897 259
276 iso_pu_bacteria 2929154850 2929159344 259
277 3300002459 JGI24751J29686_10000945 JGI24751J29686_100009456 260
278 3300002459 JGI24751J29686_10001408 JGI24751J29686_100014081 260
279 3300005328 Ga0070676_10054171 Ga0070676_100541713 260
280 3300005330 Ga0070690_100204457 Ga0070690_1002044572 260
281 3300005331 Ga0070670_100045587 Ga0070670_1000455873 260
282 3300005331 Ga0070670_100387828 Ga0070670_1003878282 260
283 3300005334 Ga0068869_100216984 Ga0068869_1002169842 260
284 3300005336 Ga0070680_100000078 Ga0070680_10000007810 260
285 3300005336 Ga0070680_100010273 Ga0070680_1000102735 260
286 3300005336 Ga0070680_100022622 Ga0070680_1000226224 260
287 3300005337 Ga0070682_100006550 Ga0070682_1000065502 260
288 3300005337 Ga0070682_100035182 Ga0070682_1000351823 260
289 3300005337 Ga0070682_100484955 Ga0070682_1004849551 260
290 3300005338 Ga0068868_100004028 Ga0068868_1000040288 260
291 3300005341 Ga0070691_10000658 Ga0070691_100006586 260
292 3300005354 Ga0070675_100294794 Ga0070675_1002947942 260
293 3300005355 Ga0070671_100001534 Ga0070671_1000015349 260
294 3300005367 Ga0070667_100019848 Ga0070667_1000198482 260
295 3300005406 Ga0070703_10074821 Ga0070703_100748212 260
296 3300005436 Ga0070713_100002396 Ga0070713_1000023963 260
297 3300005437 Ga0070710_10003818 Ga0070710_100038188 260
298 3300005439 Ga0070711_100002860 Ga0070711_1000028609 260
299 3300005456 Ga0070678_100001008 Ga0070678_1000010088 260
300 3300005456 Ga0070678_100365184 Ga0070678_1003651842 260
301 3300005458 Ga0070681_10004146 Ga0070681_100041469 260
302 3300005458 Ga0070681_10007971 Ga0070681_100079717 260
303 3300005458 Ga0070681_10010840 Ga0070681_100108404 260
304 3300005458 Ga0070681_10011407 Ga0070681_100114076 260
305 3300005458 Ga0070681_10026407 Ga0070681_100264072 260
306 3300005458 Ga0070681_10338998 Ga0070681_103389982 260
307 3300005459 Ga0068867_100003430 Ga0068867_1000034308 260
308 3300005459 Ga0068867_100028988 Ga0068867_1000289885 260
309 3300005459 Ga0068867_100108619 Ga0068867_1001086192 260
310 3300005530 Ga0070679_100000099 Ga0070679_10000009941 260
311 3300005530 Ga0070679_100000469 Ga0070679_10000046921 260
312 3300005530 Ga0070679_100290905 Ga0070679_1002909052 260
313 3300005539 Ga0068853_100001959 Ga0068853_1000019594 260
314 3300005539 Ga0068853_100047969 Ga0068853_1000479692 260
315 3300005543 Ga0070672_100141424 Ga0070672_1001414242 260
316 3300005543 Ga0070672_100383567 Ga0070672_1003835672 260
317 3300005548 Ga0070665_100002122 Ga0070665_10000212212 260
318 3300005563 Ga0068855_100000145 Ga0068855_10000014563 260
319 3300005563 Ga0068855_100001482 Ga0068855_10000148210 260
320 3300005563 Ga0068855_100004840 Ga0068855_10000484010 260
321 3300005563 Ga0068855_100057930 Ga0068855_1000579304 260
322 3300005563 Ga0068855_100425602 Ga0068855_1004256022 260
323 3300005577 Ga0068857_100145020 Ga0068857_1001450202 260
324 3300005614 Ga0068856_100009998 Ga0068856_1000099983 260
325 3300005614 Ga0068856_100064734 Ga0068856_1000647342 260
326 3300005616 Ga0068852_100408024 Ga0068852_1004080242 260
327 3300005618 Ga0068864_100126611 Ga0068864_1001266113 260
328 3300005618 Ga0068864_100261792 Ga0068864_1002617922 260
329 3300005718 Ga0068866_10018494 Ga0068866_100184944 260
330 3300005718 Ga0068866_10054316 Ga0068866_100543162 260
331 3300005841 Ga0068863_100334638 Ga0068863_1003346382 260
332 3300005843 Ga0068860_100007155 Ga0068860_1000071554 260
333 3300006163 Ga0070715_10000517 Ga0070715_100005178 260
334 3300006175 Ga0070712_100018220 Ga0070712_1000182204 260
335 3300006237 Ga0097621_100127285 Ga0097621_1001272853 260
336 3300006358 Ga0068871_100123516 Ga0068871_1001235163 260
337 3300006358 Ga0068871_100158155 Ga0068871_1001581552 260
338 3300006881 Ga0068865_100000735 Ga0068865_1000007358 260
339 3300009093 Ga0105240_10000597 Ga0105240_1000059736 260
340 3300009093 Ga0105240_10002705 Ga0105240_1000270522 260
341 3300009093 Ga0105240_10002820 Ga0105240_1000282014 260
342 3300009093 Ga0105240_10003826 Ga0105240_1000382614 260
343 3300009098 Ga0105245_10007920 Ga0105245_100079202 260
344 3300009101 Ga0105247_10031856 Ga0105247_100318563 260
345 3300009174 Ga0105241_10000056 Ga0105241_1000005640 260
346 3300009174 Ga0105241_10058234 Ga0105241_100582344 260
