F481685
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 807 | 360 | 805 | 51 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1028298|Ga0265337_10282983 |
| Length | 53 |
| Sequence | MSQHTSFRQGSGSSKKKRNVLKRFERIDLMKKRGVWKEGTKRVTGLPKTRIGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 3 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 257 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 258 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 259 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 260 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 358 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.74 |
| Nodule | 0 |
| Rhizoplane | 4.83 |
| Rhizosphere | 93.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_9372160 | 2162886011 | Unclassified | 899 |
| 2 | ARcpr5yngRDRAFT_c023372 | 3300000043 | Bacteria | 527 |
| 3 | JGI25405J52794_10003108 | 3300003911 | Bacteria | 2891 |
| 4 | JGI25405J52794_10007597 | 3300003911 | Bacteria | 2002 |
| 5 | JGI25405J52794_10054083 | 3300003911 | Bacteria | 863 |
| 6 | Ga0065714_10074612 | 3300005288 | Bacteria | 3013 |
| 7 | Ga0065704_10023110 | 3300005289 | Bacteria | 1757 |
| 8 | Ga0065712_10269117 | 3300005290 | Bacteria | 919 |
| 9 | Ga0065712_10284503 | 3300005290 | Unclassified | 889 |
| 10 | Ga0065712_10701270 | 3300005290 | Unclassified | 546 |
| 11 | Ga0065715_10003886 | 3300005293 | Bacteria | 10812 |
| 12 | Ga0065715_10257808 | 3300005293 | Unclassified | 1147 |
| 13 | Ga0065715_10378729 | 3300005293 | Unclassified | 910 |
| 14 | Ga0065715_10425479 | 3300005293 | Bacteria | 837 |
| 15 | Ga0065707_10031506 | 3300005295 | Unclassified | 2328 |
| 16 | Ga0070658_10283812 | 3300005327 | Unclassified | 1410 |
| 17 | Ga0070658_10800003 | 3300005327 | Unclassified | 819 |
| 18 | Ga0070676_10003135 | 3300005328 | Bacteria | 8545 |
| 19 | Ga0070676_10411974 | 3300005328 | Unclassified | 943 |
| 20 | Ga0070676_10472106 | 3300005328 | Unclassified | 886 |
| 21 | Ga0070676_11623094 | 3300005328 | Unclassified | 500 |
| 22 | Ga0070683_100125569 | 3300005329 | Unclassified | 2425 |
| 23 | Ga0070690_100080891 | 3300005330 | Bacteria | 2125 |
| 24 | Ga0070690_100348237 | 3300005330 | Bacteria | 1075 |
| 25 | Ga0070690_100442906 | 3300005330 | Bacteria | 962 |
| 26 | Ga0070690_100613580 | 3300005330 | Unclassified | 827 |
| 27 | Ga0070670_100011533 | 3300005331 | Bacteria | 7558 |
| 28 | Ga0070670_100191497 | 3300005331 | Bacteria | 1776 |
| 29 | Ga0070670_101275448 | 3300005331 | Bacteria | 672 |
| 30 | Ga0070670_101330871 | 3300005331 | Unclassified | 658 |
| 31 | Ga0068869_100617218 | 3300005334 | Bacteria | 917 |
| 32 | Ga0068869_101114292 | 3300005334 | Bacteria | 691 |
| 33 | Ga0070666_10008158 | 3300005335 | Bacteria | 6489 |
| 34 | Ga0068868_100257013 | 3300005338 | Unclassified | 1472 |
| 35 | Ga0068868_100406257 | 3300005338 | Bacteria | 1176 |
| 36 | Ga0068868_100547195 | 3300005338 | Unclassified | 1020 |
| 37 | Ga0068868_100963547 | 3300005338 | Unclassified | 779 |
| 38 | Ga0068868_101444014 | 3300005338 | Bacteria | 643 |
| 39 | Ga0070660_100413102 | 3300005339 | Bacteria | 1117 |
| 40 | Ga0070689_100077351 | 3300005340 | Bacteria | 2607 |
| 41 | Ga0070689_100152658 | 3300005340 | Bacteria | 1863 |
| 42 | Ga0070689_102141847 | 3300005340 | Bacteria | 512 |
| 43 | Ga0070661_100920961 | 3300005344 | Unclassified | 722 |
| 44 | Ga0070661_101730851 | 3300005344 | Unclassified | 530 |
| 45 | Ga0070668_100055023 | 3300005347 | Bacteria | 3071 |
| 46 | Ga0070668_100201146 | 3300005347 | Bacteria | 1635 |
| 47 | Ga0070668_100433373 | 3300005347 | Bacteria | 1127 |
| 48 | Ga0070668_100984870 | 3300005347 | Unclassified | 757 |
| 49 | Ga0070668_102028512 | 3300005347 | Unclassified | 531 |
| 50 | Ga0070669_100154726 | 3300005353 | Bacteria | 1777 |
| 51 | Ga0070669_100336255 | 3300005353 | Bacteria | 1223 |
| 52 | Ga0070669_101911746 | 3300005353 | Unclassified | 518 |
| 53 | Ga0070675_100286305 | 3300005354 | Unclassified | 1449 |
| 54 | Ga0070675_100368645 | 3300005354 | Unclassified | 1276 |
| 55 | Ga0070675_100507115 | 3300005354 | Unclassified | 1088 |
| 56 | Ga0070675_100950108 | 3300005354 | Unclassified | 788 |
| 57 | Ga0070671_100005387 | 3300005355 | Bacteria | 10201 |
| 58 | Ga0070671_100033099 | 3300005355 | Bacteria | 4273 |
| 59 | Ga0070671_100110880 | 3300005355 | Bacteria | 2305 |
| 60 | Ga0070671_100193118 | 3300005355 | Bacteria | 1726 |
| 61 | Ga0070671_101091214 | 3300005355 | Bacteria | 701 |
| 62 | Ga0070674_100004297 | 3300005356 | Bacteria | 8105 |
| 63 | Ga0070674_100126478 | 3300005356 | Bacteria | 1899 |
| 64 | Ga0070674_100238858 | 3300005356 | Bacteria | 1421 |
| 65 | Ga0070674_100425593 | 3300005356 | Unclassified | 1090 |
| 66 | Ga0070674_101729355 | 3300005356 | Unclassified | 566 |
| 67 | Ga0070673_100017919 | 3300005364 | Bacteria | 5047 |
| 68 | Ga0070673_100100918 | 3300005364 | Unclassified | 2377 |
| 69 | Ga0070673_100210662 | 3300005364 | Bacteria | 1678 |
| 70 | Ga0070673_100396460 | 3300005364 | Unclassified | 1233 |
| 71 | Ga0070673_101195936 | 3300005364 | Bacteria | 712 |
| 72 | Ga0070673_101298339 | 3300005364 | Unclassified | 683 |
| 73 | Ga0070688_100009774 | 3300005365 | Bacteria | 5267 |
| 74 | Ga0070688_100018097 | 3300005365 | Unclassified | 4059 |
| 75 | Ga0070659_100728747 | 3300005366 | Bacteria | 859 |
| 76 | Ga0070659_100899766 | 3300005366 | Unclassified | 773 |
| 77 | Ga0070659_101872579 | 3300005366 | Bacteria | 538 |
| 78 | Ga0070667_100142723 | 3300005367 | Bacteria | 2098 |
| 79 | Ga0070667_100252921 | 3300005367 | Unclassified | 1576 |
| 80 | Ga0070667_101535379 | 3300005367 | Unclassified | 626 |
| 81 | Ga0070703_10066704 | 3300005406 | Bacteria | 1191 |
| 82 | Ga0070703_10095729 | 3300005406 | Bacteria | 1038 |
| 83 | Ga0070709_10012964 | 3300005434 | Unclassified | 4675 |
| 84 | Ga0070714_100091936 | 3300005435 | Bacteria | 2659 |
| 85 | Ga0070714_100586178 | 3300005435 | Bacteria | 1070 |
| 86 | Ga0070714_100914622 | 3300005435 | Unclassified | 852 |
| 87 | Ga0070714_101911625 | 3300005435 | Bacteria | 579 |
| 88 | Ga0070713_100032759 | 3300005436 | Unclassified | 4155 |
| 89 | Ga0070713_100375075 | 3300005436 | Bacteria | 1324 |
| 90 | Ga0070713_101182911 | 3300005436 | Bacteria | 740 |
| 91 | Ga0070710_10952955 | 3300005437 | Unclassified | 622 |
| 92 | Ga0070711_100028777 | 3300005439 | Bacteria | 3659 |
| 93 | Ga0070711_101323145 | 3300005439 | Unclassified | 626 |
| 94 | Ga0070705_100217366 | 3300005440 | Bacteria | 1321 |
| 95 | Ga0070705_101516812 | 3300005440 | Unclassified | 562 |
| 96 | Ga0070700_100833482 | 3300005441 | Unclassified | 745 |
| 97 | Ga0070700_101859241 | 3300005441 | Unclassified | 520 |
| 98 | Ga0070694_100993383 | 3300005444 | Unclassified | 696 |
| 99 | Ga0070708_100010461 | 3300005445 | Bacteria | 7522 |
| 100 | Ga0070708_100035062 | 3300005445 | Unclassified | 4370 |
| 101 | Ga0070708_100066029 | 3300005445 | Unclassified | 3246 |
| 102 | Ga0070708_100235868 | 3300005445 | Unclassified | 1717 |
| 103 | Ga0070708_100247791 | 3300005445 | Bacteria | 1673 |
| 104 | Ga0070708_100748156 | 3300005445 | Unclassified | 919 |
| 105 | Ga0070708_101592849 | 3300005445 | Unclassified | 608 |
| 106 | Ga0070663_101425108 | 3300005455 | Bacteria | 614 |
| 107 | Ga0070678_100012695 | 3300005456 | Bacteria | 5251 |
| 108 | Ga0070678_100944682 | 3300005456 | Bacteria | 790 |
| 109 | Ga0070678_101258059 | 3300005456 | Bacteria | 688 |
| 110 | Ga0070662_100063402 | 3300005457 | Bacteria | 2703 |
| 111 | Ga0070662_100197626 | 3300005457 | Bacteria | 1594 |
| 112 | Ga0070662_100412734 | 3300005457 | Bacteria | 1116 |
| 113 | Ga0070662_100470934 | 3300005457 | Bacteria | 1045 |
| 114 | Ga0070681_11022046 | 3300005458 | Bacteria | 747 |
| 115 | Ga0068867_100101958 | 3300005459 | Bacteria | 2193 |
| 116 | Ga0068867_100317492 | 3300005459 | Bacteria | 1290 |
| 117 | Ga0068867_100559192 | 3300005459 | Bacteria | 992 |
| 118 | Ga0068867_101057224 | 3300005459 | Bacteria | 739 |
| 119 | Ga0070685_10107195 | 3300005466 | Unclassified | 1715 |
| 120 | Ga0070685_10128602 | 3300005466 | Unclassified | 1581 |
| 121 | Ga0070706_100029693 | 3300005467 | Bacteria | 5038 |
| 122 | Ga0070706_100086451 | 3300005467 | Bacteria | 2906 |
| 123 | Ga0070706_100126649 | 3300005467 | Unclassified | 2382 |
| 124 | Ga0070706_100140341 | 3300005467 | Bacteria | 2256 |
| 125 | Ga0070706_100148954 | 3300005467 | Bacteria | 2185 |
| 126 | Ga0070706_100431209 | 3300005467 | Bacteria | 1227 |
| 127 | Ga0070706_100518072 | 3300005467 | Unclassified | 1109 |
| 128 | Ga0070706_100830135 | 3300005467 | Unclassified | 855 |
| 129 | Ga0070706_101788112 | 3300005467 | Unclassified | 559 |
| 130 | Ga0070707_100001020 | 3300005468 | Bacteria | 27758 |
| 131 | Ga0070707_100011737 | 3300005468 | Bacteria | 8177 |
| 132 | Ga0070707_100060459 | 3300005468 | Unclassified | 3633 |
| 133 | Ga0070707_100238139 | 3300005468 | Bacteria | 1772 |
| 134 | Ga0070707_100335416 | 3300005468 | Unclassified | 1469 |
| 135 | Ga0070707_100801358 | 3300005468 | Unclassified | 906 |
| 136 | Ga0070707_101017942 | 3300005468 | Unclassified | 794 |
| 137 | Ga0070707_101428125 | 3300005468 | Unclassified | 659 |
| 138 | Ga0070707_101718125 | 3300005468 | Unclassified | 595 |
| 139 | Ga0070698_100001128 | 3300005471 | Bacteria | 29519 |
| 140 | Ga0070698_100001373 | 3300005471 | Bacteria | 27059 |
| 141 | Ga0070698_101188128 | 3300005471 | Unclassified | 712 |
| 142 | Ga0070698_102026818 | 3300005471 | Unclassified | 529 |
| 143 | Ga0070699_100380348 | 3300005518 | Unclassified | 1275 |
| 144 | Ga0070699_100925469 | 3300005518 | Bacteria | 799 |
| 145 | Ga0070684_100045928 | 3300005535 | Bacteria | 3784 |
| 146 | Ga0070697_100001619 | 3300005536 | Bacteria | 17147 |
| 147 | Ga0070697_100275791 | 3300005536 | Bacteria | 1442 |
| 148 | Ga0070697_100595057 | 3300005536 | Bacteria | 972 |
| 149 | Ga0070697_100748440 | 3300005536 | Bacteria | 864 |
| 150 | Ga0070697_101270264 | 3300005536 | Unclassified | 657 |
| 151 | Ga0070697_101482938 | 3300005536 | Unclassified | 606 |
| 152 | Ga0070697_101563586 | 3300005536 | Unclassified | 590 |
| 153 | Ga0070672_100043527 | 3300005543 | Bacteria | 3463 |
| 154 | Ga0070672_100161464 | 3300005543 | Bacteria | 1859 |
| 155 | Ga0070672_100374474 | 3300005543 | Unclassified | 1217 |
| 156 | Ga0070672_100396256 | 3300005543 | Bacteria | 1183 |
| 157 | Ga0070672_100689213 | 3300005543 | Unclassified | 894 |
| 158 | Ga0070686_100515197 | 3300005544 | Unclassified | 930 |
| 159 | Ga0070686_100655317 | 3300005544 | Unclassified | 833 |
| 160 | Ga0070695_100328790 | 3300005545 | Bacteria | 1139 |
| 161 | Ga0070696_100369859 | 3300005546 | Bacteria | 1115 |
| 162 | Ga0070693_100830988 | 3300005547 | Unclassified | 687 |
| 163 | Ga0070665_100240953 | 3300005548 | Unclassified | 1809 |
| 164 | Ga0070665_100251254 | 3300005548 | Bacteria | 1769 |
| 165 | Ga0070665_100346721 | 3300005548 | Bacteria | 1490 |
| 166 | Ga0070665_101218777 | 3300005548 | Unclassified | 763 |
| 167 | Ga0070665_102230876 | 3300005548 | Bacteria | 551 |
| 168 | Ga0068855_100007498 | 3300005563 | Bacteria | 13208 |
| 169 | Ga0070664_100979472 | 3300005564 | Unclassified | 794 |
| 170 | Ga0070664_101647972 | 3300005564 | Unclassified | 608 |
| 171 | Ga0068857_100462713 | 3300005577 | Bacteria | 1187 |
| 172 | Ga0068857_102179892 | 3300005577 | Unclassified | 544 |
| 173 | Ga0068854_101054778 | 3300005578 | Unclassified | 722 |
| 174 | Ga0068852_100077481 | 3300005616 | Bacteria | 2939 |
| 175 | Ga0068852_101946378 | 3300005616 | Unclassified | 610 |
| 176 | Ga0068852_102126448 | 3300005616 | Unclassified | 583 |
| 177 | Ga0068859_100526303 | 3300005617 | Unclassified | 1277 |
| 178 | Ga0068859_101223863 | 3300005617 | Unclassified | 827 |
| 179 | Ga0068864_100379287 | 3300005618 | Bacteria | 1339 |
| 180 | Ga0068866_10221888 | 3300005718 | Unclassified | 1141 |
| 181 | Ga0068866_11252912 | 3300005718 | Unclassified | 537 |
| 182 | Ga0068861_101745458 | 3300005719 | Unclassified | 616 |
| 183 | Ga0068861_101854483 | 3300005719 | Unclassified | 599 |
| 184 | Ga0068863_100425419 | 3300005841 | Unclassified | 1301 |
| 185 | Ga0068863_100952651 | 3300005841 | Bacteria | 860 |
| 186 | Ga0068863_101144119 | 3300005841 | Bacteria | 783 |
| 187 | Ga0068863_101531780 | 3300005841 | Unclassified | 675 |
| 188 | Ga0068863_101595509 | 3300005841 | Unclassified | 662 |
| 189 | Ga0068858_100213068 | 3300005842 | Bacteria | 1828 |
| 190 | Ga0068858_100873562 | 3300005842 | Unclassified | 879 |
| 191 | Ga0068858_101260012 | 3300005842 | Bacteria | 727 |
| 192 | Ga0068858_101974237 | 3300005842 | Unclassified | 577 |
| 193 | Ga0068860_100004333 | 3300005843 | Bacteria | 14506 |
| 194 | Ga0068860_101528853 | 3300005843 | Bacteria | 689 |
| 195 | Ga0068860_102420409 | 3300005843 | Unclassified | 545 |
| 196 | Ga0068862_100261199 | 3300005844 | Bacteria | 1581 |
| 197 | Ga0068862_100757840 | 3300005844 | Unclassified | 945 |
| 198 | Ga0068862_101038120 | 3300005844 | Unclassified | 812 |
| 199 | Ga0068862_101810208 | 3300005844 | Unclassified | 620 |
| 200 | Ga0081455_10001571 | 3300005937 | Bacteria | 28055 |
| 201 | Ga0081455_10001819 | 3300005937 | Bacteria | 25669 |
| 202 | Ga0081455_10011555 | 3300005937 | Bacteria | 8862 |
| 203 | Ga0081455_10012797 | 3300005937 | Bacteria | 8339 |
| 204 | Ga0081455_10018200 | 3300005937 | Bacteria | 6706 |
| 205 | Ga0081455_10038672 | 3300005937 | Unclassified | 4223 |
| 206 | Ga0081455_10077432 | 3300005937 | Unclassified | 2736 |
| 207 | Ga0081455_10084449 | 3300005937 | Unclassified | 2591 |
| 208 | Ga0081455_10149134 | 3300005937 | Unclassified | 1805 |
