F481685

General Info

Members Datasets Scaffolds Average Seq Length
807 360 805 51

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1028298|Ga0265337_10282983
Length 53
Sequence MSQHTSFRQGSGSSKKKRNVLKRFERIDLMKKRGVWKEGTKRVTGLPKTRIGE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
3 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
225 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
257 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
258 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
259 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
260 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
358 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 4.83
Rhizosphere 93.18
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_9372160 2162886011 Unclassified 899
2 ARcpr5yngRDRAFT_c023372 3300000043 Bacteria 527
3 JGI25405J52794_10003108 3300003911 Bacteria 2891
4 JGI25405J52794_10007597 3300003911 Bacteria 2002
5 JGI25405J52794_10054083 3300003911 Bacteria 863
6 Ga0065714_10074612 3300005288 Bacteria 3013
7 Ga0065704_10023110 3300005289 Bacteria 1757
8 Ga0065712_10269117 3300005290 Bacteria 919
9 Ga0065712_10284503 3300005290 Unclassified 889
10 Ga0065712_10701270 3300005290 Unclassified 546
11 Ga0065715_10003886 3300005293 Bacteria 10812
12 Ga0065715_10257808 3300005293 Unclassified 1147
13 Ga0065715_10378729 3300005293 Unclassified 910
14 Ga0065715_10425479 3300005293 Bacteria 837
15 Ga0065707_10031506 3300005295 Unclassified 2328
16 Ga0070658_10283812 3300005327 Unclassified 1410
17 Ga0070658_10800003 3300005327 Unclassified 819
18 Ga0070676_10003135 3300005328 Bacteria 8545
19 Ga0070676_10411974 3300005328 Unclassified 943
20 Ga0070676_10472106 3300005328 Unclassified 886
21 Ga0070676_11623094 3300005328 Unclassified 500
22 Ga0070683_100125569 3300005329 Unclassified 2425
23 Ga0070690_100080891 3300005330 Bacteria 2125
24 Ga0070690_100348237 3300005330 Bacteria 1075
25 Ga0070690_100442906 3300005330 Bacteria 962
26 Ga0070690_100613580 3300005330 Unclassified 827
27 Ga0070670_100011533 3300005331 Bacteria 7558
28 Ga0070670_100191497 3300005331 Bacteria 1776
29 Ga0070670_101275448 3300005331 Bacteria 672
30 Ga0070670_101330871 3300005331 Unclassified 658
31 Ga0068869_100617218 3300005334 Bacteria 917
32 Ga0068869_101114292 3300005334 Bacteria 691
33 Ga0070666_10008158 3300005335 Bacteria 6489
34 Ga0068868_100257013 3300005338 Unclassified 1472
35 Ga0068868_100406257 3300005338 Bacteria 1176
36 Ga0068868_100547195 3300005338 Unclassified 1020
37 Ga0068868_100963547 3300005338 Unclassified 779
38 Ga0068868_101444014 3300005338 Bacteria 643
39 Ga0070660_100413102 3300005339 Bacteria 1117
40 Ga0070689_100077351 3300005340 Bacteria 2607
41 Ga0070689_100152658 3300005340 Bacteria 1863
42 Ga0070689_102141847 3300005340 Bacteria 512
43 Ga0070661_100920961 3300005344 Unclassified 722
44 Ga0070661_101730851 3300005344 Unclassified 530
45 Ga0070668_100055023 3300005347 Bacteria 3071
46 Ga0070668_100201146 3300005347 Bacteria 1635
47 Ga0070668_100433373 3300005347 Bacteria 1127
48 Ga0070668_100984870 3300005347 Unclassified 757
49 Ga0070668_102028512 3300005347 Unclassified 531
50 Ga0070669_100154726 3300005353 Bacteria 1777
51 Ga0070669_100336255 3300005353 Bacteria 1223
52 Ga0070669_101911746 3300005353 Unclassified 518
53 Ga0070675_100286305 3300005354 Unclassified 1449
54 Ga0070675_100368645 3300005354 Unclassified 1276
55 Ga0070675_100507115 3300005354 Unclassified 1088
56 Ga0070675_100950108 3300005354 Unclassified 788
57 Ga0070671_100005387 3300005355 Bacteria 10201
58 Ga0070671_100033099 3300005355 Bacteria 4273
59 Ga0070671_100110880 3300005355 Bacteria 2305
60 Ga0070671_100193118 3300005355 Bacteria 1726
61 Ga0070671_101091214 3300005355 Bacteria 701
62 Ga0070674_100004297 3300005356 Bacteria 8105
63 Ga0070674_100126478 3300005356 Bacteria 1899
64 Ga0070674_100238858 3300005356 Bacteria 1421
65 Ga0070674_100425593 3300005356 Unclassified 1090
66 Ga0070674_101729355 3300005356 Unclassified 566
67 Ga0070673_100017919 3300005364 Bacteria 5047
68 Ga0070673_100100918 3300005364 Unclassified 2377
69 Ga0070673_100210662 3300005364 Bacteria 1678
70 Ga0070673_100396460 3300005364 Unclassified 1233
71 Ga0070673_101195936 3300005364 Bacteria 712
72 Ga0070673_101298339 3300005364 Unclassified 683
73 Ga0070688_100009774 3300005365 Bacteria 5267
74 Ga0070688_100018097 3300005365 Unclassified 4059
75 Ga0070659_100728747 3300005366 Bacteria 859
76 Ga0070659_100899766 3300005366 Unclassified 773
77 Ga0070659_101872579 3300005366 Bacteria 538
78 Ga0070667_100142723 3300005367 Bacteria 2098
79 Ga0070667_100252921 3300005367 Unclassified 1576
80 Ga0070667_101535379 3300005367 Unclassified 626
81 Ga0070703_10066704 3300005406 Bacteria 1191
82 Ga0070703_10095729 3300005406 Bacteria 1038
83 Ga0070709_10012964 3300005434 Unclassified 4675
84 Ga0070714_100091936 3300005435 Bacteria 2659
85 Ga0070714_100586178 3300005435 Bacteria 1070
86 Ga0070714_100914622 3300005435 Unclassified 852
87 Ga0070714_101911625 3300005435 Bacteria 579
88 Ga0070713_100032759 3300005436 Unclassified 4155
89 Ga0070713_100375075 3300005436 Bacteria 1324
90 Ga0070713_101182911 3300005436 Bacteria 740
91 Ga0070710_10952955 3300005437 Unclassified 622
92 Ga0070711_100028777 3300005439 Bacteria 3659
93 Ga0070711_101323145 3300005439 Unclassified 626
94 Ga0070705_100217366 3300005440 Bacteria 1321
95 Ga0070705_101516812 3300005440 Unclassified 562
96 Ga0070700_100833482 3300005441 Unclassified 745
97 Ga0070700_101859241 3300005441 Unclassified 520
98 Ga0070694_100993383 3300005444 Unclassified 696
99 Ga0070708_100010461 3300005445 Bacteria 7522
100 Ga0070708_100035062 3300005445 Unclassified 4370
101 Ga0070708_100066029 3300005445 Unclassified 3246
102 Ga0070708_100235868 3300005445 Unclassified 1717
103 Ga0070708_100247791 3300005445 Bacteria 1673
104 Ga0070708_100748156 3300005445 Unclassified 919
105 Ga0070708_101592849 3300005445 Unclassified 608
106 Ga0070663_101425108 3300005455 Bacteria 614
107 Ga0070678_100012695 3300005456 Bacteria 5251
108 Ga0070678_100944682 3300005456 Bacteria 790
109 Ga0070678_101258059 3300005456 Bacteria 688
110 Ga0070662_100063402 3300005457 Bacteria 2703
111 Ga0070662_100197626 3300005457 Bacteria 1594
112 Ga0070662_100412734 3300005457 Bacteria 1116
113 Ga0070662_100470934 3300005457 Bacteria 1045
114 Ga0070681_11022046 3300005458 Bacteria 747
115 Ga0068867_100101958 3300005459 Bacteria 2193
116 Ga0068867_100317492 3300005459 Bacteria 1290
117 Ga0068867_100559192 3300005459 Bacteria 992
118 Ga0068867_101057224 3300005459 Bacteria 739
119 Ga0070685_10107195 3300005466 Unclassified 1715
120 Ga0070685_10128602 3300005466 Unclassified 1581
121 Ga0070706_100029693 3300005467 Bacteria 5038
122 Ga0070706_100086451 3300005467 Bacteria 2906
123 Ga0070706_100126649 3300005467 Unclassified 2382
124 Ga0070706_100140341 3300005467 Bacteria 2256
125 Ga0070706_100148954 3300005467 Bacteria 2185
126 Ga0070706_100431209 3300005467 Bacteria 1227
127 Ga0070706_100518072 3300005467 Unclassified 1109
128 Ga0070706_100830135 3300005467 Unclassified 855
129 Ga0070706_101788112 3300005467 Unclassified 559
130 Ga0070707_100001020 3300005468 Bacteria 27758
131 Ga0070707_100011737 3300005468 Bacteria 8177
132 Ga0070707_100060459 3300005468 Unclassified 3633
133 Ga0070707_100238139 3300005468 Bacteria 1772
134 Ga0070707_100335416 3300005468 Unclassified 1469
135 Ga0070707_100801358 3300005468 Unclassified 906
136 Ga0070707_101017942 3300005468 Unclassified 794
137 Ga0070707_101428125 3300005468 Unclassified 659
138 Ga0070707_101718125 3300005468 Unclassified 595
139 Ga0070698_100001128 3300005471 Bacteria 29519
140 Ga0070698_100001373 3300005471 Bacteria 27059
141 Ga0070698_101188128 3300005471 Unclassified 712
142 Ga0070698_102026818 3300005471 Unclassified 529
143 Ga0070699_100380348 3300005518 Unclassified 1275
144 Ga0070699_100925469 3300005518 Bacteria 799
145 Ga0070684_100045928 3300005535 Bacteria 3784
146 Ga0070697_100001619 3300005536 Bacteria 17147
147 Ga0070697_100275791 3300005536 Bacteria 1442
148 Ga0070697_100595057 3300005536 Bacteria 972
149 Ga0070697_100748440 3300005536 Bacteria 864
150 Ga0070697_101270264 3300005536 Unclassified 657
151 Ga0070697_101482938 3300005536 Unclassified 606
152 Ga0070697_101563586 3300005536 Unclassified 590
153 Ga0070672_100043527 3300005543 Bacteria 3463
154 Ga0070672_100161464 3300005543 Bacteria 1859
155 Ga0070672_100374474 3300005543 Unclassified 1217
156 Ga0070672_100396256 3300005543 Bacteria 1183
157 Ga0070672_100689213 3300005543 Unclassified 894
158 Ga0070686_100515197 3300005544 Unclassified 930
159 Ga0070686_100655317 3300005544 Unclassified 833
160 Ga0070695_100328790 3300005545 Bacteria 1139
161 Ga0070696_100369859 3300005546 Bacteria 1115
162 Ga0070693_100830988 3300005547 Unclassified 687
163 Ga0070665_100240953 3300005548 Unclassified 1809
164 Ga0070665_100251254 3300005548 Bacteria 1769
165 Ga0070665_100346721 3300005548 Bacteria 1490
166 Ga0070665_101218777 3300005548 Unclassified 763
167 Ga0070665_102230876 3300005548 Bacteria 551
168 Ga0068855_100007498 3300005563 Bacteria 13208
169 Ga0070664_100979472 3300005564 Unclassified 794
170 Ga0070664_101647972 3300005564 Unclassified 608
171 Ga0068857_100462713 3300005577 Bacteria 1187
172 Ga0068857_102179892 3300005577 Unclassified 544
173 Ga0068854_101054778 3300005578 Unclassified 722
174 Ga0068852_100077481 3300005616 Bacteria 2939
175 Ga0068852_101946378 3300005616 Unclassified 610
176 Ga0068852_102126448 3300005616 Unclassified 583
177 Ga0068859_100526303 3300005617 Unclassified 1277
178 Ga0068859_101223863 3300005617 Unclassified 827
179 Ga0068864_100379287 3300005618 Bacteria 1339
180 Ga0068866_10221888 3300005718 Unclassified 1141
181 Ga0068866_11252912 3300005718 Unclassified 537
182 Ga0068861_101745458 3300005719 Unclassified 616
183 Ga0068861_101854483 3300005719 Unclassified 599
184 Ga0068863_100425419 3300005841 Unclassified 1301
185 Ga0068863_100952651 3300005841 Bacteria 860
186 Ga0068863_101144119 3300005841 Bacteria 783
187 Ga0068863_101531780 3300005841 Unclassified 675
188 Ga0068863_101595509 3300005841 Unclassified 662
189 Ga0068858_100213068 3300005842 Bacteria 1828
190 Ga0068858_100873562 3300005842 Unclassified 879
191 Ga0068858_101260012 3300005842 Bacteria 727
192 Ga0068858_101974237 3300005842 Unclassified 577
193 Ga0068860_100004333 3300005843 Bacteria 14506
194 Ga0068860_101528853 3300005843 Bacteria 689
195 Ga0068860_102420409 3300005843 Unclassified 545
196 Ga0068862_100261199 3300005844 Bacteria 1581
197 Ga0068862_100757840 3300005844 Unclassified 945
198 Ga0068862_101038120 3300005844 Unclassified 812
199 Ga0068862_101810208 3300005844 Unclassified 620
200 Ga0081455_10001571 3300005937 Bacteria 28055
201 Ga0081455_10001819 3300005937 Bacteria 25669
202 Ga0081455_10011555 3300005937 Bacteria 8862
203 Ga0081455_10012797 3300005937 Bacteria 8339
204 Ga0081455_10018200 3300005937 Bacteria 6706
205 Ga0081455_10038672 3300005937 Unclassified 4223
206 Ga0081455_10077432 3300005937 Unclassified 2736
207 Ga0081455_10084449 3300005937 Unclassified 2591
208 Ga0081455_10149134 3300005937 Unclassified 1805
209 Ga0081538_10043902 3300005981 Bacteria 2798
210 Ga0081540_1000010 3300005983 Bacteria 193206