347 3300009176 Ga0105242_10005705 Ga0105242_100057054 260
348 3300009176 Ga0105242_10078617 Ga0105242_100786172 260
349 3300009177 Ga0105248_10005489 Ga0105248_100054897 260
350 3300009545 Ga0105237_10094123 Ga0105237_100941232 260
351 3300009551 Ga0105238_10008320 Ga0105238_100083204 260
352 3300009551 Ga0105238_10629918 Ga0105238_106299181 260
353 3300009553 Ga0105249_10003119 Ga0105249_100031197 260
354 3300011119 Ga0105246_10313818 Ga0105246_103138182 260
355 3300013102 Ga0157371_10050241 Ga0157371_100502413 260
356 3300013102 Ga0157371_10111622 Ga0157371_101116222 260
357 3300013104 Ga0157370_10000491 Ga0157370_1000049110 260
358 3300013104 Ga0157370_10000628 Ga0157370_1000062825 260
359 3300013104 Ga0157370_10001472 Ga0157370_1000147219 260
360 3300013105 Ga0157369_10023058 Ga0157369_100230585 260
361 3300013105 Ga0157369_10036431 Ga0157369_100364312 260
362 3300013105 Ga0157369_10055952 Ga0157369_100559525 260
363 3300013296 Ga0157374_10078864 Ga0157374_100788642 260
364 3300013297 Ga0157378_10004873 Ga0157378_1000487311 260
365 3300013306 Ga0163162_10001535 Ga0163162_1000153516 260
366 3300013307 Ga0157372_10088748 Ga0157372_100887483 260
367 3300013307 Ga0157372_10161439 Ga0157372_101614393 260
368 3300013307 Ga0157372_10289704 Ga0157372_102897042 260
369 3300013308 Ga0157375_10764967 Ga0157375_107649671 260
370 3300014325 Ga0163163_10000703 Ga0163163_1000070323 260
371 3300014969 Ga0157376_10068087 Ga0157376_100680872 260
372 3300020070 Ga0206356_11236474 Ga0206356_112364742 260
373 3300025899 Ga0207642_10140733 Ga0207642_101407332 260
374 3300025900 Ga0207710_10011647 Ga0207710_100116473 260
375 3300025907 Ga0207645_10249609 Ga0207645_102496091 260
376 3300025909 Ga0207705_10012281 Ga0207705_100122815 260
377 3300025911 Ga0207654_10154904 Ga0207654_101549042 260
378 3300025912 Ga0207707_10000026 Ga0207707_10000026104 260
379 3300025912 Ga0207707_10000067 Ga0207707_1000006731 260
380 3300025912 Ga0207707_10000122 Ga0207707_1000012214 260
381 3300025912 Ga0207707_10018125 Ga0207707_100181253 260
382 3300025912 Ga0207707_10063528 Ga0207707_100635284 260
383 3300025913 Ga0207695_10000676 Ga0207695_1000067624 260
384 3300025913 Ga0207695_10003540 Ga0207695_100035404 260
385 3300025913 Ga0207695_10015560 Ga0207695_100155609 260
386 3300025913 Ga0207695_10024615 Ga0207695_100246152 260
387 3300025915 Ga0207693_10000083 Ga0207693_1000008316 260
388 3300025917 Ga0207660_10007760 Ga0207660_100077606 260
389 3300025917 Ga0207660_10034429 Ga0207660_100344292 260
390 3300025921 Ga0207652_10000109 Ga0207652_1000010949 260
391 3300025921 Ga0207652_10000187 Ga0207652_1000018733 260
392 3300025921 Ga0207652_10001479 Ga0207652_100014794 260
393 3300025921 Ga0207652_10285313 Ga0207652_102853132 260
394 3300025924 Ga0207694_10003403 Ga0207694_100034034 260
395 3300025924 Ga0207694_10420847 Ga0207694_104208471 260
396 3300025925 Ga0207650_10025654 Ga0207650_100256544 260
397 3300025925 Ga0207650_10156597 Ga0207650_101565972 260
398 3300025925 Ga0207650_10227617 Ga0207650_102276172 260
399 3300025934 Ga0207686_10015135 Ga0207686_100151352 260
400 3300025934 Ga0207686_10032950 Ga0207686_100329503 260
401 3300025938 Ga0207704_10366048 Ga0207704_103660482 260
402 3300025938 Ga0207704_10428002 Ga0207704_104280021 260
403 3300025940 Ga0207691_10109087 Ga0207691_101090872 260
404 3300025940 Ga0207691_10364236 Ga0207691_103642362 260
405 3300025942 Ga0207689_10027705 Ga0207689_100277054 260
406 3300025949 Ga0207667_10000492 Ga0207667_100004922 260
407 3300025949 Ga0207667_10000798 Ga0207667_100007989 260
408 3300025949 Ga0207667_10010124 Ga0207667_100101244 260
409 3300025960 Ga0207651_10089576 Ga0207651_100895762 260
410 3300026041 Ga0207639_10006152 Ga0207639_100061524 260
411 3300026041 Ga0207639_10006581 Ga0207639_100065813 260
412 3300026041 Ga0207639_10055842 Ga0207639_100558423 260
413 3300026078 Ga0207702_10038203 Ga0207702_100382034 260
414 3300026078 Ga0207702_10090174 Ga0207702_100901743 260
415 3300026088 Ga0207641_10100844 Ga0207641_101008442 260
416 3300026089 Ga0207648_10004995 Ga0207648_1000499512 260
417 3300026089 Ga0207648_10044309 Ga0207648_100443092 260
418 3300026089 Ga0207648_10068027 Ga0207648_100680272 260
419 3300026116 Ga0207674_10101246 Ga0207674_101012462 260