| 209 | Ga0081538_10043902 | 3300005981 | Bacteria | 2798 |
| 210 | Ga0081540_1000010 | 3300005983 | Bacteria | 193206 |
| 211 | Ga0081539_10008110 | 3300005985 | Bacteria | 9279 |
| 212 | Ga0081539_10391942 | 3300005985 | Unclassified | 578 |
| 213 | Ga0070717_10000015 | 3300006028 | Bacteria | 208620 |
| 214 | Ga0070717_10000276 | 3300006028 | Bacteria | 35106 |
| 215 | Ga0070717_10260706 | 3300006028 | Bacteria | 1534 |
| 216 | Ga0070717_10441606 | 3300006028 | Bacteria | 1172 |
| 217 | Ga0075363_100906710 | 3300006048 | Unclassified | 540 |
| 218 | Ga0070715_10061663 | 3300006163 | Bacteria | 1647 |
| 219 | Ga0070715_10659377 | 3300006163 | Unclassified | 620 |
| 220 | Ga0070712_100330997 | 3300006175 | Bacteria | 1241 |
| 221 | Ga0070712_100374543 | 3300006175 | Bacteria | 1170 |
| 222 | Ga0070712_100823195 | 3300006175 | Unclassified | 797 |
| 223 | Ga0070712_101356976 | 3300006175 | Unclassified | 620 |
| 224 | Ga0070712_101634951 | 3300006175 | Bacteria | 564 |
| 225 | Ga0075369_10285653 | 3300006186 | Unclassified | 769 |
| 226 | Ga0097621_100184167 | 3300006237 | Unclassified | 1806 |
| 227 | Ga0097621_101608258 | 3300006237 | Unclassified | 618 |
| 228 | Ga0068871_100009471 | 3300006358 | Bacteria | 7061 |
| 229 | Ga0068871_100919720 | 3300006358 | Unclassified | 811 |
| 230 | Ga0075428_101889793 | 3300006844 | Unclassified | 620 |
| 231 | Ga0075430_100981472 | 3300006846 | Unclassified | 696 |
| 232 | Ga0075430_101035661 | 3300006846 | Unclassified | 676 |
| 233 | Ga0075433_11523479 | 3300006852 | Unclassified | 577 |
| 234 | Ga0075434_100308097 | 3300006871 | Unclassified | 1604 |
| 235 | Ga0075434_100376968 | 3300006871 | Bacteria | 1439 |
| 236 | Ga0075434_101711928 | 3300006871 | Unclassified | 636 |
| 237 | Ga0075429_100229178 | 3300006880 | Unclassified | 1627 |
| 238 | Ga0075429_100301159 | 3300006880 | Bacteria | 1404 |
| 239 | Ga0068865_101251336 | 3300006881 | Unclassified | 658 |
| 240 | Ga0075436_100077149 | 3300006914 | Unclassified | 2308 |
| 241 | Ga0075436_100145012 | 3300006914 | Unclassified | 1669 |
| 242 | Ga0075436_100241475 | 3300006914 | Bacteria | 1285 |
| 243 | Ga0097620_100526311 | 3300006931 | Unclassified | 1277 |
| 244 | Ga0097620_101223899 | 3300006931 | Unclassified | 827 |
| 245 | Ga0075435_101026111 | 3300007076 | Bacteria | 720 |
| 246 | Ga0099794_10082571 | 3300007265 | Unclassified | 1586 |
| 247 | Ga0099794_10106214 | 3300007265 | Unclassified | 1404 |
| 248 | Ga0099795_10187027 | 3300007788 | Bacteria | 868 |
| 249 | Ga0105250_10397652 | 3300009092 | Unclassified | 610 |
| 250 | Ga0105240_10403312 | 3300009093 | Bacteria | 1539 |
| 251 | Ga0111539_10108839 | 3300009094 | Unclassified | 3252 |
| 252 | Ga0111539_10331565 | 3300009094 | Unclassified | 1771 |
| 253 | Ga0111539_10573865 | 3300009094 | Unclassified | 1314 |
| 254 | Ga0111539_10594067 | 3300009094 | Unclassified | 1289 |
| 255 | Ga0111539_11405934 | 3300009094 | Bacteria | 809 |
| 256 | Ga0111539_12017888 | 3300009094 | Bacteria | 669 |
| 257 | Ga0111539_12446991 | 3300009094 | Bacteria | 606 |
| 258 | Ga0105245_10044186 | 3300009098 | Bacteria | 3976 |
| 259 | Ga0105245_10102993 | 3300009098 | Bacteria | 2644 |
| 260 | Ga0105245_10414801 | 3300009098 | Unclassified | 1348 |
| 261 | Ga0105245_10723361 | 3300009098 | Unclassified | 1030 |
| 262 | Ga0105245_11129140 | 3300009098 | Unclassified | 830 |
| 263 | Ga0105245_11661373 | 3300009098 | Unclassified | 691 |
| 264 | Ga0105247_10396792 | 3300009101 | Unclassified | 982 |
| 265 | Ga0105247_10403943 | 3300009101 | Unclassified | 974 |
| 266 | Ga0114129_10101962 | 3300009147 | Bacteria | 3970 |
| 267 | Ga0114129_10486043 | 3300009147 | Unclassified | 1615 |
| 268 | Ga0114129_10619545 | 3300009147 | Unclassified | 1400 |
| 269 | Ga0114129_10905959 | 3300009147 | Unclassified | 1117 |
| 270 | Ga0114129_12371582 | 3300009147 | Unclassified | 636 |
| 271 | Ga0105243_10313555 | 3300009148 | Unclassified | 1426 |
| 272 | Ga0105241_10068342 | 3300009174 | Bacteria | 2753 |
| 273 | Ga0105242_10018695 | 3300009176 | Bacteria | 5422 |
| 274 | Ga0105242_12126986 | 3300009176 | Unclassified | 605 |
| 275 | Ga0105242_12406642 | 3300009176 | Bacteria | 574 |
| 276 | Ga0105248_10802106 | 3300009177 | Bacteria | 1063 |
| 277 | Ga0105248_11778740 | 3300009177 | Unclassified | 699 |
| 278 | Ga0105237_10028067 | 3300009545 | Bacteria | 5734 |
| 279 | Ga0105237_10397394 | 3300009545 | Bacteria | 1383 |
| 280 | Ga0105237_10779285 | 3300009545 | Bacteria | 963 |
| 281 | Ga0105237_11387458 | 3300009545 | Unclassified | 709 |
| 282 | Ga0105237_12177859 | 3300009545 | Bacteria | 564 |
| 283 | Ga0105238_11002522 | 3300009551 | Unclassified | 856 |
| 284 | Ga0105238_11409837 | 3300009551 | Unclassified | 724 |
| 285 | Ga0105249_11178870 | 3300009553 | Unclassified | 837 |
| 286 | Ga0105249_13314999 | 3300009553 | Bacteria | 518 |
| 287 | Ga0105239_10322587 | 3300010375 | Bacteria | 1742 |
| 288 | Ga0105239_10394873 | 3300010375 | Bacteria | 1565 |
| 289 | Ga0105239_10449527 | 3300010375 | Bacteria | 1462 |
| 290 | Ga0105239_12147934 | 3300010375 | Unclassified | 649 |
| 291 | Ga0105246_11132690 | 3300011119 | Unclassified | 716 |
| 292 | Ga0105246_11346602 | 3300011119 | Unclassified | 664 |
| 293 | Ga0105246_11782802 | 3300011119 | Unclassified | 587 |
| 294 | Ga0157373_10895790 | 3300013100 | Unclassified | 658 |
| 295 | Ga0157371_10396955 | 3300013102 | Bacteria | 1009 |
| 296 | Ga0157371_10495292 | 3300013102 | Unclassified | 902 |
| 297 | Ga0157371_11191656 | 3300013102 | Unclassified | 587 |
| 298 | Ga0157370_10303807 | 3300013104 | Unclassified | 1473 |
| 299 | Ga0157369_10091270 | 3300013105 | Bacteria | 3252 |
| 300 | Ga0157374_10003871 | 3300013296 | Bacteria | 12563 |
| 301 | Ga0157374_10246805 | 3300013296 | Unclassified | 1756 |
| 302 | Ga0157374_10427792 | 3300013296 | Bacteria | 1323 |
| 303 | Ga0157374_11229749 | 3300013296 | Unclassified | 770 |
| 304 | Ga0157374_11369943 | 3300013296 | Bacteria | 730 |
| 305 | Ga0157374_11538805 | 3300013296 | Unclassified | 689 |
| 306 | Ga0157374_12984276 | 3300013296 | Unclassified | 500 |
| 307 | Ga0157378_10030296 | 3300013297 | Unclassified | 4782 |
| 308 | Ga0157378_10031400 | 3300013297 | Bacteria | 4692 |
| 309 | Ga0157378_10122166 | 3300013297 | Unclassified | 2402 |
| 310 | Ga0157378_10259446 | 3300013297 | Unclassified | 1667 |
| 311 | Ga0157378_10337499 | 3300013297 | Unclassified | 1468 |
| 312 | Ga0157378_10349575 | 3300013297 | Unclassified | 1444 |
| 313 | Ga0157378_10407875 | 3300013297 | Bacteria | 1340 |
| 314 | Ga0157378_10752684 | 3300013297 | Unclassified | 997 |
| 315 | Ga0157378_11842096 | 3300013297 | Unclassified | 653 |
| 316 | Ga0157378_12340274 | 3300013297 | Unclassified | 586 |
| 317 | Ga0163162_10099170 | 3300013306 | Bacteria | 3004 |
| 318 | Ga0163162_10163465 | 3300013306 | Bacteria | 2349 |
| 319 | Ga0163162_10201932 | 3300013306 | Unclassified | 2117 |
| 320 | Ga0163162_10528129 | 3300013306 | Unclassified | 1309 |
| 321 | Ga0163162_12363860 | 3300013306 | Bacteria | 611 |
| 322 | Ga0163162_13423163 | 3300013306 | Bacteria | 506 |
| 323 | Ga0163162_13463579 | 3300013306 | Bacteria | 502 |
| 324 | Ga0157372_10010274 | 3300013307 | Bacteria | 9943 |
| 325 | Ga0157372_10346486 | 3300013307 | Bacteria | 1731 |
| 326 | Ga0157375_10013261 | 3300013308 | Bacteria | 7329 |
| 327 | Ga0157375_10057092 | 3300013308 | Bacteria | 3858 |
| 328 | Ga0157375_10235093 | 3300013308 | Bacteria | 1992 |
| 329 | Ga0157375_11016621 | 3300013308 | Bacteria | 968 |
| 330 | Ga0157375_11486602 | 3300013308 | Unclassified | 799 |
| 331 | Ga0157375_11683847 | 3300013308 | Unclassified | 751 |
| 332 | Ga0157375_13597607 | 3300013308 | Unclassified | 516 |
| 333 | Ga0163163_10376010 | 3300014325 | Bacteria | 1478 |
| 334 | Ga0163163_12459240 | 3300014325 | Unclassified | 579 |
| 335 | Ga0163163_13089399 | 3300014325 | Unclassified | 519 |
| 336 | Ga0157380_12049127 | 3300014326 | Bacteria | 635 |
| 337 | Ga0157380_12973571 | 3300014326 | Bacteria | 540 |
| 338 | Ga0182008_10008039 | 3300014497 | Bacteria | 5781 |
| 339 | Ga0157377_10342916 | 3300014745 | Unclassified | 1000 |
| 340 | Ga0157379_10441535 | 3300014968 | Bacteria | 1200 |
| 341 | Ga0157379_11329216 | 3300014968 | Bacteria | 695 |
| 342 | Ga0157376_10011998 | 3300014969 | Bacteria | 6411 |
| 343 | Ga0157376_10030235 | 3300014969 | Bacteria | 4323 |
| 344 | Ga0157376_10356952 | 3300014969 | Bacteria | 1401 |
| 345 | Ga0157376_10442665 | 3300014969 | Bacteria | 1266 |
| 346 | Ga0157376_11656638 | 3300014969 | Unclassified | 674 |
| 347 | Ga0157376_12056144 | 3300014969 | Bacteria | 609 |
| 348 | Ga0157376_12547927 | 3300014969 | Unclassified | 551 |
| 349 | Ga0182006_1091965 | 3300015261 | Unclassified | 1090 |
| 350 | Ga0182006_1113115 | 3300015261 | Unclassified | 951 |
| 351 | Ga0182006_1166536 | 3300015261 | Bacteria | 740 |
| 352 | Ga0182005_1028573 | 3300015265 | Unclassified | 1521 |
| 353 | Ga0163161_10358713 | 3300017792 | Unclassified | 1160 |
| 354 | Ga0163161_10378487 | 3300017792 | Bacteria | 1131 |
| 355 | Ga0163161_11157531 | 3300017792 | Unclassified | 667 |
| 356 | Ga0207666_1000363 | 3300025271 | Bacteria | 6134 |
| 357 | Ga0207673_1034728 | 3300025290 | Unclassified | 702 |
| 358 | Ga0207697_10002302 | 3300025315 | Bacteria | 9968 |
| 359 | Ga0207697_10004870 | 3300025315 | Bacteria | 6338 |
| 360 | Ga0207697_10208017 | 3300025315 | Bacteria | 862 |
| 361 | Ga0207642_10889078 | 3300025899 | Unclassified | 570 |
| 362 | Ga0207688_10282652 | 3300025901 | Bacteria | 1011 |
| 363 | Ga0207680_10129104 | 3300025903 | Bacteria | 1664 |
| 364 | Ga0207685_10255073 | 3300025905 | Bacteria | 850 |
| 365 | Ga0207699_10123140 | 3300025906 | Unclassified | 1680 |
| 366 | Ga0207699_11101522 | 3300025906 | Bacteria | 588 |
| 367 | Ga0207645_10005184 | 3300025907 | Bacteria | 9513 |
| 368 | Ga0207645_10233453 | 3300025907 | Bacteria | 1214 |
| 369 | Ga0207645_10280221 | 3300025907 | Unclassified | 1107 |
| 370 | Ga0207645_10706981 | 3300025907 | Unclassified | 685 |
| 371 | Ga0207645_11178765 | 3300025907 | Bacteria | 515 |
| 372 | Ga0207705_10046002 | 3300025909 | Unclassified | 3136 |
| 373 | Ga0207705_10664831 | 3300025909 | Bacteria | 810 |
| 374 | Ga0207705_10723104 | 3300025909 | Unclassified | 774 |
| 375 | Ga0207684_10000824 | 3300025910 | Bacteria | 35708 |
| 376 | Ga0207684_10027013 | 3300025910 | Bacteria | 4895 |
| 377 | Ga0207684_10127432 | 3300025910 | Bacteria | 2185 |
| 378 | Ga0207684_10695276 | 3300025910 | Unclassified | 864 |
| 379 | Ga0207684_10959550 | 3300025910 | Unclassified | 717 |
| 380 | Ga0207707_11003678 | 3300025912 | Bacteria | 685 |
| 381 | Ga0207695_10000186 | 3300025913 | Bacteria | 179847 |
| 382 | Ga0207695_10376029 | 3300025913 | Bacteria | 1306 |
| 383 | Ga0207671_10026068 | 3300025914 | Bacteria | 4385 |
| 384 | Ga0207671_10252804 | 3300025914 | Bacteria | 1385 |
| 385 | Ga0207693_10312996 | 3300025915 | Bacteria | 1229 |
| 386 | Ga0207693_10691125 | 3300025915 | Unclassified | 791 |
| 387 | Ga0207663_10024925 | 3300025916 | Bacteria | 3450 |
| 388 | Ga0207663_10875880 | 3300025916 | Bacteria | 717 |
| 389 | Ga0207660_10457006 | 3300025917 | Unclassified | 1033 |
| 390 | Ga0207657_10830599 | 3300025919 | Unclassified | 713 |
| 391 | Ga0207657_11122431 | 3300025919 | Unclassified | 600 |
| 392 | Ga0207657_11285881 | 3300025919 | Unclassified | 553 |
| 393 | Ga0207649_10561387 | 3300025920 | Unclassified | 874 |
| 394 | Ga0207649_11333746 | 3300025920 | Unclassified | 568 |
| 395 | Ga0207646_10003687 | 3300025922 | Bacteria | 17104 |
| 396 | Ga0207646_10022818 | 3300025922 | Bacteria | 5755 |
| 397 | Ga0207646_10044232 | 3300025922 | Bacteria | 3997 |
| 398 | Ga0207646_10068200 | 3300025922 | Unclassified | 3177 |
| 399 | Ga0207646_10133027 | 3300025922 | Unclassified | 2239 |
| 400 | Ga0207646_10313976 | 3300025922 | Bacteria | 1416 |
| 401 | Ga0207646_10389833 | 3300025922 | Unclassified | 1258 |
| 402 | Ga0207646_10609440 | 3300025922 | Bacteria | 980 |
| 403 | Ga0207646_11064566 | 3300025922 | Bacteria | 713 |
| 404 | Ga0207681_10066283 | 3300025923 | Bacteria | 2499 |
| 405 | Ga0207650_10180998 | 3300025925 | Unclassified | 1679 |
| 406 | Ga0207659_10066261 | 3300025926 | Bacteria | 2620 |
| 407 | Ga0207659_10161551 | 3300025926 | Bacteria | 1759 |
| 408 | Ga0207687_10025395 | 3300025927 | Bacteria | 3964 |
| 409 | Ga0207687_10371640 | 3300025927 | Unclassified | 1169 |
| 410 | Ga0207700_10320193 | 3300025928 | Bacteria | 1344 |
| 411 | Ga0207664_10376228 | 3300025929 | Unclassified | 1260 |
| 412 | Ga0207664_10546757 | 3300025929 | Bacteria | 1039 |
| 413 | Ga0207664_11765575 | 3300025929 | Unclassified | 541 |
| 414 | Ga0207664_11961471 | 3300025929 | Bacteria | 508 |
| 415 | Ga0207644_10091491 | 3300025931 | Bacteria | 2268 |
| 416 | Ga0207644_10325629 | 3300025931 | Bacteria | 1243 |
| 417 | Ga0207644_10974736 | 3300025931 | Bacteria | 711 |
| 418 | Ga0207706_10314191 | 3300025933 | Bacteria | 1364 |
| 419 | Ga0207706_10511890 | 3300025933 | Bacteria | 1035 |
| 420 | Ga0207686_10043024 | 3300025934 | Bacteria | 2765 |
| 421 | Ga0207670_10033442 | 3300025936 | Unclassified | 3313 |
| 422 | Ga0207670_10107142 | 3300025936 | Bacteria | 2006 |
| 423 | Ga0207670_10193315 | 3300025936 | Bacteria | 1541 |
| 424 | Ga0207670_11747943 | 3300025936 | Unclassified | 529 |
| 425 | Ga0207669_10014102 | 3300025937 | Bacteria | 3997 |
| 426 | Ga0207669_10745108 | 3300025937 | Unclassified | 809 |
| 427 | Ga0207704_10421412 | 3300025938 | Unclassified | 1058 |
| 428 | Ga0207704_10828498 | 3300025938 | Unclassified | 774 |
| 429 | Ga0207704_11062896 | 3300025938 | Unclassified | 687 |
| 430 | Ga0207704_11066830 | 3300025938 | Unclassified | 685 |
| 431 | Ga0207704_11135674 | 3300025938 | Unclassified | 665 |
| 432 | Ga0207665_10810618 | 3300025939 | Bacteria | 740 |
| 433 | Ga0207691_10046047 | 3300025940 | Bacteria | 4010 |
| 434 | Ga0207691_10323455 | 3300025940 | Bacteria | 1322 |
| 435 | Ga0207691_11403501 | 3300025940 | Unclassified | 574 |
| 436 | Ga0207689_10233454 | 3300025942 | Unclassified | 1520 |
| 437 | Ga0207661_10007121 | 3300025944 | Bacteria | 7949 |
| 438 | Ga0207661_10775437 | 3300025944 | Bacteria | 883 |
| 439 | Ga0207679_10736017 | 3300025945 | Unclassified | 896 |
| 440 | Ga0207679_10964547 | 3300025945 | Bacteria | 781 |
| 441 | Ga0207679_11454962 | 3300025945 | Bacteria | 628 |
| 442 | Ga0207679_11505817 | 3300025945 | Unclassified | 617 |
| 443 | Ga0207667_10054428 | 3300025949 | Bacteria | 4209 |
| 444 | Ga0207651_10027485 | 3300025960 | Bacteria | 3573 |
| 445 | Ga0207651_10036102 | 3300025960 | Bacteria | 3223 |
| 446 | Ga0207651_10557619 | 3300025960 | Unclassified | 997 |
| 447 | Ga0207651_11900248 | 3300025960 | Unclassified | 535 |
| 448 | Ga0207712_10023403 | 3300025961 | Bacteria | 4076 |
| 449 | Ga0207712_10965369 | 3300025961 | Unclassified | 755 |
| 450 | Ga0207668_10084141 | 3300025972 | Bacteria | 2317 |
| 451 | Ga0207668_10100127 | 3300025972 | Bacteria | 2151 |
| 452 | Ga0207668_10354506 | 3300025972 | Unclassified | 1228 |
| 453 | Ga0207668_11108551 | 3300025972 | Unclassified | 710 |
| 454 | Ga0207640_11445143 | 3300025981 | Unclassified | 617 |
| 455 | Ga0207658_10044405 | 3300025986 | Bacteria | 3236 |
| 456 | Ga0207658_10222823 | 3300025986 | Bacteria | 1588 |
| 457 | Ga0207677_10731621 | 3300026023 | Unclassified | 880 |
| 458 | Ga0207677_10894698 | 3300026023 | Unclassified | 800 |
| 459 | Ga0207677_11097204 | 3300026023 | Unclassified | 725 |
| 460 | Ga0207677_11467240 | 3300026023 | Unclassified | 629 |
| 461 | Ga0207703_10434283 | 3300026035 | Bacteria | 1224 |
| 462 | Ga0207703_11032523 | 3300026035 | Unclassified | 789 |
| 463 | Ga0207639_11754384 | 3300026041 | Unclassified | 581 |
| 464 | Ga0207639_11795641 | 3300026041 | Unclassified | 574 |
| 465 | Ga0207678_10256661 | 3300026067 | Bacteria | 1498 |
| 466 | Ga0207708_11281432 | 3300026075 | Unclassified | 642 |
| 467 | Ga0207708_11632039 | 3300026075 | Unclassified | 566 |
| 468 | Ga0207702_10475228 | 3300026078 | Bacteria | 1216 |
| 469 | Ga0207641_10216513 | 3300026088 | Bacteria | 1774 |
| 470 | Ga0207641_10656341 | 3300026088 | Bacteria | 1031 |
| 471 | Ga0207641_11489943 | 3300026088 | Unclassified | 678 |
| 472 | Ga0207648_10169502 | 3300026089 | Bacteria | 1929 |
| 473 | Ga0207676_10355600 | 3300026095 | Bacteria | 1356 |
| 474 | Ga0207676_10755641 | 3300026095 | Unclassified | 946 |
| 475 | Ga0207674_10458397 | 3300026116 | Bacteria | 1232 |
| 476 | Ga0207674_10812554 | 3300026116 | Unclassified | 902 |
| 477 | Ga0207675_101007002 | 3300026118 | Unclassified | 851 |
| 478 | Ga0207683_10016271 | 3300026121 | Bacteria | 6329 |
| 479 | Ga0207683_10248628 | 3300026121 | Bacteria | 1623 |
| 480 | Ga0207683_10407482 | 3300026121 | Bacteria | 1251 |
| 481 | Ga0207698_10131780 | 3300026142 | Bacteria | 2137 |
| 482 | Ga0207698_10299967 | 3300026142 | Unclassified | 1495 |
| 483 | Ga0209981_1062426 | 3300027378 | Bacteria | 571 |
| 484 | Ga0209968_1057160 | 3300027526 | Unclassified | 684 |
| 485 | Ga0209982_1015547 | 3300027552 | Unclassified | 1155 |
| 486 | Ga0209971_1123283 | 3300027682 | Unclassified | 637 |
| 487 | Ga0265355_1012814 | 3300028036 | Bacteria | 697 |
| 488 | Ga0268266_10006370 | 3300028379 | Bacteria | 10813 |
| 489 | Ga0268266_10135309 | 3300028379 | Unclassified | 2207 |
| 490 | Ga0268266_10559615 | 3300028379 | Unclassified | 1096 |
| 491 | Ga0268266_10626966 | 3300028379 | Bacteria | 1034 |
| 492 | Ga0268266_12114939 | 3300028379 | Unclassified | 535 |
| 493 | Ga0268265_10461555 | 3300028380 | Bacteria | 1189 |
| 494 | Ga0268265_12595783 | 3300028380 | Unclassified | 512 |
| 495 | Ga0268264_10012939 | 3300028381 | Bacteria | 6861 |
| 496 | Ga0268264_10424735 | 3300028381 | Bacteria | 1283 |
| 497 | Ga0268264_12003883 | 3300028381 | Bacteria | 588 |
| 498 | Ga0268264_12028106 | 3300028381 | Unclassified | 584 |
| 499 | Ga0265337_1008669 | 3300028556 | Bacteria | 3677 |
| 500 | Ga0265337_1028298 | 3300028556 | Bacteria | 1683 |
| 501 | Ga0265337_1131933 | 3300028556 | Bacteria | 677 |
| 502 | Ga0265319_1002037 | 3300028563 | Bacteria | 11374 |
| 503 | Ga0265319_1031375 | 3300028563 | Bacteria | 1850 |
| 504 | Ga0265319_1064233 | 3300028563 | Unclassified | 1185 |
| 505 | Ga0265319_1096467 | 3300028563 | Bacteria | 930 |
| 506 | Ga0265319_1110446 | 3300028563 | Unclassified | 860 |
| 507 | Ga0265334_10126267 | 3300028573 | Unclassified | 912 |
| 508 | Ga0265334_10312925 | 3300028573 | Unclassified | 537 |
| 509 | Ga0265318_10001738 | 3300028577 | Bacteria | 12459 |
| 510 | Ga0265318_10012130 | 3300028577 | Bacteria | 3679 |
| 511 | Ga0265318_10019765 | 3300028577 | Bacteria | 2728 |
| 512 | Ga0265318_10044898 | 3300028577 | Bacteria | 1671 |
| 513 | Ga0265318_10197805 | 3300028577 | Bacteria | 735 |
| 514 | Ga0265318_10232047 | 3300028577 | Unclassified | 674 |
| 515 | Ga0265323_10000099 | 3300028653 | Bacteria | 49631 |
| 516 | Ga0265322_10001283 | 3300028654 | Bacteria | 8438 |
| 517 | Ga0265322_10006209 | 3300028654 | Bacteria | 3516 |
| 518 | Ga0265336_10020125 | 3300028666 | Bacteria | 2145 |
| 519 | Ga0265336_10275301 | 3300028666 | Unclassified | 500 |
| 520 | Ga0307515_10931129 | 3300028794 | Unclassified | 503 |
| 521 | Ga0265338_10002794 | 3300028800 | Bacteria | 25522 |
| 522 | Ga0265338_10005644 | 3300028800 | Bacteria | 16244 |
| 523 | Ga0265338_10027683 | 3300028800 | Bacteria | 5680 |
| 524 | Ga0265338_10677112 | 3300028800 | Unclassified | 713 |
| 525 | Ga0265324_10001420 | 3300029957 | Bacteria | 13761 |
| 526 | Ga0265324_10243582 | 3300029957 | Bacteria | 610 |
| 527 | Ga0265330_10039095 | 3300031235 | Bacteria | 2109 |
| 528 | Ga0265332_10357844 | 3300031238 | Bacteria | 602 |
| 529 | Ga0265320_10001237 | 3300031240 | Bacteria | 18762 |
| 530 | Ga0265320_10004381 | 3300031240 | Bacteria | 9265 |
| 531 | Ga0265320_10017280 | 3300031240 | Bacteria | 4011 |
| 532 | Ga0265320_10068581 | 3300031240 | Unclassified | 1675 |
| 533 | Ga0265320_10150533 | 3300031240 | Bacteria | 1051 |
| 534 | Ga0265320_10236210 | 3300031240 | Unclassified | 812 |
| 535 | Ga0265320_10297203 | 3300031240 | Unclassified | 714 |
| 536 | Ga0265329_10254418 | 3300031242 | Unclassified | 586 |
| 537 | Ga0265339_10258411 | 3300031249 | Bacteria | 841 |
| 538 | Ga0265331_10093400 | 3300031250 | Bacteria | 1389 |
| 539 | Ga0265327_10025399 | 3300031251 | Bacteria | 3454 |
| 540 | Ga0265327_10036101 | 3300031251 | Bacteria | 2721 |
| 541 | Ga0265316_10003494 | 3300031344 | Bacteria | 15857 |
| 542 | Ga0265316_10065206 | 3300031344 | Bacteria | 2820 |
| 543 | Ga0265316_10145614 | 3300031344 | Bacteria | 1777 |
| 544 | Ga0307513_10134394 | 3300031456 | Bacteria | 2411 |
| 545 | Ga0307509_10473631 | 3300031507 | Bacteria | 942 |
| 546 | Ga0307408_100000033 | 3300031548 | Bacteria | 212574 |
| 547 | Ga0265313_10240782 | 3300031595 | Bacteria | 740 |
| 548 | Ga0265314_10021042 | 3300031711 | Bacteria | 5026 |
| 549 | Ga0265314_10022950 | 3300031711 | Bacteria | 4769 |
| 550 | Ga0265314_10027231 | 3300031711 | Bacteria | 4283 |
| 551 | Ga0265314_10317472 | 3300031711 | Bacteria | 868 |
| 552 | Ga0265314_10355999 | 3300031711 | Bacteria | 804 |
| 553 | Ga0265342_10015002 | 3300031712 | Bacteria | 5116 |
| 554 | Ga0265342_10581559 | 3300031712 | Unclassified | 566 |
| 555 | Ga0316576_10117945 | 3300031727 | Bacteria | 1992 |
| 556 | Ga0316576_10192869 | 3300031727 | Bacteria | 1536 |
| 557 | Ga0307413_12131499 | 3300031824 | Bacteria | 507 |
| 558 | Ga0307410_10000008 | 3300031852 | Bacteria | 93917 |
| 559 | Ga0307407_10059293 | 3300031903 | Bacteria | 2228 |
| 560 | Ga0307412_10026993 | 3300031911 | Bacteria | 3575 |
| 561 | Ga0307409_100000430 | 3300031995 | Bacteria | 17768 |
| 562 | Ga0307416_100000278 | 3300032002 | Bacteria | 27054 |
| 563 | Ga0307414_11468770 | 3300032004 | Bacteria | 634 |
| 564 | Ga0307411_10795893 | 3300032005 | Bacteria | 832 |
| 565 | Ga0373959_0056187 | 3300034820 | Unclassified | 861 |
| 566 | Ga0373938_0188058 | 3300034957 | Bacteria | 567 |
| 567 | Ga0373926_0159469 | 3300035083 | Unclassified | 861 |
| 568 | Ga0373928_0251095 | 3300035084 | Unclassified | 527 |
| 569 | Ga0373934_0058726 | 3300035086 | Unclassified | 1531 |
| 570 | Ga0373934_0339259 | 3300035086 | Bacteria | 625 |
| 571 | Ga0373923_0311057 | 3300035111 | Bacteria | 747 |
| 572 | Ga0373932_0128680 | 3300035112 | Unclassified | 851 |
| 573 | Ga0373945_0351663 | 3300035116 | Bacteria | 639 |
| 574 | Ga0373945_0510295 | 3300035116 | Unclassified | 536 |
| 575 | Ga0373956_0252695 | 3300035119 | Bacteria | 838 |
| 576 | Ga0373957_0399272 | 3300035120 | Bacteria | 591 |
| 577 | Ga0373943_0109154 | 3300035170 | Bacteria | 1457 |
| 578 | Ga0373943_0399161 | 3300035170 | Bacteria | 794 |
| 579 | Ga0373955_0312226 | 3300035172 | Bacteria | 949 |
| 580 | Ga0373955_0692967 | 3300035172 | Bacteria | 625 |
| 581 | Ga0316574_0076909 | 3300035398 | Bacteria | 2115 |
| 582 | Ga0373924_0201882 | 3300035410 | Bacteria | 877 |
| 583 | Ga0373931_0112406 | 3300035691 | Bacteria | 1547 |
| 584 | Ga0373931_0284299 | 3300035691 | Bacteria | 1017 |
| 585 | Ga0373931_0751138 | 3300035691 | Unclassified | 647 |
| 586 | Ga0373935_0035970 | 3300035692 | Bacteria | 3093 |
| 587 | Ga0373935_0650139 | 3300035692 | Bacteria | 773 |
| 588 | Ga0373935_0853600 | 3300035692 | Unclassified | 673 |
| 589 | Ga0373935_0999866 | 3300035692 | Bacteria | 621 |
| 590 | Ga0373933_0459035 | 3300035724 | Bacteria | 833 |
| 591 | Ga0373933_0542845 | 3300035724 | Bacteria | 763 |
| 592 | Ga0373933_0781449 | 3300035724 | Unclassified | 628 |
| 593 | Ga0373947_0369122 | 3300035725 | Unclassified | 965 |
| 594 | Ga0373937_0256305 | 3300036401 | Bacteria | 1649 |
| 595 | Ga0373937_0401574 | 3300036401 | Bacteria | 1300 |
| 596 | Ga0373937_0519735 | 3300036401 | Bacteria | 1131 |
| 597 | Ga0373937_0907185 | 3300036401 | Bacteria | 830 |
| 598 | Ga0373937_0975271 | 3300036401 | Bacteria | 796 |
| 599 | Ga0316584_0730727 | 3300036712 | Unclassified | 677 |
| 600 | Ga0373925_0180425 | 3300037068 | Unclassified | 1671 |
| 601 | Ga0373925_0819674 | 3300037068 | Unclassified | 767 |
| 602 | Ga0373925_1304984 | 3300037068 | Bacteria | 595 |
| 603 | Ga0373925_1566869 | 3300037068 | Bacteria | 539 |
| 604 | Ga0373925_1744360 | 3300037068 | Unclassified | 508 |
| 605 | Ga0395900_1715591 | 3300037418 | Bacteria | 539 |
| 606 | Ga0395898_0504903 | 3300037466 | Bacteria | 1150 |
| 607 | Ga0395905_0283797 | 3300037471 | Unclassified | 1542 |
| 608 | Ga0395901_0035188 | 3300038443 | Bacteria | 5175 |
| 609 | Ga0436363_0679613 | 3300039450 | Unclassified | 734 |
| 610 | Ga0451787_435827 | 3300041441 | Bacteria | 968 |
| 611 | Ga0451787_554291 | 3300041441 | Unclassified | 646 |
| 612 | Ga0451795_0822456 | 3300041456 | Unclassified | 699 |
| 613 | Ga0451800_1293054 | 3300041459 | Bacteria | 525 |
| 614 | Ga0451800_1607111 | 3300041459 | Unclassified | 1043 |
| 615 | Ga0451802_0336535 | 3300041460 | Unclassified | 840 |
| 616 | Ga0451804_1183500 | 3300041463 | Unclassified | 679 |
| 617 | Ga0451807_2567572 | 3300041486 | Unclassified | 998 |
| 618 | Ga0451855_0439774 | 3300041511 | Bacteria | 1072 |
| 619 | Ga0451855_0788558 | 3300041511 | Bacteria | 642 |
| 620 | Ga0451855_1540872 | 3300041511 | Unclassified | 517 |
| 621 | Ga0451853_1381405 | 3300041512 | Unclassified | 567 |
| 622 | Ga0439431_0025188 | 3300041997 | Bacteria | 1452 |
| 623 | Ga0439441_094175 | 3300042001 | Bacteria | 665 |
| 624 | Ga0439455_0103449 | 3300042012 | Bacteria | 788 |
| 625 | Ga0451577_0000024 | 3300042876 | Bacteria | 411758 |
| 626 | Ga0451577_0003560 | 3300042876 | Bacteria | 17186 |
| 627 | Ga0451577_0052256 | 3300042876 | Unclassified | 3649 |
| 628 | Ga0451577_0478824 | 3300042876 | Bacteria | 1130 |
| 629 | Ga0451577_0579657 | 3300042876 | Bacteria | 1018 |
| 630 | Ga0451577_1228123 | 3300042876 | Unclassified | 668 |
| 631 | Ga0453683_0001980 | 3300044673 | Bacteria | 16587 |
| 632 | Ga0466966_0587687 | 3300044684 | Unclassified | 670 |
| 633 | Ga0453684_0000027 | 3300044712 | Bacteria | 778857 |
| 634 | Ga0453684_0019118 | 3300044712 | Bacteria | 10454 |
| 635 | Ga0453684_0203186 | 3300044712 | Bacteria | 2308 |
| 636 | Ga0453684_0239001 | 3300044712 | Bacteria | 2092 |
| 637 | Ga0453684_0305967 | 3300044712 | Bacteria | 1805 |
| 638 | Ga0453684_0384225 | 3300044712 | Bacteria | 1576 |
| 639 | Ga0453684_1116526 | 3300044712 | Bacteria | 832 |
| 640 | Ga0451576_0001983 | 3300045051 | Bacteria | 32524 |
| 641 | Ga0451576_0134263 | 3300045051 | Bacteria | 2580 |
| 642 | Ga0451576_0173995 | 3300045051 | Bacteria | 2247 |
| 643 | Ga0451576_0962737 | 3300045051 | Unclassified | 895 |
| 644 | Ga0451576_1380589 | 3300045051 | Bacteria | 733 |
| 645 | Ga0451576_1452948 | 3300045051 | Unclassified | 713 |
| 646 | Ga0495592_0013392 | 3300046454 | Bacteria | 6241 |
| 647 | Ga0495592_0125465 | 3300046454 | Bacteria | 1802 |
| 648 | Ga0495651_0231279 | 3300046462 | Bacteria | 1273 |
| 649 | Ga0495651_1008102 | 3300046462 | Bacteria | 505 |
| 650 | Ga0495653_0233034 | 3300046463 | Bacteria | 1231 |
| 651 | Ga0495580_1045287 | 3300046472 | Unclassified | 519 |
| 652 | Ga0495605_0348170 | 3300046474 | Unclassified | 622 |
| 653 | Ga0495662_0277705 | 3300046476 | Bacteria | 825 |
| 654 | Ga0495664_0172395 | 3300046477 | Bacteria | 1312 |
| 655 | Ga0495585_0416442 | 3300046492 | Unclassified | 646 |
| 656 | Ga0495608_0070882 | 3300046511 | Bacteria | 2275 |
| 657 | Ga0495618_0268202 | 3300046514 | Bacteria | 1067 |
| 658 | Ga0495628_0013312 | 3300046516 | Bacteria | 6920 |
| 659 | Ga0495630_0577946 | 3300046517 | Bacteria | 861 |
| 660 | Ga0495666_0455222 | 3300046526 | Bacteria | 573 |
| 661 | Ga0495652_0157967 | 3300046529 | Bacteria | 1763 |
| 662 | Ga0495640_0606945 | 3300046533 | Bacteria | 660 |
| 663 | Ga0495586_0321968 | 3300046535 | Bacteria | 887 |
| 664 | Ga0495586_0526122 | 3300046535 | Bacteria | 683 |
| 665 | Ga0495587_0019137 | 3300046536 | Bacteria | 4241 |
| 666 | Ga0495621_0155101 | 3300046539 | Bacteria | 903 |
| 667 | Ga0495621_0304394 | 3300046539 | Unclassified | 661 |
| 668 | Ga0495645_0054596 | 3300046543 | Unclassified | 2902 |
| 669 | Ga0495667_0254506 | 3300046559 | Bacteria | 1117 |
| 670 | Ga0495667_0914196 | 3300046559 | Unclassified | 538 |
| 671 | Ga0495656_0686161 | 3300046615 | Unclassified | 551 |
| 672 | Ga0495634_0667658 | 3300046642 | Unclassified | 599 |
| 673 | Ga0495634_0713298 | 3300046642 | Bacteria | 576 |
| 674 | Ga0495635_0841456 | 3300046663 | Unclassified | 590 |
| 675 | Ga0495657_0192992 | 3300046675 | Unclassified | 1244 |
| 676 | Ga0495599_0051576 | 3300046678 | Bacteria | 2577 |
| 677 | Ga0495599_0124141 | 3300046678 | Bacteria | 1605 |
| 678 | Ga0495623_0184038 | 3300046679 | Bacteria | 1211 |
| 679 | Ga0495623_0319035 | 3300046679 | Unclassified | 854 |
| 680 | Ga0495646_0058358 | 3300046680 | Bacteria | 2307 |
| 681 | Ga0495646_0256783 | 3300046680 | Bacteria | 935 |
| 682 | Ga0495647_0425958 | 3300046681 | Unclassified | 612 |
| 683 | Ga0495658_1120571 | 3300046683 | Unclassified | 501 |
| 684 | Ga0495669_0370664 | 3300046684 | Bacteria | 693 |
| 685 | Ga0495613_0226083 | 3300046689 | Unclassified | 1312 |
| 686 | Ga0495589_0501353 | 3300046794 | Bacteria | 554 |
| 687 | Ga0495604_0145945 | 3300047317 | Bacteria | 1686 |
| 688 | Ga0495636_0339101 | 3300047318 | Unclassified | 708 |
| 689 | Ga0495674_0625847 | 3300047319 | Bacteria | 850 |
| 690 | Ga0495674_1435505 | 3300047319 | Unclassified | 513 |
| 691 | Ga0495680_1044156 | 3300047322 | Bacteria | 519 |
| 692 | Ga0495675_0117539 | 3300047444 | Bacteria | 1657 |
| 693 | Ga0495675_0150774 | 3300047444 | Bacteria | 1437 |
| 694 | Ga0495684_0134647 | 3300047471 | Bacteria | 1855 |
| 695 | Ga0495684_0534245 | 3300047471 | Unclassified | 801 |
| 696 | Ga0495684_1071936 | 3300047471 | Bacteria | 507 |
| 697 | Ga0495602_0039071 | 3300048088 | Bacteria | 4376 |
| 698 | Ga0496100_0284215 | 3300048903 | Bacteria | 1234 |
| 699 | Ga0496100_0930691 | 3300048903 | Unclassified | 683 |
| 700 | Ga0496101_0087055 | 3300048904 | Bacteria | 2318 |
| 701 | Ga0496102_0087642 | 3300048905 | Bacteria | 2876 |
| 702 | Ga0496103_0038392 | 3300048906 | Bacteria | 2938 |
| 703 | Ga0496104_0673460 | 3300048907 | Unclassified | 943 |
| 704 | Ga0496105_0094436 | 3300048908 | Bacteria | 2470 |
| 705 | Ga0496105_1218231 | 3300048908 | Unclassified | 553 |
| 706 | Ga0496106_0714584 | 3300048909 | Unclassified | 798 |
| 707 | Ga0496107_1020514 | 3300048910 | Bacteria | 600 |
| 708 | Ga0496108_0004565 | 3300048911 | Bacteria | 11156 |
| 709 | Ga0496108_0396272 | 3300048911 | Bacteria | 1206 |
| 710 | Ga0496108_0565665 | 3300048911 | Bacteria | 991 |
| 711 | Ga0496109_0001915 | 3300048912 | Bacteria | 17286 |
| 712 | Ga0496109_0322563 | 3300048912 | Bacteria | 1458 |
| 713 | Ga0496109_1157768 | 3300048912 | Bacteria | 710 |
| 714 | Ga0496109_1572912 | 3300048912 | Unclassified | 592 |
| 715 | Ga0496110_0152975 | 3300048913 | Bacteria | 2089 |
| 716 | Ga0496110_1342367 | 3300048913 | Unclassified | 624 |
| 717 | Ga0496111_0567086 | 3300048914 | Bacteria | 833 |
| 718 | Ga0496112_0025463 | 3300048915 | Bacteria | 5681 |
| 719 | Ga0496112_0434274 | 3300048915 | Unclassified | 1251 |
| 720 | Ga0496112_0477784 | 3300048915 | Unclassified | 1183 |
| 721 | Ga0496112_1129781 | 3300048915 | Unclassified | 701 |
| 722 | Ga0496112_1171874 | 3300048915 | Unclassified | 685 |
| 723 | Ga0496113_0028316 | 3300048916 | Bacteria | 4028 |
| 724 | Ga0496113_0805258 | 3300048916 | Unclassified | 746 |
| 725 | Ga0496114_0046150 | 3300048917 | Bacteria | 3620 |
| 726 | Ga0496114_0879287 | 3300048917 | Unclassified | 777 |
| 727 | Ga0496115_0116008 | 3300048918 | Bacteria | 2202 |
| 728 | Ga0496121_0520434 | 3300048924 | Bacteria | 751 |
| 729 | Ga0501031_0066289 | 3300049568 | Bacteria | 2352 |
| 730 | Ga0501032_0000745 | 3300049569 | Bacteria | 26459 |
| 731 | Ga0501032_0168601 | 3300049569 | Unclassified | 1436 |
| 732 | Ga0501033_0005513 | 3300049570 | Bacteria | 10011 |
| 733 | Ga0501034_0103914 | 3300049571 | Bacteria | 2834 |
| 734 | Ga0501036_0016442 | 3300049572 | Bacteria | 6178 |
| 735 | Ga0501037_0039911 | 3300049573 | Bacteria | 3454 |
| 736 | Ga0501037_0063862 | 3300049573 | Bacteria | 2684 |
| 737 | Ga0501037_0755580 | 3300049573 | Bacteria | 644 |
| 738 | Ga0501038_0003275 | 3300049574 | Bacteria | 15091 |
| 739 | Ga0501039_0015427 | 3300049575 | Bacteria | 5848 |
| 740 | Ga0501041_0982667 | 3300049577 | Bacteria | 543 |
| 741 | Ga0501042_0007405 | 3300049578 | Bacteria | 7188 |
| 742 | Ga0501043_0050601 | 3300049579 | Bacteria | 3265 |
| 743 | Ga0501046_0004222 | 3300049580 | Bacteria | 13074 |
| 744 | Ga0501046_0007686 | 3300049580 | Bacteria | 9453 |
| 745 | Ga0501046_0014662 | 3300049580 | Bacteria | 6601 |
| 746 | Ga0501046_0744830 | 3300049580 | Unclassified | 689 |
| 747 | Ga0501047_0035347 | 3300049581 | Bacteria | 4827 |
| 748 | Ga0501047_0052141 | 3300049581 | Bacteria | 3953 |
| 749 | Ga0501047_0052377 | 3300049581 | Bacteria | 3945 |
| 750 | Ga0501047_1087351 | 3300049581 | Unclassified | 613 |
| 751 | Ga0501048_0005753 | 3300049582 | Bacteria | 9419 |
| 752 | Ga0501048_0246029 | 3300049582 | Unclassified | 1269 |
| 753 | Ga0501070_0009556 | 3300049586 | Bacteria | 8192 |
| 754 | Ga0501070_0115335 | 3300049586 | Bacteria | 2219 |
| 755 | Ga0501070_0274592 | 3300049586 | Bacteria | 1376 |
| 756 | Ga0501071_0502577 | 3300049587 | Bacteria | 930 |
| 757 | Ga0501080_0174419 | 3300049742 | Bacteria | 1981 |
| 758 | Ga0501080_0391058 | 3300049742 | Bacteria | 1252 |
| 759 | Ga0501083_0015708 | 3300049744 | Bacteria | 5299 |
| 760 | Ga0501083_0044333 | 3300049744 | Bacteria | 3011 |
| 761 | Ga0501035_0008262 | 3300049822 | Bacteria | 9698 |
| 762 | Ga0501035_0254630 | 3300049822 | Bacteria | 1490 |
| 763 | Ga0501035_0321807 | 3300049822 | Bacteria | 1299 |
| 764 | Ga0501044_0012985 | 3300049823 | Bacteria | 9017 |
| 765 | Ga0501044_0017234 | 3300049823 | Bacteria | 7747 |
| 766 | Ga0501044_0345009 | 3300049823 | Bacteria | 1409 |
| 767 | Ga0501045_0029555 | 3300049824 | Bacteria | 3963 |
| 768 | nmdc:mga05p37_2087914_c1 | 3300050507 | Bacteria | 532 |
| 769 | nmdc:mga05p37_361162_c1 | 3300050507 | Unclassified | 1707 |
| 770 | nmdc:mga05p37_497648_c1 | 3300050507 | Unclassified | 1400 |
| 771 | nmdc:mga09592_1318437_c1 | 3300050508 | Bacteria | 593 |
| 772 | nmdc:mga09592_160331_c1 | 3300050508 | Unclassified | 1943 |
| 773 | nmdc:mga0qj67_1338832_c1 | 3300050509 | Unclassified | 554 |
| 774 | nmdc:mga08y16_1042022_c1 | 3300050511 | Unclassified | 796 |
| 775 | nmdc:mga08y16_1071323_c1 | 3300050511 | Bacteria | 782 |
| 776 | nmdc:mga08y16_1191288_c1 | 3300050511 | Bacteria | 733 |
| 777 | nmdc:mga08y16_295343_c1 | 3300050511 | Bacteria | 1670 |
| 778 | nmdc:mga08y16_666385_c1 | 3300050511 | Unclassified | 1043 |
| 779 | nmdc:mga0n895_1046999_c1 | 3300050512 | Bacteria | 795 |
| 780 | nmdc:mga0n895_163793_c1 | 3300050512 | Unclassified | 2255 |
| 781 | nmdc:mga0n895_1868875_c1 | 3300050512 | Unclassified | 560 |
| 782 | nmdc:mga0n895_315777_c1 | 3300050512 | Unclassified | 1583 |
| 783 | nmdc:mga0rr50_870115_c1 | 3300050513 | Bacteria | 768 |
| 784 | nmdc:mga08x19_1327885_c1 | 3300050514 | Unclassified | 509 |
| 785 | nmdc:mga08x19_200436_c1 | 3300050514 | Unclassified | 1368 |
| 786 | nmdc:mga0a205_263999_c1 | 3300050515 | Unclassified | 1599 |
| 787 | nmdc:mga0a205_332060_c1 | 3300050515 | Bacteria | 1390 |
| 788 | nmdc:mga0a205_441378_c1 | 3300050515 | Bacteria | 1162 |
| 789 | nmdc:mga0sz30_262647_c1 | 3300050516 | Unclassified | 769 |
| 790 | Ga0495601_0036457 | 3300053077 | Bacteria | 3071 |
| 791 | Ga0495601_0208809 | 3300053077 | Unclassified | 1276 |
| 792 | Ga0495612_0276890 | 3300053078 | Bacteria | 749 |
| 793 | Ga0495595_0084468 | 3300053084 | Bacteria | 1517 |
| 794 | Ga0495595_0180017 | 3300053084 | Bacteria | 1048 |
| 795 | Ga0495595_0246216 | 3300053084 | Bacteria | 895 |
| 796 | Ga0495595_0299557 | 3300053084 | Bacteria | 809 |
| 797 | Ga0495619_0213428 | 3300053085 | Unclassified | 1337 |
| 798 | Ga0495619_0704222 | 3300053085 | Bacteria | 687 |
| 799 | Ga0500643_102775 | 3300053087 | Bacteria | 775 |
| 800 | Ga0500573_0300800 | 3300053140 | Bacteria | 802 |
| 801 | Ga0500611_009469 | 3300053727 | Unclassified | 1545 |
| 802 | Ga0501082_0061321 | 3300060353 | Bacteria | 3238 |
| 803 | Ga0501082_1732053 | 3300060353 | Bacteria | 545 |
| 804 | Ga0501082_1982160 | 3300060353 | Bacteria | 508 |
| 805 | Ga0466962_0371178 | 3300061719 | Bacteria | 714 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005564 | Ga0070664_100979472 | Ga0070664_1009794723 | 45 |
| 2 | 3300025945 | Ga0207679_11454962 | Ga0207679_114549621 | 45 |
| 3 | 3300031548 | Ga0307408_100000033 | Ga0307408_10000003378 | 45 |
| 4 | 3300031824 | Ga0307413_12131499 | Ga0307413_121314992 | 45 |
| 5 | 3300031852 | Ga0307410_10000008 | Ga0307410_1000000895 | 45 |
| 6 | 3300031903 | Ga0307407_10059293 | Ga0307407_100592935 | 45 |
| 7 | 3300031911 | Ga0307412_10026993 | Ga0307412_100269932 | 45 |
| 8 | 3300031995 | Ga0307409_100000430 | Ga0307409_10000043011 | 45 |
| 9 | 3300032002 | Ga0307416_100000278 | Ga0307416_1000002788 | 45 |
| 10 | 3300032005 | Ga0307411_10795893 | Ga0307411_107958933 | 45 |
| 11 | 3300005338 | Ga0068868_100406257 | Ga0068868_1004062573 | 46 |
| 12 | 3300005364 | Ga0070673_101298339 | Ga0070673_1012983392 | 46 |
| 13 | 3300005459 | Ga0068867_100559192 | Ga0068867_1005591921 | 46 |
| 14 | 3300025938 | Ga0207704_11062896 | Ga0207704_110628961 | 46 |
| 15 | 3300026023 | Ga0207677_11097204 | Ga0207677_110972042 | 46 |
| 16 | 3300031507 | Ga0307509_10473631 | Ga0307509_104736312 | 46 |
| 17 | iso_pu_bacteria | 2786546517 | 2787435224 | 47 |
| 18 | iso_pu_bacteria | 2786546940 | 2788436087 | 47 |
| 19 | 3300028573 | Ga0265334_10126267 | Ga0265334_101262672 | 50 |
| 20 | 3300028800 | Ga0265338_10002794 | Ga0265338_100027949 | 50 |
| 21 | 3300028800 | Ga0265338_10027683 | Ga0265338_100276833 | 50 |
| 22 | 3300041456 | Ga0451795_0822456 | Ga0451795_0822456_164_316 | 50 |
| 23 | 3300042876 | Ga0451577_0579657 | Ga0451577_0579657_202_354 | 50 |
| 24 | 3300044712 | Ga0453684_0000027 | Ga0453684_0000027_698412_698564 | 50 |
| 25 | 2162886011 | MRS1b_contig_9372160 | MRS1b_0179.00002530 | 51 |
| 26 | 3300000043 | ARcpr5yngRDRAFT_c023372 | ARcpr5yngRDRAFT_0233722 | 51 |
| 27 | 3300003911 | JGI25405J52794_10003108 | JGI25405J52794_100031083 | 51 |
| 28 | 3300003911 | JGI25405J52794_10007597 | JGI25405J52794_100075972 | 51 |
| 29 | 3300003911 | JGI25405J52794_10054083 | JGI25405J52794_100540832 | 51 |
| 30 | 3300005288 | Ga0065714_10074612 | Ga0065714_100746122 | 51 |
| 31 | 3300005289 | Ga0065704_10023110 | Ga0065704_100231102 | 51 |
| 32 | 3300005290 | Ga0065712_10269117 | Ga0065712_102691172 | 51 |
| 33 | 3300005290 | Ga0065712_10284503 | Ga0065712_102845032 | 51 |
| 34 | 3300005290 | Ga0065712_10701270 | Ga0065712_107012701 | 51 |
| 35 | 3300005293 | Ga0065715_10003886 | Ga0065715_100038867 | 51 |
| 36 | 3300005293 | Ga0065715_10257808 | Ga0065715_102578082 | 51 |
| 37 | 3300005293 | Ga0065715_10378729 | Ga0065715_103787292 | 51 |
| 38 | 3300005293 | Ga0065715_10425479 | Ga0065715_104254792 | 51 |
| 39 | 3300005295 | Ga0065707_10031506 | Ga0065707_100315061 | 51 |
| 40 | 3300005327 | Ga0070658_10283812 | Ga0070658_102838122 | 51 |
| 41 | 3300005327 | Ga0070658_10800003 | Ga0070658_108000031 | 51 |
| 42 | 3300005328 | Ga0070676_10003135 | Ga0070676_100031358 | 51 |
| 43 | 3300005328 | Ga0070676_10411974 | Ga0070676_104119742 | 51 |
| 44 | 3300005328 | Ga0070676_10472106 | Ga0070676_104721061 | 51 |
| 45 | 3300005328 | Ga0070676_11623094 | Ga0070676_116230941 | 51 |
| 46 | 3300005329 | Ga0070683_100125569 | Ga0070683_1001255692 | 51 |
| 47 | 3300005330 | Ga0070690_100080891 | Ga0070690_1000808913 | 51 |
| 48 | 3300005330 | Ga0070690_100348237 | Ga0070690_1003482372 | 51 |
| 49 | 3300005330 | Ga0070690_100442906 | Ga0070690_1004429062 | 51 |
| 50 | 3300005330 | Ga0070690_100613580 | Ga0070690_1006135802 | 51 |
| 51 | 3300005331 | Ga0070670_100011533 | Ga0070670_1000115336 | 51 |
| 52 | 3300005331 | Ga0070670_100191497 | Ga0070670_1001914973 | 51 |
| 53 | 3300005331 | Ga0070670_101275448 | Ga0070670_1012754481 | 51 |
| 54 | 3300005331 | Ga0070670_101330871 | Ga0070670_1013308712 | 51 |
| 55 | 3300005334 | Ga0068869_100617218 | Ga0068869_1006172182 | 51 |
| 56 | 3300005334 | Ga0068869_101114292 | Ga0068869_1011142922 | 51 |
| 57 | 3300005335 | Ga0070666_10008158 | Ga0070666_100081584 | 51 |
| 58 | 3300005338 | Ga0068868_100257013 | Ga0068868_1002570131 | 51 |
| 59 | 3300005338 | Ga0068868_100547195 | Ga0068868_1005471952 | 51 |
| 60 | 3300005338 | Ga0068868_100963547 | Ga0068868_1009635471 | 51 |
| 61 | 3300005338 | Ga0068868_101444014 | Ga0068868_1014440142 | 51 |
| 62 | 3300005339 | Ga0070660_100413102 | Ga0070660_1004131022 | 51 |
| 63 | 3300005340 | Ga0070689_100077351 | Ga0070689_1000773512 | 51 |
| 64 | 3300005340 | Ga0070689_100152658 | Ga0070689_1001526582 | 51 |
| 65 | 3300005340 | Ga0070689_102141847 | Ga0070689_1021418471 | 51 |