211 Ga0081539_10008110 3300005985 Bacteria 9279
212 Ga0081539_10391942 3300005985 Unclassified 578
213 Ga0070717_10000015 3300006028 Bacteria 208620
214 Ga0070717_10000276 3300006028 Bacteria 35106
215 Ga0070717_10260706 3300006028 Bacteria 1534
216 Ga0070717_10441606 3300006028 Bacteria 1172
217 Ga0075363_100906710 3300006048 Unclassified 540
218 Ga0070715_10061663 3300006163 Bacteria 1647
219 Ga0070715_10659377 3300006163 Unclassified 620
220 Ga0070712_100330997 3300006175 Bacteria 1241
221 Ga0070712_100374543 3300006175 Bacteria 1170
222 Ga0070712_100823195 3300006175 Unclassified 797
223 Ga0070712_101356976 3300006175 Unclassified 620
224 Ga0070712_101634951 3300006175 Bacteria 564
225 Ga0075369_10285653 3300006186 Unclassified 769
226 Ga0097621_100184167 3300006237 Unclassified 1806
227 Ga0097621_101608258 3300006237 Unclassified 618
228 Ga0068871_100009471 3300006358 Bacteria 7061
229 Ga0068871_100919720 3300006358 Unclassified 811
230 Ga0075428_101889793 3300006844 Unclassified 620
231 Ga0075430_100981472 3300006846 Unclassified 696
232 Ga0075430_101035661 3300006846 Unclassified 676
233 Ga0075433_11523479 3300006852 Unclassified 577
234 Ga0075434_100308097 3300006871 Unclassified 1604
235 Ga0075434_100376968 3300006871 Bacteria 1439
236 Ga0075434_101711928 3300006871 Unclassified 636
237 Ga0075429_100229178 3300006880 Unclassified 1627
238 Ga0075429_100301159 3300006880 Bacteria 1404
239 Ga0068865_101251336 3300006881 Unclassified 658
240 Ga0075436_100077149 3300006914 Unclassified 2308
241 Ga0075436_100145012 3300006914 Unclassified 1669
242 Ga0075436_100241475 3300006914 Bacteria 1285
243 Ga0097620_100526311 3300006931 Unclassified 1277
244 Ga0097620_101223899 3300006931 Unclassified 827
245 Ga0075435_101026111 3300007076 Bacteria 720
246 Ga0099794_10082571 3300007265 Unclassified 1586
247 Ga0099794_10106214 3300007265 Unclassified 1404
248 Ga0099795_10187027 3300007788 Bacteria 868
249 Ga0105250_10397652 3300009092 Unclassified 610
250 Ga0105240_10403312 3300009093 Bacteria 1539
251 Ga0111539_10108839 3300009094 Unclassified 3252
252 Ga0111539_10331565 3300009094 Unclassified 1771
253 Ga0111539_10573865 3300009094 Unclassified 1314
254 Ga0111539_10594067 3300009094 Unclassified 1289
255 Ga0111539_11405934 3300009094 Bacteria 809
256 Ga0111539_12017888 3300009094 Bacteria 669
257 Ga0111539_12446991 3300009094 Bacteria 606
258 Ga0105245_10044186 3300009098 Bacteria 3976
259 Ga0105245_10102993 3300009098 Bacteria 2644
260 Ga0105245_10414801 3300009098 Unclassified 1348
261 Ga0105245_10723361 3300009098 Unclassified 1030
262 Ga0105245_11129140 3300009098 Unclassified 830
263 Ga0105245_11661373 3300009098 Unclassified 691
264 Ga0105247_10396792 3300009101 Unclassified 982
265 Ga0105247_10403943 3300009101 Unclassified 974
266 Ga0114129_10101962 3300009147 Bacteria 3970
267 Ga0114129_10486043 3300009147 Unclassified 1615
268 Ga0114129_10619545 3300009147 Unclassified 1400
269 Ga0114129_10905959 3300009147 Unclassified 1117
270 Ga0114129_12371582 3300009147 Unclassified 636
271 Ga0105243_10313555 3300009148 Unclassified 1426
272 Ga0105241_10068342 3300009174 Bacteria 2753
273 Ga0105242_10018695 3300009176 Bacteria 5422
274 Ga0105242_12126986 3300009176 Unclassified 605
275 Ga0105242_12406642 3300009176 Bacteria 574
276 Ga0105248_10802106 3300009177 Bacteria 1063
277 Ga0105248_11778740 3300009177 Unclassified 699
278 Ga0105237_10028067 3300009545 Bacteria 5734
279 Ga0105237_10397394 3300009545 Bacteria 1383
280 Ga0105237_10779285 3300009545 Bacteria 963
281 Ga0105237_11387458 3300009545 Unclassified 709
282 Ga0105237_12177859 3300009545 Bacteria 564
283 Ga0105238_11002522 3300009551 Unclassified 856
284 Ga0105238_11409837 3300009551 Unclassified 724
285 Ga0105249_11178870 3300009553 Unclassified 837
286 Ga0105249_13314999 3300009553 Bacteria 518
287 Ga0105239_10322587 3300010375 Bacteria 1742
288 Ga0105239_10394873 3300010375 Bacteria 1565
289 Ga0105239_10449527 3300010375 Bacteria 1462
290 Ga0105239_12147934 3300010375 Unclassified 649
291 Ga0105246_11132690 3300011119 Unclassified 716
292 Ga0105246_11346602 3300011119 Unclassified 664
293 Ga0105246_11782802 3300011119 Unclassified 587
294 Ga0157373_10895790 3300013100 Unclassified 658
295 Ga0157371_10396955 3300013102 Bacteria 1009
296 Ga0157371_10495292 3300013102 Unclassified 902
297 Ga0157371_11191656 3300013102 Unclassified 587
298 Ga0157370_10303807 3300013104 Unclassified 1473
299 Ga0157369_10091270 3300013105 Bacteria 3252
300 Ga0157374_10003871 3300013296 Bacteria 12563
301 Ga0157374_10246805 3300013296 Unclassified 1756
302 Ga0157374_10427792 3300013296 Bacteria 1323
303 Ga0157374_11229749 3300013296 Unclassified 770
304 Ga0157374_11369943 3300013296 Bacteria 730
305 Ga0157374_11538805 3300013296 Unclassified 689
306 Ga0157374_12984276 3300013296 Unclassified 500
307 Ga0157378_10030296 3300013297 Unclassified 4782
308 Ga0157378_10031400 3300013297 Bacteria 4692
309 Ga0157378_10122166 3300013297 Unclassified 2402
310 Ga0157378_10259446 3300013297 Unclassified 1667
311 Ga0157378_10337499 3300013297 Unclassified 1468
312 Ga0157378_10349575 3300013297 Unclassified 1444
313 Ga0157378_10407875 3300013297 Bacteria 1340
314 Ga0157378_10752684 3300013297 Unclassified 997
315 Ga0157378_11842096 3300013297 Unclassified 653
316 Ga0157378_12340274 3300013297 Unclassified 586
317 Ga0163162_10099170 3300013306 Bacteria 3004
318 Ga0163162_10163465 3300013306 Bacteria 2349
319 Ga0163162_10201932 3300013306 Unclassified 2117
320 Ga0163162_10528129 3300013306 Unclassified 1309
321 Ga0163162_12363860 3300013306 Bacteria 611
322 Ga0163162_13423163 3300013306 Bacteria 506
323 Ga0163162_13463579 3300013306 Bacteria 502
324 Ga0157372_10010274 3300013307 Bacteria 9943
325 Ga0157372_10346486 3300013307 Bacteria 1731
326 Ga0157375_10013261 3300013308 Bacteria 7329
327 Ga0157375_10057092 3300013308 Bacteria 3858
328 Ga0157375_10235093 3300013308 Bacteria 1992
329 Ga0157375_11016621 3300013308 Bacteria 968
330 Ga0157375_11486602 3300013308 Unclassified 799
331 Ga0157375_11683847 3300013308 Unclassified 751
332 Ga0157375_13597607 3300013308 Unclassified 516
333 Ga0163163_10376010 3300014325 Bacteria 1478
334 Ga0163163_12459240 3300014325 Unclassified 579
335 Ga0163163_13089399 3300014325 Unclassified 519
336 Ga0157380_12049127 3300014326 Bacteria 635
337 Ga0157380_12973571 3300014326 Bacteria 540
338 Ga0182008_10008039 3300014497 Bacteria 5781
339 Ga0157377_10342916 3300014745 Unclassified 1000
340 Ga0157379_10441535 3300014968 Bacteria 1200
341 Ga0157379_11329216 3300014968 Bacteria 695
342 Ga0157376_10011998 3300014969 Bacteria 6411
343 Ga0157376_10030235 3300014969 Bacteria 4323
344 Ga0157376_10356952 3300014969 Bacteria 1401
345 Ga0157376_10442665 3300014969 Bacteria 1266
346 Ga0157376_11656638 3300014969 Unclassified 674
347 Ga0157376_12056144 3300014969 Bacteria 609
348 Ga0157376_12547927 3300014969 Unclassified 551
349 Ga0182006_1091965 3300015261 Unclassified 1090
350 Ga0182006_1113115 3300015261 Unclassified 951
351 Ga0182006_1166536 3300015261 Bacteria 740
352 Ga0182005_1028573 3300015265 Unclassified 1521
353 Ga0163161_10358713 3300017792 Unclassified 1160
354 Ga0163161_10378487 3300017792 Bacteria 1131
355 Ga0163161_11157531 3300017792 Unclassified 667
356 Ga0207666_1000363 3300025271 Bacteria 6134
357 Ga0207673_1034728 3300025290 Unclassified 702
358 Ga0207697_10002302 3300025315 Bacteria 9968
359 Ga0207697_10004870 3300025315 Bacteria 6338
360 Ga0207697_10208017 3300025315 Bacteria 862
361 Ga0207642_10889078 3300025899 Unclassified 570
362 Ga0207688_10282652 3300025901 Bacteria 1011
363 Ga0207680_10129104 3300025903 Bacteria 1664
364 Ga0207685_10255073 3300025905 Bacteria 850
365 Ga0207699_10123140 3300025906 Unclassified 1680
366 Ga0207699_11101522 3300025906 Bacteria 588
367 Ga0207645_10005184 3300025907 Bacteria 9513
368 Ga0207645_10233453 3300025907 Bacteria 1214
369 Ga0207645_10280221 3300025907 Unclassified 1107
370 Ga0207645_10706981 3300025907 Unclassified 685
371 Ga0207645_11178765 3300025907 Bacteria 515
372 Ga0207705_10046002 3300025909 Unclassified 3136
373 Ga0207705_10664831 3300025909 Bacteria 810
374 Ga0207705_10723104 3300025909 Unclassified 774
375 Ga0207684_10000824 3300025910 Bacteria 35708
376 Ga0207684_10027013 3300025910 Bacteria 4895
377 Ga0207684_10127432 3300025910 Bacteria 2185
378 Ga0207684_10695276 3300025910 Unclassified 864
379 Ga0207684_10959550 3300025910 Unclassified 717
380 Ga0207707_11003678 3300025912 Bacteria 685
381 Ga0207695_10000186 3300025913 Bacteria 179847
382 Ga0207695_10376029 3300025913 Bacteria 1306
383 Ga0207671_10026068 3300025914 Bacteria 4385
384 Ga0207671_10252804 3300025914 Bacteria 1385
385 Ga0207693_10312996 3300025915 Bacteria 1229
386 Ga0207693_10691125 3300025915 Unclassified 791
387 Ga0207663_10024925 3300025916 Bacteria 3450
388 Ga0207663_10875880 3300025916 Bacteria 717
389 Ga0207660_10457006 3300025917 Unclassified 1033
390 Ga0207657_10830599 3300025919 Unclassified 713
391 Ga0207657_11122431 3300025919 Unclassified 600
392 Ga0207657_11285881 3300025919 Unclassified 553
393 Ga0207649_10561387 3300025920 Unclassified 874
394 Ga0207649_11333746 3300025920 Unclassified 568
395 Ga0207646_10003687 3300025922 Bacteria 17104
396 Ga0207646_10022818 3300025922 Bacteria 5755
397 Ga0207646_10044232 3300025922 Bacteria 3997
398 Ga0207646_10068200 3300025922 Unclassified 3177
399 Ga0207646_10133027 3300025922 Unclassified 2239
400 Ga0207646_10313976 3300025922 Bacteria 1416
401 Ga0207646_10389833 3300025922 Unclassified 1258
402 Ga0207646_10609440 3300025922 Bacteria 980
403 Ga0207646_11064566 3300025922 Bacteria 713
404 Ga0207681_10066283 3300025923 Bacteria 2499
405 Ga0207650_10180998 3300025925 Unclassified 1679
406 Ga0207659_10066261 3300025926 Bacteria 2620
407 Ga0207659_10161551 3300025926 Bacteria 1759
408 Ga0207687_10025395 3300025927 Bacteria 3964
409 Ga0207687_10371640 3300025927 Unclassified 1169
410 Ga0207700_10320193 3300025928 Bacteria 1344
411 Ga0207664_10376228 3300025929 Unclassified 1260
412 Ga0207664_10546757 3300025929 Bacteria 1039
413 Ga0207664_11765575 3300025929 Unclassified 541
414 Ga0207664_11961471 3300025929 Bacteria 508
415 Ga0207644_10091491 3300025931 Bacteria 2268
416 Ga0207644_10325629 3300025931 Bacteria 1243
417 Ga0207644_10974736 3300025931 Bacteria 711
418 Ga0207706_10314191 3300025933 Bacteria 1364
419 Ga0207706_10511890 3300025933 Bacteria 1035
420 Ga0207686_10043024 3300025934 Bacteria 2765
421 Ga0207670_10033442 3300025936 Unclassified 3313
422 Ga0207670_10107142 3300025936 Bacteria 2006
423 Ga0207670_10193315 3300025936 Bacteria 1541
424 Ga0207670_11747943 3300025936 Unclassified 529
425 Ga0207669_10014102 3300025937 Bacteria 3997
426 Ga0207669_10745108 3300025937 Unclassified 809
427 Ga0207704_10421412 3300025938 Unclassified 1058
428 Ga0207704_10828498 3300025938 Unclassified 774
429 Ga0207704_11062896 3300025938 Unclassified 687
430 Ga0207704_11066830 3300025938 Unclassified 685
431 Ga0207704_11135674 3300025938 Unclassified 665
432 Ga0207665_10810618 3300025939 Bacteria 740
433 Ga0207691_10046047 3300025940 Bacteria 4010
434 Ga0207691_10323455 3300025940 Bacteria 1322
435 Ga0207691_11403501 3300025940 Unclassified 574
436 Ga0207689_10233454 3300025942 Unclassified 1520
437 Ga0207661_10007121 3300025944 Bacteria 7949
438 Ga0207661_10775437 3300025944 Bacteria 883
439 Ga0207679_10736017 3300025945 Unclassified 896
440 Ga0207679_10964547 3300025945 Bacteria 781
441 Ga0207679_11454962 3300025945 Bacteria 628
442 Ga0207679_11505817 3300025945 Unclassified 617
443 Ga0207667_10054428 3300025949 Bacteria 4209
444 Ga0207651_10027485 3300025960 Bacteria 3573
445 Ga0207651_10036102 3300025960 Bacteria 3223
446 Ga0207651_10557619 3300025960 Unclassified 997
447 Ga0207651_11900248 3300025960 Unclassified 535
448 Ga0207712_10023403 3300025961 Bacteria 4076
449 Ga0207712_10965369 3300025961 Unclassified 755
450 Ga0207668_10084141 3300025972 Bacteria 2317
451 Ga0207668_10100127 3300025972 Bacteria 2151
452 Ga0207668_10354506 3300025972 Unclassified 1228
453 Ga0207668_11108551 3300025972 Unclassified 710
454 Ga0207640_11445143 3300025981 Unclassified 617
455 Ga0207658_10044405 3300025986 Bacteria 3236
456 Ga0207658_10222823 3300025986 Bacteria 1588
457 Ga0207677_10731621 3300026023 Unclassified 880
458 Ga0207677_10894698 3300026023 Unclassified 800
459 Ga0207677_11097204 3300026023 Unclassified 725
460 Ga0207677_11467240 3300026023 Unclassified 629
461 Ga0207703_10434283 3300026035 Bacteria 1224
462 Ga0207703_11032523 3300026035 Unclassified 789
463 Ga0207639_11754384 3300026041 Unclassified 581
464 Ga0207639_11795641 3300026041 Unclassified 574
465 Ga0207678_10256661 3300026067 Bacteria 1498
466 Ga0207708_11281432 3300026075 Unclassified 642
467 Ga0207708_11632039 3300026075 Unclassified 566
468 Ga0207702_10475228 3300026078 Bacteria 1216
469 Ga0207641_10216513 3300026088 Bacteria 1774
470 Ga0207641_10656341 3300026088 Bacteria 1031
471 Ga0207641_11489943 3300026088 Unclassified 678
472 Ga0207648_10169502 3300026089 Bacteria 1929
473 Ga0207676_10355600 3300026095 Bacteria 1356
474 Ga0207676_10755641 3300026095 Unclassified 946
475 Ga0207674_10458397 3300026116 Bacteria 1232
476 Ga0207674_10812554 3300026116 Unclassified 902
477 Ga0207675_101007002 3300026118 Unclassified 851
478 Ga0207683_10016271 3300026121 Bacteria 6329
479 Ga0207683_10248628 3300026121 Bacteria 1623
480 Ga0207683_10407482 3300026121 Bacteria 1251
481 Ga0207698_10131780 3300026142 Bacteria 2137
482 Ga0207698_10299967 3300026142 Unclassified 1495
483 Ga0209981_1062426 3300027378 Bacteria 571
484 Ga0209968_1057160 3300027526 Unclassified 684
485 Ga0209982_1015547 3300027552 Unclassified 1155
486 Ga0209971_1123283 3300027682 Unclassified 637
487 Ga0265355_1012814 3300028036 Bacteria 697
488 Ga0268266_10006370 3300028379 Bacteria 10813
489 Ga0268266_10135309 3300028379 Unclassified 2207
490 Ga0268266_10559615 3300028379 Unclassified 1096
491 Ga0268266_10626966 3300028379 Bacteria 1034
492 Ga0268266_12114939 3300028379 Unclassified 535
493 Ga0268265_10461555 3300028380 Bacteria 1189
494 Ga0268265_12595783 3300028380 Unclassified 512
495 Ga0268264_10012939 3300028381 Bacteria 6861
496 Ga0268264_10424735 3300028381 Bacteria 1283
497 Ga0268264_12003883 3300028381 Bacteria 588
498 Ga0268264_12028106 3300028381 Unclassified 584
499 Ga0265337_1008669 3300028556 Bacteria 3677
500 Ga0265337_1028298 3300028556 Bacteria 1683
501 Ga0265337_1131933 3300028556 Bacteria 677
502 Ga0265319_1002037 3300028563 Bacteria 11374
503 Ga0265319_1031375 3300028563 Bacteria 1850
504 Ga0265319_1064233 3300028563 Unclassified 1185
505 Ga0265319_1096467 3300028563 Bacteria 930
506 Ga0265319_1110446 3300028563 Unclassified 860
507 Ga0265334_10126267 3300028573 Unclassified 912
508 Ga0265334_10312925 3300028573 Unclassified 537
509 Ga0265318_10001738 3300028577 Bacteria 12459
510 Ga0265318_10012130 3300028577 Bacteria 3679
511 Ga0265318_10019765 3300028577 Bacteria 2728
512 Ga0265318_10044898 3300028577 Bacteria 1671
513 Ga0265318_10197805 3300028577 Bacteria 735
514 Ga0265318_10232047 3300028577 Unclassified 674
515 Ga0265323_10000099 3300028653 Bacteria 49631
516 Ga0265322_10001283 3300028654 Bacteria 8438
517 Ga0265322_10006209 3300028654 Bacteria 3516
518 Ga0265336_10020125 3300028666 Bacteria 2145
519 Ga0265336_10275301 3300028666 Unclassified 500
520 Ga0307515_10931129 3300028794 Unclassified 503
521 Ga0265338_10002794 3300028800 Bacteria 25522
522 Ga0265338_10005644 3300028800 Bacteria 16244
523 Ga0265338_10027683 3300028800 Bacteria 5680
524 Ga0265338_10677112 3300028800 Unclassified 713
525 Ga0265324_10001420 3300029957 Bacteria 13761
526 Ga0265324_10243582 3300029957 Bacteria 610
527 Ga0265330_10039095 3300031235 Bacteria 2109
528 Ga0265332_10357844 3300031238 Bacteria 602
529 Ga0265320_10001237 3300031240 Bacteria 18762
530 Ga0265320_10004381 3300031240 Bacteria 9265
531 Ga0265320_10017280 3300031240 Bacteria 4011
532 Ga0265320_10068581 3300031240 Unclassified 1675
533 Ga0265320_10150533 3300031240 Bacteria 1051
534 Ga0265320_10236210 3300031240 Unclassified 812
535 Ga0265320_10297203 3300031240 Unclassified 714
536 Ga0265329_10254418 3300031242 Unclassified 586
537 Ga0265339_10258411 3300031249 Bacteria 841
538 Ga0265331_10093400 3300031250 Bacteria 1389
539 Ga0265327_10025399 3300031251 Bacteria 3454
540 Ga0265327_10036101 3300031251 Bacteria 2721
541 Ga0265316_10003494 3300031344 Bacteria 15857
542 Ga0265316_10065206 3300031344 Bacteria 2820
543 Ga0265316_10145614 3300031344 Bacteria 1777
544 Ga0307513_10134394 3300031456 Bacteria 2411
545 Ga0307509_10473631 3300031507 Bacteria 942
546 Ga0307408_100000033 3300031548 Bacteria 212574
547 Ga0265313_10240782 3300031595 Bacteria 740
548 Ga0265314_10021042 3300031711 Bacteria 5026
549 Ga0265314_10022950 3300031711 Bacteria 4769
550 Ga0265314_10027231 3300031711 Bacteria 4283
551 Ga0265314_10317472 3300031711 Bacteria 868
552 Ga0265314_10355999 3300031711 Bacteria 804
553 Ga0265342_10015002 3300031712 Bacteria 5116
554 Ga0265342_10581559 3300031712 Unclassified 566
555 Ga0316576_10117945 3300031727 Bacteria 1992
556 Ga0316576_10192869 3300031727 Bacteria 1536
557 Ga0307413_12131499 3300031824 Bacteria 507
558 Ga0307410_10000008 3300031852 Bacteria 93917
559 Ga0307407_10059293 3300031903 Bacteria 2228
560 Ga0307412_10026993 3300031911 Bacteria 3575
561 Ga0307409_100000430 3300031995 Bacteria 17768
562 Ga0307416_100000278 3300032002 Bacteria 27054
563 Ga0307414_11468770 3300032004 Bacteria 634
564 Ga0307411_10795893 3300032005 Bacteria 832
565 Ga0373959_0056187 3300034820 Unclassified 861
566 Ga0373938_0188058 3300034957 Bacteria 567
567 Ga0373926_0159469 3300035083 Unclassified 861
568 Ga0373928_0251095 3300035084 Unclassified 527
569 Ga0373934_0058726 3300035086 Unclassified 1531
570 Ga0373934_0339259 3300035086 Bacteria 625
571 Ga0373923_0311057 3300035111 Bacteria 747
572 Ga0373932_0128680 3300035112 Unclassified 851
573 Ga0373945_0351663 3300035116 Bacteria 639
574 Ga0373945_0510295 3300035116 Unclassified 536
575 Ga0373956_0252695 3300035119 Bacteria 838
576 Ga0373957_0399272 3300035120 Bacteria 591
577 Ga0373943_0109154 3300035170 Bacteria 1457
578 Ga0373943_0399161 3300035170 Bacteria 794
579 Ga0373955_0312226 3300035172 Bacteria 949
580 Ga0373955_0692967 3300035172 Bacteria 625
581 Ga0316574_0076909 3300035398 Bacteria 2115
582 Ga0373924_0201882 3300035410 Bacteria 877
583 Ga0373931_0112406 3300035691 Bacteria 1547
584 Ga0373931_0284299 3300035691 Bacteria 1017
585 Ga0373931_0751138 3300035691 Unclassified 647
586 Ga0373935_0035970 3300035692 Bacteria 3093
587 Ga0373935_0650139 3300035692 Bacteria 773
588 Ga0373935_0853600 3300035692 Unclassified 673
589 Ga0373935_0999866 3300035692 Bacteria 621
590 Ga0373933_0459035 3300035724 Bacteria 833
591 Ga0373933_0542845 3300035724 Bacteria 763
592 Ga0373933_0781449 3300035724 Unclassified 628
593 Ga0373947_0369122 3300035725 Unclassified 965
594 Ga0373937_0256305 3300036401 Bacteria 1649
595 Ga0373937_0401574 3300036401 Bacteria 1300
596 Ga0373937_0519735 3300036401 Bacteria 1131
597 Ga0373937_0907185 3300036401 Bacteria 830
598 Ga0373937_0975271 3300036401 Bacteria 796
599 Ga0316584_0730727 3300036712 Unclassified 677
600 Ga0373925_0180425 3300037068 Unclassified 1671
601 Ga0373925_0819674 3300037068 Unclassified 767
602 Ga0373925_1304984 3300037068 Bacteria 595
603 Ga0373925_1566869 3300037068 Bacteria 539
604 Ga0373925_1744360 3300037068 Unclassified 508
605 Ga0395900_1715591 3300037418 Bacteria 539
606 Ga0395898_0504903 3300037466 Bacteria 1150
607 Ga0395905_0283797 3300037471 Unclassified 1542
608 Ga0395901_0035188 3300038443 Bacteria 5175
609 Ga0436363_0679613 3300039450 Unclassified 734
610 Ga0451787_435827 3300041441 Bacteria 968
611 Ga0451787_554291 3300041441 Unclassified 646
612 Ga0451795_0822456 3300041456 Unclassified 699
613 Ga0451800_1293054 3300041459 Bacteria 525
614 Ga0451800_1607111 3300041459 Unclassified 1043
615 Ga0451802_0336535 3300041460 Unclassified 840
616 Ga0451804_1183500 3300041463 Unclassified 679
617 Ga0451807_2567572 3300041486 Unclassified 998
618 Ga0451855_0439774 3300041511 Bacteria 1072
619 Ga0451855_0788558 3300041511 Bacteria 642
620 Ga0451855_1540872 3300041511 Unclassified 517
621 Ga0451853_1381405 3300041512 Unclassified 567
622 Ga0439431_0025188 3300041997 Bacteria 1452
623 Ga0439441_094175 3300042001 Bacteria 665
624 Ga0439455_0103449 3300042012 Bacteria 788
625 Ga0451577_0000024 3300042876 Bacteria 411758
626 Ga0451577_0003560 3300042876 Bacteria 17186
627 Ga0451577_0052256 3300042876 Unclassified 3649
628 Ga0451577_0478824 3300042876 Bacteria 1130
629 Ga0451577_0579657 3300042876 Bacteria 1018
630 Ga0451577_1228123 3300042876 Unclassified 668
631 Ga0453683_0001980 3300044673 Bacteria 16587
632 Ga0466966_0587687 3300044684 Unclassified 670
633 Ga0453684_0000027 3300044712 Bacteria 778857
634 Ga0453684_0019118 3300044712 Bacteria 10454
635 Ga0453684_0203186 3300044712 Bacteria 2308
636 Ga0453684_0239001 3300044712 Bacteria 2092
637 Ga0453684_0305967 3300044712 Bacteria 1805
638 Ga0453684_0384225 3300044712 Bacteria 1576
639 Ga0453684_1116526 3300044712 Bacteria 832
640 Ga0451576_0001983 3300045051 Bacteria 32524
641 Ga0451576_0134263 3300045051 Bacteria 2580
642 Ga0451576_0173995 3300045051 Bacteria 2247
643 Ga0451576_0962737 3300045051 Unclassified 895
644 Ga0451576_1380589 3300045051 Bacteria 733
645 Ga0451576_1452948 3300045051 Unclassified 713
646 Ga0495592_0013392 3300046454 Bacteria 6241
647 Ga0495592_0125465 3300046454 Bacteria 1802
648 Ga0495651_0231279 3300046462 Bacteria 1273
649 Ga0495651_1008102 3300046462 Bacteria 505
650 Ga0495653_0233034 3300046463 Bacteria 1231
651 Ga0495580_1045287 3300046472 Unclassified 519
652 Ga0495605_0348170 3300046474 Unclassified 622
653 Ga0495662_0277705 3300046476 Bacteria 825
654 Ga0495664_0172395 3300046477 Bacteria 1312
655 Ga0495585_0416442 3300046492 Unclassified 646
656 Ga0495608_0070882 3300046511 Bacteria 2275
657 Ga0495618_0268202 3300046514 Bacteria 1067
658 Ga0495628_0013312 3300046516 Bacteria 6920
659 Ga0495630_0577946 3300046517 Bacteria 861
660 Ga0495666_0455222 3300046526 Bacteria 573
661 Ga0495652_0157967 3300046529 Bacteria 1763
662 Ga0495640_0606945 3300046533 Bacteria 660
663 Ga0495586_0321968 3300046535 Bacteria 887
664 Ga0495586_0526122 3300046535 Bacteria 683
665 Ga0495587_0019137 3300046536 Bacteria 4241
666 Ga0495621_0155101 3300046539 Bacteria 903
667 Ga0495621_0304394 3300046539 Unclassified 661
668 Ga0495645_0054596 3300046543 Unclassified 2902
669 Ga0495667_0254506 3300046559 Bacteria 1117
670 Ga0495667_0914196 3300046559 Unclassified 538
671 Ga0495656_0686161 3300046615 Unclassified 551
672 Ga0495634_0667658 3300046642 Unclassified 599
673 Ga0495634_0713298 3300046642 Bacteria 576
674 Ga0495635_0841456 3300046663 Unclassified 590
675 Ga0495657_0192992 3300046675 Unclassified 1244
676 Ga0495599_0051576 3300046678 Bacteria 2577
677 Ga0495599_0124141 3300046678 Bacteria 1605
678 Ga0495623_0184038 3300046679 Bacteria 1211
679 Ga0495623_0319035 3300046679 Unclassified 854
680 Ga0495646_0058358 3300046680 Bacteria 2307
681 Ga0495646_0256783 3300046680 Bacteria 935
682 Ga0495647_0425958 3300046681 Unclassified 612
683 Ga0495658_1120571 3300046683 Unclassified 501
684 Ga0495669_0370664 3300046684 Bacteria 693
685 Ga0495613_0226083 3300046689 Unclassified 1312
686 Ga0495589_0501353 3300046794 Bacteria 554
687 Ga0495604_0145945 3300047317 Bacteria 1686
688 Ga0495636_0339101 3300047318 Unclassified 708
689 Ga0495674_0625847 3300047319 Bacteria 850
690 Ga0495674_1435505 3300047319 Unclassified 513
691 Ga0495680_1044156 3300047322 Bacteria 519
692 Ga0495675_0117539 3300047444 Bacteria 1657
693 Ga0495675_0150774 3300047444 Bacteria 1437
694 Ga0495684_0134647 3300047471 Bacteria 1855
695 Ga0495684_0534245 3300047471 Unclassified 801
696 Ga0495684_1071936 3300047471 Bacteria 507
697 Ga0495602_0039071 3300048088 Bacteria 4376
698 Ga0496100_0284215 3300048903 Bacteria 1234
699 Ga0496100_0930691 3300048903 Unclassified 683
700 Ga0496101_0087055 3300048904 Bacteria 2318
701 Ga0496102_0087642 3300048905 Bacteria 2876
702 Ga0496103_0038392 3300048906 Bacteria 2938
703 Ga0496104_0673460 3300048907 Unclassified 943
704 Ga0496105_0094436 3300048908 Bacteria 2470
705 Ga0496105_1218231 3300048908 Unclassified 553
706 Ga0496106_0714584 3300048909 Unclassified 798
707 Ga0496107_1020514 3300048910 Bacteria 600
708 Ga0496108_0004565 3300048911 Bacteria 11156
709 Ga0496108_0396272 3300048911 Bacteria 1206
710 Ga0496108_0565665 3300048911 Bacteria 991
711 Ga0496109_0001915 3300048912 Bacteria 17286
712 Ga0496109_0322563 3300048912 Bacteria 1458
713 Ga0496109_1157768 3300048912 Bacteria 710
714 Ga0496109_1572912 3300048912 Unclassified 592
715 Ga0496110_0152975 3300048913 Bacteria 2089
716 Ga0496110_1342367 3300048913 Unclassified 624
717 Ga0496111_0567086 3300048914 Bacteria 833
718 Ga0496112_0025463 3300048915 Bacteria 5681
719 Ga0496112_0434274 3300048915 Unclassified 1251
720 Ga0496112_0477784 3300048915 Unclassified 1183
721 Ga0496112_1129781 3300048915 Unclassified 701
722 Ga0496112_1171874 3300048915 Unclassified 685
723 Ga0496113_0028316 3300048916 Bacteria 4028
724 Ga0496113_0805258 3300048916 Unclassified 746
725 Ga0496114_0046150 3300048917 Bacteria 3620
726 Ga0496114_0879287 3300048917 Unclassified 777
727 Ga0496115_0116008 3300048918 Bacteria 2202
728 Ga0496121_0520434 3300048924 Bacteria 751
729 Ga0501031_0066289 3300049568 Bacteria 2352
730 Ga0501032_0000745 3300049569 Bacteria 26459
731 Ga0501032_0168601 3300049569 Unclassified 1436
732 Ga0501033_0005513 3300049570 Bacteria 10011
733 Ga0501034_0103914 3300049571 Bacteria 2834
734 Ga0501036_0016442 3300049572 Bacteria 6178
735 Ga0501037_0039911 3300049573 Bacteria 3454
736 Ga0501037_0063862 3300049573 Bacteria 2684
737 Ga0501037_0755580 3300049573 Bacteria 644
738 Ga0501038_0003275 3300049574 Bacteria 15091
739 Ga0501039_0015427 3300049575 Bacteria 5848
740 Ga0501041_0982667 3300049577 Bacteria 543
741 Ga0501042_0007405 3300049578 Bacteria 7188
742 Ga0501043_0050601 3300049579 Bacteria 3265
743 Ga0501046_0004222 3300049580 Bacteria 13074
744 Ga0501046_0007686 3300049580 Bacteria 9453
745 Ga0501046_0014662 3300049580 Bacteria 6601
746 Ga0501046_0744830 3300049580 Unclassified 689
747 Ga0501047_0035347 3300049581 Bacteria 4827
748 Ga0501047_0052141 3300049581 Bacteria 3953
749 Ga0501047_0052377 3300049581 Bacteria 3945
750 Ga0501047_1087351 3300049581 Unclassified 613
751 Ga0501048_0005753 3300049582 Bacteria 9419
752 Ga0501048_0246029 3300049582 Unclassified 1269
753 Ga0501070_0009556 3300049586 Bacteria 8192
754 Ga0501070_0115335 3300049586 Bacteria 2219
755 Ga0501070_0274592 3300049586 Bacteria 1376
756 Ga0501071_0502577 3300049587 Bacteria 930
757 Ga0501080_0174419 3300049742 Bacteria 1981
758 Ga0501080_0391058 3300049742 Bacteria 1252
759 Ga0501083_0015708 3300049744 Bacteria 5299
760 Ga0501083_0044333 3300049744 Bacteria 3011
761 Ga0501035_0008262 3300049822 Bacteria 9698
762 Ga0501035_0254630 3300049822 Bacteria 1490
763 Ga0501035_0321807 3300049822 Bacteria 1299
764 Ga0501044_0012985 3300049823 Bacteria 9017
765 Ga0501044_0017234 3300049823 Bacteria 7747
766 Ga0501044_0345009 3300049823 Bacteria 1409
767 Ga0501045_0029555 3300049824 Bacteria 3963
768 nmdc:mga05p37_2087914_c1 3300050507 Bacteria 532
769 nmdc:mga05p37_361162_c1 3300050507 Unclassified 1707
770 nmdc:mga05p37_497648_c1 3300050507 Unclassified 1400
771 nmdc:mga09592_1318437_c1 3300050508 Bacteria 593
772 nmdc:mga09592_160331_c1 3300050508 Unclassified 1943
773 nmdc:mga0qj67_1338832_c1 3300050509 Unclassified 554
774 nmdc:mga08y16_1042022_c1 3300050511 Unclassified 796
775 nmdc:mga08y16_1071323_c1 3300050511 Bacteria 782
776 nmdc:mga08y16_1191288_c1 3300050511 Bacteria 733
777 nmdc:mga08y16_295343_c1 3300050511 Bacteria 1670
778 nmdc:mga08y16_666385_c1 3300050511 Unclassified 1043
779 nmdc:mga0n895_1046999_c1 3300050512 Bacteria 795
780 nmdc:mga0n895_163793_c1 3300050512 Unclassified 2255
781 nmdc:mga0n895_1868875_c1 3300050512 Unclassified 560
782 nmdc:mga0n895_315777_c1 3300050512 Unclassified 1583
783 nmdc:mga0rr50_870115_c1 3300050513 Bacteria 768
784 nmdc:mga08x19_1327885_c1 3300050514 Unclassified 509
785 nmdc:mga08x19_200436_c1 3300050514 Unclassified 1368
786 nmdc:mga0a205_263999_c1 3300050515 Unclassified 1599
787 nmdc:mga0a205_332060_c1 3300050515 Bacteria 1390
788 nmdc:mga0a205_441378_c1 3300050515 Bacteria 1162
789 nmdc:mga0sz30_262647_c1 3300050516 Unclassified 769
790 Ga0495601_0036457 3300053077 Bacteria 3071
791 Ga0495601_0208809 3300053077 Unclassified 1276
792 Ga0495612_0276890 3300053078 Bacteria 749
793 Ga0495595_0084468 3300053084 Bacteria 1517
794 Ga0495595_0180017 3300053084 Bacteria 1048
795 Ga0495595_0246216 3300053084 Bacteria 895
796 Ga0495595_0299557 3300053084 Bacteria 809
797 Ga0495619_0213428 3300053085 Unclassified 1337
798 Ga0495619_0704222 3300053085 Bacteria 687
799 Ga0500643_102775 3300053087 Bacteria 775
800 Ga0500573_0300800 3300053140 Bacteria 802
801 Ga0500611_009469 3300053727 Unclassified 1545
802 Ga0501082_0061321 3300060353 Bacteria 3238
803 Ga0501082_1732053 3300060353 Bacteria 545
804 Ga0501082_1982160 3300060353 Bacteria 508
805 Ga0466962_0371178 3300061719 Bacteria 714

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100979472 Ga0070664_1009794723 45
2 3300025945 Ga0207679_11454962 Ga0207679_114549621 45
3 3300031548 Ga0307408_100000033 Ga0307408_10000003378 45
4 3300031824 Ga0307413_12131499 Ga0307413_121314992 45
5 3300031852 Ga0307410_10000008 Ga0307410_1000000895 45
6 3300031903 Ga0307407_10059293 Ga0307407_100592935 45
7 3300031911 Ga0307412_10026993 Ga0307412_100269932 45
8 3300031995 Ga0307409_100000430 Ga0307409_10000043011 45
9 3300032002 Ga0307416_100000278 Ga0307416_1000002788 45
10 3300032005 Ga0307411_10795893 Ga0307411_107958933 45
11 3300005338 Ga0068868_100406257 Ga0068868_1004062573 46
12 3300005364 Ga0070673_101298339 Ga0070673_1012983392 46
13 3300005459 Ga0068867_100559192 Ga0068867_1005591921 46
14 3300025938 Ga0207704_11062896 Ga0207704_110628961 46
15 3300026023 Ga0207677_11097204 Ga0207677_110972042 46
16 3300031507 Ga0307509_10473631 Ga0307509_104736312 46
17 iso_pu_bacteria 2786546517 2787435224 47
18 iso_pu_bacteria 2786546940 2788436087 47
19 3300028573 Ga0265334_10126267 Ga0265334_101262672 50
20 3300028800 Ga0265338_10002794 Ga0265338_100027949 50
21 3300028800 Ga0265338_10027683 Ga0265338_100276833 50
22 3300041456 Ga0451795_0822456 Ga0451795_0822456_164_316 50
23 3300042876 Ga0451577_0579657 Ga0451577_0579657_202_354 50
24 3300044712 Ga0453684_0000027 Ga0453684_0000027_698412_698564 50
25 2162886011 MRS1b_contig_9372160 MRS1b_0179.00002530 51
26 3300000043 ARcpr5yngRDRAFT_c023372 ARcpr5yngRDRAFT_0233722 51
27 3300003911 JGI25405J52794_10003108 JGI25405J52794_100031083 51
28 3300003911 JGI25405J52794_10007597 JGI25405J52794_100075972 51
29 3300003911 JGI25405J52794_10054083 JGI25405J52794_100540832 51
30 3300005288 Ga0065714_10074612 Ga0065714_100746122 51
31 3300005289 Ga0065704_10023110 Ga0065704_100231102 51
32 3300005290 Ga0065712_10269117 Ga0065712_102691172 51
33 3300005290 Ga0065712_10284503 Ga0065712_102845032 51
34 3300005290 Ga0065712_10701270 Ga0065712_107012701 51
35 3300005293 Ga0065715_10003886 Ga0065715_100038867 51
36 3300005293 Ga0065715_10257808 Ga0065715_102578082 51
37 3300005293 Ga0065715_10378729 Ga0065715_103787292 51
38 3300005293 Ga0065715_10425479 Ga0065715_104254792 51
39 3300005295 Ga0065707_10031506 Ga0065707_100315061 51
40 3300005327 Ga0070658_10283812 Ga0070658_102838122 51
41 3300005327 Ga0070658_10800003 Ga0070658_108000031 51
42 3300005328 Ga0070676_10003135 Ga0070676_100031358 51
43 3300005328 Ga0070676_10411974 Ga0070676_104119742 51
44 3300005328 Ga0070676_10472106 Ga0070676_104721061 51
45 3300005328 Ga0070676_11623094 Ga0070676_116230941 51
46 3300005329 Ga0070683_100125569 Ga0070683_1001255692 51
47 3300005330 Ga0070690_100080891 Ga0070690_1000808913 51
48 3300005330 Ga0070690_100348237 Ga0070690_1003482372 51
49 3300005330 Ga0070690_100442906 Ga0070690_1004429062 51
50 3300005330 Ga0070690_100613580 Ga0070690_1006135802 51
51 3300005331 Ga0070670_100011533 Ga0070670_1000115336 51
52 3300005331 Ga0070670_100191497 Ga0070670_1001914973 51
53 3300005331 Ga0070670_101275448 Ga0070670_1012754481 51
54 3300005331 Ga0070670_101330871 Ga0070670_1013308712 51
55 3300005334 Ga0068869_100617218 Ga0068869_1006172182 51
56 3300005334 Ga0068869_101114292 Ga0068869_1011142922 51
57 3300005335 Ga0070666_10008158 Ga0070666_100081584 51
58 3300005338 Ga0068868_100257013 Ga0068868_1002570131 51
59 3300005338 Ga0068868_100547195 Ga0068868_1005471952 51
60 3300005338 Ga0068868_100963547 Ga0068868_1009635471 51
61 3300005338 Ga0068868_101444014 Ga0068868_1014440142 51
62 3300005339 Ga0070660_100413102 Ga0070660_1004131022 51
63 3300005340 Ga0070689_100077351 Ga0070689_1000773512 51
64 3300005340 Ga0070689_100152658 Ga0070689_1001526582 51
65 3300005340 Ga0070689_102141847 Ga0070689_1021418471 51
66 3300005344 Ga0070661_100920961 Ga0070661_1009209612 51
67 3300005344 Ga0070661_101730851 Ga0070661_1017308512 51
68 3300005347 Ga0070668_100055023 Ga0070668_1000550233 51
69 3300005347 Ga0070668_100201146 Ga0070668_1002011463 51
70 3300005347 Ga0070668_100433373 Ga0070668_1004333731 51
71 3300005347 Ga0070668_100984870 Ga0070668_1009848702 51
72 3300005347 Ga0070668_102028512 Ga0070668_1020285121 51
73 3300005353 Ga0070669_100154726 Ga0070669_1001547263 51
74 3300005353 Ga0070669_100336255 Ga0070669_1003362553 51
75 3300005353 Ga0070669_101911746 Ga0070669_1019117461 51
76 3300005354 Ga0070675_100286305 Ga0070675_1002863052 51
77 3300005354 Ga0070675_100368645 Ga0070675_1003686453 51
78 3300005354 Ga0070675_100507115 Ga0070675_1005071152 51
79 3300005354 Ga0070675_100950108 Ga0070675_1009501082 51
80 3300005355 Ga0070671_100005387 Ga0070671_10000538710 51
81 3300005355 Ga0070671_100033099 Ga0070671_1000330992 51
82 3300005355 Ga0070671_100110880 Ga0070671_1001108802 51
83 3300005355 Ga0070671_100193118 Ga0070671_1001931182 51
84 3300005355 Ga0070671_101091214 Ga0070671_1010912142 51
85 3300005356 Ga0070674_100004297 Ga0070674_1000042977 51
86 3300005356 Ga0070674_100126478 Ga0070674_1001264782 51
87 3300005356 Ga0070674_100238858 Ga0070674_1002388582 51
88 3300005356 Ga0070674_100425593 Ga0070674_1004255932 51
89 3300005356 Ga0070674_101729355 Ga0070674_1017293551 51
90 3300005364 Ga0070673_100017919 Ga0070673_1000179194 51
91 3300005364 Ga0070673_100100918 Ga0070673_1001009183 51
92 3300005364 Ga0070673_100210662 Ga0070673_1002106622 51
93 3300005364 Ga0070673_100396460 Ga0070673_1003964602 51
94 3300005364 Ga0070673_101195936 Ga0070673_1011959361 51
95 3300005365 Ga0070688_100009774 Ga0070688_1000097742 51
96 3300005365 Ga0070688_100018097 Ga0070688_1000180975 51
97 3300005366 Ga0070659_100728747 Ga0070659_1007287472 51
98 3300005366 Ga0070659_100899766 Ga0070659_1008997662 51
99 3300005366 Ga0070659_101872579 Ga0070659_1018725792 51
100 3300005367 Ga0070667_100142723 Ga0070667_1001427232 51
101 3300005367 Ga0070667_100252921 Ga0070667_1002529213 51
102 3300005367 Ga0070667_101535379 Ga0070667_1015353792 51
103 3300005406 Ga0070703_10066704 Ga0070703_100667042 51
104 3300005406 Ga0070703_10095729 Ga0070703_100957292 51
105 3300005434 Ga0070709_10012964 Ga0070709_100129645 51
106 3300005435 Ga0070714_100091936 Ga0070714_1000919362 51
107 3300005435 Ga0070714_100586178 Ga0070714_1005861782 51
108 3300005435 Ga0070714_100914622 Ga0070714_1009146222 51
109 3300005435 Ga0070714_101911625 Ga0070714_1019116251 51
110 3300005436 Ga0070713_100032759 Ga0070713_1000327594 51
111 3300005436 Ga0070713_100375075 Ga0070713_1003750752 51
112 3300005436 Ga0070713_101182911 Ga0070713_1011829112 51
113 3300005437 Ga0070710_10952955 Ga0070710_109529552 51
114 3300005439 Ga0070711_100028777 Ga0070711_1000287775 51
115 3300005439 Ga0070711_101323145 Ga0070711_1013231452 51
116 3300005440 Ga0070705_100217366 Ga0070705_1002173662 51
117 3300005440 Ga0070705_101516812 Ga0070705_1015168121 51
118 3300005441 Ga0070700_100833482 Ga0070700_1008334821 51
119 3300005441 Ga0070700_101859241 Ga0070700_1018592412 51
120 3300005444 Ga0070694_100993383 Ga0070694_1009933832 51
121 3300005445 Ga0070708_100010461 Ga0070708_1000104614 51
122 3300005445 Ga0070708_100035062 Ga0070708_1000350622 51
123 3300005445 Ga0070708_100066029 Ga0070708_1000660293 51
124 3300005445 Ga0070708_100235868 Ga0070708_1002358682 51
125 3300005445 Ga0070708_100247791 Ga0070708_1002477912 51
126 3300005445 Ga0070708_100748156 Ga0070708_1007481562 51
127 3300005445 Ga0070708_101592849 Ga0070708_1015928492 51
128 3300005455 Ga0070663_101425108 Ga0070663_1014251082 51
129 3300005456 Ga0070678_100012695 Ga0070678_1000126953 51
130 3300005456 Ga0070678_100944682 Ga0070678_1009446821 51
131 3300005456 Ga0070678_101258059 Ga0070678_1012580592 51
132 3300005457 Ga0070662_100063402 Ga0070662_1000634022 51
133 3300005457 Ga0070662_100197626 Ga0070662_1001976262 51
134 3300005457 Ga0070662_100412734 Ga0070662_1004127342 51
135 3300005457 Ga0070662_100470934 Ga0070662_1004709342 51
136 3300005458 Ga0070681_11022046 Ga0070681_110220461 51
137 3300005459 Ga0068867_100101958 Ga0068867_1001019583 51
138 3300005459 Ga0068867_100317492 Ga0068867_1003174922 51
139 3300005459 Ga0068867_101057224 Ga0068867_1010572242 51
140 3300005466 Ga0070685_10107195 Ga0070685_101071952 51
141 3300005466 Ga0070685_10128602 Ga0070685_101286024 51
142 3300005467 Ga0070706_100029693 Ga0070706_1000296932 51
143 3300005467 Ga0070706_100086451 Ga0070706_1000864512 51
144 3300005467 Ga0070706_100126649 Ga0070706_1001266492 51
145 3300005467 Ga0070706_100140341 Ga0070706_1001403412 51
146 3300005467 Ga0070706_100148954 Ga0070706_1001489544 51
147 3300005467 Ga0070706_100431209 Ga0070706_1004312092 51
148 3300005467 Ga0070706_100518072 Ga0070706_1005180722 51
149 3300005467 Ga0070706_100830135 Ga0070706_1008301352 51
150 3300005467 Ga0070706_101788112 Ga0070706_1017881122 51
151 3300005468 Ga0070707_100001020 Ga0070707_10000102019 51
152 3300005468 Ga0070707_100011737 Ga0070707_1000117376 51
153 3300005468 Ga0070707_100060459 Ga0070707_1000604594 51
154 3300005468 Ga0070707_100238139 Ga0070707_1002381392 51
155 3300005468 Ga0070707_100335416 Ga0070707_1003354162 51
156 3300005468 Ga0070707_100801358 Ga0070707_1008013581 51
157 3300005468 Ga0070707_101017942 Ga0070707_1010179421 51
158 3300005468 Ga0070707_101428125 Ga0070707_1014281252 51
159 3300005468 Ga0070707_101718125 Ga0070707_1017181251 51
160 3300005471 Ga0070698_100001128 Ga0070698_1000011286 51
161 3300005471 Ga0070698_100001373 Ga0070698_10000137328 51
162 3300005471 Ga0070698_101188128 Ga0070698_1011881281 51
163 3300005471 Ga0070698_102026818 Ga0070698_1020268181 51
164 3300005518 Ga0070699_100380348 Ga0070699_1003803482 51
165 3300005518 Ga0070699_100925469 Ga0070699_1009254691 51
166 3300005535 Ga0070684_100045928 Ga0070684_1000459282 51
167 3300005536 Ga0070697_100001619 Ga0070697_1000016195 51
168 3300005536 Ga0070697_100275791 Ga0070697_1002757913 51
169 3300005536 Ga0070697_100595057 Ga0070697_1005950572 51
170 3300005536 Ga0070697_100748440 Ga0070697_1007484402 51
171 3300005536 Ga0070697_101270264 Ga0070697_1012702642 51
172 3300005536 Ga0070697_101482938 Ga0070697_1014829382 51
173 3300005536 Ga0070697_101563586 Ga0070697_1015635862 51
174 3300005543 Ga0070672_100043527 Ga0070672_1000435273 51
175 3300005543 Ga0070672_100161464 Ga0070672_1001614643 51
176 3300005543 Ga0070672_100374474 Ga0070672_1003744742 51
177 3300005543 Ga0070672_100396256 Ga0070672_1003962562 51
178 3300005543 Ga0070672_100689213 Ga0070672_1006892132 51
179 3300005544 Ga0070686_100515197 Ga0070686_1005151972 51
180 3300005544 Ga0070686_100655317 Ga0070686_1006553172 51
181 3300005545 Ga0070695_100328790 Ga0070695_1003287902 51
182 3300005546 Ga0070696_100369859 Ga0070696_1003698592 51
183 3300005547 Ga0070693_100830988 Ga0070693_1008309882 51
184 3300005548 Ga0070665_100240953 Ga0070665_1002409532 51
185 3300005548 Ga0070665_100251254 Ga0070665_1002512542 51
186 3300005548 Ga0070665_100346721 Ga0070665_1003467212 51
187 3300005548 Ga0070665_101218777 Ga0070665_1012187771 51
188 3300005548 Ga0070665_102230876 Ga0070665_1022308761 51
189 3300005563 Ga0068855_100007498 Ga0068855_1000074983 51
190 3300005564 Ga0070664_101647972 Ga0070664_1016479722 51
191 3300005577 Ga0068857_100462713 Ga0068857_1004627134 51
192 3300005577 Ga0068857_102179892 Ga0068857_1021798921 51
193 3300005578 Ga0068854_101054778 Ga0068854_1010547782 51
194 3300005616 Ga0068852_100077481 Ga0068852_1000774813 51
195 3300005616 Ga0068852_101946378 Ga0068852_1019463782 51
196 3300005616 Ga0068852_102126448 Ga0068852_1021264482 51
197 3300005617 Ga0068859_100526303 Ga0068859_1005263033 51
198 3300005617 Ga0068859_101223863 Ga0068859_1012238632 51
199 3300005618 Ga0068864_100379287 Ga0068864_1003792873 51
200 3300005718 Ga0068866_10221888 Ga0068866_102218882 51
201 3300005718 Ga0068866_11252912 Ga0068866_112529122 51
202 3300005719 Ga0068861_101745458 Ga0068861_1017454581 51
203 3300005719 Ga0068861_101854483 Ga0068861_1018544831 51
204 3300005841 Ga0068863_100425419 Ga0068863_1004254192 51
205 3300005841 Ga0068863_100952651 Ga0068863_1009526512 51
206 3300005841 Ga0068863_101144119 Ga0068863_1011441191 51
207 3300005841 Ga0068863_101531780 Ga0068863_1015317802 51
208 3300005841 Ga0068863_101595509 Ga0068863_1015955092 51
209 3300005842 Ga0068858_100213068 Ga0068858_1002130683 51
210 3300005842 Ga0068858_100873562 Ga0068858_1008735622 51
211 3300005842 Ga0068858_101260012 Ga0068858_1012600121 51
212 3300005842 Ga0068858_101974237 Ga0068858_1019742372 51
213 3300005843 Ga0068860_100004333 Ga0068860_1000043333 51
214 3300005843 Ga0068860_101528853 Ga0068860_1015288532 51
215 3300005843 Ga0068860_102420409 Ga0068860_1024204092 51
216 3300005844 Ga0068862_100261199 Ga0068862_1002611992 51
217 3300005844 Ga0068862_100757840 Ga0068862_1007578403 51
218 3300005844 Ga0068862_101038120 Ga0068862_1010381202 51
219 3300005844 Ga0068862_101810208 Ga0068862_1018102082 51
220 3300005937 Ga0081455_10001571 Ga0081455_1000157115 51
221 3300005937 Ga0081455_10001819 Ga0081455_100018197 51
222 3300005937 Ga0081455_10011555 Ga0081455_100115552 51
223 3300005937 Ga0081455_10012797 Ga0081455_100127976 51
224 3300005937 Ga0081455_10018200 Ga0081455_100182001 51
225 3300005937 Ga0081455_10038672 Ga0081455_100386722 51
226 3300005937 Ga0081455_10077432 Ga0081455_100774323 51
227 3300005937 Ga0081455_10084449 Ga0081455_100844493 51
228 3300005937 Ga0081455_10149134 Ga0081455_101491341 51
229 3300005981 Ga0081538_10043902 Ga0081538_100439024 51
230 3300005983 Ga0081540_1000010 Ga0081540_100001065 51
231 3300005985 Ga0081539_10008110 Ga0081539_100081108 51
232 3300005985 Ga0081539_10391942 Ga0081539_103919422 51
233 3300006028 Ga0070717_10000015 Ga0070717_1000001513 51
234 3300006028 Ga0070717_10000276 Ga0070717_1000027636 51
235 3300006028 Ga0070717_10260706 Ga0070717_102607063 51
236 3300006028 Ga0070717_10441606 Ga0070717_104416062 51
237 3300006048 Ga0075363_100906710 Ga0075363_1009067102 51
238 3300006163 Ga0070715_10061663 Ga0070715_100616632 51
239 3300006163 Ga0070715_10659377 Ga0070715_106593772 51
240 3300006175 Ga0070712_100330997 Ga0070712_1003309972 51
241 3300006175 Ga0070712_100374543 Ga0070712_1003745432 51
242 3300006175 Ga0070712_100823195 Ga0070712_1008231952 51
243 3300006175 Ga0070712_101356976 Ga0070712_1013569762 51
244 3300006175 Ga0070712_101634951 Ga0070712_1016349512 51
245 3300006186 Ga0075369_10285653 Ga0075369_102856532 51
246 3300006237 Ga0097621_100184167 Ga0097621_1001841673 51
247 3300006237 Ga0097621_101608258 Ga0097621_1016082582 51
248 3300006358 Ga0068871_100009471 Ga0068871_1000094717 51
249 3300006358 Ga0068871_100919720 Ga0068871_1009197202 51
250 3300006844 Ga0075428_101889793 Ga0075428_1018897932 51
251 3300006846 Ga0075430_100981472 Ga0075430_1009814722 51
252 3300006846 Ga0075430_101035661 Ga0075430_1010356612 51
253 3300006852 Ga0075433_11523479 Ga0075433_115234792 51
254 3300006871 Ga0075434_100308097 Ga0075434_1003080971 51
255 3300006871 Ga0075434_100376968 Ga0075434_1003769682 51
256 3300006871 Ga0075434_101711928 Ga0075434_1017119282 51
257 3300006880 Ga0075429_100229178 Ga0075429_1002291782 51
258 3300006880 Ga0075429_100301159 Ga0075429_1003011593 51
259 3300006881 Ga0068865_101251336 Ga0068865_1012513361 51
260 3300006914 Ga0075436_100077149 Ga0075436_1000771494 51
261 3300006914 Ga0075436_100145012 Ga0075436_1001450122 51
262 3300006914 Ga0075436_100241475 Ga0075436_1002414752 51
263 3300006931 Ga0097620_100526311 Ga0097620_1005263112 51
264 3300006931 Ga0097620_101223899 Ga0097620_1012238992 51
265 3300007076 Ga0075435_101026111 Ga0075435_1010261111 51
266 3300007265 Ga0099794_10082571 Ga0099794_100825712 51
267 3300007265 Ga0099794_10106214 Ga0099794_101062142 51
268 3300007788 Ga0099795_10187027 Ga0099795_101870272 51
269 3300009092 Ga0105250_10397652 Ga0105250_103976522 51
270 3300009093 Ga0105240_10403312 Ga0105240_104033121 51
271 3300009094 Ga0111539_10108839 Ga0111539_101088392 51
272 3300009094 Ga0111539_10331565 Ga0111539_103315654 51
273 3300009094 Ga0111539_10573865 Ga0111539_105738651 51
274 3300009094 Ga0111539_10594067 Ga0111539_105940671 51
275 3300009094 Ga0111539_11405934 Ga0111539_114059342 51
276 3300009094 Ga0111539_12017888 Ga0111539_120178882 51
277 3300009094 Ga0111539_12446991 Ga0111539_124469912 51
278 3300009098 Ga0105245_10044186 Ga0105245_100441862 51
279 3300009098 Ga0105245_10102993 Ga0105245_101029932 51
280 3300009098 Ga0105245_10414801 Ga0105245_104148012 51
281 3300009098 Ga0105245_10723361 Ga0105245_107233612 51
282 3300009098 Ga0105245_11129140 Ga0105245_111291402 51
283 3300009098 Ga0105245_11661373 Ga0105245_116613732 51
284 3300009101 Ga0105247_10396792 Ga0105247_103967922 51
285 3300009101 Ga0105247_10403943 Ga0105247_104039432 51
286 3300009147 Ga0114129_10101962 Ga0114129_101019622 51
287 3300009147 Ga0114129_10486043 Ga0114129_104860432 51
288 3300009147 Ga0114129_10619545 Ga0114129_106195452 51
289 3300009147 Ga0114129_10905959 Ga0114129_109059592 51
290 3300009147 Ga0114129_12371582 Ga0114129_123715821 51
291 3300009148 Ga0105243_10313555 Ga0105243_103135551 51
292 3300009174 Ga0105241_10068342 Ga0105241_100683422 51
293 3300009176 Ga0105242_10018695 Ga0105242_100186952 51
294 3300009176 Ga0105242_12126986 Ga0105242_121269862 51
295 3300009176 Ga0105242_12406642 Ga0105242_124066422 51
296 3300009177 Ga0105248_10802106 Ga0105248_108021061 51
297 3300009177 Ga0105248_11778740 Ga0105248_117787402 51
298 3300009545 Ga0105237_10028067 Ga0105237_100280674 51
299 3300009545 Ga0105237_10397394 Ga0105237_103973942 51
300 3300009545 Ga0105237_10779285 Ga0105237_107792852 51
301 3300009545 Ga0105237_11387458 Ga0105237_113874582 51
302 3300009545 Ga0105237_12177859 Ga0105237_121778592 51
303 3300009551 Ga0105238_11002522 Ga0105238_110025221 51
304 3300009551 Ga0105238_11409837 Ga0105238_114098372 51
305 3300009553 Ga0105249_11178870 Ga0105249_111788702 51
306 3300009553 Ga0105249_13314999 Ga0105249_133149991 51
307 3300010375 Ga0105239_10322587 Ga0105239_103225873 51
308 3300010375 Ga0105239_10394873 Ga0105239_103948733 51
309 3300010375 Ga0105239_10449527 Ga0105239_104495272 51
310 3300010375 Ga0105239_12147934 Ga0105239_121479341 51
311 3300011119 Ga0105246_11132690 Ga0105246_111326902 51
312 3300011119 Ga0105246_11346602 Ga0105246_113466021 51
313 3300011119 Ga0105246_11782802 Ga0105246_117828022 51
314 3300013100 Ga0157373_10895790 Ga0157373_108957901 51
315 3300013102 Ga0157371_10396955 Ga0157371_103969552 51
316 3300013102 Ga0157371_10495292 Ga0157371_104952922 51
317 3300013102 Ga0157371_11191656 Ga0157371_111916561 51
318 3300013104 Ga0157370_10303807 Ga0157370_103038072 51
319 3300013105 Ga0157369_10091270 Ga0157369_100912704 51
320 3300013296 Ga0157374_10003871 Ga0157374_1000387115 51
321 3300013296 Ga0157374_10246805 Ga0157374_102468053 51
322 3300013296 Ga0157374_10427792 Ga0157374_104277922 51
323 3300013296 Ga0157374_11229749 Ga0157374_112297491 51
324 3300013296 Ga0157374_11369943 Ga0157374_113699432 51
325 3300013296 Ga0157374_11538805 Ga0157374_115388052 51
326 3300013296 Ga0157374_12984276 Ga0157374_129842761 51
327 3300013297 Ga0157378_10030296 Ga0157378_100302964 51
328 3300013297 Ga0157378_10031400 Ga0157378_100314002 51
329 3300013297 Ga0157378_10122166 Ga0157378_101221662 51
330 3300013297 Ga0157378_10259446 Ga0157378_102594462 51
331 3300013297 Ga0157378_10337499 Ga0157378_103374992 51
332 3300013297 Ga0157378_10349575 Ga0157378_103495753 51
333 3300013297 Ga0157378_10407875 Ga0157378_104078752 51
334 3300013297 Ga0157378_10752684 Ga0157378_107526842 51
335 3300013297 Ga0157378_11842096 Ga0157378_118420962 51
336 3300013297 Ga0157378_12340274 Ga0157378_123402742 51
337 3300013306 Ga0163162_10099170 Ga0163162_100991703 51
338 3300013306 Ga0163162_10163465 Ga0163162_101634653 51
339 3300013306 Ga0163162_10201932 Ga0163162_102019323 51
340 3300013306 Ga0163162_10528129 Ga0163162_105281292 51
341 3300013306 Ga0163162_12363860 Ga0163162_123638602 51
342 3300013306 Ga0163162_13423163 Ga0163162_134231631 51
343 3300013306 Ga0163162_13463579 Ga0163162_134635792 51
344 3300013307 Ga0157372_10010274 Ga0157372_100102747 51
345 3300013307 Ga0157372_10346486 Ga0157372_103464862 51
346 3300013308 Ga0157375_10013261 Ga0157375_100132615 51
347 3300013308 Ga0157375_10057092 Ga0157375_100570925 51
348 3300013308 Ga0157375_10235093 Ga0157375_102350933 51
349 3300013308 Ga0157375_11016621 Ga0157375_110166212 51
350 3300013308 Ga0157375_11486602 Ga0157375_114866022 51
351 3300013308 Ga0157375_11683847 Ga0157375_116838472 51
352 3300013308 Ga0157375_13597607 Ga0157375_135976072 51
353 3300014325 Ga0163163_10376010 Ga0163163_103760102 51
354 3300014325 Ga0163163_12459240 Ga0163163_124592401 51
355 3300014325 Ga0163163_13089399 Ga0163163_130893991 51
356 3300014326 Ga0157380_12049127 Ga0157380_120491272 51
357 3300014326 Ga0157380_12973571 Ga0157380_129735711 51
358 3300014497 Ga0182008_10008039 Ga0182008_100080392 51
359 3300014745 Ga0157377_10342916 Ga0157377_103429161 51
360 3300014968 Ga0157379_10441535 Ga0157379_104415351 51
361 3300014968 Ga0157379_11329216 Ga0157379_113292161 51
362 3300014969 Ga0157376_10011998 Ga0157376_100119987 51
363 3300014969 Ga0157376_10030235 Ga0157376_100302355 51
364 3300014969 Ga0157376_10356952 Ga0157376_103569522 51
365 3300014969 Ga0157376_10442665 Ga0157376_104426652 51
366 3300014969 Ga0157376_11656638 Ga0157376_116566381 51
367 3300014969 Ga0157376_12056144 Ga0157376_120561442 51
368 3300014969 Ga0157376_12547927 Ga0157376_125479271 51
369 3300015261 Ga0182006_1091965 Ga0182006_10919652 51
370 3300015261 Ga0182006_1113115 Ga0182006_11131152 51
371 3300015261 Ga0182006_1166536 Ga0182006_11665362 51
372 3300015265 Ga0182005_1028573 Ga0182005_10285732 51
373 3300017792 Ga0163161_10358713 Ga0163161_103587132 51
374 3300017792 Ga0163161_10378487 Ga0163161_103784872 51
375 3300017792 Ga0163161_11157531 Ga0163161_111575312 51
376 3300025271 Ga0207666_1000363 Ga0207666_10003633 51
377 3300025290 Ga0207673_1034728 Ga0207673_10347282 51
378 3300025315 Ga0207697_10002302 Ga0207697_100023023 51
379 3300025315 Ga0207697_10004870 Ga0207697_100048706 51
380 3300025315 Ga0207697_10208017 Ga0207697_102080171 51
381 3300025899 Ga0207642_10889078 Ga0207642_108890781 51
382 3300025901 Ga0207688_10282652 Ga0207688_102826522 51
383 3300025903 Ga0207680_10129104 Ga0207680_101291043 51
384 3300025905 Ga0207685_10255073 Ga0207685_102550732 51
385 3300025906 Ga0207699_10123140 Ga0207699_101231403 51
386 3300025906 Ga0207699_11101522 Ga0207699_111015221 51
387 3300025907 Ga0207645_10005184 Ga0207645_100051843 51
388 3300025907 Ga0207645_10233453 Ga0207645_102334531 51
389 3300025907 Ga0207645_10280221 Ga0207645_102802212 51
390 3300025907 Ga0207645_10706981 Ga0207645_107069812 51
391 3300025907 Ga0207645_11178765 Ga0207645_111787651 51
392 3300025909 Ga0207705_10046002 Ga0207705_100460023 51
393 3300025909 Ga0207705_10664831 Ga0207705_106648311 51
394 3300025909 Ga0207705_10723104 Ga0207705_107231042 51
395 3300025910 Ga0207684_10000824 Ga0207684_1000082431 51
396 3300025910 Ga0207684_10027013 Ga0207684_100270135 51
397 3300025910 Ga0207684_10127432 Ga0207684_101274322 51
398 3300025910 Ga0207684_10695276 Ga0207684_106952762 51
399 3300025910 Ga0207684_10959550 Ga0207684_109595502 51
400 3300025912 Ga0207707_11003678 Ga0207707_110036782 51
401 3300025913 Ga0207695_10000186 Ga0207695_1000018621 51
402 3300025913 Ga0207695_10376029 Ga0207695_103760291 51
403 3300025914 Ga0207671_10026068 Ga0207671_100260684 51
404 3300025914 Ga0207671_10252804 Ga0207671_102528042 51
405 3300025915 Ga0207693_10312996 Ga0207693_103129962 51
406 3300025915 Ga0207693_10691125 Ga0207693_106911252 51
407 3300025916 Ga0207663_10024925 Ga0207663_100249253 51
408 3300025916 Ga0207663_10875880 Ga0207663_108758801 51
409 3300025917 Ga0207660_10457006 Ga0207660_104570062 51
410 3300025919 Ga0207657_10830599 Ga0207657_108305992 51
411 3300025919 Ga0207657_11122431 Ga0207657_111224311 51
412 3300025919 Ga0207657_11285881 Ga0207657_112858812 51
413 3300025920 Ga0207649_10561387 Ga0207649_105613872 51
414 3300025920 Ga0207649_11333746 Ga0207649_113337461 51
415 3300025922 Ga0207646_10003687 Ga0207646_100036874 51
416 3300025922 Ga0207646_10022818 Ga0207646_100228182 51
417 3300025922 Ga0207646_10044232 Ga0207646_100442323 51
418 3300025922 Ga0207646_10068200 Ga0207646_100682003 51
419 3300025922 Ga0207646_10133027 Ga0207646_101330273 51
420 3300025922 Ga0207646_10313976 Ga0207646_103139763 51
421 3300025922 Ga0207646_10389833 Ga0207646_103898331 51
422 3300025922 Ga0207646_10609440 Ga0207646_106094402 51
423 3300025922 Ga0207646_11064566 Ga0207646_110645662 51
424 3300025923 Ga0207681_10066283 Ga0207681_100662833 51
425 3300025925 Ga0207650_10180998 Ga0207650_101809982 51
426 3300025926 Ga0207659_10066261 Ga0207659_100662613 51
427 3300025926 Ga0207659_10161551 Ga0207659_101615513 51
428 3300025927 Ga0207687_10025395 Ga0207687_100253952 51
429 3300025927 Ga0207687_10371640 Ga0207687_103716402 51
430 3300025928 Ga0207700_10320193 Ga0207700_103201932 51
431 3300025929 Ga0207664_10376228 Ga0207664_103762283 51
432 3300025929 Ga0207664_10546757 Ga0207664_105467572 51
433 3300025929 Ga0207664_11765575 Ga0207664_117655752 51
434 3300025929 Ga0207664_11961471 Ga0207664_119614711 51
435 3300025931 Ga0207644_10091491 Ga0207644_100914912 51
436 3300025931 Ga0207644_10325629 Ga0207644_103256292 51
437 3300025931 Ga0207644_10974736 Ga0207644_109747362 51
438 3300025933 Ga0207706_10314191 Ga0207706_103141912 51
439 3300025933 Ga0207706_10511890 Ga0207706_105118902 51
440 3300025934 Ga0207686_10043024 Ga0207686_100430242 51
441 3300025936 Ga0207670_10033442 Ga0207670_100334423 51
442 3300025936 Ga0207670_10107142 Ga0207670_101071422 51
443 3300025936 Ga0207670_10193315 Ga0207670_101933152 51
444 3300025936 Ga0207670_11747943 Ga0207670_117479432 51
445 3300025937 Ga0207669_10014102 Ga0207669_100141023 51
446 3300025937 Ga0207669_10745108 Ga0207669_107451081 51
447 3300025938 Ga0207704_10421412 Ga0207704_104214122 51
448 3300025938 Ga0207704_10828498 Ga0207704_108284981 51
449 3300025938 Ga0207704_11066830 Ga0207704_110668302 51
450 3300025938 Ga0207704_11135674 Ga0207704_111356741 51
451 3300025939 Ga0207665_10810618 Ga0207665_108106182 51
452 3300025940 Ga0207691_10046047 Ga0207691_100460472 51
453 3300025940 Ga0207691_10323455 Ga0207691_103234552 51
454 3300025940 Ga0207691_11403501 Ga0207691_114035012 51
455 3300025942 Ga0207689_10233454 Ga0207689_102334542 51
456 3300025944 Ga0207661_10007121 Ga0207661_100071215 51
457 3300025944 Ga0207661_10775437 Ga0207661_107754372 51
458 3300025945 Ga0207679_10736017 Ga0207679_107360171 51
459 3300025945 Ga0207679_10964547 Ga0207679_109645471 51
460 3300025945 Ga0207679_11505817 Ga0207679_115058172 51
461 3300025949 Ga0207667_10054428 Ga0207667_100544282 51
462 3300025960 Ga0207651_10027485 Ga0207651_100274853 51
463 3300025960 Ga0207651_10036102 Ga0207651_100361023 51
464 3300025960 Ga0207651_10557619 Ga0207651_105576192 51
465 3300025960 Ga0207651_11900248 Ga0207651_119002482 51
466 3300025961 Ga0207712_10023403 Ga0207712_100234033 51
467 3300025961 Ga0207712_10965369 Ga0207712_109653691 51
468 3300025972 Ga0207668_10084141 Ga0207668_100841412 51
469 3300025972 Ga0207668_10100127 Ga0207668_101001273 51
470 3300025972 Ga0207668_10354506 Ga0207668_103545061 51
471 3300025972 Ga0207668_11108551 Ga0207668_111085512 51
472 3300025981 Ga0207640_11445143 Ga0207640_114451432 51
473 3300025986 Ga0207658_10044405 Ga0207658_100444053 51
474 3300025986 Ga0207658_10222823 Ga0207658_102228231 51
475 3300026023 Ga0207677_10731621 Ga0207677_107316212 51
476 3300026023 Ga0207677_10894698 Ga0207677_108946982 51
477 3300026023 Ga0207677_11467240 Ga0207677_114672402 51
478 3300026035 Ga0207703_10434283 Ga0207703_104342832 51
479 3300026035 Ga0207703_11032523 Ga0207703_110325232 51
480 3300026041 Ga0207639_11754384 Ga0207639_117543842 51
481 3300026041 Ga0207639_11795641 Ga0207639_117956411 51
482 3300026067 Ga0207678_10256661 Ga0207678_102566612 51
483 3300026075 Ga0207708_11281432 Ga0207708_112814322 51
484 3300026075 Ga0207708_11632039 Ga0207708_116320391 51
485 3300026078 Ga0207702_10475228 Ga0207702_104752282 51
486 3300026088 Ga0207641_10216513 Ga0207641_102165132 51
487 3300026088 Ga0207641_10656341 Ga0207641_106563411 51
488 3300026088 Ga0207641_11489943 Ga0207641_114899432 51
489 3300026089 Ga0207648_10169502 Ga0207648_101695023 51
490 3300026095 Ga0207676_10355600 Ga0207676_103556001 51
491 3300026095 Ga0207676_10755641 Ga0207676_107556411 51
492 3300026116 Ga0207674_10458397 Ga0207674_104583974 51
493 3300026116 Ga0207674_10812554 Ga0207674_108125541 51
494 3300026118 Ga0207675_101007002 Ga0207675_1010070021 51
495 3300026121 Ga0207683_10016271 Ga0207683_100162712 51
496 3300026121 Ga0207683_10248628 Ga0207683_102486283 51
497 3300026121 Ga0207683_10407482 Ga0207683_104074822 51
498 3300026142 Ga0207698_10131780 Ga0207698_101317802 51
499 3300026142 Ga0207698_10299967 Ga0207698_102999672 51
500 3300027378 Ga0209981_1062426 Ga0209981_10624262 51
501 3300027526 Ga0209968_1057160 Ga0209968_10571601 51
502 3300027552 Ga0209982_1015547 Ga0209982_10155472 51
503 3300027682 Ga0209971_1123283 Ga0209971_11232832 51
504 3300028036 Ga0265355_1012814 Ga0265355_10128141 51
505 3300028379 Ga0268266_10006370 Ga0268266_100063709 51
506 3300028379 Ga0268266_10135309 Ga0268266_101353092 51
507 3300028379 Ga0268266_10559615 Ga0268266_105596152 51
508 3300028379 Ga0268266_10626966 Ga0268266_106269663 51
509 3300028379 Ga0268266_12114939 Ga0268266_121149392 51
510 3300028380 Ga0268265_10461555 Ga0268265_104615552 51
511 3300028380 Ga0268265_12595783 Ga0268265_125957831 51
512 3300028381 Ga0268264_10012939 Ga0268264_100129393 51
513 3300028381 Ga0268264_10424735 Ga0268264_104247352 51
514 3300028381 Ga0268264_12003883 Ga0268264_120038831 51
515 3300028381 Ga0268264_12028106 Ga0268264_120281062 51
516 3300028556 Ga0265337_1008669 Ga0265337_10086696 51
517 3300028556 Ga0265337_1028298 Ga0265337_10282983 51
518 3300028556 Ga0265337_1131933 Ga0265337_11319332 51
519 3300028563 Ga0265319_1002037 Ga0265319_100203714 51
520 3300028563 Ga0265319_1031375 Ga0265319_10313753 51
521 3300028563 Ga0265319_1064233 Ga0265319_10642331 51
522 3300028563 Ga0265319_1096467 Ga0265319_10964672 51
523 3300028563 Ga0265319_1110446 Ga0265319_11104461 51
524 3300028573 Ga0265334_10312925 Ga0265334_103129252 51
525 3300028577 Ga0265318_10001738 Ga0265318_100017388 51
526 3300028577 Ga0265318_10012130 Ga0265318_100121303 51
527 3300028577 Ga0265318_10019765 Ga0265318_100197654 51
528 3300028577 Ga0265318_10044898 Ga0265318_100448983 51
529 3300028577 Ga0265318_10197805 Ga0265318_101978052 51
530 3300028577 Ga0265318_10232047 Ga0265318_102320471 51
531 3300028653 Ga0265323_10000099 Ga0265323_1000009962 51
532 3300028654 Ga0265322_10001283 Ga0265322_100012834 51
533 3300028654 Ga0265322_10006209 Ga0265322_100062094 51
534 3300028666 Ga0265336_10020125 Ga0265336_100201254 51
535 3300028666 Ga0265336_10275301 Ga0265336_102753012 51
536 3300028794 Ga0307515_10931129 Ga0307515_109311291 51
537 3300028800 Ga0265338_10005644 Ga0265338_100056443 51
538 3300028800 Ga0265338_10677112 Ga0265338_106771122 51
539 3300029957 Ga0265324_10001420 Ga0265324_1000142016 51
540 3300029957 Ga0265324_10243582 Ga0265324_102435821 51
541 3300031235 Ga0265330_10039095 Ga0265330_100390952 51
542 3300031238 Ga0265332_10357844 Ga0265332_103578442 51
543 3300031240 Ga0265320_10001237 Ga0265320_100012378 51
544 3300031240 Ga0265320_10004381 Ga0265320_100043813 51
545 3300031240 Ga0265320_10017280 Ga0265320_100172804 51
546 3300031240 Ga0265320_10068581 Ga0265320_100685813 51
547 3300031240 Ga0265320_10150533 Ga0265320_101505332 51
548 3300031240 Ga0265320_10236210 Ga0265320_102362102 51
549 3300031240 Ga0265320_10297203 Ga0265320_102972032 51
550 3300031242 Ga0265329_10254418 Ga0265329_102544181 51
551 3300031249 Ga0265339_10258411 Ga0265339_102584112 51
552 3300031250 Ga0265331_10093400 Ga0265331_100934003 51
553 3300031251 Ga0265327_10025399 Ga0265327_100253996 51
554 3300031251 Ga0265327_10036101 Ga0265327_100361013 51
555 3300031344 Ga0265316_10003494 Ga0265316_100034944 51
556 3300031344 Ga0265316_10065206 Ga0265316_100652065 51
557 3300031344 Ga0265316_10145614 Ga0265316_101456142 51
558 3300031456 Ga0307513_10134394 Ga0307513_101343942 51
559 3300031595 Ga0265313_10240782 Ga0265313_102407822 51
560 3300031711 Ga0265314_10021042 Ga0265314_100210426 51
561 3300031711 Ga0265314_10022950 Ga0265314_100229507 51
562 3300031711 Ga0265314_10027231 Ga0265314_100272318 51
563 3300031711 Ga0265314_10317472 Ga0265314_103174721 51
564 3300031711 Ga0265314_10355999 Ga0265314_103559992 51
565 3300031712 Ga0265342_10015002 Ga0265342_100150028 51
566 3300031712 Ga0265342_10581559 Ga0265342_105815591 51
567 3300031727 Ga0316576_10117945 Ga0316576_101179453 51
568 3300031727 Ga0316576_10192869 Ga0316576_101928692 51
569 3300032004 Ga0307414_11468770 Ga0307414_114687702 51
570 3300034820 Ga0373959_0056187 Ga0373959_0056187_238_393 51
571 3300034957 Ga0373938_0188058 Ga0373938_0188058_121_276 51
572 3300035083 Ga0373926_0159469 Ga0373926_0159469_49_204 51
573 3300035084 Ga0373928_0251095 Ga0373928_0251095_290_445 51
574 3300035086 Ga0373934_0058726 Ga0373934_0058726_1365_1520 51
575 3300035086 Ga0373934_0339259 Ga0373934_0339259_178_333 51
576 3300035111 Ga0373923_0311057 Ga0373923_0311057_496_651 51
577 3300035112 Ga0373932_0128680 Ga0373932_0128680_484_639 51
578 3300035116 Ga0373945_0351663 Ga0373945_0351663_153_308 51
579 3300035116 Ga0373945_0510295 Ga0373945_0510295_324_479 51
580 3300035119 Ga0373956_0252695 Ga0373956_0252695_573_728 51
581 3300035120 Ga0373957_0399272 Ga0373957_0399272_318_473 51
582 3300035170 Ga0373943_0109154 Ga0373943_0109154_976_1131 51
583 3300035170 Ga0373943_0399161 Ga0373943_0399161_449_604 51
584 3300035172 Ga0373955_0312226 Ga0373955_0312226_705_860 51
585 3300035172 Ga0373955_0692967 Ga0373955_0692967_58_213 51
586 3300035398 Ga0316574_0076909 Ga0316574_0076909_1457_1627 51
587 3300035410 Ga0373924_0201882 Ga0373924_0201882_227_382 51
588 3300035691 Ga0373931_0112406 Ga0373931_0112406_1038_1193 51
589 3300035691 Ga0373931_0284299 Ga0373931_0284299_199_354 51
590 3300035691 Ga0373931_0751138 Ga0373931_0751138_372_527 51
591 3300035692 Ga0373935_0035970 Ga0373935_0035970_2557_2712 51
592 3300035692 Ga0373935_0650139 Ga0373935_0650139_361_516 51
593 3300035692 Ga0373935_0853600 Ga0373935_0853600_72_227 51
594 3300035692 Ga0373935_0999866 Ga0373935_0999866_422_577 51
595 3300035724 Ga0373933_0459035 Ga0373933_0459035_446_601 51
596 3300035724 Ga0373933_0542845 Ga0373933_0542845_154_309 51
597 3300035724 Ga0373933_0781449 Ga0373933_0781449_284_439 51
598 3300035725 Ga0373947_0369122 Ga0373947_0369122_58_213 51
599 3300036401 Ga0373937_0256305 Ga0373937_0256305_59_214 51
600 3300036401 Ga0373937_0401574 Ga0373937_0401574_340_495 51
601 3300036401 Ga0373937_0519735 Ga0373937_0519735_817_972 51
602 3300036401 Ga0373937_0907185 Ga0373937_0907185_174_329 51
603 3300036401 Ga0373937_0975271 Ga0373937_0975271_330_485 51
604 3300036712 Ga0316584_0730727 Ga0316584_0730727_372_527 51
605 3300037068 Ga0373925_0180425 Ga0373925_0180425_426_581 51
606 3300037068 Ga0373925_0819674 Ga0373925_0819674_479_634 51
607 3300037068 Ga0373925_1304984 Ga0373925_1304984_163_318 51
608 3300037068 Ga0373925_1566869 Ga0373925_1566869_187_342 51
609 3300037068 Ga0373925_1744360 Ga0373925_1744360_31_186 51
610 3300037418 Ga0395900_1715591 Ga0395900_1715591_301_456 51
611 3300037466 Ga0395898_0504903 Ga0395898_0504903_54_209 51
612 3300037471 Ga0395905_0283797 Ga0395905_0283797_1275_1430 51
613 3300038443 Ga0395901_0035188 Ga0395901_0035188_52_207 51
614 3300039450 Ga0436363_0679613 Ga0436363_0679613_516_671 51
615 3300041441 Ga0451787_435827 Ga0451787_435827_264_419 51
616 3300041441 Ga0451787_554291 Ga0451787_554291_96_251 51
617 3300041459 Ga0451800_1293054 Ga0451800_1293054_40_195 51
618 3300041459 Ga0451800_1607111 Ga0451800_1607111_176_331 51
619 3300041460 Ga0451802_0336535 Ga0451802_0336535_392_547 51
620 3300041463 Ga0451804_1183500 Ga0451804_1183500_72_227 51
621 3300041486 Ga0451807_2567572 Ga0451807_2567572_60_215 51
622 3300041511 Ga0451855_0439774 Ga0451855_0439774_353_508 51
623 3300041511 Ga0451855_0788558 Ga0451855_0788558_396_551 51
624 3300041511 Ga0451855_1540872 Ga0451855_1540872_23_178 51
625 3300041512 Ga0451853_1381405 Ga0451853_1381405_318_473 51
626 3300041997 Ga0439431_0025188 Ga0439431_0025188_1261_1416 51
627 3300042001 Ga0439441_094175 Ga0439441_094175_212_370 51
628 3300042012 Ga0439455_0103449 Ga0439455_0103449_305_460 51
629 3300042876 Ga0451577_0000024 Ga0451577_0000024_105122_105277 51
630 3300042876 Ga0451577_0003560 Ga0451577_0003560_8432_8590 51
631 3300042876 Ga0451577_0052256 Ga0451577_0052256_2539_2694 51
632 3300042876 Ga0451577_0478824 Ga0451577_0478824_148_303 51
633 3300042876 Ga0451577_1228123 Ga0451577_1228123_147_302 51
634 3300044673 Ga0453683_0001980 Ga0453683_0001980_9051_9206 51
635 3300044684 Ga0466966_0587687 Ga0466966_0587687_41_196 51
636 3300044712 Ga0453684_0019118 Ga0453684_0019118_2928_3086 51
637 3300044712 Ga0453684_0203186 Ga0453684_0203186_306_461 51
638 3300044712 Ga0453684_0239001 Ga0453684_0239001_1082_1240 51
639 3300044712 Ga0453684_0305967 Ga0453684_0305967_1629_1784 51
640 3300044712 Ga0453684_0384225 Ga0453684_0384225_1400_1555 51
641 3300044712 Ga0453684_1116526 Ga0453684_1116526_396_551 51
642 3300045051 Ga0451576_0001983 Ga0451576_0001983_31861_32016 51
643 3300045051 Ga0451576_0134263 Ga0451576_0134263_469_624 51
644 3300045051 Ga0451576_0173995 Ga0451576_0173995_1738_1893 51
645 3300045051 Ga0451576_0962737 Ga0451576_0962737_91_246 51
646 3300045051 Ga0451576_1380589 Ga0451576_1380589_78_233 51
647 3300045051 Ga0451576_1452948 Ga0451576_1452948_467_622 51
648 3300046454 Ga0495592_0013392 Ga0495592_0013392_5950_6105 51
649 3300046454 Ga0495592_0125465 Ga0495592_0125465_1234_1389 51
650 3300046462 Ga0495651_0231279 Ga0495651_0231279_477_632 51
651 3300046462 Ga0495651_1008102 Ga0495651_1008102_43_198 51
652 3300046463 Ga0495653_0233034 Ga0495653_0233034_858_1013 51
653 3300046472 Ga0495580_1045287 Ga0495580_1045287_339_494 51
654 3300046474 Ga0495605_0348170 Ga0495605_0348170_438_593 51
655 3300046476 Ga0495662_0277705 Ga0495662_0277705_53_208 51
656 3300046477 Ga0495664_0172395 Ga0495664_0172395_894_1049 51
657 3300046492 Ga0495585_0416442 Ga0495585_0416442_430_585 51
658 3300046511 Ga0495608_0070882 Ga0495608_0070882_710_865 51
659 3300046514 Ga0495618_0268202 Ga0495618_0268202_295_450 51
660 3300046516 Ga0495628_0013312 Ga0495628_0013312_5799_5954 51
661 3300046517 Ga0495630_0577946 Ga0495630_0577946_495_650 51
662 3300046526 Ga0495666_0455222 Ga0495666_0455222_299_454 51
663 3300046529 Ga0495652_0157967 Ga0495652_0157967_1024_1179 51
664 3300046533 Ga0495640_0606945 Ga0495640_0606945_232_387 51
665 3300046535 Ga0495586_0321968 Ga0495586_0321968_549_704 51
666 3300046535 Ga0495586_0526122 Ga0495586_0526122_226_381 51
667 3300046536 Ga0495587_0019137 Ga0495587_0019137_2431_2586 51
668 3300046539 Ga0495621_0155101 Ga0495621_0155101_572_727 51
669 3300046539 Ga0495621_0304394 Ga0495621_0304394_60_215 51
670 3300046543 Ga0495645_0054596 Ga0495645_0054596_42_197 51
671 3300046559 Ga0495667_0254506 Ga0495667_0254506_721_876 51
672 3300046559 Ga0495667_0914196 Ga0495667_0914196_14_169 51
673 3300046615 Ga0495656_0686161 Ga0495656_0686161_343_498 51
674 3300046642 Ga0495634_0667658 Ga0495634_0667658_10_165 51
675 3300046642 Ga0495634_0713298 Ga0495634_0713298_300_455 51
676 3300046663 Ga0495635_0841456 Ga0495635_0841456_77_232 51
677 3300046675 Ga0495657_0192992 Ga0495657_0192992_657_812 51
678 3300046678 Ga0495599_0051576 Ga0495599_0051576_365_520 51
679 3300046678 Ga0495599_0124141 Ga0495599_0124141_10_165 51
680 3300046679 Ga0495623_0184038 Ga0495623_0184038_427_582 51
681 3300046679 Ga0495623_0319035 Ga0495623_0319035_498_653 51
682 3300046680 Ga0495646_0058358 Ga0495646_0058358_1666_1821 51
683 3300046680 Ga0495646_0256783 Ga0495646_0256783_391_546 51
684 3300046681 Ga0495647_0425958 Ga0495647_0425958_310_465 51
685 3300046683 Ga0495658_1120571 Ga0495658_1120571_267_422 51
686 3300046684 Ga0495669_0370664 Ga0495669_0370664_415_570 51
687 3300046689 Ga0495613_0226083 Ga0495613_0226083_1019_1174 51
688 3300046794 Ga0495589_0501353 Ga0495589_0501353_208_363 51
689 3300047317 Ga0495604_0145945 Ga0495604_0145945_615_770 51
690 3300047318 Ga0495636_0339101 Ga0495636_0339101_285_440 51
691 3300047319 Ga0495674_0625847 Ga0495674_0625847_576_731 51
692 3300047319 Ga0495674_1435505 Ga0495674_1435505_48_203 51
693 3300047322 Ga0495680_1044156 Ga0495680_1044156_264_419 51
694 3300047444 Ga0495675_0117539 Ga0495675_0117539_504_659 51
695 3300047444 Ga0495675_0150774 Ga0495675_0150774_333_488 51
696 3300047471 Ga0495684_0134647 Ga0495684_0134647_1612_1767 51
697 3300047471 Ga0495684_0534245 Ga0495684_0534245_543_698 51
698 3300047471 Ga0495684_1071936 Ga0495684_1071936_129_284 51
699 3300048088 Ga0495602_0039071 Ga0495602_0039071_1816_1971 51
700 3300048903 Ga0496100_0284215 Ga0496100_0284215_916_1071 51
701 3300048903 Ga0496100_0930691 Ga0496100_0930691_12_167 51
702 3300048904 Ga0496101_0087055 Ga0496101_0087055_257_412 51
703 3300048905 Ga0496102_0087642 Ga0496102_0087642_2225_2380 51
704 3300048906 Ga0496103_0038392 Ga0496103_0038392_2128_2283 51
705 3300048907 Ga0496104_0673460 Ga0496104_0673460_463_618 51
706 3300048908 Ga0496105_0094436 Ga0496105_0094436_1684_1839 51
707 3300048908 Ga0496105_1218231 Ga0496105_1218231_308_463 51
708 3300048909 Ga0496106_0714584 Ga0496106_0714584_90_245 51
709 3300048910 Ga0496107_1020514 Ga0496107_1020514_264_419 51
710 3300048911 Ga0496108_0004565 Ga0496108_0004565_6424_6579 51
711 3300048911 Ga0496108_0396272 Ga0496108_0396272_851_1006 51
712 3300048911 Ga0496108_0565665 Ga0496108_0565665_73_228 51
713 3300048912 Ga0496109_0001915 Ga0496109_0001915_5084_5239 51
714 3300048912 Ga0496109_0322563 Ga0496109_0322563_43_198 51
715 3300048912 Ga0496109_1157768 Ga0496109_1157768_102_257 51
716 3300048912 Ga0496109_1572912 Ga0496109_1572912_245_400 51
717 3300048913 Ga0496110_0152975 Ga0496110_0152975_1070_1225 51
718 3300048913 Ga0496110_1342367 Ga0496110_1342367_90_245 51
719 3300048914 Ga0496111_0567086 Ga0496111_0567086_110_265 51
720 3300048915 Ga0496112_0025463 Ga0496112_0025463_593_748 51
721 3300048915 Ga0496112_0434274 Ga0496112_0434274_565_720 51
722 3300048915 Ga0496112_0477784 Ga0496112_0477784_376_531 51
723 3300048915 Ga0496112_1129781 Ga0496112_1129781_419_574 51
724 3300048915 Ga0496112_1171874 Ga0496112_1171874_188_343 51
725 3300048916 Ga0496113_0028316 Ga0496113_0028316_3814_3969 51
726 3300048916 Ga0496113_0805258 Ga0496113_0805258_486_641 51
727 3300048917 Ga0496114_0046150 Ga0496114_0046150_1720_1875 51
728 3300048917 Ga0496114_0879287 Ga0496114_0879287_382_537 51
729 3300048918 Ga0496115_0116008 Ga0496115_0116008_538_693 51
730 3300048924 Ga0496121_0520434 Ga0496121_0520434_145_300 51
731 3300049568 Ga0501031_0066289 Ga0501031_0066289_683_838 51
732 3300049569 Ga0501032_0000745 Ga0501032_0000745_6037_6192 51
733 3300049569 Ga0501032_0168601 Ga0501032_0168601_557_712 51
734 3300049570 Ga0501033_0005513 Ga0501033_0005513_8342_8497 51
735 3300049571 Ga0501034_0103914 Ga0501034_0103914_366_521 51
736 3300049572 Ga0501036_0016442 Ga0501036_0016442_2519_2674 51
737 3300049573 Ga0501037_0039911 Ga0501037_0039911_1961_2116 51
738 3300049573 Ga0501037_0063862 Ga0501037_0063862_758_913 51
739 3300049573 Ga0501037_0755580 Ga0501037_0755580_260_415 51
740 3300049574 Ga0501038_0003275 Ga0501038_0003275_7341_7496 51
741 3300049575 Ga0501039_0015427 Ga0501039_0015427_5508_5663 51
742 3300049577 Ga0501041_0982667 Ga0501041_0982667_361_516 51
743 3300049578 Ga0501042_0007405 Ga0501042_0007405_2893_3048 51
744 3300049579 Ga0501043_0050601 Ga0501043_0050601_728_883 51
745 3300049580 Ga0501046_0004222 Ga0501046_0004222_11082_11237 51
746 3300049580 Ga0501046_0007686 Ga0501046_0007686_6001_6156 51
747 3300049580 Ga0501046_0014662 Ga0501046_0014662_5363_5518 51
748 3300049580 Ga0501046_0744830 Ga0501046_0744830_291_446 51
749 3300049581 Ga0501047_0035347 Ga0501047_0035347_3366_3521 51
750 3300049581 Ga0501047_0052141 Ga0501047_0052141_886_1041 51
751 3300049581 Ga0501047_0052377 Ga0501047_0052377_167_322 51
752 3300049581 Ga0501047_1087351 Ga0501047_1087351_239_394 51
753 3300049582 Ga0501048_0005753 Ga0501048_0005753_4534_4689 51
754 3300049582 Ga0501048_0246029 Ga0501048_0246029_917_1072 51
755 3300049586 Ga0501070_0009556 Ga0501070_0009556_3570_3725 51
756 3300049586 Ga0501070_0115335 Ga0501070_0115335_1146_1301 51
757 3300049586 Ga0501070_0274592 Ga0501070_0274592_462_617 51
758 3300049587 Ga0501071_0502577 Ga0501071_0502577_366_521 51
759 3300049742 Ga0501080_0174419 Ga0501080_0174419_1266_1421 51
760 3300049742 Ga0501080_0391058 Ga0501080_0391058_273_428 51
761 3300049744 Ga0501083_0015708 Ga0501083_0015708_2002_2157 51
762 3300049744 Ga0501083_0044333 Ga0501083_0044333_575_730 51
763 3300049822 Ga0501035_0008262 Ga0501035_0008262_6631_6786 51
764 3300049822 Ga0501035_0254630 Ga0501035_0254630_940_1095 51
765 3300049822 Ga0501035_0321807 Ga0501035_0321807_202_357 51
766 3300049823 Ga0501044_0012985 Ga0501044_0012985_2928_3083 51
767 3300049823 Ga0501044_0017234 Ga0501044_0017234_2428_2583 51
768 3300049823 Ga0501044_0345009 Ga0501044_0345009_1125_1280 51
769 3300049824 Ga0501045_0029555 Ga0501045_0029555_1090_1245 51
770 3300050507 nmdc:mga05p37_2087914_c1 nmdc:mga05p37_2087914_c1_230_385 51
771 3300050507 nmdc:mga05p37_361162_c1 nmdc:mga05p37_361162_c1_155_310 51
772 3300050507 nmdc:mga05p37_497648_c1 nmdc:mga05p37_497648_c1_354_509 51
773 3300050508 nmdc:mga09592_1318437_c1 nmdc:mga09592_1318437_c1_225_380 51
774 3300050508 nmdc:mga09592_160331_c1 nmdc:mga09592_160331_c1_786_941 51
775 3300050509 nmdc:mga0qj67_1338832_c1 nmdc:mga0qj67_1338832_c1_331_486 51
776 3300050511 nmdc:mga08y16_1042022_c1 nmdc:mga08y16_1042022_c1_459_614 51
777 3300050511 nmdc:mga08y16_1071323_c1 nmdc:mga08y16_1071323_c1_59_214 51
778 3300050511 nmdc:mga08y16_1191288_c1 nmdc:mga08y16_1191288_c1_71_226 51
779 3300050511 nmdc:mga08y16_295343_c1 nmdc:mga08y16_295343_c1_433_588 51
780 3300050511 nmdc:mga08y16_666385_c1 nmdc:mga08y16_666385_c1_863_1018 51
781 3300050512 nmdc:mga0n895_1046999_c1 nmdc:mga0n895_1046999_c1_447_602 51
782 3300050512 nmdc:mga0n895_163793_c1 nmdc:mga0n895_163793_c1_874_1029 51
783 3300050512 nmdc:mga0n895_1868875_c1 nmdc:mga0n895_1868875_c1_222_377 51
784 3300050512 nmdc:mga0n895_315777_c1 nmdc:mga0n895_315777_c1_1258_1413 51
785 3300050513 nmdc:mga0rr50_870115_c1 nmdc:mga0rr50_870115_c1_376_531 51
786 3300050514 nmdc:mga08x19_1327885_c1 nmdc:mga08x19_1327885_c1_200_355 51
787 3300050514 nmdc:mga08x19_200436_c1 nmdc:mga08x19_200436_c1_614_769 51
788 3300050515 nmdc:mga0a205_263999_c1 nmdc:mga0a205_263999_c1_195_350 51
789 3300050515 nmdc:mga0a205_332060_c1 nmdc:mga0a205_332060_c1_57_212 51
790 3300050515 nmdc:mga0a205_441378_c1 nmdc:mga0a205_441378_c1_247_402 51
791 3300050516 nmdc:mga0sz30_262647_c1 nmdc:mga0sz30_262647_c1_306_461 51
792 3300053077 Ga0495601_0036457 Ga0495601_0036457_728_883 51
793 3300053077 Ga0495601_0208809 Ga0495601_0208809_348_503 51
794 3300053078 Ga0495612_0276890 Ga0495612_0276890_407_562 51
795 3300053084 Ga0495595_0084468 Ga0495595_0084468_1156_1311 51
796 3300053084 Ga0495595_0180017 Ga0495595_0180017_801_956 51
797 3300053084 Ga0495595_0246216 Ga0495595_0246216_413_568 51
798 3300053084 Ga0495595_0299557 Ga0495595_0299557_118_273 51
799 3300053085 Ga0495619_0213428 Ga0495619_0213428_780_935 51
800 3300053085 Ga0495619_0704222 Ga0495619_0704222_55_210 51
801 3300053087 Ga0500643_102775 Ga0500643_102775_390_545 51
802 3300053140 Ga0500573_0300800 Ga0500573_0300800_137_292 51
803 3300053727 Ga0500611_009469 Ga0500611_009469_1213_1368 51
804 3300060353 Ga0501082_0061321 Ga0501082_0061321_2742_2897 51
805 3300060353 Ga0501082_1732053 Ga0501082_1732053_240_395 51
806 3300060353 Ga0501082_1982160 Ga0501082_1982160_22_180 51
807 3300061719 Ga0466962_0371178 Ga0466962_0371178_523_678 51

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n74-assembly1.cif.gz_A crystal structure of atpase delta1-79 spa47 r271e 0.7709 8 40
6n75-assembly1.cif.gz_A crystal structure of atpase delta1-79 spa47 e287a 0.7691 8 40
5syr-assembly1.cif.gz_A crystal structure of atpase delta1-79 spa47 r350a 0.7675 8 40
6n74-assembly2.cif.gz_B crystal structure of atpase delta1-79 spa47 r271e 0.7643 8 40
5syp-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7633 8 40
ID Description Score Start End Superfamily
3u62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8047 18 37 3.40.50.10860
af_A0A060D798_142_368_1.25.70.10 Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial 0.7415 20 42 1.25.70.10
af_Q53LJ1_243_436_1.25.70.10 Mainly Alpha;Alpha Horseshoe;Transcription termination factor 3, mitochondrial;Transcription termination factor 3, mitochondrial 0.699 20 39 1.25.70.10
4nphA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.6052 9 40 1.20.1270.330
af_Q7PLG1_250_780_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5158 7 45 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1G1MHF0-F1-model_v4 Small basic protein 0.8792 22 51
AF-A0A521GV40-F1-model_v4 Small basic protein 0.8176 22 51
AF-A0A5C5X6P1-F1-model_v4 Small basic protein 0.5678 1 51
AF-A0A1J5TB08-F1-model_v4 Small basic protein 0.5661 1 51
AF-A0A5C5X6P1-F1-model_v4 Small basic protein 0.5576 1 51

Feature Viewer

pLDDT pTM Quality
79.86 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map