420 3300026121 Ga0207683_10004897 Ga0207683_100048975 260
421 3300026121 Ga0207683_10143289 Ga0207683_101432892 260
422 3300026142 Ga0207698_10100045 Ga0207698_101000451 260
423 3300028381 Ga0268264_10086592 Ga0268264_100865923 260
424 3300030731 Ga0316177_1157475 Ga0316177_11574755 260
425 3300030745 Ga0316182_1062439 Ga0316182_10624393 260
426 3300035170 Ga0373943_0136797 Ga0373943_0136797_208_990 260
427 3300035695 Ga0373927_0006326 Ga0373927_0006326_1233_2015 260
428 3300035725 Ga0373947_0089723 Ga0373947_0089723_498_1280 260
429 3300036401 Ga0373937_0284102 Ga0373937_0284102_134_916 260
430 3300037068 Ga0373925_0669475 Ga0373925_0669475_27_809 260
431 3300037418 Ga0395900_0091423 Ga0395900_0091423_1782_2573 260
432 3300037418 Ga0395900_0693573 Ga0395900_0693573_22_831 260
433 3300037471 Ga0395905_0151976 Ga0395905_0151976_1267_2058 260
434 3300038443 Ga0395901_0015165 Ga0395901_0015165_1904_2695 260
435 3300041486 Ga0451807_0732940 Ga0451807_0732940_346_1164 260
436 3300044656 Ga0466969_0021061 Ga0466969_0021061_1265_2065 260
437 3300044693 Ga0466961_0048369 Ga0466961_0048369_1661_2461 260
438 3300044706 Ga0466964_0086505 Ga0466964_0086505_436_1236 260
439 3300045049 Ga0466959_0000904 Ga0466959_0000904_722_1522 260
440 3300045049 Ga0466959_0008505 Ga0466959_0008505_6423_7223 260
441 3300046459 Ga0495629_0494799 Ga0495629_0494799_16_798 260
442 3300046473 Ga0495582_0111349 Ga0495582_0111349_209_991 260
443 3300046517 Ga0495630_0186089 Ga0495630_0186089_396_1178 260
444 3300046522 Ga0495643_0010737 Ga0495643_0010737_2024_2839 260
445 3300046535 Ga0495586_0124937 Ga0495586_0124937_25_807 260
446 3300046616 Ga0495668_0000187 Ga0495668_0000187_49822_50622 260
447 3300046690 Ga0495624_0101766 Ga0495624_0101766_55_837 260
448 3300047315 Ga0495581_0097363 Ga0495581_0097363_396_1178 260
449 3300047319 Ga0495674_0118810 Ga0495674_0118810_751_1533 260
450 3300048903 Ga0496100_0035556 Ga0496100_0035556_383_1165 260
451 3300048904 Ga0496101_0016241 Ga0496101_0016241_3643_4425 260
452 3300048905 Ga0496102_0006064 Ga0496102_0006064_947_1729 260
453 3300048906 Ga0496103_0029252 Ga0496103_0029252_2513_3295 260
454 3300048910 Ga0496107_0001015 Ga0496107_0001015_1763_2545 260
455 3300048911 Ga0496108_0005792 Ga0496108_0005792_9169_9951 260
456 3300048912 Ga0496109_0064498 Ga0496109_0064498_271_1053 260
457 3300048913 Ga0496110_0000749 Ga0496110_0000749_19483_20265 260
458 3300048915 Ga0496112_0011995 Ga0496112_0011995_55_837 260
459 3300048916 Ga0496113_0079186 Ga0496113_0079186_768_1550 260
460 3300048917 Ga0496114_0004273 Ga0496114_0004273_1947_2729 260
461 3300048918 Ga0496115_0206207 Ga0496115_0206207_345_1136 260
462 3300048921 Ga0496118_0016140 Ga0496118_0016140_224_1006 260
463 3300049574 Ga0501038_0131985 Ga0501038_0131985_428_1258 260
464 3300049575 Ga0501039_0006315 Ga0501039_0006315_6604_7407 260
465 3300049575 Ga0501039_0428723 Ga0501039_0428723_70_900 260
466 3300049579 Ga0501043_0173560 Ga0501043_0173560_721_1524 260
467 3300049581 Ga0501047_0136410 Ga0501047_0136410_827_1630 260
468 3300049581 Ga0501047_0314816 Ga0501047_0314816_208_1038 260
469 3300049585 Ga0501069_0018408 Ga0501069_0018408_2128_2958 260
470 3300049587 Ga0501071_0076790 Ga0501071_0076790_1564_2394 260
471 3300049588 Ga0501072_0093041 Ga0501072_0093041_1460_2290 260
472 3300049589 Ga0501073_0010622 Ga0501073_0010622_3168_3998 260
473 3300049590 Ga0501074_0039165 Ga0501074_0039165_254_1084 260
474 3300049742 Ga0501080_0100361 Ga0501080_0100361_1030_1860 260
475 3300049742 Ga0501080_0487070 Ga0501080_0487070_252_1055 260
476 3300049822 Ga0501035_0043045 Ga0501035_0043045_1886_2689 260
477 3300049823 Ga0501044_0018364 Ga0501044_0018364_318_1148 260
478 3300053153 Ga0500616_0000910 Ga0500616_0000910_18567_19367 260
479 3300060353 Ga0501082_0069209 Ga0501082_0069209_1953_2783 260
480 3300061719 Ga0466962_0024213 Ga0466962_0024213_1620_2420 260
481 3300003323 rootH1_10290290 rootH1_102902902 261
482 3300005329 Ga0070683_100011967 Ga0070683_1000119674 261
483 3300005330 Ga0070690_100053183 Ga0070690_1000531833 261
484 3300005335 Ga0070666_10003443 Ga0070666_100034432 261
485 3300005336 Ga0070680_100311737 Ga0070680_1003117372 261
486 3300005337 Ga0070682_100026168 Ga0070682_1000261683 261
487 3300005338 Ga0068868_100029982 Ga0068868_1000299823 261
488 3300005339 Ga0070660_100002935 Ga0070660_1000029355 261
489 3300005339 Ga0070660_100005349 Ga0070660_10000534910 261
490 3300005340 Ga0070689_100669588 Ga0070689_1006695881 261
491 3300005344 Ga0070661_100003526 Ga0070661_1000035267 261
492 3300005354 Ga0070675_100111384 Ga0070675_1001113842 261
493 3300005355 Ga0070671_100066594 Ga0070671_1000665942 261
494 3300005366 Ga0070659_100002521 Ga0070659_1000025214 261
495 3300005366 Ga0070659_100267189 Ga0070659_1002671891 261
496 3300005367 Ga0070667_100066659 Ga0070667_1000666592 261
497 3300005439 Ga0070711_100166054 Ga0070711_1001660542 261
498 3300005456 Ga0070678_100116522 Ga0070678_1001165222 261
499 3300005457 Ga0070662_100011908 Ga0070662_1000119084 261
500 3300005458 Ga0070681_10029183 Ga0070681_100291834 261
501 3300005459 Ga0068867_100049202 Ga0068867_1000492023 261
502 3300005530 Ga0070679_100007464 Ga0070679_1000074647 261
503 3300005530 Ga0070679_100120141 Ga0070679_1001201412 261
504 3300005535 Ga0070684_100036943 Ga0070684_1000369432 261
505 3300005539 Ga0068853_100003709 Ga0068853_1000037097 261
506 3300005539 Ga0068853_100360979 Ga0068853_1003609792 261
507 3300005548 Ga0070665_100556720 Ga0070665_1005567202 261
508 3300005563 Ga0068855_100007644 Ga0068855_1000076445 261
509 3300005564 Ga0070664_100008870 Ga0070664_1000088704 261
510 3300005577 Ga0068857_100196808 Ga0068857_1001968081 261
511 3300005578 Ga0068854_100015524 Ga0068854_1000155244 261
512 3300005614 Ga0068856_100018970 Ga0068856_1000189704 261
513 3300005616 Ga0068852_100077188 Ga0068852_1000771882 261
514 3300005616 Ga0068852_100148535 Ga0068852_1001485351 261
515 3300005617 Ga0068859_100020299 Ga0068859_1000202992 261
516 3300005618 Ga0068864_100127682 Ga0068864_1001276823 261
517 3300005841 Ga0068863_100693072 Ga0068863_1006930721 261
518 3300005843 Ga0068860_100001796 Ga0068860_10000179624 261
519 3300006237 Ga0097621_100011128 Ga0097621_1000111284 261
520 3300006931 Ga0097620_100020301 Ga0097620_1000203012 261
521 3300009093 Ga0105240_10184907 Ga0105240_101849072 261
522 3300009094 Ga0111539_10089027 Ga0111539_100890273 261
523 3300009101 Ga0105247_10000331 Ga0105247_1000033123 261
524 3300009553 Ga0105249_10001162 Ga0105249_1000116218 261
525 3300013100 Ga0157373_10001202 Ga0157373_100012027 261
526 3300013100 Ga0157373_10019084 Ga0157373_100190843 261
527 3300013102 Ga0157371_10001044 Ga0157371_1000104418 261
528 3300013102 Ga0157371_10002756 Ga0157371_100027569 261
529 3300013102 Ga0157371_10002926 Ga0157371_100029268 261
530 3300013102 Ga0157371_10012575 Ga0157371_100125757 261
531 3300013102 Ga0157371_10016452 Ga0157371_100164523 261
532 3300013104 Ga0157370_10018502 Ga0157370_100185023 261
533 3300013104 Ga0157370_10019594 Ga0157370_100195944 261
534 3300013104 Ga0157370_10481807 Ga0157370_104818072 261
535 3300013105 Ga0157369_10020672 Ga0157369_100206724 261
536 3300013105 Ga0157369_10477830 Ga0157369_104778302 261
537 3300013296 Ga0157374_10009167 Ga0157374_100091675 261
538 3300013297 Ga0157378_10004107 Ga0157378_100041074 261
539 3300013307 Ga0157372_10033941 Ga0157372_100339413 261
540 3300013307 Ga0157372_10082673 Ga0157372_100826733 261
541 3300013307 Ga0157372_10087427 Ga0157372_100874274 261
542 3300013307 Ga0157372_10526304 Ga0157372_105263041 261
543 3300013307 Ga0157372_10602441 Ga0157372_106024411 261
544 3300013308 Ga0157375_10229802 Ga0157375_102298022 261
545 3300014326 Ga0157380_10227853 Ga0157380_102278531 261
546 3300014745 Ga0157377_10029766 Ga0157377_100297661 261
547 3300014969 Ga0157376_10107897 Ga0157376_101078973 261
548 3300025900 Ga0207710_10002459 Ga0207710_100024596 261
549 3300025903 Ga0207680_10060636 Ga0207680_100606362 261
550 3300025904 Ga0207647_10027722 Ga0207647_100277224 261
551 3300025909 Ga0207705_10022510 Ga0207705_100225103 261
552 3300025909 Ga0207705_10258906 Ga0207705_102589062 261
553 3300025912 Ga0207707_10021586 Ga0207707_100215864 261
554 3300025917 Ga0207660_10311835 Ga0207660_103118351 261
555 3300025919 Ga0207657_10004009 Ga0207657_100040097 261
556 3300025919 Ga0207657_10011455 Ga0207657_1001145510 261
557 3300025920 Ga0207649_10436275 Ga0207649_104362751 261
558 3300025921 Ga0207652_10000051 Ga0207652_1000005110 261
559 3300025921 Ga0207652_10094539 Ga0207652_100945392 261
560 3300025921 Ga0207652_10230880 Ga0207652_102308802 261
561 3300025923 Ga0207681_10034644 Ga0207681_100346442 261
562 3300025926 Ga0207659_10087143 Ga0207659_100871432 261
563 3300025932 Ga0207690_10036796 Ga0207690_100367962 261
564 3300025932 Ga0207690_10231126 Ga0207690_102311262 261
565 3300025933 Ga0207706_10014587 Ga0207706_100145873 261
566 3300025937 Ga0207669_10329338 Ga0207669_103293381 261
567 3300025944 Ga0207661_10034174 Ga0207661_100341742 261
568 3300025944 Ga0207661_10324434 Ga0207661_103244342 261
569 3300025945 Ga0207679_10027706 Ga0207679_100277063 261
570 3300025949 Ga0207667_10001836 Ga0207667_1000183624 261
571 3300025949 Ga0207667_10019110 Ga0207667_100191103 261
572 3300025986 Ga0207658_10021367 Ga0207658_100213672 261
573 3300026067 Ga0207678_10224817 Ga0207678_102248173 261
574 3300026078 Ga0207702_10018654 Ga0207702_100186544 261
575 3300026078 Ga0207702_10119116 Ga0207702_101191163 261
576 3300026095 Ga0207676_10581795 Ga0207676_105817952 261
577 3300026116 Ga0207674_10372073 Ga0207674_103720732 261
578 3300026118 Ga0207675_100074714 Ga0207675_1000747141 261
579 3300026121 Ga0207683_10435664 Ga0207683_104356642 261
580 3300026142 Ga0207698_10157758 Ga0207698_101577584 261
581 3300031251 Ga0265327_10017415 Ga0265327_100174153 261
582 3300031251 Ga0265327_10138812 Ga0265327_101388121 261
583 3300031344 Ga0265316_10156761 Ga0265316_101567612 261
584 3300031911 Ga0307412_10083586 Ga0307412_100835862 261
585 3300037312 Ga0395899_0006244 Ga0395899_0006244_1286_2077 261
586 3300037418 Ga0395900_0011131 Ga0395900_0011131_2672_3463 261
587 3300037418 Ga0395900_0309388 Ga0395900_0309388_360_1151 261
588 3300037466 Ga0395898_0014579 Ga0395898_0014579_6845_7636 261
589 3300037466 Ga0395898_0584194 Ga0395898_0584194_257_1048 261
590 3300037471 Ga0395905_0055864 Ga0395905_0055864_2029_2820 261
591 3300038443 Ga0395901_0013086 Ga0395901_0013086_2341_3132 261
592 3300038443 Ga0395901_0226549 Ga0395901_0226549_938_1729 261
593 3300041413 Ga0439465_0016138 Ga0439465_0016138_528_1322 261
594 3300041509 Ga0451843_0079405 Ga0451843_0079405_384_1187 261
595 3300041997 Ga0439431_0037381 Ga0439431_0037381_284_1087 261
596 3300042002 Ga0439442_008518 Ga0439442_008518_102_905 261
597 3300042004 Ga0439445_0008720 Ga0439445_0008720_73_876 261
598 3300042007 Ga0439449_0035992 Ga0439449_0035992_998_1801 261
599 3300042014 Ga0439457_014457 Ga0439457_014457_809_1612 261
600 3300042435 Ga0439434_0076203 Ga0439434_0076203_144_947 261
601 3300046524 Ga0495648_0002190 Ga0495648_0002190_4230_5066 261
602 3300049569 Ga0501032_0000800 Ga0501032_0000800_4628_5425 261
603 3300049570 Ga0501033_0147395 Ga0501033_0147395_627_1436 261
604 3300049571 Ga0501034_0012011 Ga0501034_0012011_7515_8312 261
605 3300049571 Ga0501034_0093334 Ga0501034_0093334_2139_2948 261
606 3300049571 Ga0501034_0094225 Ga0501034_0094225_2132_2923 261
607 3300049573 Ga0501037_0085574 Ga0501037_0085574_622_1419 261
608 3300049574 Ga0501038_0011233 Ga0501038_0011233_4077_4874 261
609 3300049575 Ga0501039_0018039 Ga0501039_0018039_1416_2213 261
610 3300049579 Ga0501043_0026745 Ga0501043_0026745_1758_2555 261
611 3300049580 Ga0501046_0064362 Ga0501046_0064362_94_891 261
612 3300049582 Ga0501048_0006736 Ga0501048_0006736_1861_2658 261
613 3300049583 Ga0501067_0012669 Ga0501067_0012669_738_1535 261
614 3300049589 Ga0501073_0021790 Ga0501073_0021790_3182_3979 261
615 3300049590 Ga0501074_0000935 Ga0501074_0000935_6560_7357 261
616 3300049742 Ga0501080_0075039 Ga0501080_0075039_1972_2769 261
617 3300049744 Ga0501083_0030933 Ga0501083_0030933_254_1051 261
618 3300049822 Ga0501035_0043246 Ga0501035_0043246_504_1301 261
619 3300049823 Ga0501044_0018177 Ga0501044_0018177_4247_5044 261
620 3300053139 Ga0500568_0009829 Ga0500568_0009829_581_1432 261
621 3300053153 Ga0500616_0140391 Ga0500616_0140391_308_1102 261
622 3300053178 Ga0500637_0096854 Ga0500637_0096854_24_836 261
623 3300054114 Ga0501084_0036272 Ga0501084_0036272_450_1247 261
624 3300060353 Ga0501082_0244375 Ga0501082_0244375_597_1394 261
625 3300003320 rootH2_10061393 rootH2_1006139319 262
626 3300003322 rootL2_10163886 rootL2_101638863 262
627 3300003322 rootL2_10260109 rootL2_102601092 262
628 3300005353 Ga0070669_100109044 Ga0070669_1001090443 262
629 3300005367 Ga0070667_100013431 Ga0070667_1000134316 262
630 3300005456 Ga0070678_100022664 Ga0070678_1000226643 262
631 3300005458 Ga0070681_10103829 Ga0070681_101038293 262
632 3300005539 Ga0068853_100000773 Ga0068853_10000077318 262
633 3300005548 Ga0070665_100000047 Ga0070665_10000004766 262
634 3300005617 Ga0068859_100000289 Ga0068859_10000028926 262
635 3300005617 Ga0068859_100250444 Ga0068859_1002504442 262
636 3300005718 Ga0068866_10033356 Ga0068866_100333562 262
637 3300005841 Ga0068863_100188840 Ga0068863_1001888402 262
638 3300005843 Ga0068860_100005149 Ga0068860_1000051498 262
639 3300006237 Ga0097621_100000352 Ga0097621_10000035220 262
640 3300006358 Ga0068871_100001720 Ga0068871_10000172012 262
641 3300006881 Ga0068865_100065807 Ga0068865_1000658073 262
642 3300006931 Ga0097620_100000289 Ga0097620_10000028925 262
643 3300006931 Ga0097620_100250432 Ga0097620_1002504322 262
644 3300009094 Ga0111539_10020311 Ga0111539_100203115 262
645 3300009176 Ga0105242_10035489 Ga0105242_100354894 262
646 3300009553 Ga0105249_10377449 Ga0105249_103774492 262
647 3300010375 Ga0105239_10001099 Ga0105239_1000109932 262
648 3300010375 Ga0105239_10148007 Ga0105239_101480072 262
649 3300013296 Ga0157374_10132396 Ga0157374_101323962 262
650 3300013297 Ga0157378_10044549 Ga0157378_100445492 262
651 3300013306 Ga0163162_10000237 Ga0163162_1000023739 262
652 3300013308 Ga0157375_10000599 Ga0157375_1000059921 262
653 3300013308 Ga0157375_10056438 Ga0157375_100564383 262
654 3300014745 Ga0157377_10110211 Ga0157377_101102112 262
655 3300014969 Ga0157376_10000971 Ga0157376_100009715 262
656 3300017792 Ga0163161_10032265 Ga0163161_100322653 262
657 3300025899 Ga0207642_10020063 Ga0207642_100200633 262
658 3300025912 Ga0207707_10103424 Ga0207707_101034243 262
659 3300025926 Ga0207659_10048990 Ga0207659_100489903 262
660 3300025986 Ga0207658_10002480 Ga0207658_100024803 262
661 3300025986 Ga0207658_10162652 Ga0207658_101626522 262
662 3300026041 Ga0207639_10030877 Ga0207639_100308773 262
663 3300026088 Ga0207641_10071587 Ga0207641_100715872 262
664 3300026116 Ga0207674_10092279 Ga0207674_100922792 262
665 3300026121 Ga0207683_10038510 Ga0207683_100385104 262
666 3300028379 Ga0268266_10000048 Ga0268266_1000004822 262
667 3300028381 Ga0268264_10002163 Ga0268264_100021637 262
668 3300028794 Ga0307515_10000001 Ga0307515_100000012850 262
669 3300031730 Ga0307516_10000486 Ga0307516_1000048617 262
670 3300032004 Ga0307414_10064093 Ga0307414_100640931 262
671 3300033180 Ga0307510_10002428 Ga0307510_100024283 262
672 3300044706 Ga0466964_0008038 Ga0466964_0008038_1213_2022 262
673 3300044735 Ga0466968_0056525 Ga0466968_0056525_793_1602 262
674 3300044901 Ga0466960_0197565 Ga0466960_0197565_290_1087 262
675 3300046460 Ga0495638_0062409 Ga0495638_0062409_127_972 262
676 3300046507 Ga0495606_0124843 Ga0495606_0124843_514_1416 262
677 3300046694 Ga0495649_0136271 Ga0495649_0136271_279_1124 262
678 3300048903 Ga0496100_0073676 Ga0496100_0073676_620_1441 262
679 3300048907 Ga0496104_0461326 Ga0496104_0461326_219_1040 262
680 3300048917 Ga0496114_0154237 Ga0496114_0154237_14_835 262
681 3300049703 Ga0501219_000019 Ga0501219_000019_22754_23551 262
682 3300050005 Ga0501284_00007 Ga0501284_00007_31809_32606 262
683 3300050511 nmdc:mga08y16_15141_c1 nmdc:mga08y16_15141_c1_3769_4584 262
684 3300053092 Ga0500583_0052500 Ga0500583_0052500_923_1768 262
685 3300053130 Ga0500642_0064529 Ga0500642_0064529_227_1072 262
686 3300053151 Ga0500604_0019153 Ga0500604_0019153_298_1107 262
687 3300053156 Ga0500622_0001947 Ga0500622_0001947_3258_4103 262
688 3300053178 Ga0500637_0101999 Ga0500637_0101999_177_977 262
689 3300003322 rootL2_10012238 rootL2_100122382 263
690 3300005329 Ga0070683_100013925 Ga0070683_1000139255 263
691 3300005341 Ga0070691_10097437 Ga0070691_100974372 263
692 3300005354 Ga0070675_100361372 Ga0070675_1003613722 263
693 3300005535 Ga0070684_100038510 Ga0070684_1000385102 263
694 3300005539 Ga0068853_100291166 Ga0068853_1002911662 263
695 3300005563 Ga0068855_100000081 Ga0068855_10000008116 263
696 3300005614 Ga0068856_100205214 Ga0068856_1002052142 263
697 3300005616 Ga0068852_100041393 Ga0068852_1000413933 263
698 3300005834 Ga0068851_10020590 Ga0068851_100205903 263
699 3300005841 Ga0068863_100097977 Ga0068863_1000979774 263
700 3300005843 Ga0068860_100000024 Ga0068860_1000000248 263
701 3300009093 Ga0105240_10001169 Ga0105240_1000116938 263
702 3300009093 Ga0105240_10003084 Ga0105240_1000308412 263
703 3300009147 Ga0114129_10017487 Ga0114129_100174879 263
704 3300009545 Ga0105237_10000294 Ga0105237_1000029420 263
705 3300009545 Ga0105237_10065649 Ga0105237_100656492 263
706 3300010375 Ga0105239_10038285 Ga0105239_100382856 263
707 3300013104 Ga0157370_10000945 Ga0157370_1000094516 263
708 3300013104 Ga0157370_10019993 Ga0157370_100199933 263
709 3300013296 Ga0157374_10000027 Ga0157374_1000002786 263
710 3300013296 Ga0157374_10034438 Ga0157374_100344383 263
711 3300025911 Ga0207654_10087861 Ga0207654_100878612 263
712 3300025913 Ga0207695_10000087 Ga0207695_10000087236 263
713 3300025913 Ga0207695_10000299 Ga0207695_1000029966 263
714 3300025944 Ga0207661_10076137 Ga0207661_100761373 263
715 3300025949 Ga0207667_10000172 Ga0207667_1000017264 263
716 3300025949 Ga0207667_10001462 Ga0207667_1000146230 263
717 3300026023 Ga0207677_10036508 Ga0207677_100365082 263
718 3300026078 Ga0207702_10159541 Ga0207702_101595412 263
719 3300028380 Ga0268265_10407220 Ga0268265_104072201 263
720 3300028381 Ga0268264_10000028 Ga0268264_10000028188 263
721 3300031730 Ga0307516_10091542 Ga0307516_100915421 263
722 3300044658 Ga0466972_0000001 Ga0466972_0000001_258212_259030 263
723 3300044658 Ga0466972_0000044 Ga0466972_0000044_36823_37701 263
724 3300044693 Ga0466961_0227683 Ga0466961_0227683_16_852 263
725 3300044712 Ga0453684_0029545 Ga0453684_0029545_2069_2875 263
726 3300044765 Ga0466970_0000486 Ga0466970_0000486_1997_2815 263
727 3300044842 Ga0466957_0059357 Ga0466957_0059357_560_1438 263
728 3300044901 Ga0466960_0076280 Ga0466960_0076280_224_1042 263
729 3300047443 Ga0495687_000129 Ga0495687_000129_79064_79933 263
730 3300048918 Ga0496115_0001691 Ga0496115_0001691_4086_4901 263
731 3300048927 Ga0496124_0059093 Ga0496124_0059093_969_1784 263
732 3300050507 nmdc:mga05p37_2990_c1 nmdc:mga05p37_2990_c1_6678_7529 263
733 3300053086 Ga0500578_0000026 Ga0500578_0000026_80666_81544 263
734 3300053088 Ga0500644_0011243 Ga0500644_0011243_110_916 263
735 3300053093 Ga0500651_0147083 Ga0500651_0147083_33_911 263
736 3300053139 Ga0500568_0000298 Ga0500568_0000298_28340_29149 263
737 3300053146 Ga0500588_0090237 Ga0500588_0090237_106_984 263
738 3300053156 Ga0500622_0006108 Ga0500622_0006108_378_1184 263
739 3300003203 JGI25406J46586_10000387 JGI25406J46586_100003878 264
740 3300003320 rootH2_10127001 rootH2_101270013 264
741 3300005288 Ga0065714_10109739 Ga0065714_101097392 264
742 3300005290 Ga0065712_10098628 Ga0065712_100986282 264
743 3300005331 Ga0070670_100065267 Ga0070670_1000652673 264
744 3300005331 Ga0070670_100315367 Ga0070670_1003153672 264
745 3300005331 Ga0070670_100325871 Ga0070670_1003258711 264
746 3300005334 Ga0068869_100169883 Ga0068869_1001698832 264
747 3300005339 Ga0070660_100490826 Ga0070660_1004908261 264
748 3300005564 Ga0070664_100107417 Ga0070664_1001074172 264
749 3300005614 Ga0068856_100036909 Ga0068856_1000369092 264
750 3300005617 Ga0068859_100002592 Ga0068859_10000259220 264
751 3300005841 Ga0068863_100821084 Ga0068863_1008210841 264
752 3300005985 Ga0081539_10000042 Ga0081539_10000042125 264
753 3300006358 Ga0068871_100099900 Ga0068871_1000999002 264
754 3300006931 Ga0097620_100002592 Ga0097620_10000259220 264
755 3300009093 Ga0105240_10000445 Ga0105240_1000044528 264
756 3300009174 Ga0105241_10000180 Ga0105241_100001807 264
757 3300009545 Ga0105237_10002656 Ga0105237_100026569 264
758 3300009551 Ga0105238_10001087 Ga0105238_1000108712 264
759 3300013102 Ga0157371_10084464 Ga0157371_100844642 264
760 3300013296 Ga0157374_10035460 Ga0157374_100354604 264
761 3300013297 Ga0157378_10428060 Ga0157378_104280602 264
762 3300013307 Ga0157372_10043891 Ga0157372_100438915 264
763 3300013307 Ga0157372_10441519 Ga0157372_104415192 264
764 3300013307 Ga0157372_10485090 Ga0157372_104850901 264
765 3300013307 Ga0157372_10714010 Ga0157372_107140101 264
766 3300013307 Ga0157372_11051056 Ga0157372_110510561 264
767 3300014325 Ga0163163_10001228 Ga0163163_1000122816 264
768 3300014969 Ga0157376_10078346 Ga0157376_100783463 264
769 3300025909 Ga0207705_10474639 Ga0207705_104746391 264
770 3300025911 Ga0207654_10001342 Ga0207654_100013427 264
771 3300025913 Ga0207695_10002728 Ga0207695_1000272828 264
772 3300025914 Ga0207671_10001222 Ga0207671_100012224 264
773 3300025919 Ga0207657_10422044 Ga0207657_104220441 264
774 3300025924 Ga0207694_10035018 Ga0207694_100350183 264
775 3300025925 Ga0207650_10049949 Ga0207650_100499493 264
776 3300025942 Ga0207689_10319633 Ga0207689_103196332 264
777 3300025945 Ga0207679_10242784 Ga0207679_102427842 264
778 3300026078 Ga0207702_10015635 Ga0207702_100156355 264
779 3300026095 Ga0207676_10362322 Ga0207676_103623221 264
780 3300026116 Ga0207674_10582874 Ga0207674_105828742 264
781 3300026142 Ga0207698_10403180 Ga0207698_104031802 264
782 3300028381 Ga0268264_10002184 Ga0268264_100021842 264
783 3300028794 Ga0307515_10000778 Ga0307515_1000077819 264
784 3300031852 Ga0307410_10159570 Ga0307410_101595701 264
785 3300031903 Ga0307407_10288883 Ga0307407_102888831 264
786 3300032004 Ga0307414_10327145 Ga0307414_103271452 264
787 3300037466 Ga0395898_0001425 Ga0395898_0001425_17860_18666 264
788 3300037471 Ga0395905_0002632 Ga0395905_0002632_13963_14778 264
789 3300038443 Ga0395901_0022855 Ga0395901_0022855_3673_4479 264
790 3300038443 Ga0395901_0270417 Ga0395901_0270417_501_1316 264
791 3300044658 Ga0466972_0009913 Ga0466972_0009913_1781_2629 264
792 3300044673 Ga0453683_0292019 Ga0453683_0292019_11_805 264
793 3300044735 Ga0466968_0024864 Ga0466968_0024864_1535_2383 264
794 3300045051 Ga0451576_0658158 Ga0451576_0658158_118_912 264
795 3300049652 Ga0501202_004421 Ga0501202_004421_1635_2429 264
796 3300049663 Ga0501223_016511 Ga0501223_016511_593_1387 264
797 3300049822 Ga0501035_0338162 Ga0501035_0338162_401_1195 264
798 3300039093 Ga0400489_76974 Ga0400489_76974_9722_10543 265
799 3300049571 Ga0501034_0357151 Ga0501034_0357151_26_901 265
800 3300005841 Ga0068863_100047532 Ga0068863_1000475321 267
801 3300010375 Ga0105239_10000360 Ga0105239_1000036026 267
802 3300046648 Ga0495611_0000065 Ga0495611_0000065_48877_49749 267
803 3300053108 Ga0500562_000053 Ga0500562_000053_15011_15835 267
804 3300013307 Ga0157372_10147052 Ga0157372_101470523 271
805 3300025912 Ga0207707_10058051 Ga0207707_100580514 271
806 3300005337 Ga0070682_100000012 Ga0070682_100000012162 274
807 3300030521 Ga0307511_10000002 Ga0307511_1000000263 276
808 3300013307 Ga0157372_10133414 Ga0157372_101334142 277
809 3300001904 JGI24736J21556_1015358 JGI24736J21556_10153582 278
810 3300005339 Ga0070660_100094125 Ga0070660_1000941252 278
811 3300005366 Ga0070659_100012620 Ga0070659_1000126202 278
812 3300005616 Ga0068852_100002561 Ga0068852_1000025618 278
813 3300025904 Ga0207647_10000358 Ga0207647_1000035824 278
814 3300025919 Ga0207657_10102212 Ga0207657_101022122 278
815 3300025932 Ga0207690_10173416 Ga0207690_101734162 278
816 3300026142 Ga0207698_10025447 Ga0207698_100254474 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

59

306

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.978 17 276
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.9562 17 276
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.9141 16 272
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.8999 16 272
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.8762 16 271
ID Description Score Start End Superfamily
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.978 17 276 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9678 18 277 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9603 18 277 3.60.110.10
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9562 17 276 3.60.110.10
af_Q2FWM9_1_261_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9322 18 272 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A1M7RF19-F1-model_v4 Carbon-nitrogen hydrolase 0.9927 17 277 GO:0050152
GO:0106008
AF-A0A4Q5YUG9-F1-model_v4 Nitrilase family protein 0.9927 18 217 GO:0050152
GO:0106008
AF-A0A4V1UQN5-F1-model_v4 Nitrilase family protein 0.9915 18 147 GO:0050152
GO:0106008
AF-A0A7V5EN94-F1-model_v4 Nitrilase family protein 0.9905 17 272 GO:0050152
GO:0106008
AF-A0A4Q5WBB1-F1-model_v4 Nitrilase family protein 0.9886 18 171 GO:0050152
GO:0106008

Feature Viewer

pLDDT pTM Quality
94.58 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map