| 66 | 3300005344 | Ga0070661_100920961 | Ga0070661_1009209612 | 51 |
| 67 | 3300005344 | Ga0070661_101730851 | Ga0070661_1017308512 | 51 |
| 68 | 3300005347 | Ga0070668_100055023 | Ga0070668_1000550233 | 51 |
| 69 | 3300005347 | Ga0070668_100201146 | Ga0070668_1002011463 | 51 |
| 70 | 3300005347 | Ga0070668_100433373 | Ga0070668_1004333731 | 51 |
| 71 | 3300005347 | Ga0070668_100984870 | Ga0070668_1009848702 | 51 |
| 72 | 3300005347 | Ga0070668_102028512 | Ga0070668_1020285121 | 51 |
| 73 | 3300005353 | Ga0070669_100154726 | Ga0070669_1001547263 | 51 |
| 74 | 3300005353 | Ga0070669_100336255 | Ga0070669_1003362553 | 51 |
| 75 | 3300005353 | Ga0070669_101911746 | Ga0070669_1019117461 | 51 |
| 76 | 3300005354 | Ga0070675_100286305 | Ga0070675_1002863052 | 51 |
| 77 | 3300005354 | Ga0070675_100368645 | Ga0070675_1003686453 | 51 |
| 78 | 3300005354 | Ga0070675_100507115 | Ga0070675_1005071152 | 51 |
| 79 | 3300005354 | Ga0070675_100950108 | Ga0070675_1009501082 | 51 |
| 80 | 3300005355 | Ga0070671_100005387 | Ga0070671_10000538710 | 51 |
| 81 | 3300005355 | Ga0070671_100033099 | Ga0070671_1000330992 | 51 |
| 82 | 3300005355 | Ga0070671_100110880 | Ga0070671_1001108802 | 51 |
| 83 | 3300005355 | Ga0070671_100193118 | Ga0070671_1001931182 | 51 |
| 84 | 3300005355 | Ga0070671_101091214 | Ga0070671_1010912142 | 51 |
| 85 | 3300005356 | Ga0070674_100004297 | Ga0070674_1000042977 | 51 |
| 86 | 3300005356 | Ga0070674_100126478 | Ga0070674_1001264782 | 51 |
| 87 | 3300005356 | Ga0070674_100238858 | Ga0070674_1002388582 | 51 |
| 88 | 3300005356 | Ga0070674_100425593 | Ga0070674_1004255932 | 51 |
| 89 | 3300005356 | Ga0070674_101729355 | Ga0070674_1017293551 | 51 |
| 90 | 3300005364 | Ga0070673_100017919 | Ga0070673_1000179194 | 51 |
| 91 | 3300005364 | Ga0070673_100100918 | Ga0070673_1001009183 | 51 |
| 92 | 3300005364 | Ga0070673_100210662 | Ga0070673_1002106622 | 51 |
| 93 | 3300005364 | Ga0070673_100396460 | Ga0070673_1003964602 | 51 |
| 94 | 3300005364 | Ga0070673_101195936 | Ga0070673_1011959361 | 51 |
| 95 | 3300005365 | Ga0070688_100009774 | Ga0070688_1000097742 | 51 |
| 96 | 3300005365 | Ga0070688_100018097 | Ga0070688_1000180975 | 51 |
| 97 | 3300005366 | Ga0070659_100728747 | Ga0070659_1007287472 | 51 |
| 98 | 3300005366 | Ga0070659_100899766 | Ga0070659_1008997662 | 51 |
| 99 | 3300005366 | Ga0070659_101872579 | Ga0070659_1018725792 | 51 |
| 100 | 3300005367 | Ga0070667_100142723 | Ga0070667_1001427232 | 51 |
| 101 | 3300005367 | Ga0070667_100252921 | Ga0070667_1002529213 | 51 |
| 102 | 3300005367 | Ga0070667_101535379 | Ga0070667_1015353792 | 51 |
| 103 | 3300005406 | Ga0070703_10066704 | Ga0070703_100667042 | 51 |
| 104 | 3300005406 | Ga0070703_10095729 | Ga0070703_100957292 | 51 |
| 105 | 3300005434 | Ga0070709_10012964 | Ga0070709_100129645 | 51 |
| 106 | 3300005435 | Ga0070714_100091936 | Ga0070714_1000919362 | 51 |
| 107 | 3300005435 | Ga0070714_100586178 | Ga0070714_1005861782 | 51 |
| 108 | 3300005435 | Ga0070714_100914622 | Ga0070714_1009146222 | 51 |
| 109 | 3300005435 | Ga0070714_101911625 | Ga0070714_1019116251 | 51 |
| 110 | 3300005436 | Ga0070713_100032759 | Ga0070713_1000327594 | 51 |
| 111 | 3300005436 | Ga0070713_100375075 | Ga0070713_1003750752 | 51 |
| 112 | 3300005436 | Ga0070713_101182911 | Ga0070713_1011829112 | 51 |
| 113 | 3300005437 | Ga0070710_10952955 | Ga0070710_109529552 | 51 |
| 114 | 3300005439 | Ga0070711_100028777 | Ga0070711_1000287775 | 51 |
| 115 | 3300005439 | Ga0070711_101323145 | Ga0070711_1013231452 | 51 |
| 116 | 3300005440 | Ga0070705_100217366 | Ga0070705_1002173662 | 51 |
| 117 | 3300005440 | Ga0070705_101516812 | Ga0070705_1015168121 | 51 |
| 118 | 3300005441 | Ga0070700_100833482 | Ga0070700_1008334821 | 51 |
| 119 | 3300005441 | Ga0070700_101859241 | Ga0070700_1018592412 | 51 |
| 120 | 3300005444 | Ga0070694_100993383 | Ga0070694_1009933832 | 51 |
| 121 | 3300005445 | Ga0070708_100010461 | Ga0070708_1000104614 | 51 |
| 122 | 3300005445 | Ga0070708_100035062 | Ga0070708_1000350622 | 51 |
| 123 | 3300005445 | Ga0070708_100066029 | Ga0070708_1000660293 | 51 |
| 124 | 3300005445 | Ga0070708_100235868 | Ga0070708_1002358682 | 51 |
| 125 | 3300005445 | Ga0070708_100247791 | Ga0070708_1002477912 | 51 |
| 126 | 3300005445 | Ga0070708_100748156 | Ga0070708_1007481562 | 51 |
| 127 | 3300005445 | Ga0070708_101592849 | Ga0070708_1015928492 | 51 |
| 128 | 3300005455 | Ga0070663_101425108 | Ga0070663_1014251082 | 51 |
| 129 | 3300005456 | Ga0070678_100012695 | Ga0070678_1000126953 | 51 |
| 130 | 3300005456 | Ga0070678_100944682 | Ga0070678_1009446821 | 51 |
| 131 | 3300005456 | Ga0070678_101258059 | Ga0070678_1012580592 | 51 |
| 132 | 3300005457 | Ga0070662_100063402 | Ga0070662_1000634022 | 51 |
| 133 | 3300005457 | Ga0070662_100197626 | Ga0070662_1001976262 | 51 |
| 134 | 3300005457 | Ga0070662_100412734 | Ga0070662_1004127342 | 51 |
| 135 | 3300005457 | Ga0070662_100470934 | Ga0070662_1004709342 | 51 |
| 136 | 3300005458 | Ga0070681_11022046 | Ga0070681_110220461 | 51 |
| 137 | 3300005459 | Ga0068867_100101958 | Ga0068867_1001019583 | 51 |
| 138 | 3300005459 | Ga0068867_100317492 | Ga0068867_1003174922 | 51 |
| 139 | 3300005459 | Ga0068867_101057224 | Ga0068867_1010572242 | 51 |
| 140 | 3300005466 | Ga0070685_10107195 | Ga0070685_101071952 | 51 |
| 141 | 3300005466 | Ga0070685_10128602 | Ga0070685_101286024 | 51 |
| 142 | 3300005467 | Ga0070706_100029693 | Ga0070706_1000296932 | 51 |
| 143 | 3300005467 | Ga0070706_100086451 | Ga0070706_1000864512 | 51 |
| 144 | 3300005467 | Ga0070706_100126649 | Ga0070706_1001266492 | 51 |
| 145 | 3300005467 | Ga0070706_100140341 | Ga0070706_1001403412 | 51 |
| 146 | 3300005467 | Ga0070706_100148954 | Ga0070706_1001489544 | 51 |
| 147 | 3300005467 | Ga0070706_100431209 | Ga0070706_1004312092 | 51 |
| 148 | 3300005467 | Ga0070706_100518072 | Ga0070706_1005180722 | 51 |
| 149 | 3300005467 | Ga0070706_100830135 | Ga0070706_1008301352 | 51 |
| 150 | 3300005467 | Ga0070706_101788112 | Ga0070706_1017881122 | 51 |
| 151 | 3300005468 | Ga0070707_100001020 | Ga0070707_10000102019 | 51 |
| 152 | 3300005468 | Ga0070707_100011737 | Ga0070707_1000117376 | 51 |
| 153 | 3300005468 | Ga0070707_100060459 | Ga0070707_1000604594 | 51 |
| 154 | 3300005468 | Ga0070707_100238139 | Ga0070707_1002381392 | 51 |
| 155 | 3300005468 | Ga0070707_100335416 | Ga0070707_1003354162 | 51 |
| 156 | 3300005468 | Ga0070707_100801358 | Ga0070707_1008013581 | 51 |
| 157 | 3300005468 | Ga0070707_101017942 | Ga0070707_1010179421 | 51 |
| 158 | 3300005468 | Ga0070707_101428125 | Ga0070707_1014281252 | 51 |
| 159 | 3300005468 | Ga0070707_101718125 | Ga0070707_1017181251 | 51 |
| 160 | 3300005471 | Ga0070698_100001128 | Ga0070698_1000011286 | 51 |
| 161 | 3300005471 | Ga0070698_100001373 | Ga0070698_10000137328 | 51 |
| 162 | 3300005471 | Ga0070698_101188128 | Ga0070698_1011881281 | 51 |
| 163 | 3300005471 | Ga0070698_102026818 | Ga0070698_1020268181 | 51 |
| 164 | 3300005518 | Ga0070699_100380348 | Ga0070699_1003803482 | 51 |
| 165 | 3300005518 | Ga0070699_100925469 | Ga0070699_1009254691 | 51 |
| 166 | 3300005535 | Ga0070684_100045928 | Ga0070684_1000459282 | 51 |
| 167 | 3300005536 | Ga0070697_100001619 | Ga0070697_1000016195 | 51 |
| 168 | 3300005536 | Ga0070697_100275791 | Ga0070697_1002757913 | 51 |
| 169 | 3300005536 | Ga0070697_100595057 | Ga0070697_1005950572 | 51 |
| 170 | 3300005536 | Ga0070697_100748440 | Ga0070697_1007484402 | 51 |
| 171 | 3300005536 | Ga0070697_101270264 | Ga0070697_1012702642 | 51 |
| 172 | 3300005536 | Ga0070697_101482938 | Ga0070697_1014829382 | 51 |
| 173 | 3300005536 | Ga0070697_101563586 | Ga0070697_1015635862 | 51 |
| 174 | 3300005543 | Ga0070672_100043527 | Ga0070672_1000435273 | 51 |
| 175 | 3300005543 | Ga0070672_100161464 | Ga0070672_1001614643 | 51 |
| 176 | 3300005543 | Ga0070672_100374474 | Ga0070672_1003744742 | 51 |
| 177 | 3300005543 | Ga0070672_100396256 | Ga0070672_1003962562 | 51 |
| 178 | 3300005543 | Ga0070672_100689213 | Ga0070672_1006892132 | 51 |
| 179 | 3300005544 | Ga0070686_100515197 | Ga0070686_1005151972 | 51 |
| 180 | 3300005544 | Ga0070686_100655317 | Ga0070686_1006553172 | 51 |
| 181 | 3300005545 | Ga0070695_100328790 | Ga0070695_1003287902 | 51 |
| 182 | 3300005546 | Ga0070696_100369859 | Ga0070696_1003698592 | 51 |
| 183 | 3300005547 | Ga0070693_100830988 | Ga0070693_1008309882 | 51 |
| 184 | 3300005548 | Ga0070665_100240953 | Ga0070665_1002409532 | 51 |
| 185 | 3300005548 | Ga0070665_100251254 | Ga0070665_1002512542 | 51 |
| 186 | 3300005548 | Ga0070665_100346721 | Ga0070665_1003467212 | 51 |
| 187 | 3300005548 | Ga0070665_101218777 | Ga0070665_1012187771 | 51 |
| 188 | 3300005548 | Ga0070665_102230876 | Ga0070665_1022308761 | 51 |
| 189 | 3300005563 | Ga0068855_100007498 | Ga0068855_1000074983 | 51 |
| 190 | 3300005564 | Ga0070664_101647972 | Ga0070664_1016479722 | 51 |
| 191 | 3300005577 | Ga0068857_100462713 | Ga0068857_1004627134 | 51 |
| 192 | 3300005577 | Ga0068857_102179892 | Ga0068857_1021798921 | 51 |
| 193 | 3300005578 | Ga0068854_101054778 | Ga0068854_1010547782 | 51 |
| 194 | 3300005616 | Ga0068852_100077481 | Ga0068852_1000774813 | 51 |
| 195 | 3300005616 | Ga0068852_101946378 | Ga0068852_1019463782 | 51 |
| 196 | 3300005616 | Ga0068852_102126448 | Ga0068852_1021264482 | 51 |
| 197 | 3300005617 | Ga0068859_100526303 | Ga0068859_1005263033 | 51 |
| 198 | 3300005617 | Ga0068859_101223863 | Ga0068859_1012238632 | 51 |
| 199 | 3300005618 | Ga0068864_100379287 | Ga0068864_1003792873 | 51 |
| 200 | 3300005718 | Ga0068866_10221888 | Ga0068866_102218882 | 51 |
| 201 | 3300005718 | Ga0068866_11252912 | Ga0068866_112529122 | 51 |
| 202 | 3300005719 | Ga0068861_101745458 | Ga0068861_1017454581 | 51 |
| 203 | 3300005719 | Ga0068861_101854483 | Ga0068861_1018544831 | 51 |
| 204 | 3300005841 | Ga0068863_100425419 | Ga0068863_1004254192 | 51 |
| 205 | 3300005841 | Ga0068863_100952651 | Ga0068863_1009526512 | 51 |
| 206 | 3300005841 | Ga0068863_101144119 | Ga0068863_1011441191 | 51 |
| 207 | 3300005841 | Ga0068863_101531780 | Ga0068863_1015317802 | 51 |
| 208 | 3300005841 | Ga0068863_101595509 | Ga0068863_1015955092 | 51 |
| 209 | 3300005842 | Ga0068858_100213068 | Ga0068858_1002130683 | 51 |
| 210 | 3300005842 | Ga0068858_100873562 | Ga0068858_1008735622 | 51 |
| 211 | 3300005842 | Ga0068858_101260012 | Ga0068858_1012600121 | 51 |
| 212 | 3300005842 | Ga0068858_101974237 | Ga0068858_1019742372 | 51 |
| 213 | 3300005843 | Ga0068860_100004333 | Ga0068860_1000043333 | 51 |
| 214 | 3300005843 | Ga0068860_101528853 | Ga0068860_1015288532 | 51 |
| 215 | 3300005843 | Ga0068860_102420409 | Ga0068860_1024204092 | 51 |
| 216 | 3300005844 | Ga0068862_100261199 | Ga0068862_1002611992 | 51 |
| 217 | 3300005844 | Ga0068862_100757840 | Ga0068862_1007578403 | 51 |
| 218 | 3300005844 | Ga0068862_101038120 | Ga0068862_1010381202 | 51 |
| 219 | 3300005844 | Ga0068862_101810208 | Ga0068862_1018102082 | 51 |
| 220 | 3300005937 | Ga0081455_10001571 | Ga0081455_1000157115 | 51 |
| 221 | 3300005937 | Ga0081455_10001819 | Ga0081455_100018197 | 51 |
| 222 | 3300005937 | Ga0081455_10011555 | Ga0081455_100115552 | 51 |
| 223 | 3300005937 | Ga0081455_10012797 | Ga0081455_100127976 | 51 |
| 224 | 3300005937 | Ga0081455_10018200 | Ga0081455_100182001 | 51 |
| 225 | 3300005937 | Ga0081455_10038672 | Ga0081455_100386722 | 51 |
| 226 | 3300005937 | Ga0081455_10077432 | Ga0081455_100774323 | 51 |
| 227 | 3300005937 | Ga0081455_10084449 | Ga0081455_100844493 | 51 |
| 228 | 3300005937 | Ga0081455_10149134 | Ga0081455_101491341 | 51 |
| 229 | 3300005981 | Ga0081538_10043902 | Ga0081538_100439024 | 51 |
| 230 | 3300005983 | Ga0081540_1000010 | Ga0081540_100001065 | 51 |
| 231 | 3300005985 | Ga0081539_10008110 | Ga0081539_100081108 | 51 |
| 232 | 3300005985 | Ga0081539_10391942 | Ga0081539_103919422 | 51 |
| 233 | 3300006028 | Ga0070717_10000015 | Ga0070717_1000001513 | 51 |
| 234 | 3300006028 | Ga0070717_10000276 | Ga0070717_1000027636 | 51 |
| 235 | 3300006028 | Ga0070717_10260706 | Ga0070717_102607063 | 51 |
| 236 | 3300006028 | Ga0070717_10441606 | Ga0070717_104416062 | 51 |
| 237 | 3300006048 | Ga0075363_100906710 | Ga0075363_1009067102 | 51 |
| 238 | 3300006163 | Ga0070715_10061663 | Ga0070715_100616632 | 51 |
| 239 | 3300006163 | Ga0070715_10659377 | Ga0070715_106593772 | 51 |
| 240 | 3300006175 | Ga0070712_100330997 | Ga0070712_1003309972 | 51 |
| 241 | 3300006175 | Ga0070712_100374543 | Ga0070712_1003745432 | 51 |
| 242 | 3300006175 | Ga0070712_100823195 | Ga0070712_1008231952 | 51 |
| 243 | 3300006175 | Ga0070712_101356976 | Ga0070712_1013569762 | 51 |
| 244 | 3300006175 | Ga0070712_101634951 | Ga0070712_1016349512 | 51 |
| 245 | 3300006186 | Ga0075369_10285653 | Ga0075369_102856532 | 51 |
| 246 | 3300006237 | Ga0097621_100184167 | Ga0097621_1001841673 | 51 |
| 247 | 3300006237 | Ga0097621_101608258 | Ga0097621_1016082582 | 51 |
| 248 | 3300006358 | Ga0068871_100009471 | Ga0068871_1000094717 | 51 |
| 249 | 3300006358 | Ga0068871_100919720 | Ga0068871_1009197202 | 51 |
| 250 | 3300006844 | Ga0075428_101889793 | Ga0075428_1018897932 | 51 |
| 251 | 3300006846 | Ga0075430_100981472 | Ga0075430_1009814722 | 51 |
| 252 | 3300006846 | Ga0075430_101035661 | Ga0075430_1010356612 | 51 |
| 253 | 3300006852 | Ga0075433_11523479 | Ga0075433_115234792 | 51 |
| 254 | 3300006871 | Ga0075434_100308097 | Ga0075434_1003080971 | 51 |
| 255 | 3300006871 | Ga0075434_100376968 | Ga0075434_1003769682 | 51 |
| 256 | 3300006871 | Ga0075434_101711928 | Ga0075434_1017119282 | 51 |
| 257 | 3300006880 | Ga0075429_100229178 | Ga0075429_1002291782 | 51 |
| 258 | 3300006880 | Ga0075429_100301159 | Ga0075429_1003011593 | 51 |
| 259 | 3300006881 | Ga0068865_101251336 | Ga0068865_1012513361 | 51 |
| 260 | 3300006914 | Ga0075436_100077149 | Ga0075436_1000771494 | 51 |
| 261 | 3300006914 | Ga0075436_100145012 | Ga0075436_1001450122 | 51 |
| 262 | 3300006914 | Ga0075436_100241475 | Ga0075436_1002414752 | 51 |
| 263 | 3300006931 | Ga0097620_100526311 | Ga0097620_1005263112 | 51 |
| 264 | 3300006931 | Ga0097620_101223899 | Ga0097620_1012238992 | 51 |
| 265 | 3300007076 | Ga0075435_101026111 | Ga0075435_1010261111 | 51 |
| 266 | 3300007265 | Ga0099794_10082571 | Ga0099794_100825712 | 51 |
| 267 | 3300007265 | Ga0099794_10106214 | Ga0099794_101062142 | 51 |
| 268 | 3300007788 | Ga0099795_10187027 | Ga0099795_101870272 | 51 |
| 269 | 3300009092 | Ga0105250_10397652 | Ga0105250_103976522 | 51 |
| 270 | 3300009093 | Ga0105240_10403312 | Ga0105240_104033121 | 51 |
| 271 | 3300009094 | Ga0111539_10108839 | Ga0111539_101088392 | 51 |
| 272 | 3300009094 | Ga0111539_10331565 | Ga0111539_103315654 | 51 |
| 273 | 3300009094 | Ga0111539_10573865 | Ga0111539_105738651 | 51 |
| 274 | 3300009094 | Ga0111539_10594067 | Ga0111539_105940671 | 51 |
| 275 | 3300009094 | Ga0111539_11405934 | Ga0111539_114059342 | 51 |
| 276 | 3300009094 | Ga0111539_12017888 | Ga0111539_120178882 | 51 |
| 277 | 3300009094 | Ga0111539_12446991 | Ga0111539_124469912 | 51 |
| 278 | 3300009098 | Ga0105245_10044186 | Ga0105245_100441862 | 51 |
| 279 | 3300009098 | Ga0105245_10102993 | Ga0105245_101029932 | 51 |
| 280 | 3300009098 | Ga0105245_10414801 | Ga0105245_104148012 | 51 |
| 281 | 3300009098 | Ga0105245_10723361 | Ga0105245_107233612 | 51 |
| 282 | 3300009098 | Ga0105245_11129140 | Ga0105245_111291402 | 51 |
| 283 | 3300009098 | Ga0105245_11661373 | Ga0105245_116613732 | 51 |
| 284 | 3300009101 | Ga0105247_10396792 | Ga0105247_103967922 | 51 |
| 285 | 3300009101 | Ga0105247_10403943 | Ga0105247_104039432 | 51 |
| 286 | 3300009147 | Ga0114129_10101962 | Ga0114129_101019622 | 51 |
| 287 | 3300009147 | Ga0114129_10486043 | Ga0114129_104860432 | 51 |
| 288 | 3300009147 | Ga0114129_10619545 | Ga0114129_106195452 | 51 |
| 289 | 3300009147 | Ga0114129_10905959 | Ga0114129_109059592 | 51 |
| 290 | 3300009147 | Ga0114129_12371582 | Ga0114129_123715821 | 51 |
| 291 | 3300009148 | Ga0105243_10313555 | Ga0105243_103135551 | 51 |
| 292 | 3300009174 | Ga0105241_10068342 | Ga0105241_100683422 | 51 |
| 293 | 3300009176 | Ga0105242_10018695 | Ga0105242_100186952 | 51 |
| 294 | 3300009176 | Ga0105242_12126986 | Ga0105242_121269862 | 51 |
| 295 | 3300009176 | Ga0105242_12406642 | Ga0105242_124066422 | 51 |
| 296 | 3300009177 | Ga0105248_10802106 | Ga0105248_108021061 | 51 |
| 297 | 3300009177 | Ga0105248_11778740 | Ga0105248_117787402 | 51 |
| 298 | 3300009545 | Ga0105237_10028067 | Ga0105237_100280674 | 51 |
| 299 | 3300009545 | Ga0105237_10397394 | Ga0105237_103973942 | 51 |
| 300 | 3300009545 | Ga0105237_10779285 | Ga0105237_107792852 | 51 |
| 301 | 3300009545 | Ga0105237_11387458 | Ga0105237_113874582 | 51 |
| 302 | 3300009545 | Ga0105237_12177859 | Ga0105237_121778592 | 51 |
| 303 | 3300009551 | Ga0105238_11002522 | Ga0105238_110025221 | 51 |
| 304 | 3300009551 | Ga0105238_11409837 | Ga0105238_114098372 | 51 |
| 305 | 3300009553 | Ga0105249_11178870 | Ga0105249_111788702 | 51 |
| 306 | 3300009553 | Ga0105249_13314999 | Ga0105249_133149991 | 51 |
| 307 | 3300010375 | Ga0105239_10322587 | Ga0105239_103225873 | 51 |
| 308 | 3300010375 | Ga0105239_10394873 | Ga0105239_103948733 | 51 |
| 309 | 3300010375 | Ga0105239_10449527 | Ga0105239_104495272 | 51 |
| 310 | 3300010375 | Ga0105239_12147934 | Ga0105239_121479341 | 51 |
| 311 | 3300011119 | Ga0105246_11132690 | Ga0105246_111326902 | 51 |
| 312 | 3300011119 | Ga0105246_11346602 | Ga0105246_113466021 | 51 |
| 313 | 3300011119 | Ga0105246_11782802 | Ga0105246_117828022 | 51 |
| 314 | 3300013100 | Ga0157373_10895790 | Ga0157373_108957901 | 51 |
| 315 | 3300013102 | Ga0157371_10396955 | Ga0157371_103969552 | 51 |
| 316 | 3300013102 | Ga0157371_10495292 | Ga0157371_104952922 | 51 |
| 317 | 3300013102 | Ga0157371_11191656 | Ga0157371_111916561 | 51 |
| 318 | 3300013104 | Ga0157370_10303807 | Ga0157370_103038072 | 51 |
| 319 | 3300013105 | Ga0157369_10091270 | Ga0157369_100912704 | 51 |
| 320 | 3300013296 | Ga0157374_10003871 | Ga0157374_1000387115 | 51 |
| 321 | 3300013296 | Ga0157374_10246805 | Ga0157374_102468053 | 51 |
| 322 | 3300013296 | Ga0157374_10427792 | Ga0157374_104277922 | 51 |
| 323 | 3300013296 | Ga0157374_11229749 | Ga0157374_112297491 | 51 |
| 324 | 3300013296 | Ga0157374_11369943 | Ga0157374_113699432 | 51 |
| 325 | 3300013296 | Ga0157374_11538805 | Ga0157374_115388052 | 51 |
| 326 | 3300013296 | Ga0157374_12984276 | Ga0157374_129842761 | 51 |
| 327 | 3300013297 | Ga0157378_10030296 | Ga0157378_100302964 | 51 |
| 328 | 3300013297 | Ga0157378_10031400 | Ga0157378_100314002 | 51 |
| 329 | 3300013297 | Ga0157378_10122166 | Ga0157378_101221662 | 51 |
| 330 | 3300013297 | Ga0157378_10259446 | Ga0157378_102594462 | 51 |
| 331 | 3300013297 | Ga0157378_10337499 | Ga0157378_103374992 | 51 |
| 332 | 3300013297 | Ga0157378_10349575 | Ga0157378_103495753 | 51 |
| 333 | 3300013297 | Ga0157378_10407875 | Ga0157378_104078752 | 51 |
| 334 | 3300013297 | Ga0157378_10752684 | Ga0157378_107526842 | 51 |
| 335 | 3300013297 | Ga0157378_11842096 | Ga0157378_118420962 | 51 |
| 336 | 3300013297 | Ga0157378_12340274 | Ga0157378_123402742 | 51 |
| 337 | 3300013306 | Ga0163162_10099170 | Ga0163162_100991703 | 51 |
| 338 | 3300013306 | Ga0163162_10163465 | Ga0163162_101634653 | 51 |
| 339 | 3300013306 | Ga0163162_10201932 | Ga0163162_102019323 | 51 |
| 340 | 3300013306 | Ga0163162_10528129 | Ga0163162_105281292 | 51 |
| 341 | 3300013306 | Ga0163162_12363860 | Ga0163162_123638602 | 51 |
| 342 | 3300013306 | Ga0163162_13423163 | Ga0163162_134231631 | 51 |
| 343 | 3300013306 | Ga0163162_13463579 | Ga0163162_134635792 | 51 |
| 344 | 3300013307 | Ga0157372_10010274 | Ga0157372_100102747 | 51 |
| 345 | 3300013307 | Ga0157372_10346486 | Ga0157372_103464862 | 51 |
| 346 | 3300013308 | Ga0157375_10013261 | Ga0157375_100132615 | 51 |
| 347 | 3300013308 | Ga0157375_10057092 | Ga0157375_100570925 | 51 |
| 348 | 3300013308 | Ga0157375_10235093 | Ga0157375_102350933 | 51 |
| 349 | 3300013308 | Ga0157375_11016621 | Ga0157375_110166212 | 51 |
| 350 | 3300013308 | Ga0157375_11486602 | Ga0157375_114866022 | 51 |
| 351 | 3300013308 | Ga0157375_11683847 | Ga0157375_116838472 | 51 |
| 352 | 3300013308 | Ga0157375_13597607 | Ga0157375_135976072 | 51 |
| 353 | 3300014325 | Ga0163163_10376010 | Ga0163163_103760102 | 51 |
| 354 | 3300014325 | Ga0163163_12459240 | Ga0163163_124592401 | 51 |
| 355 | 3300014325 | Ga0163163_13089399 | Ga0163163_130893991 | 51 |
| 356 | 3300014326 | Ga0157380_12049127 | Ga0157380_120491272 | 51 |
| 357 | 3300014326 | Ga0157380_12973571 | Ga0157380_129735711 | 51 |
| 358 | 3300014497 | Ga0182008_10008039 | Ga0182008_100080392 | 51 |
| 359 | 3300014745 | Ga0157377_10342916 | Ga0157377_103429161 | 51 |
| 360 | 3300014968 | Ga0157379_10441535 | Ga0157379_104415351 | 51 |
| 361 | 3300014968 | Ga0157379_11329216 | Ga0157379_113292161 | 51 |
| 362 | 3300014969 | Ga0157376_10011998 | Ga0157376_100119987 | 51 |
| 363 | 3300014969 | Ga0157376_10030235 | Ga0157376_100302355 | 51 |
| 364 | 3300014969 | Ga0157376_10356952 | Ga0157376_103569522 | 51 |
| 365 | 3300014969 | Ga0157376_10442665 | Ga0157376_104426652 | 51 |
| 366 | 3300014969 | Ga0157376_11656638 | Ga0157376_116566381 | 51 |
| 367 | 3300014969 | Ga0157376_12056144 | Ga0157376_120561442 | 51 |
| 368 | 3300014969 | Ga0157376_12547927 | Ga0157376_125479271 | 51 |
| 369 | 3300015261 | Ga0182006_1091965 | Ga0182006_10919652 | 51 |
| 370 | 3300015261 | Ga0182006_1113115 | Ga0182006_11131152 | 51 |
| 371 | 3300015261 | Ga0182006_1166536 | Ga0182006_11665362 | 51 |
| 372 | 3300015265 | Ga0182005_1028573 | Ga0182005_10285732 | 51 |
| 373 | 3300017792 | Ga0163161_10358713 | Ga0163161_103587132 | 51 |
| 374 | 3300017792 | Ga0163161_10378487 | Ga0163161_103784872 | 51 |
| 375 | 3300017792 | Ga0163161_11157531 | Ga0163161_111575312 | 51 |
| 376 | 3300025271 | Ga0207666_1000363 | Ga0207666_10003633 | 51 |
| 377 | 3300025290 | Ga0207673_1034728 | Ga0207673_10347282 | 51 |
| 378 | 3300025315 | Ga0207697_10002302 | Ga0207697_100023023 | 51 |
| 379 | 3300025315 | Ga0207697_10004870 | Ga0207697_100048706 | 51 |
| 380 | 3300025315 | Ga0207697_10208017 | Ga0207697_102080171 | 51 |
| 381 | 3300025899 | Ga0207642_10889078 | Ga0207642_108890781 | 51 |
| 382 | 3300025901 | Ga0207688_10282652 | Ga0207688_102826522 | 51 |
| 383 | 3300025903 | Ga0207680_10129104 | Ga0207680_101291043 | 51 |
| 384 | 3300025905 | Ga0207685_10255073 | Ga0207685_102550732 | 51 |
| 385 | 3300025906 | Ga0207699_10123140 | Ga0207699_101231403 | 51 |
| 386 | 3300025906 | Ga0207699_11101522 | Ga0207699_111015221 | 51 |
| 387 | 3300025907 | Ga0207645_10005184 | Ga0207645_100051843 | 51 |
| 388 | 3300025907 | Ga0207645_10233453 | Ga0207645_102334531 | 51 |
| 389 | 3300025907 | Ga0207645_10280221 | Ga0207645_102802212 | 51 |
| 390 | 3300025907 | Ga0207645_10706981 | Ga0207645_107069812 | 51 |
| 391 | 3300025907 | Ga0207645_11178765 | Ga0207645_111787651 | 51 |
| 392 | 3300025909 | Ga0207705_10046002 | Ga0207705_100460023 | 51 |
| 393 | 3300025909 | Ga0207705_10664831 | Ga0207705_106648311 | 51 |
| 394 | 3300025909 | Ga0207705_10723104 | Ga0207705_107231042 | 51 |
| 395 | 3300025910 | Ga0207684_10000824 | Ga0207684_1000082431 | 51 |
| 396 | 3300025910 | Ga0207684_10027013 | Ga0207684_100270135 | 51 |
| 397 | 3300025910 | Ga0207684_10127432 | Ga0207684_101274322 | 51 |
| 398 | 3300025910 | Ga0207684_10695276 | Ga0207684_106952762 | 51 |
| 399 | 3300025910 | Ga0207684_10959550 | Ga0207684_109595502 | 51 |
| 400 | 3300025912 | Ga0207707_11003678 | Ga0207707_110036782 | 51 |
| 401 | 3300025913 | Ga0207695_10000186 | Ga0207695_1000018621 | 51 |
| 402 | 3300025913 | Ga0207695_10376029 | Ga0207695_103760291 | 51 |
| 403 | 3300025914 | Ga0207671_10026068 | Ga0207671_100260684 | 51 |
| 404 | 3300025914 | Ga0207671_10252804 | Ga0207671_102528042 | 51 |
| 405 | 3300025915 | Ga0207693_10312996 | Ga0207693_103129962 | 51 |
| 406 | 3300025915 | Ga0207693_10691125 | Ga0207693_106911252 | 51 |
| 407 | 3300025916 | Ga0207663_10024925 | Ga0207663_100249253 | 51 |
| 408 | 3300025916 | Ga0207663_10875880 | Ga0207663_108758801 | 51 |
| 409 | 3300025917 | Ga0207660_10457006 | Ga0207660_104570062 | 51 |
| 410 | 3300025919 | Ga0207657_10830599 | Ga0207657_108305992 | 51 |
| 411 | 3300025919 | Ga0207657_11122431 | Ga0207657_111224311 | 51 |
| 412 | 3300025919 | Ga0207657_11285881 | Ga0207657_112858812 | 51 |
| 413 | 3300025920 | Ga0207649_10561387 | Ga0207649_105613872 | 51 |
| 414 | 3300025920 | Ga0207649_11333746 | Ga0207649_113337461 | 51 |
| 415 | 3300025922 | Ga0207646_10003687 | Ga0207646_100036874 | 51 |
| 416 | 3300025922 | Ga0207646_10022818 | Ga0207646_100228182 | 51 |
| 417 | 3300025922 | Ga0207646_10044232 | Ga0207646_100442323 | 51 |
| 418 | 3300025922 | Ga0207646_10068200 | Ga0207646_100682003 | 51 |
| 419 | 3300025922 | Ga0207646_10133027 | Ga0207646_101330273 | 51 |
| 420 | 3300025922 | Ga0207646_10313976 | Ga0207646_103139763 | 51 |
| 421 | 3300025922 | Ga0207646_10389833 | Ga0207646_103898331 | 51 |
| 422 | 3300025922 | Ga0207646_10609440 | Ga0207646_106094402 | 51 |
| 423 | 3300025922 | Ga0207646_11064566 | Ga0207646_110645662 | 51 |
| 424 | 3300025923 | Ga0207681_10066283 | Ga0207681_100662833 | 51 |
| 425 | 3300025925 | Ga0207650_10180998 | Ga0207650_101809982 | 51 |
| 426 | 3300025926 | Ga0207659_10066261 | Ga0207659_100662613 | 51 |
| 427 | 3300025926 | Ga0207659_10161551 | Ga0207659_101615513 | 51 |
| 428 | 3300025927 | Ga0207687_10025395 | Ga0207687_100253952 | 51 |
| 429 | 3300025927 | Ga0207687_10371640 | Ga0207687_103716402 | 51 |
| 430 | 3300025928 | Ga0207700_10320193 | Ga0207700_103201932 | 51 |
| 431 | 3300025929 | Ga0207664_10376228 | Ga0207664_103762283 | 51 |
| 432 | 3300025929 | Ga0207664_10546757 | Ga0207664_105467572 | 51 |
| 433 | 3300025929 | Ga0207664_11765575 | Ga0207664_117655752 | 51 |
| 434 | 3300025929 | Ga0207664_11961471 | Ga0207664_119614711 | 51 |
| 435 | 3300025931 | Ga0207644_10091491 | Ga0207644_100914912 | 51 |
| 436 | 3300025931 | Ga0207644_10325629 | Ga0207644_103256292 | 51 |
| 437 | 3300025931 | Ga0207644_10974736 | Ga0207644_109747362 | 51 |
| 438 | 3300025933 | Ga0207706_10314191 | Ga0207706_103141912 | 51 |
| 439 | 3300025933 | Ga0207706_10511890 | Ga0207706_105118902 | 51 |
| 440 | 3300025934 | Ga0207686_10043024 | Ga0207686_100430242 | 51 |
| 441 | 3300025936 | Ga0207670_10033442 | Ga0207670_100334423 | 51 |
| 442 | 3300025936 | Ga0207670_10107142 | Ga0207670_101071422 | 51 |
| 443 | 3300025936 | Ga0207670_10193315 | Ga0207670_101933152 | 51 |
| 444 | 3300025936 | Ga0207670_11747943 | Ga0207670_117479432 | 51 |
| 445 | 3300025937 | Ga0207669_10014102 | Ga0207669_100141023 | 51 |
| 446 | 3300025937 | Ga0207669_10745108 | Ga0207669_107451081 | 51 |
| 447 | 3300025938 | Ga0207704_10421412 | Ga0207704_104214122 | 51 |
| 448 | 3300025938 | Ga0207704_10828498 | Ga0207704_108284981 | 51 |
| 449 | 3300025938 | Ga0207704_11066830 | Ga0207704_110668302 | 51 |
| 450 | 3300025938 | Ga0207704_11135674 | Ga0207704_111356741 | 51 |
| 451 | 3300025939 | Ga0207665_10810618 | Ga0207665_108106182 | 51 |
| 452 | 3300025940 | Ga0207691_10046047 | Ga0207691_100460472 | 51 |
| 453 | 3300025940 | Ga0207691_10323455 | Ga0207691_103234552 | 51 |
| 454 | 3300025940 | Ga0207691_11403501 | Ga0207691_114035012 | 51 |
| 455 | 3300025942 | Ga0207689_10233454 | Ga0207689_102334542 | 51 |
| 456 | 3300025944 | Ga0207661_10007121 | Ga0207661_100071215 | 51 |
| 457 | 3300025944 | Ga0207661_10775437 | Ga0207661_107754372 | 51 |
| 458 | 3300025945 | Ga0207679_10736017 | Ga0207679_107360171 | 51 |
| 459 | 3300025945 | Ga0207679_10964547 | Ga0207679_109645471 | 51 |
| 460 | 3300025945 | Ga0207679_11505817 | Ga0207679_115058172 | 51 |
| 461 | 3300025949 | Ga0207667_10054428 | Ga0207667_100544282 | 51 |
| 462 | 3300025960 | Ga0207651_10027485 | Ga0207651_100274853 | 51 |
| 463 | 3300025960 | Ga0207651_10036102 | Ga0207651_100361023 | 51 |
| 464 | 3300025960 | Ga0207651_10557619 | Ga0207651_105576192 | 51 |
| 465 | 3300025960 | Ga0207651_11900248 | Ga0207651_119002482 | 51 |
| 466 | 3300025961 | Ga0207712_10023403 | Ga0207712_100234033 | 51 |
| 467 | 3300025961 | Ga0207712_10965369 | Ga0207712_109653691 | 51 |
| 468 | 3300025972 | Ga0207668_10084141 | Ga0207668_100841412 | 51 |
| 469 | 3300025972 | Ga0207668_10100127 | Ga0207668_101001273 | 51 |
| 470 | 3300025972 | Ga0207668_10354506 | Ga0207668_103545061 | 51 |
| 471 | 3300025972 | Ga0207668_11108551 | Ga0207668_111085512 | 51 |
| 472 | 3300025981 | Ga0207640_11445143 | Ga0207640_114451432 | 51 |
| 473 | 3300025986 | Ga0207658_10044405 | Ga0207658_100444053 | 51 |
| 474 | 3300025986 | Ga0207658_10222823 | Ga0207658_102228231 | 51 |
| 475 | 3300026023 | Ga0207677_10731621 | Ga0207677_107316212 | 51 |
| 476 | 3300026023 | Ga0207677_10894698 | Ga0207677_108946982 | 51 |
| 477 | 3300026023 | Ga0207677_11467240 | Ga0207677_114672402 | 51 |
| 478 | 3300026035 | Ga0207703_10434283 | Ga0207703_104342832 | 51 |
| 479 | 3300026035 | Ga0207703_11032523 | Ga0207703_110325232 | 51 |
| 480 | 3300026041 | Ga0207639_11754384 | Ga0207639_117543842 | 51 |
| 481 | 3300026041 | Ga0207639_11795641 | Ga0207639_117956411 | 51 |
| 482 | 3300026067 | Ga0207678_10256661 | Ga0207678_102566612 | 51 |
| 483 | 3300026075 | Ga0207708_11281432 | Ga0207708_112814322 | 51 |
| 484 | 3300026075 | Ga0207708_11632039 | Ga0207708_116320391 | 51 |
| 485 | 3300026078 | Ga0207702_10475228 | Ga0207702_104752282 | 51 |
| 486 | 3300026088 | Ga0207641_10216513 | Ga0207641_102165132 | 51 |
| 487 | 3300026088 | Ga0207641_10656341 | Ga0207641_106563411 | 51 |
| 488 | 3300026088 | Ga0207641_11489943 | Ga0207641_114899432 | 51 |
| 489 | 3300026089 | Ga0207648_10169502 | Ga0207648_101695023 | 51 |
| 490 | 3300026095 | Ga0207676_10355600 | Ga0207676_103556001 | 51 |
| 491 | 3300026095 | Ga0207676_10755641 | Ga0207676_107556411 | 51 |
| 492 | 3300026116 | Ga0207674_10458397 | Ga0207674_104583974 | 51 |
| 493 | 3300026116 | Ga0207674_10812554 | Ga0207674_108125541 | 51 |
| 494 | 3300026118 | Ga0207675_101007002 | Ga0207675_1010070021 | 51 |
| 495 | 3300026121 | Ga0207683_10016271 | Ga0207683_100162712 | 51 |
| 496 | 3300026121 | Ga0207683_10248628 | Ga0207683_102486283 | 51 |
| 497 | 3300026121 | Ga0207683_10407482 | Ga0207683_104074822 | 51 |
| 498 | 3300026142 | Ga0207698_10131780 | Ga0207698_101317802 | 51 |
| 499 | 3300026142 | Ga0207698_10299967 | Ga0207698_102999672 | 51 |
| 500 | 3300027378 | Ga0209981_1062426 | Ga0209981_10624262 | 51 |
| 501 | 3300027526 | Ga0209968_1057160 | Ga0209968_10571601 | 51 |
| 502 | 3300027552 | Ga0209982_1015547 | Ga0209982_10155472 | 51 |
| 503 | 3300027682 | Ga0209971_1123283 | Ga0209971_11232832 | 51 |
| 504 | 3300028036 | Ga0265355_1012814 | Ga0265355_10128141 | 51 |
| 505 | 3300028379 | Ga0268266_10006370 | Ga0268266_100063709 | 51 |
| 506 | 3300028379 | Ga0268266_10135309 | Ga0268266_101353092 | 51 |
| 507 | 3300028379 | Ga0268266_10559615 | Ga0268266_105596152 | 51 |
| 508 | 3300028379 | Ga0268266_10626966 | Ga0268266_106269663 | 51 |
| 509 | 3300028379 | Ga0268266_12114939 | Ga0268266_121149392 | 51 |
| 510 | 3300028380 | Ga0268265_10461555 | Ga0268265_104615552 | 51 |
| 511 | 3300028380 | Ga0268265_12595783 | Ga0268265_125957831 | 51 |
| 512 | 3300028381 | Ga0268264_10012939 | Ga0268264_100129393 | 51 |
| 513 | 3300028381 | Ga0268264_10424735 | Ga0268264_104247352 | 51 |
| 514 | 3300028381 | Ga0268264_12003883 | Ga0268264_120038831 | 51 |
| 515 | 3300028381 | Ga0268264_12028106 | Ga0268264_120281062 | 51 |
| 516 | 3300028556 | Ga0265337_1008669 | Ga0265337_10086696 | 51 |
| 517 | 3300028556 | Ga0265337_1028298 | Ga0265337_10282983 | 51 |
| 518 | 3300028556 | Ga0265337_1131933 | Ga0265337_11319332 | 51 |
| 519 | 3300028563 | Ga0265319_1002037 | Ga0265319_100203714 | 51 |
| 520 | 3300028563 | Ga0265319_1031375 | Ga0265319_10313753 | 51 |
| 521 | 3300028563 | Ga0265319_1064233 | Ga0265319_10642331 | 51 |
| 522 | 3300028563 | Ga0265319_1096467 | Ga0265319_10964672 | 51 |
| 523 | 3300028563 | Ga0265319_1110446 | Ga0265319_11104461 | 51 |
| 524 | 3300028573 | Ga0265334_10312925 | Ga0265334_103129252 | 51 |
| 525 | 3300028577 | Ga0265318_10001738 | Ga0265318_100017388 | 51 |
| 526 | 3300028577 | Ga0265318_10012130 | Ga0265318_100121303 | 51 |
| 527 | 3300028577 | Ga0265318_10019765 | Ga0265318_100197654 | 51 |
| 528 | 3300028577 | Ga0265318_10044898 | Ga0265318_100448983 | 51 |
| 529 | 3300028577 | Ga0265318_10197805 | Ga0265318_101978052 | 51 |
| 530 | 3300028577 | Ga0265318_10232047 | Ga0265318_102320471 | 51 |
| 531 | 3300028653 | Ga0265323_10000099 | Ga0265323_1000009962 | 51 |
| 532 | 3300028654 | Ga0265322_10001283 | Ga0265322_100012834 | 51 |
| 533 | 3300028654 | Ga0265322_10006209 | Ga0265322_100062094 | 51 |
| 534 | 3300028666 | Ga0265336_10020125 | Ga0265336_100201254 | 51 |
| 535 | 3300028666 | Ga0265336_10275301 | Ga0265336_102753012 | 51 |
| 536 | 3300028794 | Ga0307515_10931129 | Ga0307515_109311291 | 51 |
| 537 | 3300028800 | Ga0265338_10005644 | Ga0265338_100056443 | 51 |
| 538 | 3300028800 | Ga0265338_10677112 | Ga0265338_106771122 | 51 |
| 539 | 3300029957 | Ga0265324_10001420 | Ga0265324_1000142016 | 51 |
| 540 | 3300029957 | Ga0265324_10243582 | Ga0265324_102435821 | 51 |
| 541 | 3300031235 | Ga0265330_10039095 | Ga0265330_100390952 | 51 |
| 542 | 3300031238 | Ga0265332_10357844 | Ga0265332_103578442 | 51 |
| 543 | 3300031240 | Ga0265320_10001237 | Ga0265320_100012378 | 51 |
| 544 | 3300031240 | Ga0265320_10004381 | Ga0265320_100043813 | 51 |
| 545 | 3300031240 | Ga0265320_10017280 | Ga0265320_100172804 | 51 |
| 546 | 3300031240 | Ga0265320_10068581 | Ga0265320_100685813 | 51 |
| 547 | 3300031240 | Ga0265320_10150533 | Ga0265320_101505332 | 51 |
| 548 | 3300031240 | Ga0265320_10236210 | Ga0265320_102362102 | 51 |
| 549 | 3300031240 | Ga0265320_10297203 | Ga0265320_102972032 | 51 |
| 550 | 3300031242 | Ga0265329_10254418 | Ga0265329_102544181 | 51 |
| 551 | 3300031249 | Ga0265339_10258411 | Ga0265339_102584112 | 51 |
| 552 | 3300031250 | Ga0265331_10093400 | Ga0265331_100934003 | 51 |
| 553 | 3300031251 | Ga0265327_10025399 | Ga0265327_100253996 | 51 |
| 554 | 3300031251 | Ga0265327_10036101 | Ga0265327_100361013 | 51 |
| 555 | 3300031344 | Ga0265316_10003494 | Ga0265316_100034944 | 51 |
| 556 | 3300031344 | Ga0265316_10065206 | Ga0265316_100652065 | 51 |
| 557 | 3300031344 | Ga0265316_10145614 | Ga0265316_101456142 | 51 |
| 558 | 3300031456 | Ga0307513_10134394 | Ga0307513_101343942 | 51 |
| 559 | 3300031595 | Ga0265313_10240782 | Ga0265313_102407822 | 51 |
| 560 | 3300031711 | Ga0265314_10021042 | Ga0265314_100210426 | 51 |
| 561 | 3300031711 | Ga0265314_10022950 | Ga0265314_100229507 | 51 |
| 562 | 3300031711 | Ga0265314_10027231 | Ga0265314_100272318 | 51 |
| 563 | 3300031711 | Ga0265314_10317472 | Ga0265314_103174721 | 51 |
| 564 | 3300031711 | Ga0265314_10355999 | Ga0265314_103559992 | 51 |
| 565 | 3300031712 | Ga0265342_10015002 | Ga0265342_100150028 | 51 |
| 566 | 3300031712 | Ga0265342_10581559 | Ga0265342_105815591 | 51 |
| 567 | 3300031727 | Ga0316576_10117945 | Ga0316576_101179453 | 51 |
| 568 | 3300031727 | Ga0316576_10192869 | Ga0316576_101928692 | 51 |
| 569 | 3300032004 | Ga0307414_11468770 | Ga0307414_114687702 | 51 |
| 570 | 3300034820 | Ga0373959_0056187 | Ga0373959_0056187_238_393 | 51 |
| 571 | 3300034957 | Ga0373938_0188058 | Ga0373938_0188058_121_276 | 51 |
| 572 | 3300035083 | Ga0373926_0159469 | Ga0373926_0159469_49_204 | 51 |
| 573 | 3300035084 | Ga0373928_0251095 | Ga0373928_0251095_290_445 | 51 |
| 574 | 3300035086 | Ga0373934_0058726 | Ga0373934_0058726_1365_1520 | 51 |
| 575 | 3300035086 | Ga0373934_0339259 | Ga0373934_0339259_178_333 | 51 |
| 576 | 3300035111 | Ga0373923_0311057 | Ga0373923_0311057_496_651 | 51 |
| 577 | 3300035112 | Ga0373932_0128680 | Ga0373932_0128680_484_639 | 51 |
| 578 | 3300035116 | Ga0373945_0351663 | Ga0373945_0351663_153_308 | 51 |
| 579 | 3300035116 | Ga0373945_0510295 | Ga0373945_0510295_324_479 | 51 |
| 580 | 3300035119 | Ga0373956_0252695 | Ga0373956_0252695_573_728 | 51 |
| 581 | 3300035120 | Ga0373957_0399272 | Ga0373957_0399272_318_473 | 51 |
| 582 | 3300035170 | Ga0373943_0109154 | Ga0373943_0109154_976_1131 | 51 |
| 583 | 3300035170 | Ga0373943_0399161 | Ga0373943_0399161_449_604 | 51 |
| 584 | 3300035172 | Ga0373955_0312226 | Ga0373955_0312226_705_860 | 51 |
| 585 | 3300035172 | Ga0373955_0692967 | Ga0373955_0692967_58_213 | 51 |
| 586 | 3300035398 | Ga0316574_0076909 | Ga0316574_0076909_1457_1627 | 51 |
| 587 | 3300035410 | Ga0373924_0201882 | Ga0373924_0201882_227_382 | 51 |
| 588 | 3300035691 | Ga0373931_0112406 | Ga0373931_0112406_1038_1193 | 51 |
| 589 | 3300035691 | Ga0373931_0284299 | Ga0373931_0284299_199_354 | 51 |
| 590 | 3300035691 | Ga0373931_0751138 | Ga0373931_0751138_372_527 | 51 |
| 591 | 3300035692 | Ga0373935_0035970 | Ga0373935_0035970_2557_2712 | 51 |
| 592 | 3300035692 | Ga0373935_0650139 | Ga0373935_0650139_361_516 | 51 |
| 593 | 3300035692 | Ga0373935_0853600 | Ga0373935_0853600_72_227 | 51 |
| 594 | 3300035692 | Ga0373935_0999866 | Ga0373935_0999866_422_577 | 51 |
| 595 | 3300035724 | Ga0373933_0459035 | Ga0373933_0459035_446_601 | 51 |
| 596 | 3300035724 | Ga0373933_0542845 | Ga0373933_0542845_154_309 | 51 |
| 597 | 3300035724 | Ga0373933_0781449 | Ga0373933_0781449_284_439 | 51 |
| 598 | 3300035725 | Ga0373947_0369122 | Ga0373947_0369122_58_213 | 51 |
| 599 | 3300036401 | Ga0373937_0256305 | Ga0373937_0256305_59_214 | 51 |
| 600 | 3300036401 | Ga0373937_0401574 | Ga0373937_0401574_340_495 | 51 |
| 601 | 3300036401 | Ga0373937_0519735 | Ga0373937_0519735_817_972 | 51 |
| 602 | 3300036401 | Ga0373937_0907185 | Ga0373937_0907185_174_329 | 51 |
| 603 | 3300036401 | Ga0373937_0975271 | Ga0373937_0975271_330_485 | 51 |
| 604 | 3300036712 | Ga0316584_0730727 | Ga0316584_0730727_372_527 | 51 |
| 605 | 3300037068 | Ga0373925_0180425 | Ga0373925_0180425_426_581 | 51 |
| 606 | 3300037068 | Ga0373925_0819674 | Ga0373925_0819674_479_634 | 51 |
| 607 | 3300037068 | Ga0373925_1304984 | Ga0373925_1304984_163_318 | 51 |
| 608 | 3300037068 | Ga0373925_1566869 | Ga0373925_1566869_187_342 | 51 |
| 609 | 3300037068 | Ga0373925_1744360 | Ga0373925_1744360_31_186 | 51 |
| 610 | 3300037418 | Ga0395900_1715591 | Ga0395900_1715591_301_456 | 51 |
| 611 | 3300037466 | Ga0395898_0504903 | Ga0395898_0504903_54_209 | 51 |
| 612 | 3300037471 | Ga0395905_0283797 | Ga0395905_0283797_1275_1430 | 51 |
| 613 | 3300038443 | Ga0395901_0035188 | Ga0395901_0035188_52_207 | 51 |
| 614 | 3300039450 | Ga0436363_0679613 | Ga0436363_0679613_516_671 | 51 |
| 615 | 3300041441 | Ga0451787_435827 | Ga0451787_435827_264_419 | 51 |
| 616 | 3300041441 | Ga0451787_554291 | Ga0451787_554291_96_251 | 51 |
| 617 | 3300041459 | Ga0451800_1293054 | Ga0451800_1293054_40_195 | 51 |
| 618 | 3300041459 | Ga0451800_1607111 | Ga0451800_1607111_176_331 | 51 |
| 619 | 3300041460 | Ga0451802_0336535 | Ga0451802_0336535_392_547 | 51 |
| 620 | 3300041463 | Ga0451804_1183500 | Ga0451804_1183500_72_227 | 51 |
| 621 | 3300041486 | Ga0451807_2567572 | Ga0451807_2567572_60_215 | 51 |
| 622 | 3300041511 | Ga0451855_0439774 | Ga0451855_0439774_353_508 | 51 |
| 623 | 3300041511 | Ga0451855_0788558 | Ga0451855_0788558_396_551 | 51 |
| 624 | 3300041511 | Ga0451855_1540872 | Ga0451855_1540872_23_178 | 51 |
| 625 | 3300041512 | Ga0451853_1381405 | Ga0451853_1381405_318_473 | 51 |
| 626 | 3300041997 | Ga0439431_0025188 | Ga0439431_0025188_1261_1416 | 51 |
| 627 | 3300042001 | Ga0439441_094175 | Ga0439441_094175_212_370 | 51 |
| 628 | 3300042012 | Ga0439455_0103449 | Ga0439455_0103449_305_460 | 51 |
| 629 | 3300042876 | Ga0451577_0000024 | Ga0451577_0000024_105122_105277 | 51 |
| 630 | 3300042876 | Ga0451577_0003560 | Ga0451577_0003560_8432_8590 | 51 |
| 631 | 3300042876 | Ga0451577_0052256 | Ga0451577_0052256_2539_2694 | 51 |
| 632 | 3300042876 | Ga0451577_0478824 | Ga0451577_0478824_148_303 | 51 |
| 633 | 3300042876 | Ga0451577_1228123 | Ga0451577_1228123_147_302 | 51 |
| 634 | 3300044673 | Ga0453683_0001980 | Ga0453683_0001980_9051_9206 | 51 |
| 635 | 3300044684 | Ga0466966_0587687 | Ga0466966_0587687_41_196 | 51 |
| 636 | 3300044712 | Ga0453684_0019118 | Ga0453684_0019118_2928_3086 | 51 |
| 637 | 3300044712 | Ga0453684_0203186 | Ga0453684_0203186_306_461 | 51 |
| 638 | 3300044712 | Ga0453684_0239001 | Ga0453684_0239001_1082_1240 | 51 |
| 639 | 3300044712 | Ga0453684_0305967 | Ga0453684_0305967_1629_1784 | 51 |
| 640 | 3300044712 | Ga0453684_0384225 | Ga0453684_0384225_1400_1555 | 51 |
| 641 | 3300044712 | Ga0453684_1116526 | Ga0453684_1116526_396_551 | 51 |
| 642 | 3300045051 | Ga0451576_0001983 | Ga0451576_0001983_31861_32016 | 51 |
| 643 | 3300045051 | Ga0451576_0134263 | Ga0451576_0134263_469_624 | 51 |
| 644 | 3300045051 | Ga0451576_0173995 | Ga0451576_0173995_1738_1893 | 51 |
| 645 | 3300045051 | Ga0451576_0962737 | Ga0451576_0962737_91_246 | 51 |
| 646 | 3300045051 | Ga0451576_1380589 | Ga0451576_1380589_78_233 | 51 |
| 647 | 3300045051 | Ga0451576_1452948 | Ga0451576_1452948_467_622 | 51 |
| 648 | 3300046454 | Ga0495592_0013392 | Ga0495592_0013392_5950_6105 | 51 |
| 649 | 3300046454 | Ga0495592_0125465 | Ga0495592_0125465_1234_1389 | 51 |
| 650 | 3300046462 | Ga0495651_0231279 | Ga0495651_0231279_477_632 | 51 |
| 651 | 3300046462 | Ga0495651_1008102 | Ga0495651_1008102_43_198 | 51 |
| 652 | 3300046463 | Ga0495653_0233034 | Ga0495653_0233034_858_1013 | 51 |
| 653 | 3300046472 | Ga0495580_1045287 | Ga0495580_1045287_339_494 | 51 |
| 654 | 3300046474 | Ga0495605_0348170 | Ga0495605_0348170_438_593 | 51 |
| 655 | 3300046476 | Ga0495662_0277705 | Ga0495662_0277705_53_208 | 51 |
| 656 | 3300046477 | Ga0495664_0172395 | Ga0495664_0172395_894_1049 | 51 |
| 657 | 3300046492 | Ga0495585_0416442 | Ga0495585_0416442_430_585 | 51 |
| 658 | 3300046511 | Ga0495608_0070882 | Ga0495608_0070882_710_865 | 51 |
| 659 | 3300046514 | Ga0495618_0268202 | Ga0495618_0268202_295_450 | 51 |
| 660 | 3300046516 | Ga0495628_0013312 | Ga0495628_0013312_5799_5954 | 51 |
| 661 | 3300046517 | Ga0495630_0577946 | Ga0495630_0577946_495_650 | 51 |
| 662 | 3300046526 | Ga0495666_0455222 | Ga0495666_0455222_299_454 | 51 |
| 663 | 3300046529 | Ga0495652_0157967 | Ga0495652_0157967_1024_1179 | 51 |
| 664 | 3300046533 | Ga0495640_0606945 | Ga0495640_0606945_232_387 | 51 |
| 665 | 3300046535 | Ga0495586_0321968 | Ga0495586_0321968_549_704 | 51 |
| 666 | 3300046535 | Ga0495586_0526122 | Ga0495586_0526122_226_381 | 51 |
| 667 | 3300046536 | Ga0495587_0019137 | Ga0495587_0019137_2431_2586 | 51 |
| 668 | 3300046539 | Ga0495621_0155101 | Ga0495621_0155101_572_727 | 51 |
| 669 | 3300046539 | Ga0495621_0304394 | Ga0495621_0304394_60_215 | 51 |
| 670 | 3300046543 | Ga0495645_0054596 | Ga0495645_0054596_42_197 | 51 |
| 671 | 3300046559 | Ga0495667_0254506 | Ga0495667_0254506_721_876 | 51 |
| 672 | 3300046559 | Ga0495667_0914196 | Ga0495667_0914196_14_169 | 51 |
| 673 | 3300046615 | Ga0495656_0686161 | Ga0495656_0686161_343_498 | 51 |
| 674 | 3300046642 | Ga0495634_0667658 | Ga0495634_0667658_10_165 | 51 |
| 675 | 3300046642 | Ga0495634_0713298 | Ga0495634_0713298_300_455 | 51 |
| 676 | 3300046663 | Ga0495635_0841456 | Ga0495635_0841456_77_232 | 51 |
| 677 | 3300046675 | Ga0495657_0192992 | Ga0495657_0192992_657_812 | 51 |
| 678 | 3300046678 | Ga0495599_0051576 | Ga0495599_0051576_365_520 | 51 |
| 679 | 3300046678 | Ga0495599_0124141 | Ga0495599_0124141_10_165 | 51 |
| 680 | 3300046679 | Ga0495623_0184038 | Ga0495623_0184038_427_582 | 51 |
| 681 | 3300046679 | Ga0495623_0319035 | Ga0495623_0319035_498_653 | 51 |
| 682 | 3300046680 | Ga0495646_0058358 | Ga0495646_0058358_1666_1821 | 51 |
| 683 | 3300046680 | Ga0495646_0256783 | Ga0495646_0256783_391_546 | 51 |
| 684 | 3300046681 | Ga0495647_0425958 | Ga0495647_0425958_310_465 | 51 |
| 685 | 3300046683 | Ga0495658_1120571 | Ga0495658_1120571_267_422 | 51 |
| 686 | 3300046684 | Ga0495669_0370664 | Ga0495669_0370664_415_570 | 51 |
| 687 | 3300046689 | Ga0495613_0226083 | Ga0495613_0226083_1019_1174 | 51 |
| 688 | 3300046794 | Ga0495589_0501353 | Ga0495589_0501353_208_363 | 51 |
| 689 | 3300047317 | Ga0495604_0145945 | Ga0495604_0145945_615_770 | 51 |
| 690 | 3300047318 | Ga0495636_0339101 | Ga0495636_0339101_285_440 | 51 |
| 691 | 3300047319 | Ga0495674_0625847 | Ga0495674_0625847_576_731 | 51 |
| 692 | 3300047319 | Ga0495674_1435505 | Ga0495674_1435505_48_203 | 51 |
| 693 | 3300047322 | Ga0495680_1044156 | Ga0495680_1044156_264_419 | 51 |
| 694 | 3300047444 | Ga0495675_0117539 | Ga0495675_0117539_504_659 | 51 |
| 695 | 3300047444 | Ga0495675_0150774 | Ga0495675_0150774_333_488 | 51 |
| 696 | 3300047471 | Ga0495684_0134647 | Ga0495684_0134647_1612_1767 | 51 |
| 697 | 3300047471 | Ga0495684_0534245 | Ga0495684_0534245_543_698 | 51 |
| 698 | 3300047471 | Ga0495684_1071936 | Ga0495684_1071936_129_284 | 51 |
| 699 | 3300048088 | Ga0495602_0039071 | Ga0495602_0039071_1816_1971 | 51 |
| 700 | 3300048903 | Ga0496100_0284215 | Ga0496100_0284215_916_1071 | 51 |
| 701 | 3300048903 | Ga0496100_0930691 | Ga0496100_0930691_12_167 | 51 |
| 702 | 3300048904 | Ga0496101_0087055 | Ga0496101_0087055_257_412 | 51 |
| 703 | 3300048905 | Ga0496102_0087642 | Ga0496102_0087642_2225_2380 | 51 |
| 704 | 3300048906 | Ga0496103_0038392 | Ga0496103_0038392_2128_2283 | 51 |
| 705 | 3300048907 | Ga0496104_0673460 | Ga0496104_0673460_463_618 | 51 |
| 706 | 3300048908 | Ga0496105_0094436 | Ga0496105_0094436_1684_1839 | 51 |
| 707 | 3300048908 | Ga0496105_1218231 | Ga0496105_1218231_308_463 | 51 |
| 708 | 3300048909 | Ga0496106_0714584 | Ga0496106_0714584_90_245 | 51 |
| 709 | 3300048910 | Ga0496107_1020514 | Ga0496107_1020514_264_419 | 51 |
| 710 | 3300048911 | Ga0496108_0004565 | Ga0496108_0004565_6424_6579 | 51 |
| 711 | 3300048911 | Ga0496108_0396272 | Ga0496108_0396272_851_1006 | 51 |
| 712 | 3300048911 | Ga0496108_0565665 | Ga0496108_0565665_73_228 | 51 |
| 713 | 3300048912 | Ga0496109_0001915 | Ga0496109_0001915_5084_5239 | 51 |
| 714 | 3300048912 | Ga0496109_0322563 | Ga0496109_0322563_43_198 | 51 |
| 715 | 3300048912 | Ga0496109_1157768 | Ga0496109_1157768_102_257 | 51 |
| 716 | 3300048912 | Ga0496109_1572912 | Ga0496109_1572912_245_400 | 51 |
| 717 | 3300048913 | Ga0496110_0152975 | Ga0496110_0152975_1070_1225 | 51 |
| 718 | 3300048913 | Ga0496110_1342367 | Ga0496110_1342367_90_245 | 51 |
| 719 | 3300048914 | Ga0496111_0567086 | Ga0496111_0567086_110_265 | 51 |
| 720 | 3300048915 | Ga0496112_0025463 | Ga0496112_0025463_593_748 | 51 |
| 721 | 3300048915 | Ga0496112_0434274 | Ga0496112_0434274_565_720 | 51 |
| 722 | 3300048915 | Ga0496112_0477784 | Ga0496112_0477784_376_531 | 51 |
| 723 | 3300048915 | Ga0496112_1129781 | Ga0496112_1129781_419_574 | 51 |
| 724 | 3300048915 | Ga0496112_1171874 | Ga0496112_1171874_188_343 | 51 |
| 725 | 3300048916 | Ga0496113_0028316 | Ga0496113_0028316_3814_3969 | 51 |
| 726 | 3300048916 | Ga0496113_0805258 | Ga0496113_0805258_486_641 | 51 |
| 727 | 3300048917 | Ga0496114_0046150 | Ga0496114_0046150_1720_1875 | 51 |
| 728 | 3300048917 | Ga0496114_0879287 | Ga0496114_0879287_382_537 | 51 |
| 729 | 3300048918 | Ga0496115_0116008 | Ga0496115_0116008_538_693 | 51 |
| 730 | 3300048924 | Ga0496121_0520434 | Ga0496121_0520434_145_300 | 51 |
| 731 | 3300049568 | Ga0501031_0066289 | Ga0501031_0066289_683_838 | 51 |
| 732 | 3300049569 | Ga0501032_0000745 | Ga0501032_0000745_6037_6192 | 51 |
| 733 | 3300049569 | Ga0501032_0168601 | Ga0501032_0168601_557_712 | 51 |
| 734 | 3300049570 | Ga0501033_0005513 | Ga0501033_0005513_8342_8497 | 51 |
| 735 | 3300049571 | Ga0501034_0103914 | Ga0501034_0103914_366_521 | 51 |
| 736 | 3300049572 | Ga0501036_0016442 | Ga0501036_0016442_2519_2674 | 51 |
| 737 | 3300049573 | Ga0501037_0039911 | Ga0501037_0039911_1961_2116 | 51 |
| 738 | 3300049573 | Ga0501037_0063862 | Ga0501037_0063862_758_913 | 51 |
| 739 | 3300049573 | Ga0501037_0755580 | Ga0501037_0755580_260_415 | 51 |
| 740 | 3300049574 | Ga0501038_0003275 | Ga0501038_0003275_7341_7496 | 51 |
| 741 | 3300049575 | Ga0501039_0015427 | Ga0501039_0015427_5508_5663 | 51 |
| 742 | 3300049577 | Ga0501041_0982667 | Ga0501041_0982667_361_516 | 51 |
| 743 | 3300049578 | Ga0501042_0007405 | Ga0501042_0007405_2893_3048 | 51 |
| 744 | 3300049579 | Ga0501043_0050601 | Ga0501043_0050601_728_883 | 51 |
| 745 | 3300049580 | Ga0501046_0004222 | Ga0501046_0004222_11082_11237 | 51 |
| 746 | 3300049580 | Ga0501046_0007686 | Ga0501046_0007686_6001_6156 | 51 |
| 747 | 3300049580 | Ga0501046_0014662 | Ga0501046_0014662_5363_5518 | 51 |
| 748 | 3300049580 | Ga0501046_0744830 | Ga0501046_0744830_291_446 | 51 |
| 749 | 3300049581 | Ga0501047_0035347 | Ga0501047_0035347_3366_3521 | 51 |
| 750 | 3300049581 | Ga0501047_0052141 | Ga0501047_0052141_886_1041 | 51 |
| 751 | 3300049581 | Ga0501047_0052377 | Ga0501047_0052377_167_322 | 51 |
| 752 | 3300049581 | Ga0501047_1087351 | Ga0501047_1087351_239_394 | 51 |
| 753 | 3300049582 | Ga0501048_0005753 | Ga0501048_0005753_4534_4689 | 51 |
| 754 | 3300049582 | Ga0501048_0246029 | Ga0501048_0246029_917_1072 | 51 |
| 755 | 3300049586 | Ga0501070_0009556 | Ga0501070_0009556_3570_3725 | 51 |
| 756 | 3300049586 | Ga0501070_0115335 | Ga0501070_0115335_1146_1301 | 51 |
| 757 | 3300049586 | Ga0501070_0274592 | Ga0501070_0274592_462_617 | 51 |
| 758 | 3300049587 | Ga0501071_0502577 | Ga0501071_0502577_366_521 | 51 |
| 759 | 3300049742 | Ga0501080_0174419 | Ga0501080_0174419_1266_1421 | 51 |
| 760 | 3300049742 | Ga0501080_0391058 | Ga0501080_0391058_273_428 | 51 |
| 761 | 3300049744 | Ga0501083_0015708 | Ga0501083_0015708_2002_2157 | 51 |
| 762 | 3300049744 | Ga0501083_0044333 | Ga0501083_0044333_575_730 | 51 |
| 763 | 3300049822 | Ga0501035_0008262 | Ga0501035_0008262_6631_6786 | 51 |
| 764 | 3300049822 | Ga0501035_0254630 | Ga0501035_0254630_940_1095 | 51 |
| 765 | 3300049822 | Ga0501035_0321807 | Ga0501035_0321807_202_357 | 51 |
| 766 | 3300049823 | Ga0501044_0012985 | Ga0501044_0012985_2928_3083 | 51 |
| 767 | 3300049823 | Ga0501044_0017234 | Ga0501044_0017234_2428_2583 | 51 |
| 768 | 3300049823 | Ga0501044_0345009 | Ga0501044_0345009_1125_1280 | 51 |
| 769 | 3300049824 | Ga0501045_0029555 | Ga0501045_0029555_1090_1245 | 51 |
| 770 | 3300050507 | nmdc:mga05p37_2087914_c1 | nmdc:mga05p37_2087914_c1_230_385 | 51 |
| 771 | 3300050507 | nmdc:mga05p37_361162_c1 | nmdc:mga05p37_361162_c1_155_310 | 51 |
| 772 | 3300050507 | nmdc:mga05p37_497648_c1 | nmdc:mga05p37_497648_c1_354_509 | 51 |
| 773 | 3300050508 | nmdc:mga09592_1318437_c1 | nmdc:mga09592_1318437_c1_225_380 | 51 |
| 774 | 3300050508 | nmdc:mga09592_160331_c1 | nmdc:mga09592_160331_c1_786_941 | 51 |
| 775 | 3300050509 | nmdc:mga0qj67_1338832_c1 | nmdc:mga0qj67_1338832_c1_331_486 | 51 |
| 776 | 3300050511 | nmdc:mga08y16_1042022_c1 | nmdc:mga08y16_1042022_c1_459_614 | 51 |
| 777 | 3300050511 | nmdc:mga08y16_1071323_c1 | nmdc:mga08y16_1071323_c1_59_214 | 51 |
| 778 | 3300050511 | nmdc:mga08y16_1191288_c1 | nmdc:mga08y16_1191288_c1_71_226 | 51 |
| 779 | 3300050511 | nmdc:mga08y16_295343_c1 | nmdc:mga08y16_295343_c1_433_588 | 51 |
| 780 | 3300050511 | nmdc:mga08y16_666385_c1 | nmdc:mga08y16_666385_c1_863_1018 | 51 |
| 781 | 3300050512 | nmdc:mga0n895_1046999_c1 | nmdc:mga0n895_1046999_c1_447_602 | 51 |
| 782 | 3300050512 | nmdc:mga0n895_163793_c1 | nmdc:mga0n895_163793_c1_874_1029 | 51 |
| 783 | 3300050512 | nmdc:mga0n895_1868875_c1 | nmdc:mga0n895_1868875_c1_222_377 | 51 |
| 784 | 3300050512 | nmdc:mga0n895_315777_c1 | nmdc:mga0n895_315777_c1_1258_1413 | 51 |
| 785 | 3300050513 | nmdc:mga0rr50_870115_c1 | nmdc:mga0rr50_870115_c1_376_531 | 51 |
| 786 | 3300050514 | nmdc:mga08x19_1327885_c1 | nmdc:mga08x19_1327885_c1_200_355 | 51 |
| 787 | 3300050514 | nmdc:mga08x19_200436_c1 | nmdc:mga08x19_200436_c1_614_769 | 51 |
| 788 | 3300050515 | nmdc:mga0a205_263999_c1 | nmdc:mga0a205_263999_c1_195_350 | 51 |
| 789 | 3300050515 | nmdc:mga0a205_332060_c1 | nmdc:mga0a205_332060_c1_57_212 | 51 |
| 790 | 3300050515 | nmdc:mga0a205_441378_c1 | nmdc:mga0a205_441378_c1_247_402 | 51 |
| 791 | 3300050516 | nmdc:mga0sz30_262647_c1 | nmdc:mga0sz30_262647_c1_306_461 | 51 |
| 792 | 3300053077 | Ga0495601_0036457 | Ga0495601_0036457_728_883 | 51 |
| 793 | 3300053077 | Ga0495601_0208809 | Ga0495601_0208809_348_503 | 51 |
| 794 | 3300053078 | Ga0495612_0276890 | Ga0495612_0276890_407_562 | 51 |
| 795 | 3300053084 | Ga0495595_0084468 | Ga0495595_0084468_1156_1311 | 51 |
| 796 | 3300053084 | Ga0495595_0180017 | Ga0495595_0180017_801_956 | 51 |
| 797 | 3300053084 | Ga0495595_0246216 | Ga0495595_0246216_413_568 | 51 |
| 798 | 3300053084 | Ga0495595_0299557 | Ga0495595_0299557_118_273 | 51 |
| 799 | 3300053085 | Ga0495619_0213428 | Ga0495619_0213428_780_935 | 51 |
| 800 | 3300053085 | Ga0495619_0704222 | Ga0495619_0704222_55_210 | 51 |
| 801 | 3300053087 | Ga0500643_102775 | Ga0500643_102775_390_545 | 51 |
| 802 | 3300053140 | Ga0500573_0300800 | Ga0500573_0300800_137_292 | 51 |
| 803 | 3300053727 | Ga0500611_009469 | Ga0500611_009469_1213_1368 | 51 |
| 804 | 3300060353 | Ga0501082_0061321 | Ga0501082_0061321_2742_2897 | 51 |
| 805 | 3300060353 | Ga0501082_1732053 | Ga0501082_1732053_240_395 | 51 |
| 806 | 3300060353 | Ga0501082_1982160 | Ga0501082_1982160_22_180 | 51 |
| 807 | 3300061719 | Ga0466962_0371178 | Ga0466962_0371178_523_678 | 51 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6n74-assembly1.cif.gz_A | crystal structure of atpase delta1-79 spa47 r271e | 0.7709 | 8 | 40 |
| 6n75-assembly1.cif.gz_A | crystal structure of atpase delta1-79 spa47 e287a | 0.7691 | 8 | 40 |
| 5syr-assembly1.cif.gz_A | crystal structure of atpase delta1-79 spa47 r350a | 0.7675 | 8 | 40 |
| 6n74-assembly2.cif.gz_B | crystal structure of atpase delta1-79 spa47 r271e | 0.7643 | 8 | 40 |
| 5syp-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7633 | 8 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u62A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.8047 | 18 | 37 | 3.40.50.10860 |
| af_A0A060D798_142_368_1.25.70.10 | Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial | 0.7415 | 20 | 42 | 1.25.70.10 |
| af_Q53LJ1_243_436_1.25.70.10 | Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial | 0.699 | 20 | 39 | 1.25.70.10 |
| 4nphA02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.6052 | 9 | 40 | 1.20.1270.330 |
| af_Q7PLG1_250_780_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.5158 | 7 | 45 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G1MHF0-F1-model_v4 | Small basic protein | 0.8792 | 22 | 51 |
|
| AF-A0A521GV40-F1-model_v4 | Small basic protein | 0.8176 | 22 | 51 |
|
| AF-A0A5C5X6P1-F1-model_v4 | Small basic protein | 0.5678 | 1 | 51 |
|
| AF-A0A1J5TB08-F1-model_v4 | Small basic protein | 0.5661 | 1 | 51 |
|
| AF-A0A5C5X6P1-F1-model_v4 | Small basic protein | 0.5576 | 1 | 51 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar