F482059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 816 | 318 | 804 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300030521|Ga0307511_10000002|Ga0307511_1000000263 |
| Length | 321 |
| Sequence | MFAGGFAIFLKSESPANLKGWKPFSPTGQTLALCRRCARFLKAHFRHIFLFCSGMSTLTITTIQTALQWEDKAANLLRLAEKIDGIREKTEIVILPEMFSTGFSMKPEILAERMDGPTMEWMKKTAAQKRVILTGSLIIEEEGNYYNRLIWMLPNGEYGYYDKRHRFAYAGENEHYTAGKKRLIASVKGWKINLLVCYDLRFPVWSRQAPNSSEMNSELEYDLLIYVANWPERRSLAWKTLLQARAIENQSYVIGVNRVGEDGNNISHSGDTMIIDPLGEVLYHGLKEEAIFTYTLRKERLEEVRSRFPFWRDADDFSVHP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 2 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 3 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 4 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 5 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 6 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 7 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 8 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 9 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 10 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 11 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 12 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 172 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 173 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 199 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 200 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 201 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 202 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 207 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 208 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 209 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 210 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 211 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 212 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 217 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 218 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 223 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 224 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 261 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 262 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 263 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 286 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 287 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 292 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 303 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 305 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 306 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 307 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 308 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 314 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 0.25 |
| Isolates | 1.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.45 |
| Nodule | 0.25 |
| Rhizoplane | 2.57 |
| Rhizosphere | 89.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1015358 | 3300001904 | Bacteria | 1227 |
| 2 | JGI24751J29686_10000945 | 3300002459 | Bacteria | 6466 |
| 3 | JGI24751J29686_10001408 | 3300002459 | Bacteria | 5040 |
| 4 | JGI25406J46586_10000387 | 3300003203 | Bacteria | 20246 |
| 5 | rootH2_10061393 | 3300003320 | Bacteria | 15275 |
| 6 | rootH2_10127001 | 3300003320 | Bacteria | 7405 |
| 7 | rootH2_10254154 | 3300003320 | Bacteria | 1942 |
| 8 | rootL2_10012238 | 3300003322 | Unclassified | 2660 |
| 9 | rootL2_10163886 | 3300003322 | Bacteria | 2795 |
| 10 | rootL2_10260109 | 3300003322 | Bacteria | 2239 |
| 11 | rootH1_10290290 | 3300003323 | Bacteria | 2510 |
| 12 | Ga0058692_1002672 | 3300003856 | Bacteria | 5869 |
| 13 | Ga0065165_1000601 | 3300005262 | Bacteria | 52747 |
| 14 | Ga0065714_10109739 | 3300005288 | Bacteria | 1495 |
| 15 | Ga0065712_10098628 | 3300005290 | Bacteria | 2114 |
| 16 | Ga0065707_10114619 | 3300005295 | Bacteria | 2292 |
| 17 | Ga0070658_10000512 | 3300005327 | Bacteria | 33597 |
| 18 | Ga0070658_10165345 | 3300005327 | Unclassified | 1857 |
| 19 | Ga0070676_10000439 | 3300005328 | Bacteria | 19781 |
| 20 | Ga0070676_10054171 | 3300005328 | Bacteria | 2364 |
| 21 | Ga0070683_100011967 | 3300005329 | Bacteria | 7527 |
| 22 | Ga0070683_100013925 | 3300005329 | Bacteria | 7026 |
| 23 | Ga0070683_100546953 | 3300005329 | Unclassified | 1107 |
| 24 | Ga0070690_100053183 | 3300005330 | Bacteria | 2590 |
| 25 | Ga0070690_100204457 | 3300005330 | Bacteria | 1376 |
| 26 | Ga0070670_100045587 | 3300005331 | Bacteria | 3770 |
| 27 | Ga0070670_100065267 | 3300005331 | Unclassified | 3123 |
| 28 | Ga0070670_100315367 | 3300005331 | Unclassified | 1369 |
| 29 | Ga0070670_100325871 | 3300005331 | Bacteria | 1346 |
| 30 | Ga0070670_100387828 | 3300005331 | Unclassified | 1231 |
| 31 | Ga0068869_100106559 | 3300005334 | Unclassified | 2127 |
| 32 | Ga0068869_100169883 | 3300005334 | Bacteria | 1703 |
| 33 | Ga0068869_100216984 | 3300005334 | Bacteria | 1515 |
| 34 | Ga0070666_10000499 | 3300005335 | Bacteria | 23607 |
| 35 | Ga0070666_10003443 | 3300005335 | Bacteria | 9589 |
| 36 | Ga0070666_10096799 | 3300005335 | Bacteria | 2032 |
| 37 | Ga0070680_100000078 | 3300005336 | Bacteria | 52994 |
| 38 | Ga0070680_100010273 | 3300005336 | Bacteria | 7216 |
| 39 | Ga0070680_100022622 | 3300005336 | Bacteria | 5009 |
| 40 | Ga0070680_100311737 | 3300005336 | Unclassified | 1335 |
| 41 | Ga0070682_100000012 | 3300005337 | Bacteria | 265658 |
| 42 | Ga0070682_100006550 | 3300005337 | Bacteria | 6533 |
| 43 | Ga0070682_100026168 | 3300005337 | Bacteria | 3489 |
| 44 | Ga0070682_100035182 | 3300005337 | Bacteria | 3056 |
| 45 | Ga0070682_100484955 | 3300005337 | Unclassified | 954 |
| 46 | Ga0068868_100000119 | 3300005338 | Bacteria | 49590 |
| 47 | Ga0068868_100004028 | 3300005338 | Bacteria | 10248 |
| 48 | Ga0068868_100029982 | 3300005338 | Bacteria | 4170 |
| 49 | Ga0070660_100002935 | 3300005339 | Bacteria | 11731 |
| 50 | Ga0070660_100005349 | 3300005339 | Bacteria | 8884 |
| 51 | Ga0070660_100077428 | 3300005339 | Unclassified | 2606 |
| 52 | Ga0070660_100094125 | 3300005339 | Bacteria | 2367 |
| 53 | Ga0070660_100196454 | 3300005339 | Bacteria | 1635 |
| 54 | Ga0070660_100490826 | 3300005339 | Bacteria | 1021 |
| 55 | Ga0070689_100302398 | 3300005340 | Viruses | 1332 |
| 56 | Ga0070689_100466835 | 3300005340 | Bacteria | 1076 |
| 57 | Ga0070689_100669588 | 3300005340 | Bacteria | 904 |
| 58 | Ga0070691_10000658 | 3300005341 | Bacteria | 13391 |
| 59 | Ga0070691_10097437 | 3300005341 | Bacteria | 1457 |
| 60 | Ga0070661_100003526 | 3300005344 | Bacteria | 10774 |
| 61 | Ga0070668_100005038 | 3300005347 | Bacteria | 9783 |
| 62 | Ga0070669_100109044 | 3300005353 | Bacteria | 2099 |
| 63 | Ga0070675_100111384 | 3300005354 | Bacteria | 2316 |
| 64 | Ga0070675_100294794 | 3300005354 | Bacteria | 1428 |
| 65 | Ga0070675_100361372 | 3300005354 | Bacteria | 1289 |
| 66 | Ga0070671_100001534 | 3300005355 | Bacteria | 17343 |
| 67 | Ga0070671_100066594 | 3300005355 | Bacteria | 3002 |
| 68 | Ga0070673_100000331 | 3300005364 | Bacteria | 24760 |
| 69 | Ga0070659_100002521 | 3300005366 | Bacteria | 13007 |
| 70 | Ga0070659_100012620 | 3300005366 | Bacteria | 6266 |
| 71 | Ga0070659_100169738 | 3300005366 | Unclassified | 1786 |
| 72 | Ga0070659_100267189 | 3300005366 | Bacteria | 1420 |
| 73 | Ga0070667_100001052 | 3300005367 | Bacteria | 25199 |
| 74 | Ga0070667_100013431 | 3300005367 | Bacteria | 6770 |
| 75 | Ga0070667_100019848 | 3300005367 | Bacteria | 5577 |
| 76 | Ga0070667_100066659 | 3300005367 | Bacteria | 3059 |
| 77 | Ga0070703_10074821 | 3300005406 | Bacteria | 1139 |
| 78 | Ga0070714_100247622 | 3300005435 | Bacteria | 1647 |
| 79 | Ga0070713_100002396 | 3300005436 | Bacteria | 12225 |
| 80 | Ga0070713_100135257 | 3300005436 | Bacteria | 2177 |
| 81 | Ga0070710_10003818 | 3300005437 | Bacteria | 7128 |
| 82 | Ga0070711_100002860 | 3300005439 | Bacteria | 9931 |
| 83 | Ga0070711_100166054 | 3300005439 | Bacteria | 1678 |
| 84 | Ga0070678_100001008 | 3300005456 | Bacteria | 14634 |
| 85 | Ga0070678_100022664 | 3300005456 | Bacteria | 4167 |
| 86 | Ga0070678_100114791 | 3300005456 | Unclassified | 2113 |
| 87 | Ga0070678_100116522 | 3300005456 | Bacteria | 2099 |
| 88 | Ga0070678_100365184 | 3300005456 | Unclassified | 1245 |
| 89 | Ga0070662_100011908 | 3300005457 | Bacteria | 5750 |
| 90 | Ga0070681_10001582 | 3300005458 | Bacteria | 20207 |
| 91 | Ga0070681_10004146 | 3300005458 | Bacteria | 13709 |
| 92 | Ga0070681_10007971 | 3300005458 | Bacteria | 10366 |
| 93 | Ga0070681_10010840 | 3300005458 | Bacteria | 9008 |
| 94 | Ga0070681_10011407 | 3300005458 | Bacteria | 8795 |
| 95 | Ga0070681_10026407 | 3300005458 | Bacteria | 5836 |
| 96 | Ga0070681_10029183 | 3300005458 | Bacteria | 5538 |
| 97 | Ga0070681_10103829 | 3300005458 | Bacteria | 2786 |
| 98 | Ga0070681_10139072 | 3300005458 | Unclassified | 2358 |
| 99 | Ga0070681_10179824 | 3300005458 | Bacteria | 2037 |
| 100 | Ga0070681_10338998 | 3300005458 | Bacteria | 1413 |
| 101 | Ga0068867_100002653 | 3300005459 | Bacteria | 12624 |
| 102 | Ga0068867_100003430 | 3300005459 | Bacteria | 11147 |
| 103 | Ga0068867_100028988 | 3300005459 | Bacteria | 3987 |
| 104 | Ga0068867_100049202 | 3300005459 | Bacteria | 3103 |
| 105 | Ga0068867_100108619 | 3300005459 | Bacteria | 2128 |
| 106 | Ga0070679_100000099 | 3300005530 | Bacteria | 66873 |
| 107 | Ga0070679_100000469 | 3300005530 | Bacteria | 34407 |
| 108 | Ga0070679_100007464 | 3300005530 | Bacteria | 10219 |
| 109 | Ga0070679_100048036 | 3300005530 | Bacteria | 4253 |
| 110 | Ga0070679_100120141 | 3300005530 | Unclassified | 2613 |
| 111 | Ga0070679_100290905 | 3300005530 | Bacteria | 1585 |
| 112 | Ga0070684_100036943 | 3300005535 | Bacteria | 4188 |
| 113 | Ga0070684_100038510 | 3300005535 | Unclassified | 4107 |
| 114 | Ga0068853_100000773 | 3300005539 | Bacteria | 22203 |
| 115 | Ga0068853_100001959 | 3300005539 | Bacteria | 15174 |
| 116 | Ga0068853_100003709 | 3300005539 | Bacteria | 11729 |
| 117 | Ga0068853_100008365 | 3300005539 | Bacteria | 8308 |
| 118 | Ga0068853_100047969 | 3300005539 | Bacteria | 3666 |
| 119 | Ga0068853_100291166 | 3300005539 | Bacteria | 1507 |
| 120 | Ga0068853_100317422 | 3300005539 | Bacteria | 1444 |
| 121 | Ga0068853_100360979 | 3300005539 | Bacteria | 1353 |
| 122 | Ga0070672_100000183 | 3300005543 | Bacteria | 34362 |
| 123 | Ga0070672_100141424 | 3300005543 | Bacteria | 1985 |
| 124 | Ga0070672_100383567 | 3300005543 | Bacteria | 1202 |
| 125 | Ga0070686_100005249 | 3300005544 | Bacteria | 7155 |
| 126 | Ga0070665_100000047 | 3300005548 | Bacteria | 269702 |
| 127 | Ga0070665_100001045 | 3300005548 | Bacteria | 34668 |
| 128 | Ga0070665_100002122 | 3300005548 | Bacteria | 22146 |
| 129 | Ga0070665_100556720 | 3300005548 | Bacteria | 1159 |
| 130 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 131 | Ga0068855_100000145 | 3300005563 | Bacteria | 91452 |
| 132 | Ga0068855_100000582 | 3300005563 | Bacteria | 44891 |
| 133 | Ga0068855_100001482 | 3300005563 | Bacteria | 29366 |
| 134 | Ga0068855_100004840 | 3300005563 | Bacteria | 16434 |
| 135 | Ga0068855_100007644 | 3300005563 | Bacteria | 13072 |
| 136 | Ga0068855_100057930 | 3300005563 | Bacteria | 4540 |
| 137 | Ga0068855_100079337 | 3300005563 | Bacteria | 3807 |
| 138 | Ga0068855_100140468 | 3300005563 | Bacteria | 2754 |
| 139 | Ga0068855_100189177 | 3300005563 | Unclassified | 2323 |
| 140 | Ga0068855_100211440 | 3300005563 | Bacteria | 2179 |
| 141 | Ga0068855_100425602 | 3300005563 | Bacteria | 1452 |
| 142 | Ga0068855_100435262 | 3300005563 | Bacteria | 1433 |
| 143 | Ga0070664_100008870 | 3300005564 | Bacteria | 8150 |
| 144 | Ga0070664_100107417 | 3300005564 | Unclassified | 2433 |
| 145 | Ga0068857_100111310 | 3300005577 | Bacteria | 2461 |
| 146 | Ga0068857_100145020 | 3300005577 | Bacteria | 2148 |
| 147 | Ga0068857_100189049 | 3300005577 | Unclassified | 1875 |
| 148 | Ga0068857_100196808 | 3300005577 | Bacteria | 1836 |
| 149 | Ga0068854_100015524 | 3300005578 | Bacteria | 5048 |
| 150 | Ga0068854_100269523 | 3300005578 | Bacteria | 1366 |
| 151 | Ga0068856_100009998 | 3300005614 | Bacteria | 9212 |
| 152 | Ga0068856_100018970 | 3300005614 | Bacteria | 6673 |
| 153 | Ga0068856_100036909 | 3300005614 | Bacteria | 4793 |
| 154 | Ga0068856_100064734 | 3300005614 | Bacteria | 3612 |
| 155 | Ga0068856_100147294 | 3300005614 | Unclassified | 2362 |
| 156 | Ga0068856_100205214 | 3300005614 | Bacteria | 1985 |
| 157 | Ga0068852_100002561 | 3300005616 | Bacteria | 12525 |
| 158 | Ga0068852_100002956 | 3300005616 | Bacteria | 11806 |
| 159 | Ga0068852_100041393 | 3300005616 | Bacteria | 3893 |
| 160 | Ga0068852_100062502 | 3300005616 | Unclassified | 3239 |
| 161 | Ga0068852_100077188 | 3300005616 | Bacteria | 2944 |
| 162 | Ga0068852_100148535 | 3300005616 | Bacteria | 2177 |
| 163 | Ga0068852_100163502 | 3300005616 | Bacteria | 2080 |
| 164 | Ga0068852_100338306 | 3300005616 | Bacteria | 1466 |
| 165 | Ga0068852_100408024 | 3300005616 | Unclassified | 1338 |
| 166 | Ga0068859_100000289 | 3300005617 | Bacteria | 49979 |
| 167 | Ga0068859_100002592 | 3300005617 | Bacteria | 18396 |
| 168 | Ga0068859_100020299 | 3300005617 | Bacteria | 6669 |
| 169 | Ga0068859_100080329 | 3300005617 | Viruses | 3302 |
| 170 | Ga0068859_100250444 | 3300005617 | Bacteria | 1862 |
| 171 | Ga0068864_100002400 | 3300005618 | Bacteria | 15470 |
| 172 | Ga0068864_100126611 | 3300005618 | Bacteria | 2290 |
| 173 | Ga0068864_100127682 | 3300005618 | Bacteria | 2280 |
| 174 | Ga0068864_100261792 | 3300005618 | Unclassified | 1609 |
| 175 | Ga0068866_10018494 | 3300005718 | Bacteria | 3153 |
| 176 | Ga0068866_10033356 | 3300005718 | Unclassified | 2497 |
| 177 | Ga0068866_10054316 | 3300005718 | Bacteria | 2052 |
| 178 | Ga0068861_100008556 | 3300005719 | Bacteria | 7042 |
| 179 | Ga0068861_100298212 | 3300005719 | Bacteria | 1395 |
| 180 | Ga0068851_10015042 | 3300005834 | Unclassified | 3682 |
| 181 | Ga0068851_10020590 | 3300005834 | Bacteria | 3195 |
| 182 | Ga0068863_100001935 | 3300005841 | Bacteria | 20565 |
| 183 | Ga0068863_100047532 | 3300005841 | Bacteria | 4070 |
| 184 | Ga0068863_100097977 | 3300005841 | Bacteria | 2785 |
| 185 | Ga0068863_100188840 | 3300005841 | Unclassified | 1980 |
| 186 | Ga0068863_100334638 | 3300005841 | Unclassified | 1472 |
| 187 | Ga0068863_100693072 | 3300005841 | Bacteria | 1012 |
| 188 | Ga0068863_100821084 | 3300005841 | Bacteria | 928 |
| 189 | Ga0068858_100003089 | 3300005842 | Bacteria | 16660 |
| 190 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 191 | Ga0068860_100001796 | 3300005843 | Bacteria | 22849 |
| 192 | Ga0068860_100002234 | 3300005843 | Bacteria | 20388 |
| 193 | Ga0068860_100005149 | 3300005843 | Bacteria | 13296 |
| 194 | Ga0068860_100007155 | 3300005843 | Bacteria | 11163 |
| 195 | Ga0068860_100365509 | 3300005843 | Bacteria | 1422 |
| 196 | Ga0081539_10000028 | 3300005985 | Bacteria | 328182 |
| 197 | Ga0081539_10000042 | 3300005985 | Bacteria | 289955 |
| 198 | Ga0070715_10000517 | 3300006163 | Bacteria | 10106 |
| 199 | Ga0070712_100018220 | 3300006175 | Bacteria | 4558 |
| 200 | Ga0097621_100000352 | 3300006237 | Bacteria | 31757 |
| 201 | Ga0097621_100003204 | 3300006237 | Bacteria | 11241 |
| 202 | Ga0097621_100008440 | 3300006237 | Bacteria | 7421 |
| 203 | Ga0097621_100011128 | 3300006237 | Bacteria | 6619 |
| 204 | Ga0097621_100127285 | 3300006237 | Bacteria | 2164 |
| 205 | Ga0068871_100001720 | 3300006358 | Bacteria | 14724 |
| 206 | Ga0068871_100003066 | 3300006358 | Bacteria | 11455 |
| 207 | Ga0068871_100099900 | 3300006358 | Bacteria | 2430 |
| 208 | Ga0068871_100123516 | 3300006358 | Bacteria | 2189 |
| 209 | Ga0068871_100158155 | 3300006358 | Bacteria | 1936 |
| 210 | Ga0068865_100000660 | 3300006881 | Bacteria | 19448 |
| 211 | Ga0068865_100000735 | 3300006881 | Bacteria | 18419 |
| 212 | Ga0068865_100065807 | 3300006881 | Bacteria | 2555 |
| 213 | Ga0097620_100000289 | 3300006931 | Bacteria | 49979 |
| 214 | Ga0097620_100002592 | 3300006931 | Bacteria | 18396 |
| 215 | Ga0097620_100020301 | 3300006931 | Bacteria | 6669 |
| 216 | Ga0097620_100080330 | 3300006931 | Viruses | 3302 |
| 217 | Ga0097620_100250432 | 3300006931 | Bacteria | 1862 |
| 218 | Ga0105251_10001069 | 3300009011 | Bacteria | 23983 |
| 219 | Ga0105250_10000964 | 3300009092 | Bacteria | 16866 |
| 220 | Ga0105240_10000445 | 3300009093 | Bacteria | 76036 |
| 221 | Ga0105240_10000597 | 3300009093 | Bacteria | 67036 |
| 222 | Ga0105240_10001169 | 3300009093 | Bacteria | 46003 |
| 223 | Ga0105240_10002705 | 3300009093 | Bacteria | 28172 |
| 224 | Ga0105240_10002820 | 3300009093 | Bacteria | 27478 |
| 225 | Ga0105240_10003084 | 3300009093 | Bacteria | 26189 |
| 226 | Ga0105240_10003826 | 3300009093 | Bacteria | 23268 |
| 227 | Ga0105240_10014679 | 3300009093 | Bacteria | 10689 |
| 228 | Ga0105240_10067580 | 3300009093 | Unclassified | 4430 |
| 229 | Ga0105240_10122228 | 3300009093 | Unclassified | 3134 |
| 230 | Ga0105240_10156390 | 3300009093 | Bacteria | 2711 |
| 231 | Ga0105240_10184907 | 3300009093 | Unclassified | 2455 |
| 232 | Ga0111539_10020311 | 3300009094 | Bacteria | 8182 |
| 233 | Ga0111539_10089027 | 3300009094 | Bacteria | 3627 |
| 234 | Ga0105245_10007920 | 3300009098 | Bacteria | 9291 |
| 235 | Ga0105247_10000132 | 3300009101 | Bacteria | 72520 |
| 236 | Ga0105247_10000331 | 3300009101 | Bacteria | 41671 |
| 237 | Ga0105247_10031856 | 3300009101 | Bacteria | 3201 |
| 238 | Ga0114129_10017487 | 3300009147 | Bacteria | 10210 |
| 239 | Ga0105241_10000056 | 3300009174 | Bacteria | 84758 |
| 240 | Ga0105241_10000180 | 3300009174 | Bacteria | 47089 |
| 241 | Ga0105241_10058234 | 3300009174 | Bacteria | 2967 |
| 242 | Ga0105242_10005705 | 3300009176 | Bacteria | 9604 |
| 243 | Ga0105242_10035489 | 3300009176 | Bacteria | 3999 |
| 244 | Ga0105242_10078617 | 3300009176 | Bacteria | 2754 |
| 245 | Ga0105248_10005489 | 3300009177 | Bacteria | 13923 |
| 246 | Ga0105248_10033299 | 3300009177 | Bacteria | 5756 |
| 247 | Ga0105237_10000294 | 3300009545 | Bacteria | 69126 |
| 248 | Ga0105237_10000379 | 3300009545 | Bacteria | 63367 |
| 249 | Ga0105237_10002656 | 3300009545 | Bacteria | 21976 |
| 250 | Ga0105237_10058587 | 3300009545 | Unclassified | 3855 |
| 251 | Ga0105237_10065649 | 3300009545 | Unclassified | 3625 |
| 252 | Ga0105237_10094123 | 3300009545 | Bacteria | 2985 |
| 253 | Ga0105237_10507142 | 3300009545 | Bacteria | 1213 |
| 254 | Ga0105238_10001087 | 3300009551 | Bacteria | 27427 |
| 255 | Ga0105238_10008320 | 3300009551 | Bacteria | 10374 |
| 256 | Ga0105238_10128706 | 3300009551 | Bacteria | 2510 |
| 257 | Ga0105238_10137353 | 3300009551 | Bacteria | 2422 |
| 258 | Ga0105238_10629918 | 3300009551 | Bacteria | 1082 |
| 259 | Ga0105249_10001162 | 3300009553 | Bacteria | 23270 |
| 260 | Ga0105249_10003119 | 3300009553 | Bacteria | 14328 |
| 261 | Ga0105249_10006156 | 3300009553 | Bacteria | 10408 |
| 262 | Ga0105249_10108945 | 3300009553 | Bacteria | 2615 |
| 263 | Ga0105249_10377449 | 3300009553 | Unclassified | 1443 |
| 264 | Ga0105239_10000360 | 3300010375 | Bacteria | 66494 |
| 265 | Ga0105239_10000628 | 3300010375 | Bacteria | 50293 |
| 266 | Ga0105239_10001099 | 3300010375 | Bacteria | 37369 |
| 267 | Ga0105239_10003340 | 3300010375 | Bacteria | 19725 |
| 268 | Ga0105239_10038285 | 3300010375 | Bacteria | 5255 |
| 269 | Ga0105239_10148007 | 3300010375 | Bacteria | 2620 |
| 270 | Ga0105239_10423671 | 3300010375 | Bacteria | 1508 |
| 271 | Ga0105239_10453007 | 3300010375 | Unclassified | 1456 |
| 272 | Ga0105246_10313818 | 3300011119 | Bacteria | 1271 |
| 273 | Ga0105246_10413041 | 3300011119 | Bacteria | 1124 |
| 274 | Ga0157373_10001202 | 3300013100 | Bacteria | 19803 |
| 275 | Ga0157373_10019084 | 3300013100 | Bacteria | 4991 |
| 276 | Ga0157373_10176833 | 3300013100 | Bacteria | 1502 |
| 277 | Ga0157371_10001044 | 3300013102 | Bacteria | 30377 |
| 278 | Ga0157371_10002756 | 3300013102 | Bacteria | 16506 |
| 279 | Ga0157371_10002926 | 3300013102 | Bacteria | 15940 |
| 280 | Ga0157371_10010251 | 3300013102 | Bacteria | 7316 |
| 281 | Ga0157371_10012575 | 3300013102 | Bacteria | 6465 |
| 282 | Ga0157371_10016452 | 3300013102 | Bacteria | 5519 |
| 283 | Ga0157371_10050241 | 3300013102 | Unclassified | 2962 |
| 284 | Ga0157371_10084464 | 3300013102 | Bacteria | 2249 |
| 285 | Ga0157371_10111622 | 3300013102 | Bacteria | 1940 |
| 286 | Ga0157371_10120663 | 3300013102 | Unclassified | 1864 |
| 287 | Ga0157370_10000491 | 3300013104 | Bacteria | 49237 |
| 288 | Ga0157370_10000628 | 3300013104 | Bacteria | 43950 |
| 289 | Ga0157370_10000945 | 3300013104 | Bacteria | 36860 |
| 290 | Ga0157370_10001472 | 3300013104 | Bacteria | 29117 |
| 291 | Ga0157370_10004027 | 3300013104 | Bacteria | 17072 |
| 292 | Ga0157370_10018502 | 3300013104 | Bacteria | 7003 |
| 293 | Ga0157370_10019594 | 3300013104 | Bacteria | 6779 |
| 294 | Ga0157370_10019993 | 3300013104 | Bacteria | 6698 |
| 295 | Ga0157370_10180877 | 3300013104 | Bacteria | 1959 |
| 296 | Ga0157370_10481807 | 3300013104 | Bacteria | 1140 |
| 297 | Ga0157369_10020672 | 3300013105 | Bacteria | 7360 |
| 298 | Ga0157369_10023058 | 3300013105 | Bacteria | 6938 |
| 299 | Ga0157369_10036431 | 3300013105 | Bacteria | 5389 |
| 300 | Ga0157369_10055952 | 3300013105 | Unclassified | 4257 |
| 301 | Ga0157369_10231093 | 3300013105 | Bacteria | 1934 |
| 302 | Ga0157369_10477830 | 3300013105 | Bacteria | 1290 |
| 303 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 304 | Ga0157374_10000505 | 3300013296 | Bacteria | 35194 |
| 305 | Ga0157374_10009167 | 3300013296 | Bacteria | 8484 |
| 306 | Ga0157374_10034438 | 3300013296 | Bacteria | 4626 |
| 307 | Ga0157374_10035460 | 3300013296 | Bacteria | 4564 |
| 308 | Ga0157374_10039284 | 3300013296 | Bacteria | 4355 |
| 309 | Ga0157374_10078864 | 3300013296 | Bacteria | 3120 |
| 310 | Ga0157374_10132396 | 3300013296 | Bacteria | 2414 |
| 311 | Ga0157374_10238879 | 3300013296 | Bacteria | 1786 |
| 312 | Ga0157378_10004107 | 3300013297 | Bacteria | 12854 |
| 313 | Ga0157378_10004873 | 3300013297 | Bacteria | 11772 |
| 314 | Ga0157378_10035396 | 3300013297 | Unclassified | 4416 |
| 315 | Ga0157378_10044549 | 3300013297 | Bacteria | 3940 |
| 316 | Ga0157378_10162212 | 3300013297 | Unclassified | 2091 |
| 317 | Ga0157378_10428060 | 3300013297 | Unclassified | 1309 |
| 318 | Ga0163162_10000096 | 3300013306 | Bacteria | 80090 |
| 319 | Ga0163162_10000237 | 3300013306 | Bacteria | 50279 |
| 320 | Ga0163162_10001535 | 3300013306 | Bacteria | 21544 |
| 321 | Ga0163162_10017169 | 3300013306 | Bacteria | 7082 |
| 322 | Ga0163162_10043590 | 3300013306 | Bacteria | 4493 |
| 323 | Ga0157372_10001266 | 3300013307 | Bacteria | 27333 |
| 324 | Ga0157372_10002206 | 3300013307 | Bacteria | 21137 |
| 325 | Ga0157372_10033941 | 3300013307 | Bacteria | 5607 |
| 326 | Ga0157372_10043891 | 3300013307 | Bacteria | 4953 |
| 327 | Ga0157372_10082673 | 3300013307 | Bacteria | 3636 |
| 328 | Ga0157372_10087427 | 3300013307 | Bacteria | 3537 |
| 329 | Ga0157372_10088748 | 3300013307 | Unclassified | 3511 |
| 330 | Ga0157372_10133414 | 3300013307 | Bacteria | 2859 |
| 331 | Ga0157372_10141571 | 3300013307 | Bacteria | 2771 |
| 332 | Ga0157372_10147052 | 3300013307 | Bacteria | 2717 |
| 333 | Ga0157372_10161439 | 3300013307 | Bacteria | 2590 |
| 334 | Ga0157372_10191614 | 3300013307 | Bacteria | 2368 |
| 335 | Ga0157372_10289704 | 3300013307 | Bacteria | 1904 |
| 336 | Ga0157372_10441519 | 3300013307 | Bacteria | 1517 |
| 337 | Ga0157372_10485090 | 3300013307 | Bacteria | 1441 |
| 338 | Ga0157372_10526304 | 3300013307 | Bacteria | 1378 |
| 339 | Ga0157372_10602441 | 3300013307 | Bacteria | 1280 |
| 340 | Ga0157372_10714010 | 3300013307 | Bacteria | 1166 |
| 341 | Ga0157372_11051056 | 3300013307 | Bacteria | 943 |
| 342 | Ga0157375_10000599 | 3300013308 | Bacteria | 31988 |
| 343 | Ga0157375_10000622 | 3300013308 | Bacteria | 31461 |
| 344 | Ga0157375_10009700 | 3300013308 | Bacteria | 8464 |
| 345 | Ga0157375_10056438 | 3300013308 | Bacteria | 3877 |
| 346 | Ga0157375_10229802 | 3300013308 | Bacteria | 2014 |
| 347 | Ga0157375_10764967 | 3300013308 | Bacteria | 1116 |
| 348 | Ga0163163_10000251 | 3300014325 | Bacteria | 54526 |
| 349 | Ga0163163_10000703 | 3300014325 | Bacteria | 28430 |
| 350 | Ga0163163_10001228 | 3300014325 | Bacteria | 21670 |
| 351 | Ga0157380_10227853 | 3300014326 | Bacteria | 1671 |
| 352 | Ga0157377_10029766 | 3300014745 | Bacteria | 2952 |
| 353 | Ga0157377_10110211 | 3300014745 | Bacteria | 1653 |
| 354 | Ga0157379_10000128 | 3300014968 | Bacteria | 53403 |
| 355 | Ga0157376_10000334 | 3300014969 | Bacteria | 31383 |
| 356 | Ga0157376_10000971 | 3300014969 | Bacteria | 18693 |
| 357 | Ga0157376_10068087 | 3300014969 | Unclassified | 3013 |
| 358 | Ga0157376_10078346 | 3300014969 | Bacteria | 2829 |
| 359 | Ga0157376_10095468 | 3300014969 | Bacteria | 2586 |
| 360 | Ga0157376_10107897 | 3300014969 | Bacteria | 2445 |
| 361 | Ga0163161_10000052 | 3300017792 | Bacteria | 119943 |
| 362 | Ga0163161_10011663 | 3300017792 | Bacteria | 6100 |
| 363 | Ga0163161_10024797 | 3300017792 | Bacteria | 4239 |
| 364 | Ga0163161_10032265 | 3300017792 | Bacteria | 3738 |
| 365 | Ga0206356_11236474 | 3300020070 | Unclassified | 1030 |
| 366 | Ga0213876_10008793 | 3300021384 | Bacteria | 5454 |
| 367 | Ga0213876_10013593 | 3300021384 | Bacteria | 4319 |
| 368 | Ga0209646_1001958 | 3300025246 | Bacteria | 4969 |
| 369 | Ga0209676_1000485 | 3300025292 | Bacteria | 64653 |
| 370 | Ga0207656_10010828 | 3300025321 | Unclassified | 3429 |
| 371 | Ga0207696_1000014 | 3300025711 | Bacteria | 517939 |
| 372 | Ga0207713_1000109 | 3300025735 | Bacteria | 137009 |
| 373 | Ga0207642_10020063 | 3300025899 | Unclassified | 2602 |
| 374 | Ga0207642_10140733 | 3300025899 | Bacteria | 1272 |
| 375 | Ga0207710_10000007 | 3300025900 | Bacteria | 488292 |
| 376 | Ga0207710_10002459 | 3300025900 | Bacteria | 8588 |
| 377 | Ga0207710_10011647 | 3300025900 | Bacteria | 3701 |
| 378 | Ga0207680_10000223 | 3300025903 | Bacteria | 27399 |
| 379 | Ga0207680_10060636 | 3300025903 | Bacteria | 2303 |
| 380 | Ga0207647_10000358 | 3300025904 | Bacteria | 37132 |
| 381 | Ga0207647_10007138 | 3300025904 | Bacteria | 8101 |
| 382 | Ga0207647_10025085 | 3300025904 | Bacteria | 3924 |
| 383 | Ga0207647_10027722 | 3300025904 | Bacteria | 3689 |
| 384 | Ga0207645_10004116 | 3300025907 | Bacteria | 10812 |
| 385 | Ga0207645_10249609 | 3300025907 | Bacteria | 1174 |
| 386 | Ga0207705_10001296 | 3300025909 | Bacteria | 20071 |
| 387 | Ga0207705_10012281 | 3300025909 | Bacteria | 6188 |
| 388 | Ga0207705_10022510 | 3300025909 | Bacteria | 4494 |
| 389 | Ga0207705_10150612 | 3300025909 | Bacteria | 1743 |
| 390 | Ga0207705_10179697 | 3300025909 | Bacteria | 1596 |
| 391 | Ga0207705_10258906 | 3300025909 | Bacteria | 1328 |
| 392 | Ga0207705_10274608 | 3300025909 | Bacteria | 1289 |
| 393 | Ga0207705_10474639 | 3300025909 | Bacteria | 971 |
| 394 | Ga0207654_10001342 | 3300025911 | Bacteria | 13053 |
| 395 | Ga0207654_10087861 | 3300025911 | Unclassified | 1887 |
| 396 | Ga0207654_10154904 | 3300025911 | Bacteria | 1475 |
| 397 | Ga0207707_10000026 | 3300025912 | Bacteria | 175026 |
| 398 | Ga0207707_10000067 | 3300025912 | Bacteria | 105764 |
| 399 | Ga0207707_10000122 | 3300025912 | Bacteria | 80159 |
| 400 | Ga0207707_10018125 | 3300025912 | Bacteria | 6135 |
| 401 | Ga0207707_10021586 | 3300025912 | Bacteria | 5626 |
| 402 | Ga0207707_10058051 | 3300025912 | Bacteria | 3368 |
| 403 | Ga0207707_10063528 | 3300025912 | Bacteria | 3214 |
| 404 | Ga0207707_10103424 | 3300025912 | Bacteria | 2490 |
| 405 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 406 | Ga0207695_10000299 | 3300025913 | Bacteria | 122118 |
| 407 | Ga0207695_10000676 | 3300025913 | Bacteria | 67018 |
| 408 | Ga0207695_10002728 | 3300025913 | Bacteria | 25766 |
| 409 | Ga0207695_10003540 | 3300025913 | Bacteria | 21874 |
| 410 | Ga0207695_10015560 | 3300025913 | Bacteria | 8949 |
| 411 | Ga0207695_10024615 | 3300025913 | Bacteria | 6765 |
| 412 | Ga0207695_10280694 | 3300025913 | Bacteria | 1559 |
| 413 | Ga0207695_10306386 | 3300025913 | Bacteria | 1479 |
| 414 | Ga0207671_10001222 | 3300025914 | Bacteria | 30430 |
| 415 | Ga0207671_10019529 | 3300025914 | Bacteria | 5180 |
| 416 | Ga0207671_10020298 | 3300025914 | Bacteria | 5061 |
| 417 | Ga0207693_10000083 | 3300025915 | Bacteria | 84611 |
| 418 | Ga0207660_10007760 | 3300025917 | Bacteria | 6948 |
| 419 | Ga0207660_10034429 | 3300025917 | Bacteria | 3511 |
| 420 | Ga0207660_10171526 | 3300025917 | Bacteria | 1679 |
| 421 | Ga0207660_10311835 | 3300025917 | Unclassified | 1255 |
| 422 | Ga0207657_10004009 | 3300025919 | Bacteria | 15652 |
| 423 | Ga0207657_10011455 | 3300025919 | Bacteria | 8805 |
| 424 | Ga0207657_10102212 | 3300025919 | Bacteria | 2377 |
| 425 | Ga0207657_10274580 | 3300025919 | Bacteria | 1339 |
| 426 | Ga0207657_10422044 | 3300025919 | Bacteria | 1048 |
| 427 | Ga0207649_10436275 | 3300025920 | Unclassified | 986 |
| 428 | Ga0207652_10000051 | 3300025921 | Bacteria | 120327 |
| 429 | Ga0207652_10000109 | 3300025921 | Bacteria | 89337 |
| 430 | Ga0207652_10000187 | 3300025921 | Bacteria | 65282 |
| 431 | Ga0207652_10001479 | 3300025921 | Bacteria | 20778 |
| 432 | Ga0207652_10036588 | 3300025921 | Bacteria | 4150 |
| 433 | Ga0207652_10079076 | 3300025921 | Bacteria | 2872 |
| 434 | Ga0207652_10094539 | 3300025921 | Bacteria | 2632 |
| 435 | Ga0207652_10230880 | 3300025921 | Unclassified | 1668 |
| 436 | Ga0207652_10285313 | 3300025921 | Bacteria | 1489 |
| 437 | Ga0207652_10299558 | 3300025921 | Bacteria | 1451 |
| 438 | Ga0207681_10034644 | 3300025923 | Bacteria | 3321 |
| 439 | Ga0207694_10003403 | 3300025924 | Bacteria | 12669 |
| 440 | Ga0207694_10035018 | 3300025924 | Bacteria | 3850 |
| 441 | Ga0207694_10420847 | 3300025924 | Bacteria | 1113 |
| 442 | Ga0207650_10001053 | 3300025925 | Bacteria | 20514 |
| 443 | Ga0207650_10025654 | 3300025925 | Unclassified | 4199 |
| 444 | Ga0207650_10049949 | 3300025925 | Unclassified | 3091 |
| 445 | Ga0207650_10156597 | 3300025925 | Bacteria | 1802 |
| 446 | Ga0207650_10227617 | 3300025925 | Bacteria | 1503 |
| 447 | Ga0207659_10048990 | 3300025926 | Bacteria | 2995 |
| 448 | Ga0207659_10087143 | 3300025926 | Bacteria | 2323 |
| 449 | Ga0207644_10065750 | 3300025931 | Unclassified | 2638 |
| 450 | Ga0207690_10036796 | 3300025932 | Bacteria | 3172 |
| 451 | Ga0207690_10173416 | 3300025932 | Bacteria | 1617 |
| 452 | Ga0207690_10231126 | 3300025932 | Bacteria | 1420 |
| 453 | Ga0207706_10014587 | 3300025933 | Bacteria | 7117 |
| 454 | Ga0207686_10015135 | 3300025934 | Bacteria | 4308 |
| 455 | Ga0207686_10032950 | 3300025934 | Bacteria | 3088 |
| 456 | Ga0207669_10329338 | 3300025937 | Unclassified | 1172 |
| 457 | Ga0207704_10001257 | 3300025938 | Bacteria | 11322 |
| 458 | Ga0207704_10366048 | 3300025938 | Bacteria | 1127 |
| 459 | Ga0207704_10428002 | 3300025938 | Bacteria | 1051 |
| 460 | Ga0207691_10000057 | 3300025940 | Bacteria | 89823 |
| 461 | Ga0207691_10109087 | 3300025940 | Bacteria | 2463 |
| 462 | Ga0207691_10364236 | 3300025940 | Bacteria | 1236 |
| 463 | Ga0207711_10204004 | 3300025941 | Unclassified | 1805 |
| 464 | Ga0207689_10027705 | 3300025942 | Bacteria | 4742 |
| 465 | Ga0207689_10319633 | 3300025942 | Bacteria | 1288 |
| 466 | Ga0207689_10352703 | 3300025942 | Bacteria | 1223 |
| 467 | Ga0207689_10424022 | 3300025942 | Unclassified | 1110 |
| 468 | Ga0207661_10034174 | 3300025944 | Unclassified | 3952 |
| 469 | Ga0207661_10076137 | 3300025944 | Unclassified | 2755 |
| 470 | Ga0207661_10324434 | 3300025944 | Bacteria | 1385 |
| 471 | Ga0207679_10027706 | 3300025945 | Unclassified | 3922 |
| 472 | Ga0207679_10242784 | 3300025945 | Bacteria | 1527 |
| 473 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 474 | Ga0207667_10000492 | 3300025949 | Bacteria | 52207 |
| 475 | Ga0207667_10000798 | 3300025949 | Bacteria | 40876 |
| 476 | Ga0207667_10001462 | 3300025949 | Bacteria | 29619 |
| 477 | Ga0207667_10001836 | 3300025949 | Bacteria | 26673 |
| 478 | Ga0207667_10005296 | 3300025949 | Bacteria | 15731 |
| 479 | Ga0207667_10010124 | 3300025949 | Bacteria | 11044 |
| 480 | Ga0207667_10019110 | 3300025949 | Bacteria | 7661 |
| 481 | Ga0207667_10024664 | 3300025949 | Bacteria | 6597 |
| 482 | Ga0207667_10127082 | 3300025949 | Bacteria | 2626 |
| 483 | Ga0207667_10174790 | 3300025949 | Unclassified | 2207 |
| 484 | Ga0207651_10000330 | 3300025960 | Bacteria | 20100 |
| 485 | Ga0207651_10089576 | 3300025960 | Bacteria | 2247 |
| 486 | Ga0207712_10188008 | 3300025961 | Bacteria | 1628 |
| 487 | Ga0207712_10336024 | 3300025961 | Bacteria | 1251 |
| 488 | Ga0207668_10000736 | 3300025972 | Bacteria | 20067 |
| 489 | Ga0207658_10002480 | 3300025986 | Bacteria | 13457 |
| 490 | Ga0207658_10004083 | 3300025986 | Bacteria | 10178 |
| 491 | Ga0207658_10021367 | 3300025986 | Bacteria | 4492 |
| 492 | Ga0207658_10162652 | 3300025986 | Bacteria | 1831 |
| 493 | Ga0207677_10002398 | 3300026023 | Bacteria | 9824 |
| 494 | Ga0207677_10035468 | 3300026023 | Unclassified | 3240 |
| 495 | Ga0207677_10036508 | 3300026023 | Bacteria | 3204 |
| 496 | Ga0207703_10001287 | 3300026035 | Bacteria | 23239 |
| 497 | Ga0207639_10001406 | 3300026041 | Bacteria | 16243 |
| 498 | Ga0207639_10006152 | 3300026041 | Bacteria | 8149 |
| 499 | Ga0207639_10006581 | 3300026041 | Bacteria | 7902 |
| 500 | Ga0207639_10030877 | 3300026041 | Bacteria | 3933 |
| 501 | Ga0207639_10055842 | 3300026041 | Bacteria | 3024 |
| 502 | Ga0207639_10344304 | 3300026041 | Bacteria | 1330 |
| 503 | Ga0207678_10224817 | 3300026067 | Bacteria | 1607 |
| 504 | Ga0207702_10015635 | 3300026078 | Bacteria | 6282 |
| 505 | Ga0207702_10018654 | 3300026078 | Bacteria | 5739 |
| 506 | Ga0207702_10038203 | 3300026078 | Bacteria | 4021 |
| 507 | Ga0207702_10090174 | 3300026078 | Bacteria | 2682 |
| 508 | Ga0207702_10119116 | 3300026078 | Bacteria | 2360 |
| 509 | Ga0207702_10159541 | 3300026078 | Bacteria | 2059 |
| 510 | Ga0207702_10166913 | 3300026078 | Bacteria | 2015 |
| 511 | Ga0207702_10173228 | 3300026078 | Bacteria | 1981 |
| 512 | Ga0207641_10005451 | 3300026088 | Bacteria | 10856 |
| 513 | Ga0207641_10071587 | 3300026088 | Bacteria | 2983 |
| 514 | Ga0207641_10100844 | 3300026088 | Bacteria | 2543 |
| 515 | Ga0207648_10003815 | 3300026089 | Bacteria | 15758 |
| 516 | Ga0207648_10004995 | 3300026089 | Bacteria | 13479 |
| 517 | Ga0207648_10044309 | 3300026089 | Bacteria | 3903 |
| 518 | Ga0207648_10068027 | 3300026089 | Unclassified | 3104 |
| 519 | Ga0207676_10002484 | 3300026095 | Bacteria | 13139 |
| 520 | Ga0207676_10362322 | 3300026095 | Unclassified | 1344 |
| 521 | Ga0207676_10581795 | 3300026095 | Unclassified | 1073 |
| 522 | Ga0207674_10007313 | 3300026116 | Bacteria | 12866 |
| 523 | Ga0207674_10063048 | 3300026116 | Bacteria | 3742 |
| 524 | Ga0207674_10092279 | 3300026116 | Bacteria | 3018 |
| 525 | Ga0207674_10101246 | 3300026116 | Bacteria | 2862 |
| 526 | Ga0207674_10372073 | 3300026116 | Bacteria | 1381 |
| 527 | Ga0207674_10582874 | 3300026116 | Bacteria | 1080 |
| 528 | Ga0207675_100074714 | 3300026118 | Bacteria | 3172 |
| 529 | Ga0207675_100171854 | 3300026118 | Bacteria | 2072 |
| 530 | Ga0207675_100286387 | 3300026118 | Unclassified | 1602 |
| 531 | Ga0207683_10004897 | 3300026121 | Bacteria | 11526 |
| 532 | Ga0207683_10038510 | 3300026121 | Bacteria | 4168 |
| 533 | Ga0207683_10143289 | 3300026121 | Unclassified | 2154 |
| 534 | Ga0207683_10435664 | 3300026121 | Unclassified | 1208 |
| 535 | Ga0207698_10025447 | 3300026142 | Bacteria | 4170 |
| 536 | Ga0207698_10033077 | 3300026142 | Bacteria | 3754 |
| 537 | Ga0207698_10035280 | 3300026142 | Bacteria | 3657 |
| 538 | Ga0207698_10047364 | 3300026142 | Unclassified | 3256 |
| 539 | Ga0207698_10100045 | 3300026142 | Bacteria | 2400 |
| 540 | Ga0207698_10157758 | 3300026142 | Bacteria | 1980 |
| 541 | Ga0207698_10199081 | 3300026142 | Bacteria | 1792 |
| 542 | Ga0207698_10403180 | 3300026142 | Bacteria | 1307 |
| 543 | Ga0209371_1000822 | 3300027312 | Bacteria | 25564 |
| 544 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 545 | Ga0268266_10005746 | 3300028379 | Bacteria | 11482 |
| 546 | Ga0268265_10405181 | 3300028380 | Bacteria | 1262 |
| 547 | Ga0268265_10407220 | 3300028380 | Unclassified | 1259 |
| 548 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 549 | Ga0268264_10002163 | 3300028381 | Bacteria | 17523 |
| 550 | Ga0268264_10002184 | 3300028381 | Bacteria | 17393 |
| 551 | Ga0268264_10004004 | 3300028381 | Bacteria | 12611 |
| 552 | Ga0268264_10086592 | 3300028381 | Bacteria | 2692 |
| 553 | Ga0268264_10300515 | 3300028381 | Bacteria | 1511 |
| 554 | Ga0307517_10016737 | 3300028786 | Bacteria | 9612 |
| 555 | Ga0307517_10115738 | 3300028786 | Bacteria | 2011 |
| 556 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 557 | Ga0307515_10000778 | 3300028794 | Bacteria | 73451 |
| 558 | Ga0307515_10003029 | 3300028794 | Bacteria | 35637 |
| 559 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 560 | Ga0316177_1157475 | 3300030731 | Bacteria | 8234 |
| 561 | Ga0316182_1062439 | 3300030745 | Bacteria | 3006 |
| 562 | Ga0265340_10099240 | 3300031247 | Bacteria | 1355 |
| 563 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 564 | Ga0265327_10017415 | 3300031251 | Bacteria | 4509 |
| 565 | Ga0265327_10138812 | 3300031251 | Bacteria | 1137 |
| 566 | Ga0265316_10156761 | 3300031344 | Bacteria | 1704 |
| 567 | Ga0307513_10239473 | 3300031456 | Unclassified | 1620 |
| 568 | Ga0307509_10182649 | 3300031507 | Bacteria | 1960 |
| 569 | Ga0265313_10092889 | 3300031595 | Bacteria | 1351 |
| 570 | Ga0307516_10000486 | 3300031730 | Bacteria | 52749 |
| 571 | Ga0307516_10091542 | 3300031730 | Bacteria | 2869 |
| 572 | Ga0307405_10028543 | 3300031731 | Bacteria | 3251 |
| 573 | Ga0307410_10125608 | 3300031852 | Bacteria | 1878 |
| 574 | Ga0307410_10159570 | 3300031852 | Unclassified | 1688 |
| 575 | Ga0307407_10288883 | 3300031903 | Unclassified | 1139 |
| 576 | Ga0307412_10055289 | 3300031911 | Bacteria | 2639 |
| 577 | Ga0307412_10083586 | 3300031911 | Bacteria | 2214 |
| 578 | Ga0307412_10467066 | 3300031911 | Bacteria | 1043 |
| 579 | Ga0307414_10064093 | 3300032004 | Bacteria | 2615 |
| 580 | Ga0307414_10327145 | 3300032004 | Bacteria | 1307 |
| 581 | Ga0307414_10563184 | 3300032004 | Bacteria | 1017 |
| 582 | Ga0307510_10002428 | 3300033180 | Bacteria | 21155 |
| 583 | Ga0373943_0136797 | 3300035170 | Bacteria | 1316 |
| 584 | Ga0373927_0006326 | 3300035695 | Bacteria | 8071 |
| 585 | Ga0373947_0089723 | 3300035725 | Bacteria | 1915 |
| 586 | Ga0373937_0284102 | 3300036401 | Bacteria | 1563 |
| 587 | Ga0316584_0006323 | 3300036712 | Bacteria | 8021 |
| 588 | Ga0373925_0669475 | 3300037068 | Bacteria | 855 |
| 589 | Ga0395899_0006244 | 3300037312 | Bacteria | 9230 |
| 590 | Ga0395900_0011131 | 3300037418 | Bacteria | 9194 |
| 591 | Ga0395900_0091423 | 3300037418 | Unclassified | 3127 |
| 592 | Ga0395900_0309388 | 3300037418 | Bacteria | 1563 |
| 593 | Ga0395900_0693573 | 3300037418 | Unclassified | 952 |
| 594 | Ga0395898_0001425 | 3300037466 | Bacteria | 34011 |
| 595 | Ga0395898_0014579 | 3300037466 | Bacteria | 8070 |
| 596 | Ga0395898_0584194 | 3300037466 | Bacteria | 1059 |
| 597 | Ga0395898_0885958 | 3300037466 | Unclassified | 831 |
| 598 | Ga0395905_0002632 | 3300037471 | Bacteria | 19709 |
| 599 | Ga0395905_0055864 | 3300037471 | Bacteria | 3695 |
| 600 | Ga0395905_0147405 | 3300037471 | Bacteria | 2214 |
| 601 | Ga0395905_0151976 | 3300037471 | Bacteria | 2178 |
| 602 | Ga0395901_0013086 | 3300038443 | Bacteria | 8420 |
| 603 | Ga0395901_0015165 | 3300038443 | Bacteria | 7837 |
| 604 | Ga0395901_0022855 | 3300038443 | Bacteria | 6411 |
| 605 | Ga0395901_0226549 | 3300038443 | Unclassified | 1952 |
| 606 | Ga0395901_0270417 | 3300038443 | Unclassified | 1768 |
| 607 | Ga0400484_14764 | 3300038725 | Bacteria | 7948 |
| 608 | Ga0400490_41645 | 3300038726 | Bacteria | 2224 |
| 609 | Ga0400488_01959 | 3300038741 | Bacteria | 14805 |
| 610 | Ga0400488_49253 | 3300038741 | Unclassified | 2427 |
| 611 | Ga0400483_083912 | 3300039062 | Bacteria | 11462 |
| 612 | Ga0400489_76974 | 3300039093 | Bacteria | 25095 |
| 613 | Ga0436365_1821680 | 3300039437 | Bacteria | 4564 |
| 614 | Ga0436365_1875604 | 3300039437 | Bacteria | 17186 |
| 615 | Ga0439465_0016138 | 3300041413 | Bacteria | 2329 |
| 616 | Ga0451807_0732940 | 3300041486 | Bacteria | 1538 |
| 617 | Ga0451843_0079405 | 3300041509 | Bacteria | 2070 |
| 618 | Ga0439431_0037381 | 3300041997 | Unclassified | 1225 |
| 619 | Ga0439442_008518 | 3300042002 | Unclassified | 2070 |
| 620 | Ga0439445_0008720 | 3300042004 | Unclassified | 2378 |
| 621 | Ga0439449_0035992 | 3300042007 | Unclassified | 1841 |
| 622 | Ga0439449_0099587 | 3300042007 | Bacteria | 1074 |
| 623 | Ga0439457_014457 | 3300042014 | Unclassified | 1766 |
| 624 | Ga0439434_0076203 | 3300042435 | Unclassified | 1060 |
| 625 | Ga0451577_0165277 | 3300042876 | Bacteria | 1993 |
| 626 | Ga0451577_0456291 | 3300042876 | Bacteria | 1161 |
| 627 | Ga0466969_0021061 | 3300044656 | Bacteria | 3373 |
| 628 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 629 | Ga0466972_0000044 | 3300044658 | Bacteria | 131031 |
| 630 | Ga0466972_0009913 | 3300044658 | Bacteria | 4781 |
| 631 | Ga0453683_0203415 | 3300044673 | Bacteria | 1257 |
| 632 | Ga0453683_0292019 | 3300044673 | Unclassified | 1042 |
| 633 | Ga0466966_0026346 | 3300044684 | Bacteria | 3796 |
| 634 | Ga0466966_0035229 | 3300044684 | Bacteria | 3235 |
| 635 | Ga0466961_0016877 | 3300044693 | Bacteria | 4691 |
| 636 | Ga0466961_0048369 | 3300044693 | Bacteria | 2718 |
| 637 | Ga0466961_0227683 | 3300044693 | Bacteria | 1148 |
| 638 | Ga0466963_0041077 | 3300044694 | Bacteria | 3032 |
| 639 | Ga0466964_0000208 | 3300044706 | Bacteria | 16611 |
| 640 | Ga0466964_0008038 | 3300044706 | Bacteria | 3954 |
| 641 | Ga0466964_0086505 | 3300044706 | Unclassified | 1356 |
| 642 | Ga0453684_0000311 | 3300044712 | Bacteria | 206847 |
| 643 | Ga0453684_0004045 | 3300044712 | Bacteria | 31879 |
| 644 | Ga0453684_0005017 | 3300044712 | Bacteria | 26881 |
| 645 | Ga0453684_0029545 | 3300044712 | Bacteria | 7778 |
| 646 | Ga0453684_0683921 | 3300044712 | Bacteria | 1116 |
| 647 | Ga0453684_0812534 | 3300044712 | Bacteria | 1007 |
| 648 | Ga0466971_0002696 | 3300044719 | Bacteria | 7502 |
| 649 | Ga0466971_0035320 | 3300044719 | Bacteria | 2240 |
| 650 | Ga0466968_0024864 | 3300044735 | Bacteria | 2450 |
| 651 | Ga0466968_0056525 | 3300044735 | Unclassified | 1686 |
| 652 | Ga0466970_0000486 | 3300044765 | Bacteria | 19528 |
| 653 | Ga0466970_0257209 | 3300044765 | Bacteria | 979 |
| 654 | Ga0466957_0059357 | 3300044842 | Bacteria | 2345 |
| 655 | Ga0466960_0076280 | 3300044901 | Bacteria | 1679 |
| 656 | Ga0466960_0197565 | 3300044901 | Unclassified | 1097 |
| 657 | Ga0466959_0000904 | 3300045049 | Bacteria | 17527 |
| 658 | Ga0466959_0008505 | 3300045049 | Bacteria | 7263 |
| 659 | Ga0466959_0064253 | 3300045049 | Bacteria | 2665 |
| 660 | Ga0466959_0149935 | 3300045049 | Bacteria | 1644 |
| 661 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 662 | Ga0451576_0033300 | 3300045051 | Bacteria | 5478 |
| 663 | Ga0451576_0658158 | 3300045051 | Bacteria | 1101 |
| 664 | Ga0466967_0004457 | 3300045976 | Bacteria | 9448 |
| 665 | Ga0495629_0494799 | 3300046459 | Bacteria | 825 |
| 666 | Ga0495638_0062409 | 3300046460 | Bacteria | 2300 |
| 667 | Ga0495582_0111349 | 3300046473 | Bacteria | 1538 |
| 668 | Ga0495606_0124843 | 3300046507 | Bacteria | 1536 |
| 669 | Ga0495630_0186089 | 3300046517 | Bacteria | 1584 |
| 670 | Ga0495643_0010737 | 3300046522 | Bacteria | 5625 |
| 671 | Ga0495648_0002190 | 3300046524 | Bacteria | 18309 |
| 672 | Ga0495586_0102124 | 3300046535 | Unclassified | 1592 |
| 673 | Ga0495586_0124937 | 3300046535 | Bacteria | 1439 |
| 674 | Ga0495668_0000187 | 3300046616 | Bacteria | 92571 |
| 675 | Ga0495611_0000065 | 3300046648 | Bacteria | 74332 |
| 676 | Ga0495624_0101766 | 3300046690 | Bacteria | 1769 |
| 677 | Ga0495649_0136271 | 3300046694 | Bacteria | 1294 |
| 678 | Ga0495581_0097363 | 3300047315 | Bacteria | 1709 |
| 679 | Ga0495674_0118810 | 3300047319 | Bacteria | 2235 |
| 680 | Ga0495687_000129 | 3300047443 | Bacteria | 116030 |
| 681 | Ga0495684_0178751 | 3300047471 | Bacteria | 1574 |
| 682 | Ga0495686_0110735 | 3300047472 | Bacteria | 1647 |
| 683 | Ga0496100_0035556 | 3300048903 | Bacteria | 3134 |
| 684 | Ga0496100_0073676 | 3300048903 | Bacteria | 2286 |
| 685 | Ga0496101_0016241 | 3300048904 | Bacteria | 5024 |
| 686 | Ga0496102_0006064 | 3300048905 | Bacteria | 10305 |
| 687 | Ga0496103_0025983 | 3300048906 | Bacteria | 3543 |
| 688 | Ga0496103_0029252 | 3300048906 | Bacteria | 3348 |
| 689 | Ga0496104_0253321 | 3300048907 | Bacteria | 1673 |
| 690 | Ga0496104_0461326 | 3300048907 | Unclassified | 1182 |
| 691 | Ga0496107_0001015 | 3300048910 | Bacteria | 16758 |
| 692 | Ga0496108_0005792 | 3300048911 | Bacteria | 10014 |
| 693 | Ga0496109_0032631 | 3300048912 | Bacteria | 4682 |
| 694 | Ga0496109_0064498 | 3300048912 | Bacteria | 3352 |
| 695 | Ga0496110_0000749 | 3300048913 | Bacteria | 22420 |
| 696 | Ga0496112_0011995 | 3300048915 | Bacteria | 7946 |
| 697 | Ga0496113_0079186 | 3300048916 | Bacteria | 2515 |
| 698 | Ga0496114_0004273 | 3300048917 | Bacteria | 11058 |
| 699 | Ga0496114_0154237 | 3300048917 | Bacteria | 1993 |
| 700 | Ga0496115_0001691 | 3300048918 | Bacteria | 15816 |
| 701 | Ga0496115_0206207 | 3300048918 | Bacteria | 1624 |
| 702 | Ga0496116_0000009 | 3300048919 | Bacteria | 716119 |
| 703 | Ga0496117_0001526 | 3300048920 | Bacteria | 33056 |
| 704 | Ga0496118_0002425 | 3300048921 | Bacteria | 25126 |
| 705 | Ga0496118_0016140 | 3300048921 | Bacteria | 6868 |
| 706 | Ga0496119_0012983 | 3300048922 | Bacteria | 6693 |
| 707 | Ga0496120_0100561 | 3300048923 | Bacteria | 1529 |
| 708 | Ga0496124_0059093 | 3300048927 | Bacteria | 3222 |
| 709 | Ga0501031_0012718 | 3300049568 | Bacteria | 5497 |
| 710 | Ga0501032_0000800 | 3300049569 | Bacteria | 25544 |
| 711 | Ga0501032_0001218 | 3300049569 | Bacteria | 20593 |
| 712 | Ga0501032_0001241 | 3300049569 | Bacteria | 20473 |
| 713 | Ga0501033_0000199 | 3300049570 | Bacteria | 57341 |
| 714 | Ga0501033_0147395 | 3300049570 | Bacteria | 1699 |
| 715 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 716 | Ga0501034_0000506 | 3300049571 | Bacteria | 62858 |
| 717 | Ga0501034_0012011 | 3300049571 | Bacteria | 8950 |
| 718 | Ga0501034_0093334 | 3300049571 | Bacteria | 3006 |
| 719 | Ga0501034_0094225 | 3300049571 | Bacteria | 2991 |
| 720 | Ga0501034_0307672 | 3300049571 | Bacteria | 1520 |
| 721 | Ga0501034_0357151 | 3300049571 | Bacteria | 1389 |
| 722 | Ga0501036_0096330 | 3300049572 | Bacteria | 2501 |
| 723 | Ga0501036_0612702 | 3300049572 | Bacteria | 902 |
| 724 | Ga0501037_0018322 | 3300049573 | Bacteria | 5159 |
| 725 | Ga0501037_0077497 | 3300049573 | Bacteria | 2412 |
| 726 | Ga0501037_0085574 | 3300049573 | Unclassified | 2283 |
| 727 | Ga0501038_0011233 | 3300049574 | Bacteria | 8175 |
| 728 | Ga0501038_0131985 | 3300049574 | Bacteria | 2050 |
| 729 | Ga0501038_0160766 | 3300049574 | Bacteria | 1825 |
| 730 | Ga0501039_0001671 | 3300049575 | Bacteria | 16340 |
| 731 | Ga0501039_0006315 | 3300049575 | Bacteria | 8998 |
| 732 | Ga0501039_0018039 | 3300049575 | Bacteria | 5414 |
| 733 | Ga0501039_0428723 | 3300049575 | Unclassified | 1039 |
| 734 | Ga0501043_0005572 | 3300049579 | Bacteria | 10146 |
| 735 | Ga0501043_0026745 | 3300049579 | Bacteria | 4526 |
| 736 | Ga0501043_0173560 | 3300049579 | Bacteria | 1681 |
| 737 | Ga0501046_0064362 | 3300049580 | Bacteria | 2862 |
| 738 | Ga0501047_0063396 | 3300049581 | Bacteria | 3566 |
| 739 | Ga0501047_0136410 | 3300049581 | Bacteria | 2334 |
| 740 | Ga0501047_0314816 | 3300049581 | Bacteria | 1405 |
| 741 | Ga0501048_0006736 | 3300049582 | Bacteria | 8728 |
| 742 | Ga0501067_0012669 | 3300049583 | Bacteria | 4677 |
| 743 | Ga0501069_0018408 | 3300049585 | Unclassified | 3769 |
| 744 | Ga0501069_0135406 | 3300049585 | Bacteria | 1412 |
| 745 | Ga0501070_0160549 | 3300049586 | Bacteria | 1853 |
| 746 | Ga0501071_0076790 | 3300049587 | Bacteria | 2440 |
| 747 | Ga0501072_0093041 | 3300049588 | Bacteria | 2395 |
| 748 | Ga0501072_0196146 | 3300049588 | Bacteria | 1610 |
| 749 | Ga0501073_0010622 | 3300049589 | Bacteria | 6737 |
| 750 | Ga0501073_0021790 | 3300049589 | Bacteria | 4616 |
| 751 | Ga0501074_0000935 | 3300049590 | Bacteria | 18795 |
| 752 | Ga0501074_0039165 | 3300049590 | Bacteria | 3433 |
| 753 | Ga0501202_004421 | 3300049652 | Bacteria | 2460 |
| 754 | Ga0501217_019316 | 3300049661 | Bacteria | 1590 |
| 755 | Ga0501223_016511 | 3300049663 | Bacteria | 1459 |
| 756 | Ga0501227_012930 | 3300049665 | Bacteria | 1834 |
| 757 | Ga0501235_037638 | 3300049669 | Unclassified | 1101 |
| 758 | Ga0501242_000505 | 3300049674 | Bacteria | 3452 |
| 759 | Ga0501219_000019 | 3300049703 | Bacteria | 25267 |
| 760 | Ga0501225_0001000 | 3300049705 | Bacteria | 8866 |
| 761 | Ga0501225_0053277 | 3300049705 | Bacteria | 1129 |
| 762 | Ga0501080_0075039 | 3300049742 | Bacteria | 3145 |
| 763 | Ga0501080_0100361 | 3300049742 | Bacteria | 2685 |
| 764 | Ga0501080_0168781 | 3300049742 | Bacteria | 2019 |
| 765 | Ga0501080_0487070 | 3300049742 | Bacteria | 1103 |
| 766 | Ga0501083_0030933 | 3300049744 | Bacteria | 3674 |
| 767 | Ga0501266_001843 | 3300049763 | Bacteria | 2674 |
| 768 | Ga0501035_0001716 | 3300049822 | Bacteria | 22138 |
| 769 | Ga0501035_0043045 | 3300049822 | Bacteria | 4071 |
| 770 | Ga0501035_0043246 | 3300049822 | Bacteria | 4060 |
| 771 | Ga0501035_0338162 | 3300049822 | Unclassified | 1262 |
| 772 | Ga0501044_0009431 | 3300049823 | Bacteria | 10631 |
| 773 | Ga0501044_0018177 | 3300049823 | Bacteria | 7540 |
| 774 | Ga0501044_0018364 | 3300049823 | Bacteria | 7494 |
| 775 | Ga0501044_0032501 | 3300049823 | Bacteria | 5486 |
| 776 | Ga0501045_0000122 | 3300049824 | Bacteria | 40414 |
| 777 | Ga0501045_0039408 | 3300049824 | Bacteria | 3438 |
| 778 | Ga0501284_00007 | 3300050005 | Bacteria | 147956 |
| 779 | nmdc:mga05p37_2990_c1 | 3300050507 | Bacteria | 19630 |
| 780 | nmdc:mga08y16_15141_c1 | 3300050511 | Bacteria | 8107 |
| 781 | Ga0500578_0000026 | 3300053086 | Bacteria | 145328 |
| 782 | Ga0500644_0011243 | 3300053088 | Unclassified | 2443 |
| 783 | Ga0500647_0097511 | 3300053091 | Bacteria | 1405 |
| 784 | Ga0500583_0052500 | 3300053092 | Bacteria | 1897 |
| 785 | Ga0500651_0147083 | 3300053093 | Bacteria | 1417 |
| 786 | Ga0500562_000053 | 3300053108 | Bacteria | 58984 |
| 787 | Ga0500642_0062036 | 3300053130 | Bacteria | 1681 |
| 788 | Ga0500642_0064529 | 3300053130 | Bacteria | 1653 |
| 789 | Ga0500568_0000298 | 3300053139 | Bacteria | 40260 |
| 790 | Ga0500568_0009829 | 3300053139 | Bacteria | 4520 |
| 791 | Ga0500588_0090237 | 3300053146 | Bacteria | 1040 |
| 792 | Ga0500604_0019153 | 3300053151 | Unclassified | 1914 |
| 793 | Ga0500616_0000910 | 3300053153 | Bacteria | 32358 |
| 794 | Ga0500616_0140391 | 3300053153 | Unclassified | 1130 |
| 795 | Ga0500622_0001947 | 3300053156 | Bacteria | 15544 |
| 796 | Ga0500622_0006108 | 3300053156 | Bacteria | 7070 |
| 797 | Ga0500637_0096854 | 3300053178 | Bacteria | 1710 |
| 798 | Ga0500637_0101999 | 3300053178 | Bacteria | 1664 |
| 799 | Ga0501084_0036272 | 3300054114 | Bacteria | 4119 |
| 800 | Ga0587077_006542 | 3300059493 | Bacteria | 1655 |
| 801 | Ga0501082_0069209 | 3300060353 | Bacteria | 3038 |
| 802 | Ga0501082_0244375 | 3300060353 | Bacteria | 1562 |
| 803 | Ga0466962_0024213 | 3300061719 | Bacteria | 2917 |
| 804 | Ga0466962_0276228 | 3300061719 | Bacteria | 829 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044719 | Ga0466971_0035320 | Ga0466971_0035320_1581_2225 | 210 |
| 2 | 3300044712 | Ga0453684_0812534 | Ga0453684_0812534_52_696 | 211 |
| 3 | 3300049824 | Ga0501045_0039408 | Ga0501045_0039408_18_665 | 211 |
| 4 | 3300061719 | Ga0466962_0276228 | Ga0466962_0276228_114_806 | 222 |
| 5 | 3300037466 | Ga0395898_0885958 | Ga0395898_0885958_95_796 | 233 |
| 6 | 3300005295 | Ga0065707_10114619 | Ga0065707_101146192 | 235 |
| 7 | 3300005339 | Ga0070660_100196454 | Ga0070660_1001964542 | 237 |
| 8 | 3300013306 | Ga0163162_10017169 | Ga0163162_100171692 | 237 |
| 9 | 3300013308 | Ga0157375_10009700 | Ga0157375_100097002 | 237 |
| 10 | 3300025904 | Ga0207647_10007138 | Ga0207647_100071384 | 237 |
| 11 | 3300025909 | Ga0207705_10150612 | Ga0207705_101506121 | 237 |
| 12 | 3300025919 | Ga0207657_10274580 | Ga0207657_102745801 | 237 |
| 13 | 3300005339 | Ga0070660_100077428 | Ga0070660_1000774282 | 238 |
| 14 | 3300005563 | Ga0068855_100079337 | Ga0068855_1000793372 | 238 |
| 15 | 3300013102 | Ga0157371_10120663 | Ga0157371_101206632 | 238 |
| 16 | 3300025949 | Ga0207667_10024664 | Ga0207667_100246644 | 238 |
| 17 | 3300049572 | Ga0501036_0612702 | Ga0501036_0612702_19_747 | 238 |
| 18 | 3300017792 | Ga0163161_10024797 | Ga0163161_100247974 | 239 |
| 19 | 3300025961 | Ga0207712_10336024 | Ga0207712_103360242 | 239 |
| 20 | 3300042007 | Ga0439449_0099587 | Ga0439449_0099587_255_1064 | 240 |
| 21 | 3300006237 | Ga0097621_100008440 | Ga0097621_1000084403 | 241 |
| 22 | 3300013307 | Ga0157372_10141571 | Ga0157372_101415714 | 241 |
| 23 | 3300025925 | Ga0207650_10001053 | Ga0207650_100010537 | 241 |
| 24 | 3300049661 | Ga0501217_019316 | Ga0501217_019316_555_1280 | 241 |
| 25 | 3300049669 | Ga0501235_037638 | Ga0501235_037638_264_989 | 241 |
| 26 | 3300049674 | Ga0501242_000505 | Ga0501242_000505_1199_1924 | 241 |
| 27 | 3300049705 | Ga0501225_0053277 | Ga0501225_0053277_247_972 | 241 |
| 28 | 3300049763 | Ga0501266_001843 | Ga0501266_001843_1531_2256 | 241 |
| 29 | 3300013307 | Ga0157372_10001266 | Ga0157372_1000126621 | 242 |
| 30 | 3300025913 | Ga0207695_10280694 | Ga0207695_102806942 | 242 |
| 31 | 3300025914 | Ga0207671_10020298 | Ga0207671_100202982 | 242 |
| 32 | 3300005577 | Ga0068857_100189049 | Ga0068857_1001890492 | 244 |
| 33 | 3300009545 | Ga0105237_10507142 | Ga0105237_105071421 | 244 |
| 34 | 3300010375 | Ga0105239_10423671 | Ga0105239_104236712 | 244 |
| 35 | 3300059493 | Ga0587077_006542 | Ga0587077_006542_511_1302 | 244 |
| 36 | 3300009093 | Ga0105240_10067580 | Ga0105240_100675802 | 245 |
| 37 | 3300010375 | Ga0105239_10000628 | Ga0105239_1000062828 | 245 |
| 38 | 3300005563 | Ga0068855_100000582 | Ga0068855_1000005822 | 246 |
| 39 | 3300005616 | Ga0068852_100163502 | Ga0068852_1001635022 | 246 |
| 40 | 3300009093 | Ga0105240_10014679 | Ga0105240_100146799 | 246 |
| 41 | 3300009545 | Ga0105237_10000379 | Ga0105237_100003793 | 246 |
| 42 | 3300009551 | Ga0105238_10137353 | Ga0105238_101373532 | 246 |
| 43 | 3300010375 | Ga0105239_10003340 | Ga0105239_1000334011 | 246 |
| 44 | 3300025914 | Ga0207671_10019529 | Ga0207671_100195293 | 246 |
| 45 | 3300025949 | Ga0207667_10005296 | Ga0207667_1000529612 | 246 |
| 46 | 3300026078 | Ga0207702_10173228 | Ga0207702_101732281 | 246 |
| 47 | 3300026142 | Ga0207698_10035280 | Ga0207698_100352803 | 246 |
| 48 | 3300044684 | Ga0466966_0026346 | Ga0466966_0026346_1496_2260 | 246 |
| 49 | 3300044706 | Ga0466964_0000208 | Ga0466964_0000208_2500_3279 | 246 |
| 50 | 3300044719 | Ga0466971_0002696 | Ga0466971_0002696_2263_3042 | 246 |
| 51 | 3300005262 | Ga0065165_1000601 | Ga0065165_100060126 | 247 |
| 52 | 3300005435 | Ga0070714_100247622 | Ga0070714_1002476222 | 247 |
| 53 | 3300021384 | Ga0213876_10013593 | Ga0213876_100135934 | 247 |
| 54 | 3300025292 | Ga0209676_1000485 | Ga0209676_100048529 | 247 |
| 55 | 3300025904 | Ga0207647_10025085 | Ga0207647_100250852 | 247 |
| 56 | 3300039437 | Ga0436365_1821680 | Ga0436365_1821680_1665_2444 | 247 |
| 57 | 3300044684 | Ga0466966_0035229 | Ga0466966_0035229_1284_2069 | 247 |
| 58 | 3300044694 | Ga0466963_0041077 | Ga0466963_0041077_2169_2927 | 247 |
| 59 | 3300044765 | Ga0466970_0257209 | Ga0466970_0257209_77_841 | 247 |
| 60 | 3300045049 | Ga0466959_0064253 | Ga0466959_0064253_241_1005 | 247 |
| 61 | 3300045049 | Ga0466959_0149935 | Ga0466959_0149935_374_1159 | 247 |
| 62 | 3300045976 | Ga0466967_0004457 | Ga0466967_0004457_727_1485 | 247 |
| 63 | 3300046535 | Ga0495586_0102124 | Ga0495586_0102124_244_1023 | 247 |
| 64 | 3300049581 | Ga0501047_0063396 | Ga0501047_0063396_1929_2687 | 247 |
| 65 | 3300005340 | Ga0070689_100302398 | Ga0070689_1003023981 | 248 |
| 66 | 3300005458 | Ga0070681_10179824 | Ga0070681_101798241 | 248 |
| 67 | 3300005617 | Ga0068859_100080329 | Ga0068859_1000803294 | 248 |
| 68 | 3300006931 | Ga0097620_100080330 | Ga0097620_1000803304 | 248 |
| 69 | 3300025921 | Ga0207652_10299558 | Ga0207652_102995582 | 248 |
| 70 | 3300044693 | Ga0466961_0016877 | Ga0466961_0016877_2472_3242 | 248 |
| 71 | 3300047471 | Ga0495684_0178751 | Ga0495684_0178751_395_1183 | 248 |
| 72 | 3300005544 | Ga0070686_100005249 | Ga0070686_1000052492 | 249 |
| 73 | 3300037471 | Ga0395905_0147405 | Ga0395905_0147405_821_1594 | 249 |
| 74 | 3300009092 | Ga0105250_10000964 | Ga0105250_100009643 | 250 |
| 75 | 3300005366 | Ga0070659_100169738 | Ga0070659_1001697381 | 251 |
| 76 | 3300005539 | Ga0068853_100317422 | Ga0068853_1003174222 | 251 |
| 77 | 3300013100 | Ga0157373_10176833 | Ga0157373_101768332 | 251 |
| 78 | 3300014969 | Ga0157376_10095468 | Ga0157376_100954682 | 251 |
| 79 | 3300031852 | Ga0307410_10125608 | Ga0307410_101256081 | 251 |
| 80 | 3300053130 | Ga0500642_0062036 | Ga0500642_0062036_513_1391 | 251 |
| 81 | 3300025917 | Ga0207660_10171526 | Ga0207660_101715261 | 252 |
| 82 | 3300025921 | Ga0207652_10079076 | Ga0207652_100790762 | 252 |
| 83 | 3300005563 | Ga0068855_100211440 | Ga0068855_1002114402 | 253 |
| 84 | 3300005577 | Ga0068857_100111310 | Ga0068857_1001113102 | 253 |
| 85 | 3300005616 | Ga0068852_100002956 | Ga0068852_1000029562 | 253 |
| 86 | 3300009093 | Ga0105240_10156390 | Ga0105240_101563904 | 253 |
| 87 | 3300013104 | Ga0157370_10004027 | Ga0157370_100040272 | 253 |
| 88 | 3300013307 | Ga0157372_10002206 | Ga0157372_1000220622 | 253 |
| 89 | 3300025909 | Ga0207705_10274608 | Ga0207705_102746081 | 253 |
| 90 | 3300026041 | Ga0207639_10344304 | Ga0207639_103443042 | 253 |
| 91 | 3300026116 | Ga0207674_10007313 | Ga0207674_1000731313 | 253 |
| 92 | 3300026116 | Ga0207674_10063048 | Ga0207674_100630483 | 253 |
| 93 | 3300026142 | Ga0207698_10033077 | Ga0207698_100330774 | 253 |
| 94 | iso_pu_bacteria | 2522125168 | 2522549124 | 253 |
| 95 | 3300031731 | Ga0307405_10028543 | Ga0307405_100285434 | 254 |
| 96 | 3300031911 | Ga0307412_10055289 | Ga0307412_100552891 | 254 |
| 97 | 3300032004 | Ga0307414_10563184 | Ga0307414_105631841 | 254 |
| 98 | 3300005327 | Ga0070658_10165345 | Ga0070658_101653451 | 255 |
| 99 | 3300013102 | Ga0157371_10010251 | Ga0157371_100102519 | 255 |
| 100 | 3300025246 | Ga0209646_1001958 | Ga0209646_10019586 | 255 |
| 101 | 3300044712 | Ga0453684_0000311 | Ga0453684_0000311_57755_58528 | 255 |
| 102 | iso_pu_bacteria | 2506520007 | 2506580375 | 255 |
| 103 | iso_pu_bacteria | 2506520008 | 2506585514 | 255 |
| 104 | iso_pu_bacteria | 2599185210 | 2599603974 | 255 |
| 105 | iso_pu_bacteria | 2654587920 | 2656277290 | 255 |
| 106 | iso_pu_bacteria | 2687453601 | 2689446929 | 255 |
| 107 | iso_pu_bacteria | 2841859092 | 2841859558 | 255 |
| 108 | iso_pu_bacteria | 2842515876 | 2842516343 | 255 |
| 109 | iso_pu_bacteria | 2914759650 | 2914763140 | 255 |
| 110 | iso_pu_bacteria | 2933011516 | 2933013015 | 255 |
| 111 | 3300005843 | Ga0068860_100365509 | Ga0068860_1003655092 | 256 |
| 112 | 3300013104 | Ga0157370_10180877 | Ga0157370_101808772 | 256 |
| 113 | 3300028381 | Ga0268264_10300515 | Ga0268264_103005152 | 256 |
| 114 | 3300036712 | Ga0316584_0006323 | Ga0316584_0006323_4941_5723 | 256 |
| 115 | 3300049569 | Ga0501032_0001218 | Ga0501032_0001218_8086_8859 | 256 |
| 116 | 3300049665 | Ga0501227_012930 | Ga0501227_012930_186_980 | 256 |
| 117 | 3300005335 | Ga0070666_10096799 | Ga0070666_100967993 | 257 |
| 118 | 3300005616 | Ga0068852_100062502 | Ga0068852_1000625023 | 257 |
| 119 | 3300013297 | Ga0157378_10162212 | Ga0157378_101622122 | 257 |
| 120 | 3300026023 | Ga0207677_10035468 | Ga0207677_100354681 | 257 |
| 121 | 3300026142 | Ga0207698_10047364 | Ga0207698_100473643 | 257 |
| 122 | 3300044712 | Ga0453684_0005017 | Ga0453684_0005017_16119_16898 | 257 |
| 123 | 3300049568 | Ga0501031_0012718 | Ga0501031_0012718_2740_3513 | 257 |
| 124 | 3300049569 | Ga0501032_0001241 | Ga0501032_0001241_10401_11174 | 257 |
| 125 | 3300049570 | Ga0501033_0000199 | Ga0501033_0000199_6572_7345 | 257 |
| 126 | 3300049571 | Ga0501034_0000506 | Ga0501034_0000506_56608_57381 | 257 |
| 127 | 3300049572 | Ga0501036_0096330 | Ga0501036_0096330_1664_2437 | 257 |
| 128 | 3300049573 | Ga0501037_0018322 | Ga0501037_0018322_1249_2022 | 257 |
| 129 | 3300049574 | Ga0501038_0160766 | Ga0501038_0160766_988_1761 | 257 |
| 130 | 3300049575 | Ga0501039_0001671 | Ga0501039_0001671_5614_6387 | 257 |
| 131 | 3300049579 | Ga0501043_0005572 | Ga0501043_0005572_224_997 | 257 |
| 132 | 3300049822 | Ga0501035_0001716 | Ga0501035_0001716_9169_9942 | 257 |
| 133 | 3300049823 | Ga0501044_0009431 | Ga0501044_0009431_3297_4070 | 257 |
| 134 | 3300049824 | Ga0501045_0000122 | Ga0501045_0000122_8718_9491 | 257 |
| 135 | 3300003320 | rootH2_10254154 | rootH2_102541542 | 258 |
| 136 | 3300005578 | Ga0068854_100269523 | Ga0068854_1002695232 | 258 |
| 137 | 3300005616 | Ga0068852_100338306 | Ga0068852_1003383062 | 258 |
| 138 | 3300013105 | Ga0157369_10231093 | Ga0157369_102310932 | 258 |
| 139 | 3300013296 | Ga0157374_10039284 | Ga0157374_100392842 | 258 |
| 140 | 3300013306 | Ga0163162_10043590 | Ga0163162_100435903 | 258 |
| 141 | 3300026142 | Ga0207698_10199081 | Ga0207698_101990812 | 258 |
| 142 | 3300028786 | Ga0307517_10016737 | Ga0307517_100167376 | 258 |
| 143 | 3300028794 | Ga0307515_10003029 | Ga0307515_100030293 | 258 |
| 144 | 3300031507 | Ga0307509_10182649 | Ga0307509_101826492 | 258 |
| 145 | 3300031911 | Ga0307412_10467066 | Ga0307412_104670662 | 258 |
| 146 | 3300042876 | Ga0451577_0165277 | Ga0451577_0165277_1077_1865 | 258 |
| 147 | 3300042876 | Ga0451577_0456291 | Ga0451577_0456291_307_1101 | 258 |
| 148 | 3300044673 | Ga0453683_0203415 | Ga0453683_0203415_434_1222 | 258 |
| 149 | 3300044712 | Ga0453684_0683921 | Ga0453684_0683921_153_947 | 258 |
| 150 | 3300045051 | Ga0451576_0033300 | Ga0451576_0033300_1692_2480 | 258 |
| 151 | 3300049571 | Ga0501034_0307672 | Ga0501034_0307672_364_1158 | 258 |
| 152 | 3300049573 | Ga0501037_0077497 | Ga0501037_0077497_997_1791 | 258 |
| 153 | 3300049585 | Ga0501069_0135406 | Ga0501069_0135406_186_980 | 258 |
| 154 | 3300049586 | Ga0501070_0160549 | Ga0501070_0160549_914_1708 | 258 |
| 155 | 3300049823 | Ga0501044_0032501 | Ga0501044_0032501_3209_4003 | 258 |
| 156 | 3300053091 | Ga0500647_0097511 | Ga0500647_0097511_440_1225 | 258 |
| 157 | 3300003856 | Ga0058692_1002672 | Ga0058692_10026722 | 259 |
| 158 | 3300005327 | Ga0070658_10000512 | Ga0070658_1000051229 | 259 |
| 159 | 3300005328 | Ga0070676_10000439 | Ga0070676_100004392 | 259 |
| 160 | 3300005329 | Ga0070683_100546953 | Ga0070683_1005469531 | 259 |
| 161 | 3300005334 | Ga0068869_100106559 | Ga0068869_1001065592 | 259 |
| 162 | 3300005335 | Ga0070666_10000499 | Ga0070666_1000049916 | 259 |
| 163 | 3300005338 | Ga0068868_100000119 | Ga0068868_1000001197 | 259 |
| 164 | 3300005340 | Ga0070689_100466835 | Ga0070689_1004668351 | 259 |
| 165 | 3300005347 | Ga0070668_100005038 | Ga0070668_1000050386 | 259 |
| 166 | 3300005364 | Ga0070673_100000331 | Ga0070673_10000033128 | 259 |
| 167 | 3300005367 | Ga0070667_100001052 | Ga0070667_10000105221 | 259 |
| 168 | 3300005436 | Ga0070713_100135257 | Ga0070713_1001352572 | 259 |
| 169 | 3300005456 | Ga0070678_100114791 | Ga0070678_1001147913 | 259 |
| 170 | 3300005458 | Ga0070681_10001582 | Ga0070681_1000158210 | 259 |
| 171 | 3300005458 | Ga0070681_10139072 | Ga0070681_101390721 | 259 |
| 172 | 3300005459 | Ga0068867_100002653 | Ga0068867_10000265314 | 259 |
| 173 | 3300005530 | Ga0070679_100048036 | Ga0070679_1000480363 | 259 |
| 174 | 3300005539 | Ga0068853_100008365 | Ga0068853_1000083652 | 259 |
| 175 | 3300005543 | Ga0070672_100000183 | Ga0070672_10000018332 | 259 |
| 176 | 3300005548 | Ga0070665_100001045 | Ga0070665_1000010459 | 259 |
| 177 | 3300005563 | Ga0068855_100140468 | Ga0068855_1001404682 | 259 |
| 178 | 3300005563 | Ga0068855_100189177 | Ga0068855_1001891772 | 259 |
| 179 | 3300005563 | Ga0068855_100435262 | Ga0068855_1004352622 | 259 |
| 180 | 3300005614 | Ga0068856_100147294 | Ga0068856_1001472944 | 259 |
| 181 | 3300005618 | Ga0068864_100002400 | Ga0068864_1000024005 | 259 |
| 182 | 3300005719 | Ga0068861_100008556 | Ga0068861_1000085563 | 259 |
| 183 | 3300005719 | Ga0068861_100298212 | Ga0068861_1002982122 | 259 |
| 184 | 3300005834 | Ga0068851_10015042 | Ga0068851_100150423 | 259 |
| 185 | 3300005841 | Ga0068863_100001935 | Ga0068863_1000019358 | 259 |
| 186 | 3300005842 | Ga0068858_100003089 | Ga0068858_10000308912 | 259 |
| 187 | 3300005843 | Ga0068860_100002234 | Ga0068860_10000223410 | 259 |
| 188 | 3300005985 | Ga0081539_10000028 | Ga0081539_10000028263 | 259 |
| 189 | 3300006237 | Ga0097621_100003204 | Ga0097621_10000320414 | 259 |
| 190 | 3300006358 | Ga0068871_100003066 | Ga0068871_1000030668 | 259 |
| 191 | 3300006881 | Ga0068865_100000660 | Ga0068865_10000066014 | 259 |
| 192 | 3300009011 | Ga0105251_10001069 | Ga0105251_100010693 | 259 |
| 193 | 3300009093 | Ga0105240_10122228 | Ga0105240_101222286 | 259 |
| 194 | 3300009101 | Ga0105247_10000132 | Ga0105247_1000013226 | 259 |
| 195 | 3300009177 | Ga0105248_10033299 | Ga0105248_100332998 | 259 |
| 196 | 3300009545 | Ga0105237_10058587 | Ga0105237_100585872 | 259 |
| 197 | 3300009551 | Ga0105238_10128706 | Ga0105238_101287063 | 259 |
| 198 | 3300009553 | Ga0105249_10006156 | Ga0105249_1000615610 | 259 |
| 199 | 3300009553 | Ga0105249_10108945 | Ga0105249_101089453 | 259 |
| 200 | 3300010375 | Ga0105239_10453007 | Ga0105239_104530072 | 259 |
| 201 | 3300011119 | Ga0105246_10413041 | Ga0105246_104130412 | 259 |
| 202 | 3300013296 | Ga0157374_10000505 | Ga0157374_100005052 | 259 |
| 203 | 3300013296 | Ga0157374_10238879 | Ga0157374_102388791 | 259 |
| 204 | 3300013297 | Ga0157378_10035396 | Ga0157378_100353966 | 259 |
| 205 | 3300013306 | Ga0163162_10000096 | Ga0163162_1000009650 | 259 |
| 206 | 3300013307 | Ga0157372_10191614 | Ga0157372_101916142 | 259 |
| 207 | 3300013308 | Ga0157375_10000622 | Ga0157375_1000062224 | 259 |
| 208 | 3300014325 | Ga0163163_10000251 | Ga0163163_1000025116 | 259 |
| 209 | 3300014968 | Ga0157379_10000128 | Ga0157379_1000012816 | 259 |
| 210 | 3300014969 | Ga0157376_10000334 | Ga0157376_1000033425 | 259 |
| 211 | 3300017792 | Ga0163161_10000052 | Ga0163161_1000005217 | 259 |
| 212 | 3300017792 | Ga0163161_10011663 | Ga0163161_100116638 | 259 |
| 213 | 3300021384 | Ga0213876_10008793 | Ga0213876_100087934 | 259 |
| 214 | 3300025321 | Ga0207656_10010828 | Ga0207656_100108282 | 259 |
| 215 | 3300025711 | Ga0207696_1000014 | Ga0207696_1000014117 | 259 |
| 216 | 3300025735 | Ga0207713_1000109 | Ga0207713_100010954 | 259 |
| 217 | 3300025900 | Ga0207710_10000007 | Ga0207710_10000007320 | 259 |
| 218 | 3300025903 | Ga0207680_10000223 | Ga0207680_1000022330 | 259 |
| 219 | 3300025907 | Ga0207645_10004116 | Ga0207645_100041164 | 259 |
| 220 | 3300025909 | Ga0207705_10001296 | Ga0207705_1000129614 | 259 |
| 221 | 3300025909 | Ga0207705_10179697 | Ga0207705_101796972 | 259 |
| 222 | 3300025913 | Ga0207695_10306386 | Ga0207695_103063861 | 259 |
| 223 | 3300025921 | Ga0207652_10036588 | Ga0207652_100365883 | 259 |
| 224 | 3300025931 | Ga0207644_10065750 | Ga0207644_100657503 | 259 |
| 225 | 3300025938 | Ga0207704_10001257 | Ga0207704_1000125714 | 259 |
| 226 | 3300025940 | Ga0207691_10000057 | Ga0207691_1000005716 | 259 |
| 227 | 3300025941 | Ga0207711_10204004 | Ga0207711_102040042 | 259 |
| 228 | 3300025942 | Ga0207689_10352703 | Ga0207689_103527032 | 259 |
| 229 | 3300025942 | Ga0207689_10424022 | Ga0207689_104240222 | 259 |
| 230 | 3300025949 | Ga0207667_10127082 | Ga0207667_101270823 | 259 |
| 231 | 3300025949 | Ga0207667_10174790 | Ga0207667_101747902 | 259 |
| 232 | 3300025960 | Ga0207651_10000330 | Ga0207651_1000033021 | 259 |
| 233 | 3300025961 | Ga0207712_10188008 | Ga0207712_101880082 | 259 |
| 234 | 3300025972 | Ga0207668_10000736 | Ga0207668_100007368 | 259 |
| 235 | 3300025986 | Ga0207658_10004083 | Ga0207658_100040838 | 259 |
| 236 | 3300026023 | Ga0207677_10002398 | Ga0207677_1000239812 | 259 |
| 237 | 3300026035 | Ga0207703_10001287 | Ga0207703_1000128710 | 259 |
| 238 | 3300026041 | Ga0207639_10001406 | Ga0207639_1000140616 | 259 |
| 239 | 3300026078 | Ga0207702_10166913 | Ga0207702_101669132 | 259 |
| 240 | 3300026088 | Ga0207641_10005451 | Ga0207641_100054513 | 259 |
| 241 | 3300026089 | Ga0207648_10003815 | Ga0207648_1000381516 | 259 |
| 242 | 3300026095 | Ga0207676_10002484 | Ga0207676_100024842 | 259 |
| 243 | 3300026118 | Ga0207675_100171854 | Ga0207675_1001718542 | 259 |
| 244 | 3300026118 | Ga0207675_100286387 | Ga0207675_1002863871 | 259 |
| 245 | 3300027312 | Ga0209371_1000822 | Ga0209371_100082215 | 259 |
| 246 | 3300028379 | Ga0268266_10005746 | Ga0268266_100057464 | 259 |
| 247 | 3300028380 | Ga0268265_10405181 | Ga0268265_104051812 | 259 |
| 248 | 3300028381 | Ga0268264_10004004 | Ga0268264_1000400410 | 259 |
| 249 | 3300028786 | Ga0307517_10115738 | Ga0307517_101157381 | 259 |
| 250 | 3300031247 | Ga0265340_10099240 | Ga0265340_100992402 | 259 |
| 251 | 3300031251 | Ga0265327_10000024 | Ga0265327_1000002490 | 259 |
| 252 | 3300031456 | Ga0307513_10239473 | Ga0307513_102394732 | 259 |
| 253 | 3300031595 | Ga0265313_10092889 | Ga0265313_100928892 | 259 |
| 254 | 3300038725 | Ga0400484_14764 | Ga0400484_14764_1415_2206 | 259 |
| 255 | 3300038726 | Ga0400490_41645 | Ga0400490_41645_717_1499 | 259 |
| 256 | 3300038741 | Ga0400488_01959 | Ga0400488_01959_2492_3274 | 259 |
| 257 | 3300038741 | Ga0400488_49253 | Ga0400488_49253_170_961 | 259 |
| 258 | 3300039062 | Ga0400483_083912 | Ga0400483_083912_5640_6431 | 259 |
| 259 | 3300039437 | Ga0436365_1875604 | Ga0436365_1875604_12995_13795 | 259 |
| 260 | 3300044712 | Ga0453684_0004045 | Ga0453684_0004045_25198_25989 | 259 |
| 261 | 3300045051 | Ga0451576_0000002 | Ga0451576_0000002_309352_310152 | 259 |
| 262 | 3300047472 | Ga0495686_0110735 | Ga0495686_0110735_18_893 | 259 |
| 263 | 3300048906 | Ga0496103_0025983 | Ga0496103_0025983_269_1048 | 259 |
| 264 | 3300048907 | Ga0496104_0253321 | Ga0496104_0253321_49_828 | 259 |
| 265 | 3300048912 | Ga0496109_0032631 | Ga0496109_0032631_2711_3511 | 259 |
| 266 | 3300048919 | Ga0496116_0000009 | Ga0496116_0000009_345593_346372 | 259 |
| 267 | 3300048920 | Ga0496117_0001526 | Ga0496117_0001526_11220_11999 | 259 |
| 268 | 3300048921 | Ga0496118_0002425 | Ga0496118_0002425_14811_15590 | 259 |
| 269 | 3300048922 | Ga0496119_0012983 | Ga0496119_0012983_3012_3791 | 259 |
| 270 | 3300048923 | Ga0496120_0100561 | Ga0496120_0100561_396_1175 | 259 |
| 271 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_146554_147363 | 259 |
| 272 | 3300049588 | Ga0501072_0196146 | Ga0501072_0196146_211_1020 | 259 |
| 273 | 3300049705 | Ga0501225_0001000 | Ga0501225_0001000_5005_5871 | 259 |
| 274 | 3300049742 | Ga0501080_0168781 | Ga0501080_0168781_209_1018 | 259 |
| 275 | iso_pu_bacteria | 2818991444 | 2819585897 | 259 |
| 276 | iso_pu_bacteria | 2929154850 | 2929159344 | 259 |
| 277 | 3300002459 | JGI24751J29686_10000945 | JGI24751J29686_100009456 | 260 |
| 278 | 3300002459 | JGI24751J29686_10001408 | JGI24751J29686_100014081 | 260 |
| 279 | 3300005328 | Ga0070676_10054171 | Ga0070676_100541713 | 260 |
| 280 | 3300005330 | Ga0070690_100204457 | Ga0070690_1002044572 | 260 |
| 281 | 3300005331 | Ga0070670_100045587 | Ga0070670_1000455873 | 260 |
| 282 | 3300005331 | Ga0070670_100387828 | Ga0070670_1003878282 | 260 |
| 283 | 3300005334 | Ga0068869_100216984 | Ga0068869_1002169842 | 260 |
| 284 | 3300005336 | Ga0070680_100000078 | Ga0070680_10000007810 | 260 |
| 285 | 3300005336 | Ga0070680_100010273 | Ga0070680_1000102735 | 260 |
| 286 | 3300005336 | Ga0070680_100022622 | Ga0070680_1000226224 | 260 |
| 287 | 3300005337 | Ga0070682_100006550 | Ga0070682_1000065502 | 260 |
| 288 | 3300005337 | Ga0070682_100035182 | Ga0070682_1000351823 | 260 |
| 289 | 3300005337 | Ga0070682_100484955 | Ga0070682_1004849551 | 260 |
| 290 | 3300005338 | Ga0068868_100004028 | Ga0068868_1000040288 | 260 |
| 291 | 3300005341 | Ga0070691_10000658 | Ga0070691_100006586 | 260 |
| 292 | 3300005354 | Ga0070675_100294794 | Ga0070675_1002947942 | 260 |
| 293 | 3300005355 | Ga0070671_100001534 | Ga0070671_1000015349 | 260 |
| 294 | 3300005367 | Ga0070667_100019848 | Ga0070667_1000198482 | 260 |
| 295 | 3300005406 | Ga0070703_10074821 | Ga0070703_100748212 | 260 |
| 296 | 3300005436 | Ga0070713_100002396 | Ga0070713_1000023963 | 260 |
| 297 | 3300005437 | Ga0070710_10003818 | Ga0070710_100038188 | 260 |
| 298 | 3300005439 | Ga0070711_100002860 | Ga0070711_1000028609 | 260 |
| 299 | 3300005456 | Ga0070678_100001008 | Ga0070678_1000010088 | 260 |
| 300 | 3300005456 | Ga0070678_100365184 | Ga0070678_1003651842 | 260 |
| 301 | 3300005458 | Ga0070681_10004146 | Ga0070681_100041469 | 260 |
| 302 | 3300005458 | Ga0070681_10007971 | Ga0070681_100079717 | 260 |
| 303 | 3300005458 | Ga0070681_10010840 | Ga0070681_100108404 | 260 |
| 304 | 3300005458 | Ga0070681_10011407 | Ga0070681_100114076 | 260 |
| 305 | 3300005458 | Ga0070681_10026407 | Ga0070681_100264072 | 260 |
| 306 | 3300005458 | Ga0070681_10338998 | Ga0070681_103389982 | 260 |
| 307 | 3300005459 | Ga0068867_100003430 | Ga0068867_1000034308 | 260 |
| 308 | 3300005459 | Ga0068867_100028988 | Ga0068867_1000289885 | 260 |
| 309 | 3300005459 | Ga0068867_100108619 | Ga0068867_1001086192 | 260 |
| 310 | 3300005530 | Ga0070679_100000099 | Ga0070679_10000009941 | 260 |
| 311 | 3300005530 | Ga0070679_100000469 | Ga0070679_10000046921 | 260 |
| 312 | 3300005530 | Ga0070679_100290905 | Ga0070679_1002909052 | 260 |
| 313 | 3300005539 | Ga0068853_100001959 | Ga0068853_1000019594 | 260 |
| 314 | 3300005539 | Ga0068853_100047969 | Ga0068853_1000479692 | 260 |
| 315 | 3300005543 | Ga0070672_100141424 | Ga0070672_1001414242 | 260 |
| 316 | 3300005543 | Ga0070672_100383567 | Ga0070672_1003835672 | 260 |
| 317 | 3300005548 | Ga0070665_100002122 | Ga0070665_10000212212 | 260 |
| 318 | 3300005563 | Ga0068855_100000145 | Ga0068855_10000014563 | 260 |
| 319 | 3300005563 | Ga0068855_100001482 | Ga0068855_10000148210 | 260 |
| 320 | 3300005563 | Ga0068855_100004840 | Ga0068855_10000484010 | 260 |
| 321 | 3300005563 | Ga0068855_100057930 | Ga0068855_1000579304 | 260 |
| 322 | 3300005563 | Ga0068855_100425602 | Ga0068855_1004256022 | 260 |
| 323 | 3300005577 | Ga0068857_100145020 | Ga0068857_1001450202 | 260 |
| 324 | 3300005614 | Ga0068856_100009998 | Ga0068856_1000099983 | 260 |
| 325 | 3300005614 | Ga0068856_100064734 | Ga0068856_1000647342 | 260 |
| 326 | 3300005616 | Ga0068852_100408024 | Ga0068852_1004080242 | 260 |
| 327 | 3300005618 | Ga0068864_100126611 | Ga0068864_1001266113 | 260 |
| 328 | 3300005618 | Ga0068864_100261792 | Ga0068864_1002617922 | 260 |
| 329 | 3300005718 | Ga0068866_10018494 | Ga0068866_100184944 | 260 |
| 330 | 3300005718 | Ga0068866_10054316 | Ga0068866_100543162 | 260 |
| 331 | 3300005841 | Ga0068863_100334638 | Ga0068863_1003346382 | 260 |
| 332 | 3300005843 | Ga0068860_100007155 | Ga0068860_1000071554 | 260 |
| 333 | 3300006163 | Ga0070715_10000517 | Ga0070715_100005178 | 260 |
| 334 | 3300006175 | Ga0070712_100018220 | Ga0070712_1000182204 | 260 |
| 335 | 3300006237 | Ga0097621_100127285 | Ga0097621_1001272853 | 260 |
| 336 | 3300006358 | Ga0068871_100123516 | Ga0068871_1001235163 | 260 |
| 337 | 3300006358 | Ga0068871_100158155 | Ga0068871_1001581552 | 260 |
| 338 | 3300006881 | Ga0068865_100000735 | Ga0068865_1000007358 | 260 |
| 339 | 3300009093 | Ga0105240_10000597 | Ga0105240_1000059736 | 260 |
| 340 | 3300009093 | Ga0105240_10002705 | Ga0105240_1000270522 | 260 |
| 341 | 3300009093 | Ga0105240_10002820 | Ga0105240_1000282014 | 260 |
| 342 | 3300009093 | Ga0105240_10003826 | Ga0105240_1000382614 | 260 |
| 343 | 3300009098 | Ga0105245_10007920 | Ga0105245_100079202 | 260 |
| 344 | 3300009101 | Ga0105247_10031856 | Ga0105247_100318563 | 260 |
| 345 | 3300009174 | Ga0105241_10000056 | Ga0105241_1000005640 | 260 |
| 346 | 3300009174 | Ga0105241_10058234 | Ga0105241_100582344 | 260 |
| 347 | 3300009176 | Ga0105242_10005705 | Ga0105242_100057054 | 260 |
| 348 | 3300009176 | Ga0105242_10078617 | Ga0105242_100786172 | 260 |
| 349 | 3300009177 | Ga0105248_10005489 | Ga0105248_100054897 | 260 |
| 350 | 3300009545 | Ga0105237_10094123 | Ga0105237_100941232 | 260 |
| 351 | 3300009551 | Ga0105238_10008320 | Ga0105238_100083204 | 260 |
| 352 | 3300009551 | Ga0105238_10629918 | Ga0105238_106299181 | 260 |
| 353 | 3300009553 | Ga0105249_10003119 | Ga0105249_100031197 | 260 |
| 354 | 3300011119 | Ga0105246_10313818 | Ga0105246_103138182 | 260 |
| 355 | 3300013102 | Ga0157371_10050241 | Ga0157371_100502413 | 260 |
| 356 | 3300013102 | Ga0157371_10111622 | Ga0157371_101116222 | 260 |
| 357 | 3300013104 | Ga0157370_10000491 | Ga0157370_1000049110 | 260 |
| 358 | 3300013104 | Ga0157370_10000628 | Ga0157370_1000062825 | 260 |
| 359 | 3300013104 | Ga0157370_10001472 | Ga0157370_1000147219 | 260 |
| 360 | 3300013105 | Ga0157369_10023058 | Ga0157369_100230585 | 260 |
| 361 | 3300013105 | Ga0157369_10036431 | Ga0157369_100364312 | 260 |
| 362 | 3300013105 | Ga0157369_10055952 | Ga0157369_100559525 | 260 |
| 363 | 3300013296 | Ga0157374_10078864 | Ga0157374_100788642 | 260 |
| 364 | 3300013297 | Ga0157378_10004873 | Ga0157378_1000487311 | 260 |
| 365 | 3300013306 | Ga0163162_10001535 | Ga0163162_1000153516 | 260 |
| 366 | 3300013307 | Ga0157372_10088748 | Ga0157372_100887483 | 260 |
| 367 | 3300013307 | Ga0157372_10161439 | Ga0157372_101614393 | 260 |
| 368 | 3300013307 | Ga0157372_10289704 | Ga0157372_102897042 | 260 |
| 369 | 3300013308 | Ga0157375_10764967 | Ga0157375_107649671 | 260 |
| 370 | 3300014325 | Ga0163163_10000703 | Ga0163163_1000070323 | 260 |
| 371 | 3300014969 | Ga0157376_10068087 | Ga0157376_100680872 | 260 |
| 372 | 3300020070 | Ga0206356_11236474 | Ga0206356_112364742 | 260 |
| 373 | 3300025899 | Ga0207642_10140733 | Ga0207642_101407332 | 260 |
| 374 | 3300025900 | Ga0207710_10011647 | Ga0207710_100116473 | 260 |
| 375 | 3300025907 | Ga0207645_10249609 | Ga0207645_102496091 | 260 |
| 376 | 3300025909 | Ga0207705_10012281 | Ga0207705_100122815 | 260 |
| 377 | 3300025911 | Ga0207654_10154904 | Ga0207654_101549042 | 260 |
| 378 | 3300025912 | Ga0207707_10000026 | Ga0207707_10000026104 | 260 |
| 379 | 3300025912 | Ga0207707_10000067 | Ga0207707_1000006731 | 260 |
| 380 | 3300025912 | Ga0207707_10000122 | Ga0207707_1000012214 | 260 |
| 381 | 3300025912 | Ga0207707_10018125 | Ga0207707_100181253 | 260 |
| 382 | 3300025912 | Ga0207707_10063528 | Ga0207707_100635284 | 260 |
| 383 | 3300025913 | Ga0207695_10000676 | Ga0207695_1000067624 | 260 |
| 384 | 3300025913 | Ga0207695_10003540 | Ga0207695_100035404 | 260 |
| 385 | 3300025913 | Ga0207695_10015560 | Ga0207695_100155609 | 260 |
| 386 | 3300025913 | Ga0207695_10024615 | Ga0207695_100246152 | 260 |
| 387 | 3300025915 | Ga0207693_10000083 | Ga0207693_1000008316 | 260 |
| 388 | 3300025917 | Ga0207660_10007760 | Ga0207660_100077606 | 260 |
| 389 | 3300025917 | Ga0207660_10034429 | Ga0207660_100344292 | 260 |
| 390 | 3300025921 | Ga0207652_10000109 | Ga0207652_1000010949 | 260 |
| 391 | 3300025921 | Ga0207652_10000187 | Ga0207652_1000018733 | 260 |
| 392 | 3300025921 | Ga0207652_10001479 | Ga0207652_100014794 | 260 |
| 393 | 3300025921 | Ga0207652_10285313 | Ga0207652_102853132 | 260 |
| 394 | 3300025924 | Ga0207694_10003403 | Ga0207694_100034034 | 260 |
| 395 | 3300025924 | Ga0207694_10420847 | Ga0207694_104208471 | 260 |
| 396 | 3300025925 | Ga0207650_10025654 | Ga0207650_100256544 | 260 |
| 397 | 3300025925 | Ga0207650_10156597 | Ga0207650_101565972 | 260 |
| 398 | 3300025925 | Ga0207650_10227617 | Ga0207650_102276172 | 260 |
| 399 | 3300025934 | Ga0207686_10015135 | Ga0207686_100151352 | 260 |
| 400 | 3300025934 | Ga0207686_10032950 | Ga0207686_100329503 | 260 |
| 401 | 3300025938 | Ga0207704_10366048 | Ga0207704_103660482 | 260 |
| 402 | 3300025938 | Ga0207704_10428002 | Ga0207704_104280021 | 260 |
| 403 | 3300025940 | Ga0207691_10109087 | Ga0207691_101090872 | 260 |
| 404 | 3300025940 | Ga0207691_10364236 | Ga0207691_103642362 | 260 |
| 405 | 3300025942 | Ga0207689_10027705 | Ga0207689_100277054 | 260 |
| 406 | 3300025949 | Ga0207667_10000492 | Ga0207667_100004922 | 260 |
| 407 | 3300025949 | Ga0207667_10000798 | Ga0207667_100007989 | 260 |
| 408 | 3300025949 | Ga0207667_10010124 | Ga0207667_100101244 | 260 |
| 409 | 3300025960 | Ga0207651_10089576 | Ga0207651_100895762 | 260 |
| 410 | 3300026041 | Ga0207639_10006152 | Ga0207639_100061524 | 260 |
| 411 | 3300026041 | Ga0207639_10006581 | Ga0207639_100065813 | 260 |
| 412 | 3300026041 | Ga0207639_10055842 | Ga0207639_100558423 | 260 |
| 413 | 3300026078 | Ga0207702_10038203 | Ga0207702_100382034 | 260 |
| 414 | 3300026078 | Ga0207702_10090174 | Ga0207702_100901743 | 260 |
| 415 | 3300026088 | Ga0207641_10100844 | Ga0207641_101008442 | 260 |
| 416 | 3300026089 | Ga0207648_10004995 | Ga0207648_1000499512 | 260 |
| 417 | 3300026089 | Ga0207648_10044309 | Ga0207648_100443092 | 260 |
| 418 | 3300026089 | Ga0207648_10068027 | Ga0207648_100680272 | 260 |
| 419 | 3300026116 | Ga0207674_10101246 | Ga0207674_101012462 | 260 |
| 420 | 3300026121 | Ga0207683_10004897 | Ga0207683_100048975 | 260 |
| 421 | 3300026121 | Ga0207683_10143289 | Ga0207683_101432892 | 260 |
| 422 | 3300026142 | Ga0207698_10100045 | Ga0207698_101000451 | 260 |
| 423 | 3300028381 | Ga0268264_10086592 | Ga0268264_100865923 | 260 |
| 424 | 3300030731 | Ga0316177_1157475 | Ga0316177_11574755 | 260 |
| 425 | 3300030745 | Ga0316182_1062439 | Ga0316182_10624393 | 260 |
| 426 | 3300035170 | Ga0373943_0136797 | Ga0373943_0136797_208_990 | 260 |
| 427 | 3300035695 | Ga0373927_0006326 | Ga0373927_0006326_1233_2015 | 260 |
| 428 | 3300035725 | Ga0373947_0089723 | Ga0373947_0089723_498_1280 | 260 |
| 429 | 3300036401 | Ga0373937_0284102 | Ga0373937_0284102_134_916 | 260 |
| 430 | 3300037068 | Ga0373925_0669475 | Ga0373925_0669475_27_809 | 260 |
| 431 | 3300037418 | Ga0395900_0091423 | Ga0395900_0091423_1782_2573 | 260 |
| 432 | 3300037418 | Ga0395900_0693573 | Ga0395900_0693573_22_831 | 260 |
| 433 | 3300037471 | Ga0395905_0151976 | Ga0395905_0151976_1267_2058 | 260 |
| 434 | 3300038443 | Ga0395901_0015165 | Ga0395901_0015165_1904_2695 | 260 |
| 435 | 3300041486 | Ga0451807_0732940 | Ga0451807_0732940_346_1164 | 260 |
| 436 | 3300044656 | Ga0466969_0021061 | Ga0466969_0021061_1265_2065 | 260 |
| 437 | 3300044693 | Ga0466961_0048369 | Ga0466961_0048369_1661_2461 | 260 |
| 438 | 3300044706 | Ga0466964_0086505 | Ga0466964_0086505_436_1236 | 260 |
| 439 | 3300045049 | Ga0466959_0000904 | Ga0466959_0000904_722_1522 | 260 |
| 440 | 3300045049 | Ga0466959_0008505 | Ga0466959_0008505_6423_7223 | 260 |
| 441 | 3300046459 | Ga0495629_0494799 | Ga0495629_0494799_16_798 | 260 |
| 442 | 3300046473 | Ga0495582_0111349 | Ga0495582_0111349_209_991 | 260 |
| 443 | 3300046517 | Ga0495630_0186089 | Ga0495630_0186089_396_1178 | 260 |
| 444 | 3300046522 | Ga0495643_0010737 | Ga0495643_0010737_2024_2839 | 260 |
| 445 | 3300046535 | Ga0495586_0124937 | Ga0495586_0124937_25_807 | 260 |
| 446 | 3300046616 | Ga0495668_0000187 | Ga0495668_0000187_49822_50622 | 260 |
| 447 | 3300046690 | Ga0495624_0101766 | Ga0495624_0101766_55_837 | 260 |
| 448 | 3300047315 | Ga0495581_0097363 | Ga0495581_0097363_396_1178 | 260 |
| 449 | 3300047319 | Ga0495674_0118810 | Ga0495674_0118810_751_1533 | 260 |
| 450 | 3300048903 | Ga0496100_0035556 | Ga0496100_0035556_383_1165 | 260 |
| 451 | 3300048904 | Ga0496101_0016241 | Ga0496101_0016241_3643_4425 | 260 |
| 452 | 3300048905 | Ga0496102_0006064 | Ga0496102_0006064_947_1729 | 260 |
| 453 | 3300048906 | Ga0496103_0029252 | Ga0496103_0029252_2513_3295 | 260 |
| 454 | 3300048910 | Ga0496107_0001015 | Ga0496107_0001015_1763_2545 | 260 |
| 455 | 3300048911 | Ga0496108_0005792 | Ga0496108_0005792_9169_9951 | 260 |
| 456 | 3300048912 | Ga0496109_0064498 | Ga0496109_0064498_271_1053 | 260 |
| 457 | 3300048913 | Ga0496110_0000749 | Ga0496110_0000749_19483_20265 | 260 |
| 458 | 3300048915 | Ga0496112_0011995 | Ga0496112_0011995_55_837 | 260 |
| 459 | 3300048916 | Ga0496113_0079186 | Ga0496113_0079186_768_1550 | 260 |
| 460 | 3300048917 | Ga0496114_0004273 | Ga0496114_0004273_1947_2729 | 260 |
| 461 | 3300048918 | Ga0496115_0206207 | Ga0496115_0206207_345_1136 | 260 |
| 462 | 3300048921 | Ga0496118_0016140 | Ga0496118_0016140_224_1006 | 260 |
| 463 | 3300049574 | Ga0501038_0131985 | Ga0501038_0131985_428_1258 | 260 |
| 464 | 3300049575 | Ga0501039_0006315 | Ga0501039_0006315_6604_7407 | 260 |
| 465 | 3300049575 | Ga0501039_0428723 | Ga0501039_0428723_70_900 | 260 |
| 466 | 3300049579 | Ga0501043_0173560 | Ga0501043_0173560_721_1524 | 260 |
| 467 | 3300049581 | Ga0501047_0136410 | Ga0501047_0136410_827_1630 | 260 |
| 468 | 3300049581 | Ga0501047_0314816 | Ga0501047_0314816_208_1038 | 260 |
| 469 | 3300049585 | Ga0501069_0018408 | Ga0501069_0018408_2128_2958 | 260 |
| 470 | 3300049587 | Ga0501071_0076790 | Ga0501071_0076790_1564_2394 | 260 |
| 471 | 3300049588 | Ga0501072_0093041 | Ga0501072_0093041_1460_2290 | 260 |
| 472 | 3300049589 | Ga0501073_0010622 | Ga0501073_0010622_3168_3998 | 260 |
| 473 | 3300049590 | Ga0501074_0039165 | Ga0501074_0039165_254_1084 | 260 |
| 474 | 3300049742 | Ga0501080_0100361 | Ga0501080_0100361_1030_1860 | 260 |
| 475 | 3300049742 | Ga0501080_0487070 | Ga0501080_0487070_252_1055 | 260 |
| 476 | 3300049822 | Ga0501035_0043045 | Ga0501035_0043045_1886_2689 | 260 |
| 477 | 3300049823 | Ga0501044_0018364 | Ga0501044_0018364_318_1148 | 260 |
| 478 | 3300053153 | Ga0500616_0000910 | Ga0500616_0000910_18567_19367 | 260 |
| 479 | 3300060353 | Ga0501082_0069209 | Ga0501082_0069209_1953_2783 | 260 |
| 480 | 3300061719 | Ga0466962_0024213 | Ga0466962_0024213_1620_2420 | 260 |
| 481 | 3300003323 | rootH1_10290290 | rootH1_102902902 | 261 |
| 482 | 3300005329 | Ga0070683_100011967 | Ga0070683_1000119674 | 261 |
| 483 | 3300005330 | Ga0070690_100053183 | Ga0070690_1000531833 | 261 |
| 484 | 3300005335 | Ga0070666_10003443 | Ga0070666_100034432 | 261 |
| 485 | 3300005336 | Ga0070680_100311737 | Ga0070680_1003117372 | 261 |
| 486 | 3300005337 | Ga0070682_100026168 | Ga0070682_1000261683 | 261 |
| 487 | 3300005338 | Ga0068868_100029982 | Ga0068868_1000299823 | 261 |
| 488 | 3300005339 | Ga0070660_100002935 | Ga0070660_1000029355 | 261 |
| 489 | 3300005339 | Ga0070660_100005349 | Ga0070660_10000534910 | 261 |
| 490 | 3300005340 | Ga0070689_100669588 | Ga0070689_1006695881 | 261 |
| 491 | 3300005344 | Ga0070661_100003526 | Ga0070661_1000035267 | 261 |
| 492 | 3300005354 | Ga0070675_100111384 | Ga0070675_1001113842 | 261 |
| 493 | 3300005355 | Ga0070671_100066594 | Ga0070671_1000665942 | 261 |
| 494 | 3300005366 | Ga0070659_100002521 | Ga0070659_1000025214 | 261 |
| 495 | 3300005366 | Ga0070659_100267189 | Ga0070659_1002671891 | 261 |
| 496 | 3300005367 | Ga0070667_100066659 | Ga0070667_1000666592 | 261 |
| 497 | 3300005439 | Ga0070711_100166054 | Ga0070711_1001660542 | 261 |
| 498 | 3300005456 | Ga0070678_100116522 | Ga0070678_1001165222 | 261 |
| 499 | 3300005457 | Ga0070662_100011908 | Ga0070662_1000119084 | 261 |
| 500 | 3300005458 | Ga0070681_10029183 | Ga0070681_100291834 | 261 |
| 501 | 3300005459 | Ga0068867_100049202 | Ga0068867_1000492023 | 261 |
| 502 | 3300005530 | Ga0070679_100007464 | Ga0070679_1000074647 | 261 |
| 503 | 3300005530 | Ga0070679_100120141 | Ga0070679_1001201412 | 261 |
| 504 | 3300005535 | Ga0070684_100036943 | Ga0070684_1000369432 | 261 |
| 505 | 3300005539 | Ga0068853_100003709 | Ga0068853_1000037097 | 261 |
| 506 | 3300005539 | Ga0068853_100360979 | Ga0068853_1003609792 | 261 |
| 507 | 3300005548 | Ga0070665_100556720 | Ga0070665_1005567202 | 261 |
| 508 | 3300005563 | Ga0068855_100007644 | Ga0068855_1000076445 | 261 |
| 509 | 3300005564 | Ga0070664_100008870 | Ga0070664_1000088704 | 261 |
| 510 | 3300005577 | Ga0068857_100196808 | Ga0068857_1001968081 | 261 |
| 511 | 3300005578 | Ga0068854_100015524 | Ga0068854_1000155244 | 261 |
| 512 | 3300005614 | Ga0068856_100018970 | Ga0068856_1000189704 | 261 |
| 513 | 3300005616 | Ga0068852_100077188 | Ga0068852_1000771882 | 261 |
| 514 | 3300005616 | Ga0068852_100148535 | Ga0068852_1001485351 | 261 |
| 515 | 3300005617 | Ga0068859_100020299 | Ga0068859_1000202992 | 261 |
| 516 | 3300005618 | Ga0068864_100127682 | Ga0068864_1001276823 | 261 |
| 517 | 3300005841 | Ga0068863_100693072 | Ga0068863_1006930721 | 261 |
| 518 | 3300005843 | Ga0068860_100001796 | Ga0068860_10000179624 | 261 |
| 519 | 3300006237 | Ga0097621_100011128 | Ga0097621_1000111284 | 261 |
| 520 | 3300006931 | Ga0097620_100020301 | Ga0097620_1000203012 | 261 |
| 521 | 3300009093 | Ga0105240_10184907 | Ga0105240_101849072 | 261 |
| 522 | 3300009094 | Ga0111539_10089027 | Ga0111539_100890273 | 261 |
| 523 | 3300009101 | Ga0105247_10000331 | Ga0105247_1000033123 | 261 |
| 524 | 3300009553 | Ga0105249_10001162 | Ga0105249_1000116218 | 261 |
| 525 | 3300013100 | Ga0157373_10001202 | Ga0157373_100012027 | 261 |
| 526 | 3300013100 | Ga0157373_10019084 | Ga0157373_100190843 | 261 |
| 527 | 3300013102 | Ga0157371_10001044 | Ga0157371_1000104418 | 261 |
| 528 | 3300013102 | Ga0157371_10002756 | Ga0157371_100027569 | 261 |
| 529 | 3300013102 | Ga0157371_10002926 | Ga0157371_100029268 | 261 |
| 530 | 3300013102 | Ga0157371_10012575 | Ga0157371_100125757 | 261 |
| 531 | 3300013102 | Ga0157371_10016452 | Ga0157371_100164523 | 261 |
| 532 | 3300013104 | Ga0157370_10018502 | Ga0157370_100185023 | 261 |
| 533 | 3300013104 | Ga0157370_10019594 | Ga0157370_100195944 | 261 |
| 534 | 3300013104 | Ga0157370_10481807 | Ga0157370_104818072 | 261 |
| 535 | 3300013105 | Ga0157369_10020672 | Ga0157369_100206724 | 261 |
| 536 | 3300013105 | Ga0157369_10477830 | Ga0157369_104778302 | 261 |
| 537 | 3300013296 | Ga0157374_10009167 | Ga0157374_100091675 | 261 |
| 538 | 3300013297 | Ga0157378_10004107 | Ga0157378_100041074 | 261 |
| 539 | 3300013307 | Ga0157372_10033941 | Ga0157372_100339413 | 261 |
| 540 | 3300013307 | Ga0157372_10082673 | Ga0157372_100826733 | 261 |
| 541 | 3300013307 | Ga0157372_10087427 | Ga0157372_100874274 | 261 |
| 542 | 3300013307 | Ga0157372_10526304 | Ga0157372_105263041 | 261 |
| 543 | 3300013307 | Ga0157372_10602441 | Ga0157372_106024411 | 261 |
| 544 | 3300013308 | Ga0157375_10229802 | Ga0157375_102298022 | 261 |
| 545 | 3300014326 | Ga0157380_10227853 | Ga0157380_102278531 | 261 |
| 546 | 3300014745 | Ga0157377_10029766 | Ga0157377_100297661 | 261 |
| 547 | 3300014969 | Ga0157376_10107897 | Ga0157376_101078973 | 261 |
| 548 | 3300025900 | Ga0207710_10002459 | Ga0207710_100024596 | 261 |
| 549 | 3300025903 | Ga0207680_10060636 | Ga0207680_100606362 | 261 |
| 550 | 3300025904 | Ga0207647_10027722 | Ga0207647_100277224 | 261 |
| 551 | 3300025909 | Ga0207705_10022510 | Ga0207705_100225103 | 261 |
| 552 | 3300025909 | Ga0207705_10258906 | Ga0207705_102589062 | 261 |
| 553 | 3300025912 | Ga0207707_10021586 | Ga0207707_100215864 | 261 |
| 554 | 3300025917 | Ga0207660_10311835 | Ga0207660_103118351 | 261 |
| 555 | 3300025919 | Ga0207657_10004009 | Ga0207657_100040097 | 261 |
| 556 | 3300025919 | Ga0207657_10011455 | Ga0207657_1001145510 | 261 |
| 557 | 3300025920 | Ga0207649_10436275 | Ga0207649_104362751 | 261 |
| 558 | 3300025921 | Ga0207652_10000051 | Ga0207652_1000005110 | 261 |
| 559 | 3300025921 | Ga0207652_10094539 | Ga0207652_100945392 | 261 |
| 560 | 3300025921 | Ga0207652_10230880 | Ga0207652_102308802 | 261 |
| 561 | 3300025923 | Ga0207681_10034644 | Ga0207681_100346442 | 261 |
| 562 | 3300025926 | Ga0207659_10087143 | Ga0207659_100871432 | 261 |
| 563 | 3300025932 | Ga0207690_10036796 | Ga0207690_100367962 | 261 |
| 564 | 3300025932 | Ga0207690_10231126 | Ga0207690_102311262 | 261 |
| 565 | 3300025933 | Ga0207706_10014587 | Ga0207706_100145873 | 261 |
| 566 | 3300025937 | Ga0207669_10329338 | Ga0207669_103293381 | 261 |
| 567 | 3300025944 | Ga0207661_10034174 | Ga0207661_100341742 | 261 |
| 568 | 3300025944 | Ga0207661_10324434 | Ga0207661_103244342 | 261 |
| 569 | 3300025945 | Ga0207679_10027706 | Ga0207679_100277063 | 261 |
| 570 | 3300025949 | Ga0207667_10001836 | Ga0207667_1000183624 | 261 |
| 571 | 3300025949 | Ga0207667_10019110 | Ga0207667_100191103 | 261 |
| 572 | 3300025986 | Ga0207658_10021367 | Ga0207658_100213672 | 261 |
| 573 | 3300026067 | Ga0207678_10224817 | Ga0207678_102248173 | 261 |
| 574 | 3300026078 | Ga0207702_10018654 | Ga0207702_100186544 | 261 |
| 575 | 3300026078 | Ga0207702_10119116 | Ga0207702_101191163 | 261 |
| 576 | 3300026095 | Ga0207676_10581795 | Ga0207676_105817952 | 261 |
| 577 | 3300026116 | Ga0207674_10372073 | Ga0207674_103720732 | 261 |
| 578 | 3300026118 | Ga0207675_100074714 | Ga0207675_1000747141 | 261 |
| 579 | 3300026121 | Ga0207683_10435664 | Ga0207683_104356642 | 261 |
| 580 | 3300026142 | Ga0207698_10157758 | Ga0207698_101577584 | 261 |
| 581 | 3300031251 | Ga0265327_10017415 | Ga0265327_100174153 | 261 |
| 582 | 3300031251 | Ga0265327_10138812 | Ga0265327_101388121 | 261 |
| 583 | 3300031344 | Ga0265316_10156761 | Ga0265316_101567612 | 261 |
| 584 | 3300031911 | Ga0307412_10083586 | Ga0307412_100835862 | 261 |
| 585 | 3300037312 | Ga0395899_0006244 | Ga0395899_0006244_1286_2077 | 261 |
| 586 | 3300037418 | Ga0395900_0011131 | Ga0395900_0011131_2672_3463 | 261 |
| 587 | 3300037418 | Ga0395900_0309388 | Ga0395900_0309388_360_1151 | 261 |
| 588 | 3300037466 | Ga0395898_0014579 | Ga0395898_0014579_6845_7636 | 261 |
| 589 | 3300037466 | Ga0395898_0584194 | Ga0395898_0584194_257_1048 | 261 |
| 590 | 3300037471 | Ga0395905_0055864 | Ga0395905_0055864_2029_2820 | 261 |
| 591 | 3300038443 | Ga0395901_0013086 | Ga0395901_0013086_2341_3132 | 261 |
| 592 | 3300038443 | Ga0395901_0226549 | Ga0395901_0226549_938_1729 | 261 |
| 593 | 3300041413 | Ga0439465_0016138 | Ga0439465_0016138_528_1322 | 261 |
| 594 | 3300041509 | Ga0451843_0079405 | Ga0451843_0079405_384_1187 | 261 |
| 595 | 3300041997 | Ga0439431_0037381 | Ga0439431_0037381_284_1087 | 261 |
| 596 | 3300042002 | Ga0439442_008518 | Ga0439442_008518_102_905 | 261 |
| 597 | 3300042004 | Ga0439445_0008720 | Ga0439445_0008720_73_876 | 261 |
| 598 | 3300042007 | Ga0439449_0035992 | Ga0439449_0035992_998_1801 | 261 |
| 599 | 3300042014 | Ga0439457_014457 | Ga0439457_014457_809_1612 | 261 |
| 600 | 3300042435 | Ga0439434_0076203 | Ga0439434_0076203_144_947 | 261 |
| 601 | 3300046524 | Ga0495648_0002190 | Ga0495648_0002190_4230_5066 | 261 |
| 602 | 3300049569 | Ga0501032_0000800 | Ga0501032_0000800_4628_5425 | 261 |
| 603 | 3300049570 | Ga0501033_0147395 | Ga0501033_0147395_627_1436 | 261 |
| 604 | 3300049571 | Ga0501034_0012011 | Ga0501034_0012011_7515_8312 | 261 |
| 605 | 3300049571 | Ga0501034_0093334 | Ga0501034_0093334_2139_2948 | 261 |
| 606 | 3300049571 | Ga0501034_0094225 | Ga0501034_0094225_2132_2923 | 261 |
| 607 | 3300049573 | Ga0501037_0085574 | Ga0501037_0085574_622_1419 | 261 |
| 608 | 3300049574 | Ga0501038_0011233 | Ga0501038_0011233_4077_4874 | 261 |
| 609 | 3300049575 | Ga0501039_0018039 | Ga0501039_0018039_1416_2213 | 261 |
| 610 | 3300049579 | Ga0501043_0026745 | Ga0501043_0026745_1758_2555 | 261 |
| 611 | 3300049580 | Ga0501046_0064362 | Ga0501046_0064362_94_891 | 261 |
| 612 | 3300049582 | Ga0501048_0006736 | Ga0501048_0006736_1861_2658 | 261 |
| 613 | 3300049583 | Ga0501067_0012669 | Ga0501067_0012669_738_1535 | 261 |
| 614 | 3300049589 | Ga0501073_0021790 | Ga0501073_0021790_3182_3979 | 261 |
| 615 | 3300049590 | Ga0501074_0000935 | Ga0501074_0000935_6560_7357 | 261 |
| 616 | 3300049742 | Ga0501080_0075039 | Ga0501080_0075039_1972_2769 | 261 |
| 617 | 3300049744 | Ga0501083_0030933 | Ga0501083_0030933_254_1051 | 261 |
| 618 | 3300049822 | Ga0501035_0043246 | Ga0501035_0043246_504_1301 | 261 |
| 619 | 3300049823 | Ga0501044_0018177 | Ga0501044_0018177_4247_5044 | 261 |
| 620 | 3300053139 | Ga0500568_0009829 | Ga0500568_0009829_581_1432 | 261 |
| 621 | 3300053153 | Ga0500616_0140391 | Ga0500616_0140391_308_1102 | 261 |
| 622 | 3300053178 | Ga0500637_0096854 | Ga0500637_0096854_24_836 | 261 |
| 623 | 3300054114 | Ga0501084_0036272 | Ga0501084_0036272_450_1247 | 261 |
| 624 | 3300060353 | Ga0501082_0244375 | Ga0501082_0244375_597_1394 | 261 |
| 625 | 3300003320 | rootH2_10061393 | rootH2_1006139319 | 262 |
| 626 | 3300003322 | rootL2_10163886 | rootL2_101638863 | 262 |
| 627 | 3300003322 | rootL2_10260109 | rootL2_102601092 | 262 |
| 628 | 3300005353 | Ga0070669_100109044 | Ga0070669_1001090443 | 262 |
| 629 | 3300005367 | Ga0070667_100013431 | Ga0070667_1000134316 | 262 |
| 630 | 3300005456 | Ga0070678_100022664 | Ga0070678_1000226643 | 262 |
| 631 | 3300005458 | Ga0070681_10103829 | Ga0070681_101038293 | 262 |
| 632 | 3300005539 | Ga0068853_100000773 | Ga0068853_10000077318 | 262 |
| 633 | 3300005548 | Ga0070665_100000047 | Ga0070665_10000004766 | 262 |
| 634 | 3300005617 | Ga0068859_100000289 | Ga0068859_10000028926 | 262 |
| 635 | 3300005617 | Ga0068859_100250444 | Ga0068859_1002504442 | 262 |
| 636 | 3300005718 | Ga0068866_10033356 | Ga0068866_100333562 | 262 |
| 637 | 3300005841 | Ga0068863_100188840 | Ga0068863_1001888402 | 262 |
| 638 | 3300005843 | Ga0068860_100005149 | Ga0068860_1000051498 | 262 |
| 639 | 3300006237 | Ga0097621_100000352 | Ga0097621_10000035220 | 262 |
| 640 | 3300006358 | Ga0068871_100001720 | Ga0068871_10000172012 | 262 |
| 641 | 3300006881 | Ga0068865_100065807 | Ga0068865_1000658073 | 262 |
| 642 | 3300006931 | Ga0097620_100000289 | Ga0097620_10000028925 | 262 |
| 643 | 3300006931 | Ga0097620_100250432 | Ga0097620_1002504322 | 262 |
| 644 | 3300009094 | Ga0111539_10020311 | Ga0111539_100203115 | 262 |
| 645 | 3300009176 | Ga0105242_10035489 | Ga0105242_100354894 | 262 |
| 646 | 3300009553 | Ga0105249_10377449 | Ga0105249_103774492 | 262 |
| 647 | 3300010375 | Ga0105239_10001099 | Ga0105239_1000109932 | 262 |
| 648 | 3300010375 | Ga0105239_10148007 | Ga0105239_101480072 | 262 |
| 649 | 3300013296 | Ga0157374_10132396 | Ga0157374_101323962 | 262 |
| 650 | 3300013297 | Ga0157378_10044549 | Ga0157378_100445492 | 262 |
| 651 | 3300013306 | Ga0163162_10000237 | Ga0163162_1000023739 | 262 |
| 652 | 3300013308 | Ga0157375_10000599 | Ga0157375_1000059921 | 262 |
| 653 | 3300013308 | Ga0157375_10056438 | Ga0157375_100564383 | 262 |
| 654 | 3300014745 | Ga0157377_10110211 | Ga0157377_101102112 | 262 |
| 655 | 3300014969 | Ga0157376_10000971 | Ga0157376_100009715 | 262 |
| 656 | 3300017792 | Ga0163161_10032265 | Ga0163161_100322653 | 262 |
| 657 | 3300025899 | Ga0207642_10020063 | Ga0207642_100200633 | 262 |
| 658 | 3300025912 | Ga0207707_10103424 | Ga0207707_101034243 | 262 |
| 659 | 3300025926 | Ga0207659_10048990 | Ga0207659_100489903 | 262 |
| 660 | 3300025986 | Ga0207658_10002480 | Ga0207658_100024803 | 262 |
| 661 | 3300025986 | Ga0207658_10162652 | Ga0207658_101626522 | 262 |
| 662 | 3300026041 | Ga0207639_10030877 | Ga0207639_100308773 | 262 |
| 663 | 3300026088 | Ga0207641_10071587 | Ga0207641_100715872 | 262 |
| 664 | 3300026116 | Ga0207674_10092279 | Ga0207674_100922792 | 262 |
| 665 | 3300026121 | Ga0207683_10038510 | Ga0207683_100385104 | 262 |
| 666 | 3300028379 | Ga0268266_10000048 | Ga0268266_1000004822 | 262 |
| 667 | 3300028381 | Ga0268264_10002163 | Ga0268264_100021637 | 262 |
| 668 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012850 | 262 |
| 669 | 3300031730 | Ga0307516_10000486 | Ga0307516_1000048617 | 262 |
| 670 | 3300032004 | Ga0307414_10064093 | Ga0307414_100640931 | 262 |
| 671 | 3300033180 | Ga0307510_10002428 | Ga0307510_100024283 | 262 |
| 672 | 3300044706 | Ga0466964_0008038 | Ga0466964_0008038_1213_2022 | 262 |
| 673 | 3300044735 | Ga0466968_0056525 | Ga0466968_0056525_793_1602 | 262 |
| 674 | 3300044901 | Ga0466960_0197565 | Ga0466960_0197565_290_1087 | 262 |
| 675 | 3300046460 | Ga0495638_0062409 | Ga0495638_0062409_127_972 | 262 |
| 676 | 3300046507 | Ga0495606_0124843 | Ga0495606_0124843_514_1416 | 262 |
| 677 | 3300046694 | Ga0495649_0136271 | Ga0495649_0136271_279_1124 | 262 |
| 678 | 3300048903 | Ga0496100_0073676 | Ga0496100_0073676_620_1441 | 262 |
| 679 | 3300048907 | Ga0496104_0461326 | Ga0496104_0461326_219_1040 | 262 |
| 680 | 3300048917 | Ga0496114_0154237 | Ga0496114_0154237_14_835 | 262 |
| 681 | 3300049703 | Ga0501219_000019 | Ga0501219_000019_22754_23551 | 262 |
| 682 | 3300050005 | Ga0501284_00007 | Ga0501284_00007_31809_32606 | 262 |
| 683 | 3300050511 | nmdc:mga08y16_15141_c1 | nmdc:mga08y16_15141_c1_3769_4584 | 262 |
| 684 | 3300053092 | Ga0500583_0052500 | Ga0500583_0052500_923_1768 | 262 |
| 685 | 3300053130 | Ga0500642_0064529 | Ga0500642_0064529_227_1072 | 262 |
| 686 | 3300053151 | Ga0500604_0019153 | Ga0500604_0019153_298_1107 | 262 |
| 687 | 3300053156 | Ga0500622_0001947 | Ga0500622_0001947_3258_4103 | 262 |
| 688 | 3300053178 | Ga0500637_0101999 | Ga0500637_0101999_177_977 | 262 |
| 689 | 3300003322 | rootL2_10012238 | rootL2_100122382 | 263 |
| 690 | 3300005329 | Ga0070683_100013925 | Ga0070683_1000139255 | 263 |
| 691 | 3300005341 | Ga0070691_10097437 | Ga0070691_100974372 | 263 |
| 692 | 3300005354 | Ga0070675_100361372 | Ga0070675_1003613722 | 263 |
| 693 | 3300005535 | Ga0070684_100038510 | Ga0070684_1000385102 | 263 |
| 694 | 3300005539 | Ga0068853_100291166 | Ga0068853_1002911662 | 263 |
| 695 | 3300005563 | Ga0068855_100000081 | Ga0068855_10000008116 | 263 |
| 696 | 3300005614 | Ga0068856_100205214 | Ga0068856_1002052142 | 263 |
| 697 | 3300005616 | Ga0068852_100041393 | Ga0068852_1000413933 | 263 |
| 698 | 3300005834 | Ga0068851_10020590 | Ga0068851_100205903 | 263 |
| 699 | 3300005841 | Ga0068863_100097977 | Ga0068863_1000979774 | 263 |
| 700 | 3300005843 | Ga0068860_100000024 | Ga0068860_1000000248 | 263 |
| 701 | 3300009093 | Ga0105240_10001169 | Ga0105240_1000116938 | 263 |
| 702 | 3300009093 | Ga0105240_10003084 | Ga0105240_1000308412 | 263 |
| 703 | 3300009147 | Ga0114129_10017487 | Ga0114129_100174879 | 263 |
| 704 | 3300009545 | Ga0105237_10000294 | Ga0105237_1000029420 | 263 |
| 705 | 3300009545 | Ga0105237_10065649 | Ga0105237_100656492 | 263 |
| 706 | 3300010375 | Ga0105239_10038285 | Ga0105239_100382856 | 263 |
| 707 | 3300013104 | Ga0157370_10000945 | Ga0157370_1000094516 | 263 |
| 708 | 3300013104 | Ga0157370_10019993 | Ga0157370_100199933 | 263 |
| 709 | 3300013296 | Ga0157374_10000027 | Ga0157374_1000002786 | 263 |
| 710 | 3300013296 | Ga0157374_10034438 | Ga0157374_100344383 | 263 |
| 711 | 3300025911 | Ga0207654_10087861 | Ga0207654_100878612 | 263 |
| 712 | 3300025913 | Ga0207695_10000087 | Ga0207695_10000087236 | 263 |
| 713 | 3300025913 | Ga0207695_10000299 | Ga0207695_1000029966 | 263 |
| 714 | 3300025944 | Ga0207661_10076137 | Ga0207661_100761373 | 263 |
| 715 | 3300025949 | Ga0207667_10000172 | Ga0207667_1000017264 | 263 |
| 716 | 3300025949 | Ga0207667_10001462 | Ga0207667_1000146230 | 263 |
| 717 | 3300026023 | Ga0207677_10036508 | Ga0207677_100365082 | 263 |
| 718 | 3300026078 | Ga0207702_10159541 | Ga0207702_101595412 | 263 |
| 719 | 3300028380 | Ga0268265_10407220 | Ga0268265_104072201 | 263 |
| 720 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028188 | 263 |
| 721 | 3300031730 | Ga0307516_10091542 | Ga0307516_100915421 | 263 |
| 722 | 3300044658 | Ga0466972_0000001 | Ga0466972_0000001_258212_259030 | 263 |
| 723 | 3300044658 | Ga0466972_0000044 | Ga0466972_0000044_36823_37701 | 263 |
| 724 | 3300044693 | Ga0466961_0227683 | Ga0466961_0227683_16_852 | 263 |
| 725 | 3300044712 | Ga0453684_0029545 | Ga0453684_0029545_2069_2875 | 263 |
| 726 | 3300044765 | Ga0466970_0000486 | Ga0466970_0000486_1997_2815 | 263 |
| 727 | 3300044842 | Ga0466957_0059357 | Ga0466957_0059357_560_1438 | 263 |
| 728 | 3300044901 | Ga0466960_0076280 | Ga0466960_0076280_224_1042 | 263 |
| 729 | 3300047443 | Ga0495687_000129 | Ga0495687_000129_79064_79933 | 263 |
| 730 | 3300048918 | Ga0496115_0001691 | Ga0496115_0001691_4086_4901 | 263 |
| 731 | 3300048927 | Ga0496124_0059093 | Ga0496124_0059093_969_1784 | 263 |
| 732 | 3300050507 | nmdc:mga05p37_2990_c1 | nmdc:mga05p37_2990_c1_6678_7529 | 263 |
| 733 | 3300053086 | Ga0500578_0000026 | Ga0500578_0000026_80666_81544 | 263 |
| 734 | 3300053088 | Ga0500644_0011243 | Ga0500644_0011243_110_916 | 263 |
| 735 | 3300053093 | Ga0500651_0147083 | Ga0500651_0147083_33_911 | 263 |
| 736 | 3300053139 | Ga0500568_0000298 | Ga0500568_0000298_28340_29149 | 263 |
| 737 | 3300053146 | Ga0500588_0090237 | Ga0500588_0090237_106_984 | 263 |
| 738 | 3300053156 | Ga0500622_0006108 | Ga0500622_0006108_378_1184 | 263 |
| 739 | 3300003203 | JGI25406J46586_10000387 | JGI25406J46586_100003878 | 264 |
| 740 | 3300003320 | rootH2_10127001 | rootH2_101270013 | 264 |
| 741 | 3300005288 | Ga0065714_10109739 | Ga0065714_101097392 | 264 |
| 742 | 3300005290 | Ga0065712_10098628 | Ga0065712_100986282 | 264 |
| 743 | 3300005331 | Ga0070670_100065267 | Ga0070670_1000652673 | 264 |
| 744 | 3300005331 | Ga0070670_100315367 | Ga0070670_1003153672 | 264 |
| 745 | 3300005331 | Ga0070670_100325871 | Ga0070670_1003258711 | 264 |
| 746 | 3300005334 | Ga0068869_100169883 | Ga0068869_1001698832 | 264 |
| 747 | 3300005339 | Ga0070660_100490826 | Ga0070660_1004908261 | 264 |
| 748 | 3300005564 | Ga0070664_100107417 | Ga0070664_1001074172 | 264 |
| 749 | 3300005614 | Ga0068856_100036909 | Ga0068856_1000369092 | 264 |
| 750 | 3300005617 | Ga0068859_100002592 | Ga0068859_10000259220 | 264 |
| 751 | 3300005841 | Ga0068863_100821084 | Ga0068863_1008210841 | 264 |
| 752 | 3300005985 | Ga0081539_10000042 | Ga0081539_10000042125 | 264 |
| 753 | 3300006358 | Ga0068871_100099900 | Ga0068871_1000999002 | 264 |
| 754 | 3300006931 | Ga0097620_100002592 | Ga0097620_10000259220 | 264 |
| 755 | 3300009093 | Ga0105240_10000445 | Ga0105240_1000044528 | 264 |
| 756 | 3300009174 | Ga0105241_10000180 | Ga0105241_100001807 | 264 |
| 757 | 3300009545 | Ga0105237_10002656 | Ga0105237_100026569 | 264 |
| 758 | 3300009551 | Ga0105238_10001087 | Ga0105238_1000108712 | 264 |
| 759 | 3300013102 | Ga0157371_10084464 | Ga0157371_100844642 | 264 |
| 760 | 3300013296 | Ga0157374_10035460 | Ga0157374_100354604 | 264 |
| 761 | 3300013297 | Ga0157378_10428060 | Ga0157378_104280602 | 264 |
| 762 | 3300013307 | Ga0157372_10043891 | Ga0157372_100438915 | 264 |
| 763 | 3300013307 | Ga0157372_10441519 | Ga0157372_104415192 | 264 |
| 764 | 3300013307 | Ga0157372_10485090 | Ga0157372_104850901 | 264 |
| 765 | 3300013307 | Ga0157372_10714010 | Ga0157372_107140101 | 264 |
| 766 | 3300013307 | Ga0157372_11051056 | Ga0157372_110510561 | 264 |
| 767 | 3300014325 | Ga0163163_10001228 | Ga0163163_1000122816 | 264 |
| 768 | 3300014969 | Ga0157376_10078346 | Ga0157376_100783463 | 264 |
| 769 | 3300025909 | Ga0207705_10474639 | Ga0207705_104746391 | 264 |
| 770 | 3300025911 | Ga0207654_10001342 | Ga0207654_100013427 | 264 |
| 771 | 3300025913 | Ga0207695_10002728 | Ga0207695_1000272828 | 264 |
| 772 | 3300025914 | Ga0207671_10001222 | Ga0207671_100012224 | 264 |
| 773 | 3300025919 | Ga0207657_10422044 | Ga0207657_104220441 | 264 |
| 774 | 3300025924 | Ga0207694_10035018 | Ga0207694_100350183 | 264 |
| 775 | 3300025925 | Ga0207650_10049949 | Ga0207650_100499493 | 264 |
| 776 | 3300025942 | Ga0207689_10319633 | Ga0207689_103196332 | 264 |
| 777 | 3300025945 | Ga0207679_10242784 | Ga0207679_102427842 | 264 |
| 778 | 3300026078 | Ga0207702_10015635 | Ga0207702_100156355 | 264 |
| 779 | 3300026095 | Ga0207676_10362322 | Ga0207676_103623221 | 264 |
| 780 | 3300026116 | Ga0207674_10582874 | Ga0207674_105828742 | 264 |
| 781 | 3300026142 | Ga0207698_10403180 | Ga0207698_104031802 | 264 |
| 782 | 3300028381 | Ga0268264_10002184 | Ga0268264_100021842 | 264 |
| 783 | 3300028794 | Ga0307515_10000778 | Ga0307515_1000077819 | 264 |
| 784 | 3300031852 | Ga0307410_10159570 | Ga0307410_101595701 | 264 |
| 785 | 3300031903 | Ga0307407_10288883 | Ga0307407_102888831 | 264 |
| 786 | 3300032004 | Ga0307414_10327145 | Ga0307414_103271452 | 264 |
| 787 | 3300037466 | Ga0395898_0001425 | Ga0395898_0001425_17860_18666 | 264 |
| 788 | 3300037471 | Ga0395905_0002632 | Ga0395905_0002632_13963_14778 | 264 |
| 789 | 3300038443 | Ga0395901_0022855 | Ga0395901_0022855_3673_4479 | 264 |
| 790 | 3300038443 | Ga0395901_0270417 | Ga0395901_0270417_501_1316 | 264 |
| 791 | 3300044658 | Ga0466972_0009913 | Ga0466972_0009913_1781_2629 | 264 |
| 792 | 3300044673 | Ga0453683_0292019 | Ga0453683_0292019_11_805 | 264 |
| 793 | 3300044735 | Ga0466968_0024864 | Ga0466968_0024864_1535_2383 | 264 |
| 794 | 3300045051 | Ga0451576_0658158 | Ga0451576_0658158_118_912 | 264 |
| 795 | 3300049652 | Ga0501202_004421 | Ga0501202_004421_1635_2429 | 264 |
| 796 | 3300049663 | Ga0501223_016511 | Ga0501223_016511_593_1387 | 264 |
| 797 | 3300049822 | Ga0501035_0338162 | Ga0501035_0338162_401_1195 | 264 |
| 798 | 3300039093 | Ga0400489_76974 | Ga0400489_76974_9722_10543 | 265 |
| 799 | 3300049571 | Ga0501034_0357151 | Ga0501034_0357151_26_901 | 265 |
| 800 | 3300005841 | Ga0068863_100047532 | Ga0068863_1000475321 | 267 |
| 801 | 3300010375 | Ga0105239_10000360 | Ga0105239_1000036026 | 267 |
| 802 | 3300046648 | Ga0495611_0000065 | Ga0495611_0000065_48877_49749 | 267 |
| 803 | 3300053108 | Ga0500562_000053 | Ga0500562_000053_15011_15835 | 267 |
| 804 | 3300013307 | Ga0157372_10147052 | Ga0157372_101470523 | 271 |
| 805 | 3300025912 | Ga0207707_10058051 | Ga0207707_100580514 | 271 |
| 806 | 3300005337 | Ga0070682_100000012 | Ga0070682_100000012162 | 274 |
| 807 | 3300030521 | Ga0307511_10000002 | Ga0307511_1000000263 | 276 |
| 808 | 3300013307 | Ga0157372_10133414 | Ga0157372_101334142 | 277 |
| 809 | 3300001904 | JGI24736J21556_1015358 | JGI24736J21556_10153582 | 278 |
| 810 | 3300005339 | Ga0070660_100094125 | Ga0070660_1000941252 | 278 |
| 811 | 3300005366 | Ga0070659_100012620 | Ga0070659_1000126202 | 278 |
| 812 | 3300005616 | Ga0068852_100002561 | Ga0068852_1000025618 | 278 |
| 813 | 3300025904 | Ga0207647_10000358 | Ga0207647_1000035824 | 278 |
| 814 | 3300025919 | Ga0207657_10102212 | Ga0207657_101022122 | 278 |
| 815 | 3300025932 | Ga0207690_10173416 | Ga0207690_101734162 | 278 |
| 816 | 3300026142 | Ga0207698_10025447 | Ga0207698_100254474 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e11-assembly2.cif.gz_D | the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site | 0.978 | 17 | 276 |
| 2e11-assembly2.cif.gz_D | the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site | 0.9562 | 17 | 276 |
| 3p8k-assembly1.cif.gz_B | crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus | 0.9141 | 16 | 272 |
| 2w1v-assembly1.cif.gz_B | crystal structure of mouse nitrilase-2 at 1.4a resolution | 0.8999 | 16 | 272 |
| 1ems-assembly1.cif.gz_A | crystal structure of the c. elegans nitfhit protein | 0.8762 | 16 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2e11D00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.978 | 17 | 276 | 3.60.110.10 |
| af_Q47679_3_256_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9678 | 18 | 277 | 3.60.110.10 |
| af_Q47679_3_256_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9603 | 18 | 277 | 3.60.110.10 |
| 2e11D00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9562 | 17 | 276 | 3.60.110.10 |
| af_Q2FWM9_1_261_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9322 | 18 | 272 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M7RF19-F1-model_v4 | Carbon-nitrogen hydrolase | 0.9927 | 17 | 277 |
GO:0050152
GO:0106008 |
| AF-A0A4Q5YUG9-F1-model_v4 | Nitrilase family protein | 0.9927 | 18 | 217 |
GO:0050152
GO:0106008 |
| AF-A0A4V1UQN5-F1-model_v4 | Nitrilase family protein | 0.9915 | 18 | 147 |
GO:0050152
GO:0106008 |
| AF-A0A7V5EN94-F1-model_v4 | Nitrilase family protein | 0.9905 | 17 | 272 |
GO:0050152
GO:0106008 |
| AF-A0A4Q5WBB1-F1-model_v4 | Nitrilase family protein | 0.9886 | 18 | 171 |
GO:0050152
GO:0106008 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar