F481674

General Info

Members Datasets Scaffolds Average Seq Length
807 415 792 87

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_102616279|Ga0068852_1026162791
Length 97
Sequence MSLLSFLLGEKKKTAGVAKERLQIILAHERVGRNAGNAPDYLPALQRDLIAVISKYVKIDPTHLKVNVDRQDNLEVLEVKIELPDPPVGKVVAKVAR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2721755523 Delftia sp. HK171 Isolate Unclassified
3 2831864461 Roseateles noduli HZ7 Isolate Nodule
4 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
5 2855730933 Achromobacter sp. HZ28 Isolate Nodule
6 2855767633 Achromobacter sp. HZ34 Isolate Nodule
7 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
8 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
9 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
10 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
11 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
12 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
13 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
14 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
30 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
115 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
116 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
131 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
151 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
158 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
230 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
240 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
243 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
244 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
245 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
248 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
268 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
278 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
279 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
280 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
281 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
282 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
283 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
284 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
285 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
286 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
287 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
288 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
289 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
290 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
291 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
292 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
293 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
294 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
295 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
296 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
297 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
298 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
299 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
300 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
301 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
302 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
303 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
304 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
305 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
306 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
307 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
308 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
309 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
310 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
311 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
312 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
313 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
314 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
315 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
316 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
317 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
320 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
321 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
325 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
326 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
327 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
328 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
329 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
332 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
335 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
336 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
337 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
346 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
347 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
348 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
349 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
350 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
379 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
382 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
383 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
399 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
403 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
404 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
405 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
406 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
412 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
413 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0.25
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.18
Nodule 1.24
Rhizoplane 3.22
Rhizosphere 65.92
Stem 0
Stem Tuber 0
Unclassified 7.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000154 3300002704 Bacteria 31016
2 JGI25156J39149_1000067 3300002705 Bacteria 82796
3 JGI25156J39149_1000419 3300002705 Bacteria 26375
4 JGI25156J39149_1026593 3300002705 Bacteria 915
5 JGI25154J39366_1000089 3300002738 Bacteria 82796
6 JGI25154J39366_1002043 3300002738 Bacteria 5796
7 JGI25157J39369_1000084 3300002741 Bacteria 82796
8 JGI25157J39369_1000174 3300002741 Bacteria 54162
9 JGI25164J39214_1003316 3300002772 Bacteria 2079
10 JGI25152J39213_1048253 3300002773 Bacteria 565
11 JGI25150J39212_1006313 3300002774 Bacteria 2456
12 JGI25150J39212_1036639 3300002774 Bacteria 650
13 JGI25159J45721_1000314 3300002987 Bacteria 22609
14 JGI25159J45721_1017200 3300002987 Bacteria 1505
15 JGI25151J46595_10004306 3300003187 Bacteria 7560
16 JGI25151J46595_10013319 3300003187 Bacteria 3705
17 JGI25151J46595_10037114 3300003187 Bacteria 1830
18 rootH1_10022997 3300003316 Bacteria 4610
19 rootH1_10036997 3300003316 Bacteria 4526
20 rootH2_10010510 3300003320 Bacteria 5487
21 rootH2_10037754 3300003320 Bacteria 3877
22 rootH2_10081249 3300003320 Bacteria 2366
23 rootL2_10018076 3300003322 Bacteria 7888
24 rootL2_10025710 3300003322 Bacteria 4037
25 rootH1_10008020 3300003323 Bacteria 6429
26 rootH1_10013777 3300003323 Bacteria 2190
27 rootH1_10013778 3300003323 Bacteria 1507
28 rootH1_10121381 3300003323 Bacteria 1826
29 rootH1_10299180 3300003323 Bacteria 1307
30 JGI25160J50197_1000131 3300003354 Bacteria 67778
31 JGI25160J50197_1036872 3300003354 Bacteria 1179
32 JGI25161J50226_1000009 3300003374 Bacteria 224699
33 Ga0055539_1010866 3300003752 Bacteria 1126
34 Ga0055533_1000011 3300003756 Bacteria 467893
35 Ga0055525_1000989 3300003759 Bacteria 7651
36 Ga0055535_1000097 3300003761 Bacteria 95927
37 Ga0055535_1024006 3300003761 Bacteria 706
38 Ga0055529_1000202 3300003763 Bacteria 79179
39 Ga0055529_1001828 3300003763 Bacteria 5060
40 Ga0055526_1002155 3300003771 Bacteria 13493
41 Ga0055526_1007332 3300003771 Bacteria 5762
42 Ga0055526_1042022 3300003771 Bacteria 1131
43 Ga0055537_1003449 3300003773 Bacteria 4860
44 Ga0055537_1017660 3300003773 Bacteria 1165
45 Ga0055524_1000047 3300003775 Bacteria 150887
46 Ga0055524_1000554 3300003775 Bacteria 28221
47 Ga0055524_1007049 3300003775 Bacteria 4826
48 Ga0055536_1010008 3300003781 Bacteria 3832
49 Ga0055534_1024781 3300003784 Bacteria 969
50 Ga0055528_1001275 3300003790 Bacteria 15847
51 Ga0055528_1020790 3300003790 Bacteria 2114
52 Ga0055528_1043631 3300003790 Bacteria 974
53 Ga0055530_10001499 3300003791 Bacteria 16950
54 Ga0055530_10026106 3300003791 Bacteria 1620
55 Ga0055530_10033421 3300003791 Bacteria 1326
56 Ga0055540_1000027 3300003792 Bacteria 187454
57 Ga0055540_1006840 3300003792 Bacteria 4437
58 Ga0055540_1029832 3300003792 Bacteria 1273
59 Ga0055531_10000312 3300003794 Bacteria 47848
60 Ga0055531_10002146 3300003794 Bacteria 13489
61 Ga0055531_10003057 3300003794 Bacteria 10840
62 Ga0055531_10009223 3300003794 Bacteria 5075
63 Ga0055543_1000122 3300004625 Bacteria 65110
64 Ga0055543_1076764 3300004625 Bacteria 518
65 Ga0065165_1000283 3300005262 Bacteria 86141
66 Ga0065165_1000935 3300005262 Bacteria 37344
67 Ga0065165_1019851 3300005262 Bacteria 2385
68 Ga0065165_1020045 3300005262 Bacteria 2368
69 Ga0065165_1104882 3300005262 Bacteria 703
70 Ga0065714_10092872 3300005288 Bacteria 1863
71 Ga0065704_10101871 3300005289 Bacteria 2223
72 Ga0065707_10286322 3300005295 Bacteria 1035
73 Ga0070658_10063772 3300005327 Bacteria 3004
74 Ga0070658_10064006 3300005327 Bacteria 2999
75 Ga0070658_10177994 3300005327 Bacteria 1789
76 Ga0070658_10221641 3300005327 Bacteria 1600
77 Ga0070658_10810179 3300005327 Bacteria 814
78 Ga0070658_11241450 3300005327 Bacteria 648
79 Ga0070676_10016974 3300005328 Bacteria 4024
80 Ga0070676_10049433 3300005328 Bacteria 2462
81 Ga0070683_102440058 3300005329 Bacteria 501
82 Ga0070690_100104539 3300005330 Bacteria 1881
83 Ga0070670_100012213 3300005331 Bacteria 7346
84 Ga0070670_100301079 3300005331 Bacteria 1403
85 Ga0070677_10003281 3300005333 Bacteria 5209
86 Ga0070677_10047184 3300005333 Bacteria 1726
87 Ga0068869_100006181 3300005334 Bacteria 7580
88 Ga0068869_100610853 3300005334 Bacteria 922
89 Ga0070666_10190296 3300005335 Bacteria 1442
90 Ga0070666_10443233 3300005335 Bacteria 937
91 Ga0070680_101998320 3300005336 Bacteria 502
92 Ga0068868_100830482 3300005338 Bacteria 836
93 Ga0068868_100853073 3300005338 Bacteria 825
94 Ga0068868_101770327 3300005338 Bacteria 583
95 Ga0070660_100021704 3300005339 Bacteria 4739
96 Ga0070660_100056954 3300005339 Bacteria 3026
97 Ga0070660_100529851 3300005339 Bacteria 981
98 Ga0070689_101084522 3300005340 Bacteria 715
99 Ga0070691_10131246 3300005341 Bacteria 1270
100 Ga0070687_100935021 3300005343 Bacteria 624
101 Ga0070661_101259256 3300005344 Bacteria 620
102 Ga0070661_101501979 3300005344 Bacteria 568
103 Ga0070692_11193217 3300005345 Bacteria 541
104 Ga0070669_100002753 3300005353 Bacteria 12687
105 Ga0070675_100000137 3300005354 Bacteria 44007
106 Ga0070675_100011301 3300005354 Bacteria 6987
107 Ga0070675_101246534 3300005354 Bacteria 685
108 Ga0070671_100006504 3300005355 Bacteria 9343
109 Ga0070671_100021060 3300005355 Bacteria 5323
110 Ga0070671_101174924 3300005355 Bacteria 675
111 Ga0070671_101918997 3300005355 Bacteria 527
112 Ga0070674_100055843 3300005356 Bacteria 2737
113 Ga0070674_100124598 3300005356 Bacteria 1912
114 Ga0070673_100011122 3300005364 Bacteria 6135
115 Ga0070673_100787828 3300005364 Bacteria 877
116 Ga0070673_100922332 3300005364 Bacteria 811
117 Ga0070673_101779635 3300005364 Bacteria 584
118 Ga0070688_100185921 3300005365 Bacteria 1444
119 Ga0070659_100011135 3300005366 Bacteria 6643
120 Ga0070659_100500500 3300005366 Bacteria 1036
121 Ga0070667_100045834 3300005367 Bacteria 3678
122 Ga0070667_101217262 3300005367 Bacteria 705
123 Ga0070700_101956878 3300005441 Bacteria 508
124 Ga0070708_100602428 3300005445 Bacteria 1036
125 Ga0070708_101688532 3300005445 Bacteria 589
126 Ga0070663_101086822 3300005455 Bacteria 699
127 Ga0070678_100085936 3300005456 Bacteria 2398
128 Ga0070678_100129530 3300005456 Bacteria 2002
129 Ga0070678_100136476 3300005456 Bacteria 1957
130 Ga0070662_101533417 3300005457 Bacteria 575
131 Ga0070662_101814173 3300005457 Bacteria 527
132 Ga0070681_11687238 3300005458 Bacteria 560
133 Ga0068867_100005126 3300005459 Bacteria 9258
134 Ga0068867_100015020 3300005459 Bacteria 5489
135 Ga0068867_100134651 3300005459 Bacteria 1924
136 Ga0070685_10148826 3300005466 Bacteria 1482
137 Ga0070685_10483596 3300005466 Bacteria 873
138 Ga0070685_10854841 3300005466 Bacteria 674
139 Ga0070707_100229616 3300005468 Bacteria 1807
140 Ga0070679_100076511 3300005530 Bacteria 3336
141 Ga0070684_100022047 3300005535 Bacteria 5308
142 Ga0068853_100115161 3300005539 Bacteria 2392
143 Ga0068853_100630848 3300005539 Bacteria 1019
144 Ga0068853_100965636 3300005539 Bacteria 820
145 Ga0068853_101486943 3300005539 Bacteria 656
146 Ga0070672_100000520 3300005543 Bacteria 22520
147 Ga0070665_100846338 3300005548 Bacteria 928
148 Ga0070665_101994326 3300005548 Bacteria 586
149 Ga0068855_100000971 3300005563 Bacteria 35725
150 Ga0068855_100022188 3300005563 Bacteria 7607
151 Ga0068855_100029769 3300005563 Bacteria 6529
152 Ga0068855_100307735 3300005563 Bacteria 1754
153 Ga0068855_100744297 3300005563 Bacteria 1046
154 Ga0068855_102606391 3300005563 Bacteria 501
155 Ga0070664_100160216 3300005564 Bacteria 1991
156 Ga0070664_101668593 3300005564 Bacteria 604
157 Ga0070664_102254076 3300005564 Bacteria 517
158 Ga0068857_100003123 3300005577 Bacteria 13705
159 Ga0068857_100531184 3300005577 Bacteria 1106
160 Ga0068854_100030573 3300005578 Bacteria 3736
161 Ga0068856_100000951 3300005614 Bacteria 31014
162 Ga0068856_100288493 3300005614 Bacteria 1658
163 Ga0068852_100777559 3300005616 Bacteria 971
164 Ga0068852_101828204 3300005616 Bacteria 630
165 Ga0068852_102616279 3300005616 Bacteria 524
166 Ga0068852_102668876 3300005616 Bacteria 519
167 Ga0068864_100050509 3300005618 Bacteria 3580
168 Ga0068864_100744594 3300005618 Bacteria 960
169 Ga0068866_10562771 3300005718 Bacteria 764
170 Ga0068861_100021114 3300005719 Bacteria 4679
171 Ga0068851_10019074 3300005834 Bacteria 3314
172 Ga0068851_11016655 3300005834 Bacteria 523
173 Ga0068870_10165055 3300005840 Bacteria 1317
174 Ga0068863_100825863 3300005841 Bacteria 925
175 Ga0068863_101866102 3300005841 Bacteria 611
176 Ga0068860_100203759 3300005843 Bacteria 1918
177 Ga0068862_101354676 3300005844 Bacteria 714
178 Ga0081538_10061611 3300005981 Bacteria 2146
179 Ga0075365_10005107 3300006038 Bacteria 7046
180 Ga0075365_10142421 3300006038 Bacteria 1664
181 Ga0075365_10182253 3300006038 Bacteria 1468
182 Ga0075365_10314983 3300006038 Bacteria 1102
183 Ga0075365_10970646 3300006038 Bacteria 599
184 Ga0075368_10015246 3300006042 Bacteria 2848
185 Ga0075363_100015256 3300006048 Bacteria 3774
186 Ga0075363_100088103 3300006048 Bacteria 1706
187 Ga0075363_100407215 3300006048 Bacteria 800
188 Ga0075363_100696936 3300006048 Bacteria 613
189 Ga0075363_100821783 3300006048 Bacteria 566
190 Ga0075364_10049130 3300006051 Bacteria 2750
191 Ga0075362_10055281 3300006177 Bacteria 1785
192 Ga0075362_10120303 3300006177 Bacteria 1242
193 Ga0075367_10007807 3300006178 Bacteria 5503
194 Ga0075367_10194618 3300006178 Bacteria 1266
195 Ga0075367_10737124 3300006178 Bacteria 627
196 Ga0075366_10057805 3300006195 Bacteria 2304
197 Ga0075366_10064724 3300006195 Bacteria 2174
198 Ga0075366_10105355 3300006195 Bacteria 1695
199 Ga0097621_100060641 3300006237 Bacteria 3101
200 Ga0097621_101311968 3300006237 Bacteria 684
201 Ga0097621_102379452 3300006237 Bacteria 507
202 Ga0075370_10009248 3300006353 Bacteria 5108
203 Ga0075370_10224485 3300006353 Bacteria 1111
204 Ga0075370_10611129 3300006353 Bacteria 661
205 Ga0068871_100030494 3300006358 Bacteria 4247
206 Ga0075430_100054008 3300006846 Bacteria 3381
207 Ga0075430_100085353 3300006846 Bacteria 2643
208 Ga0075429_100003208 3300006880 Bacteria 13911
209 Ga0075429_100145689 3300006880 Bacteria 2073
210 Ga0075429_101799522 3300006880 Bacteria 531
211 Ga0068865_100396283 3300006881 Bacteria 1130
212 Ga0068865_100577957 3300006881 Bacteria 947
213 Ga0068865_101581802 3300006881 Bacteria 589
214 Ga0099824_1066035 3300006942 Bacteria 551
215 Ga0099823_1007351 3300006944 Bacteria 11174
216 Ga0079104_1000008 3300006946 Bacteria 371223
217 Ga0099826_10253071 3300006948 Bacteria 927
218 Ga0105250_10000043 3300009092 Bacteria 129336
219 Ga0105240_10001650 3300009093 Bacteria 37876
220 Ga0105240_10019163 3300009093 Bacteria 9148
221 Ga0105240_10026802 3300009093 Bacteria 7558
222 Ga0105240_10027737 3300009093 Bacteria 7411
223 Ga0105240_10780051 3300009093 Bacteria 1037
224 Ga0105240_11026253 3300009093 Bacteria 881
225 Ga0105240_11821040 3300009093 Bacteria 634
226 Ga0111539_11262287 3300009094 Bacteria 857
227 Ga0105245_10648020 3300009098 Bacteria 1086
228 Ga0105245_11767656 3300009098 Bacteria 671
229 Ga0114129_10086267 3300009147 Bacteria 4354
230 Ga0105243_10002163 3300009148 Bacteria 16598
231 Ga0105243_10416431 3300009148 Bacteria 1252
232 Ga0105243_10853324 3300009148 Bacteria 902
233 Ga0105243_12416204 3300009148 Bacteria 564
234 Ga0105241_10206283 3300009174 Bacteria 1645
235 Ga0105242_10489349 3300009176 Bacteria 1167
236 Ga0105237_10001445 3300009545 Bacteria 31382
237 Ga0105237_10437550 3300009545 Bacteria 1313
238 Ga0105237_12759218 3300009545 Bacteria 502
239 Ga0105238_10006278 3300009551 Bacteria 11811
240 Ga0105238_10023931 3300009551 Bacteria 6225
241 Ga0105238_10046256 3300009551 Bacteria 4393
242 Ga0105249_10635990 3300009553 Bacteria 1124
243 Ga0105249_12154526 3300009553 Bacteria 630
244 Ga0105249_12407406 3300009553 Bacteria 599
245 Ga0105239_10002359 3300010375 Bacteria 24075
246 Ga0105239_10142228 3300010375 Bacteria 2674
247 Ga0105239_13090582 3300010375 Bacteria 542
248 Ga0157319_1000009 3300012497 Bacteria 227971
249 Ga0157326_1003398 3300012513 Bacteria 1677
250 Ga0157373_11397829 3300013100 Bacteria 532
251 Ga0157370_11387830 3300013104 Bacteria 632
252 Ga0157370_11647734 3300013104 Bacteria 576
253 Ga0157369_10137207 3300013105 Bacteria 2589
254 Ga0157374_10276489 3300013296 Bacteria 1657
255 Ga0157374_12333335 3300013296 Bacteria 562
256 Ga0157378_10055779 3300013297 Bacteria 3520
257 Ga0163162_10706031 3300013306 Bacteria 1130
258 Ga0163162_11814711 3300013306 Bacteria 697
259 Ga0157372_10103908 3300013307 Bacteria 3247
260 Ga0157372_12050099 3300013307 Bacteria 657
261 Ga0157375_10144659 3300013308 Bacteria 2507
262 Ga0163163_11217692 3300014325 Bacteria 815
263 Ga0157380_10897102 3300014326 Bacteria 912
264 Ga0157380_11043677 3300014326 Bacteria 853
265 Ga0157380_12032387 3300014326 Bacteria 637
266 Ga0157380_12685755 3300014326 Bacteria 564
267 Ga0182008_10669119 3300014497 Bacteria 590
268 Ga0157377_10394633 3300014745 Bacteria 941
269 Ga0157379_11684972 3300014968 Bacteria 621
270 Ga0157376_10600104 3300014969 Bacteria 1096
271 Ga0157376_10680492 3300014969 Bacteria 1032
272 Ga0157376_12225864 3300014969 Bacteria 587
273 Ga0182006_1250452 3300015261 Bacteria 582
274 Ga0182007_10031429 3300015262 Bacteria 1808
275 Ga0182007_10135318 3300015262 Bacteria 831
276 Ga0163161_10079688 3300017792 Bacteria 2409
277 Ga0163161_12091703 3300017792 Bacteria 503
278 Ga0213872_10042110 3300021361 Bacteria 2083
279 Ga0209435_100008 3300025206 Bacteria 503644
280 Ga0209674_100003 3300025226 Bacteria 2196646
281 Ga0209672_104319 3300025228 Bacteria 2663
282 Ga0209672_108419 3300025228 Bacteria 1527
283 Ga0209563_100010 3300025230 Bacteria 1337457
284 Ga0207427_101137 3300025231 Bacteria 10557
285 Ga0209258_100162 3300025242 Bacteria 151725
286 Ga0209258_102002 3300025242 Bacteria 5889
287 Ga0207425_1002969 3300025245 Bacteria 5672
288 Ga0207425_1004534 3300025245 Bacteria 4134
289 Ga0207425_1040463 3300025245 Bacteria 889
290 Ga0209646_1000029 3300025246 Bacteria 386414
291 Ga0209646_1000066 3300025246 Bacteria 244823
292 Ga0209026_1000016 3300025250 Bacteria 386457
293 Ga0209026_1000027 3300025250 Bacteria 351282
294 Ga0209026_1048919 3300025250 Bacteria 603
295 Ga0209677_100178 3300025253 Bacteria 53699
296 Ga0209677_100183 3300025253 Bacteria 51950
297 Ga0209677_104325 3300025253 Bacteria 4151
298 Ga0209759_1000016 3300025256 Bacteria 386414
299 Ga0209759_1000131 3300025256 Bacteria 130014
300 Ga0209759_1000662 3300025256 Bacteria 31972
301 Ga0209759_1005141 3300025256 Bacteria 4665
302 Ga0209759_1017083 3300025256 Bacteria 1801
303 Ga0209759_1046348 3300025256 Bacteria 704
304 Ga0209129_1006958 3300025258 Bacteria 3491
305 Ga0209129_1059409 3300025258 Bacteria 568
306 Ga0209565_1000061 3300025263 Bacteria 185308
307 Ga0209565_1001227 3300025263 Bacteria 12058
308 Ga0209455_1000128 3300025272 Bacteria 162413
309 Ga0209455_1000687 3300025272 Bacteria 19947
310 Ga0209673_1000491 3300025273 Bacteria 65636
311 Ga0209673_1007346 3300025273 Bacteria 5104
312 Ga0209673_1009683 3300025273 Bacteria 4141
313 Ga0209673_1037143 3300025273 Bacteria 1435
314 Ga0209130_1000014 3300025284 Bacteria 412039
315 Ga0209130_1000862 3300025284 Bacteria 24952
316 Ga0209675_1000105 3300025291 Bacteria 121013
317 Ga0209675_1000703 3300025291 Bacteria 23088
318 Ga0209676_1000013 3300025292 Bacteria 816080
319 Ga0209676_1000153 3300025292 Bacteria 166393
320 Ga0209676_1006585 3300025292 Bacteria 5693
321 Ga0209025_1010455 3300025294 Bacteria 6285
322 Ga0209025_1013015 3300025294 Bacteria 5265
323 Ga0209025_1020829 3300025294 Bacteria 3562
324 Ga0209025_1034780 3300025294 Bacteria 2291
325 Ga0209025_1091850 3300025294 Bacteria 990
326 Ga0209564_1000003 3300025295 Bacteria 1585848
327 Ga0209564_1000181 3300025295 Bacteria 151002
328 Ga0209564_1000247 3300025295 Bacteria 116628
329 Ga0209758_1031085 3300025297 Bacteria 2198
330 Ga0209758_1079909 3300025297 Bacteria 993
331 Ga0209758_1107255 3300025297 Bacteria 780
332 Ga0209050_1000008 3300025298 Bacteria 1144179
333 Ga0209050_1002596 3300025298 Bacteria 14968
334 Ga0209050_1015921 3300025298 Bacteria 3116
335 Ga0209050_1018285 3300025298 Bacteria 2732
336 Ga0209256_1000039 3300025299 Bacteria 372337
337 Ga0209256_1002170 3300025299 Bacteria 16860
338 Ga0209256_1002204 3300025299 Bacteria 16682
339 Ga0209256_1028537 3300025299 Bacteria 1572
340 Ga0209256_1049133 3300025299 Bacteria 1029
341 Ga0209256_1111211 3300025299 Bacteria 551
342 Ga0207426_1000242 3300025302 Bacteria 122839
343 Ga0207426_1001759 3300025302 Bacteria 16401
344 Ga0207426_1090302 3300025302 Bacteria 812
345 Ga0209051_1000005 3300025303 Bacteria 1142353
346 Ga0209051_1000241 3300025303 Bacteria 91816
347 Ga0209051_1008919 3300025303 Bacteria 5238
348 Ga0209051_1071683 3300025303 Bacteria 1040
349 Ga0209257_1000015 3300025304 Bacteria 908141
350 Ga0209257_1000031 3300025304 Bacteria 688770
351 Ga0209257_1002930 3300025304 Bacteria 15721
352 Ga0209257_1003485 3300025304 Bacteria 13420
353 Ga0209257_1030164 3300025304 Bacteria 1755
354 Ga0207697_10015928 3300025315 Bacteria 3101
355 Ga0207656_10014495 3300025321 Bacteria 3038
356 Ga0207696_1000424 3300025711 Bacteria 38612
357 Ga0207682_10002496 3300025893 Bacteria 8220
358 Ga0207682_10034562 3300025893 Bacteria 2038
359 Ga0207642_10379205 3300025899 Bacteria 841
360 Ga0207642_10976435 3300025899 Bacteria 545
361 Ga0207688_10789625 3300025901 Bacteria 601
362 Ga0207680_10243058 3300025903 Bacteria 1241
363 Ga0207680_10255778 3300025903 Bacteria 1211
364 Ga0207645_10016384 3300025907 Bacteria 4907
365 Ga0207645_10119290 3300025907 Bacteria 1712
366 Ga0207643_10021956 3300025908 Bacteria 3512
367 Ga0207705_10050795 3300025909 Bacteria 2985
368 Ga0207705_10051128 3300025909 Bacteria 2975
369 Ga0207705_10086725 3300025909 Bacteria 2288
370 Ga0207705_10112426 3300025909 Bacteria 2013
371 Ga0207705_10144672 3300025909 Bacteria 1778
372 Ga0207705_10153312 3300025909 Bacteria 1727
373 Ga0207705_10173874 3300025909 Bacteria 1622
374 Ga0207705_10337951 3300025909 Bacteria 1159
375 Ga0207705_10470833 3300025909 Bacteria 975
376 Ga0207654_10027109 3300025911 Bacteria 3112
377 Ga0207707_10892295 3300025912 Bacteria 735
378 Ga0207695_10011214 3300025913 Bacteria 10870
379 Ga0207695_10030702 3300025913 Bacteria 5913
380 Ga0207695_10038286 3300025913 Bacteria 5165
381 Ga0207695_10105566 3300025913 Bacteria 2804
382 Ga0207671_10004904 3300025914 Bacteria 12572
383 Ga0207671_10133918 3300025914 Bacteria 1904
384 Ga0207660_10358589 3300025917 Bacteria 1169
385 Ga0207660_10661646 3300025917 Bacteria 852
386 Ga0207662_10425178 3300025918 Bacteria 904
387 Ga0207657_10005150 3300025919 Bacteria 13708
388 Ga0207657_10014524 3300025919 Bacteria 7679
389 Ga0207657_10362666 3300025919 Bacteria 1142
390 Ga0207649_11298560 3300025920 Bacteria 576
391 Ga0207652_10098275 3300025921 Bacteria 2581
392 Ga0207652_10414513 3300025921 Bacteria 1215
393 Ga0207646_10318474 3300025922 Bacteria 1405
394 Ga0207681_10030499 3300025923 Bacteria 3515
395 Ga0207681_11516900 3300025923 Bacteria 562
396 Ga0207694_10010745 3300025924 Bacteria 6914
397 Ga0207694_10049847 3300025924 Bacteria 3241
398 Ga0207694_10703404 3300025924 Bacteria 852
399 Ga0207650_10000265 3300025925 Bacteria 55786
400 Ga0207650_10580291 3300025925 Bacteria 942
401 Ga0207659_10000148 3300025926 Bacteria 41151
402 Ga0207659_10433916 3300025926 Bacteria 1104
403 Ga0207687_10328433 3300025927 Bacteria 1240
404 Ga0207687_10411114 3300025927 Bacteria 1115
405 Ga0207664_10580353 3300025929 Bacteria 1007
406 Ga0207644_10209224 3300025931 Bacteria 1541
407 Ga0207644_11813150 3300025931 Bacteria 510
408 Ga0207690_10012639 3300025932 Bacteria 5056
409 Ga0207690_10248709 3300025932 Bacteria 1372
410 Ga0207706_10846812 3300025933 Bacteria 775
411 Ga0207709_10000070 3300025935 Bacteria 183020
412 Ga0207709_10380129 3300025935 Bacteria 1074
413 Ga0207709_10627962 3300025935 Bacteria 853
414 Ga0207670_10657343 3300025936 Bacteria 865
415 Ga0207669_10080300 3300025937 Bacteria 2085
416 Ga0207669_10899010 3300025937 Bacteria 739
417 Ga0207704_10037547 3300025938 Bacteria 2799
418 Ga0207691_10012845 3300025940 Bacteria 8017
419 Ga0207691_10894928 3300025940 Bacteria 743
420 Ga0207689_10131208 3300025942 Bacteria 2062
421 Ga0207689_10484882 3300025942 Bacteria 1035
422 Ga0207679_10652019 3300025945 Bacteria 952
423 Ga0207679_11063023 3300025945 Bacteria 742
424 Ga0207667_10103966 3300025949 Bacteria 2929
425 Ga0207667_10106740 3300025949 Bacteria 2889
426 Ga0207667_10193771 3300025949 Bacteria 2085
427 Ga0207667_10276242 3300025949 Bacteria 1717
428 Ga0207667_10365573 3300025949 Bacteria 1471
429 Ga0207667_10662083 3300025949 Bacteria 1049
430 Ga0207651_10006277 3300025960 Bacteria 6199
431 Ga0207651_11404461 3300025960 Bacteria 628
432 Ga0207651_11904524 3300025960 Bacteria 535
433 Ga0207668_10198425 3300025972 Bacteria 1596
434 Ga0207668_10888083 3300025972 Bacteria 793
435 Ga0207640_10005583 3300025981 Bacteria 6860
436 Ga0207640_10115473 3300025981 Bacteria 1912
437 Ga0207640_10558461 3300025981 Bacteria 963
438 Ga0207658_10064120 3300025986 Bacteria 2755
439 Ga0207658_11007677 3300025986 Bacteria 760
440 Ga0207658_11559584 3300025986 Bacteria 604
441 Ga0207677_10008981 3300026023 Bacteria 5606
442 Ga0207677_10579311 3300026023 Bacteria 982
443 Ga0207639_10343987 3300026041 Bacteria 1330
444 Ga0207639_10377379 3300026041 Bacteria 1272
445 Ga0207639_10500676 3300026041 Bacteria 1110
446 Ga0207639_11132730 3300026041 Bacteria 734
447 Ga0207678_10649317 3300026067 Bacteria 927
448 Ga0207678_11450588 3300026067 Bacteria 606
449 Ga0207702_10000220 3300026078 Bacteria 66634
450 Ga0207702_10487159 3300026078 Bacteria 1201
451 Ga0207702_10575741 3300026078 Bacteria 1103
452 Ga0207641_10837485 3300026088 Bacteria 911
453 Ga0207641_11489245 3300026088 Bacteria 678
454 Ga0207641_12334546 3300026088 Bacteria 534
455 Ga0207648_10034719 3300026089 Bacteria 4444
456 Ga0207648_10312313 3300026089 Bacteria 1411
457 Ga0207676_10005934 3300026095 Bacteria 8622
458 Ga0207674_10006407 3300026116 Bacteria 13844
459 Ga0207675_100031693 3300026118 Bacteria 4925
460 Ga0207675_100879392 3300026118 Bacteria 912
461 Ga0207683_10013304 3300026121 Bacteria 7015
462 Ga0207683_10035679 3300026121 Bacteria 4326
463 Ga0207683_10389721 3300026121 Bacteria 1281
464 Ga0207698_10220476 3300026142 Bacteria 1714
465 Ga0207698_11538011 3300026142 Bacteria 681
466 Ga0207698_11981318 3300026142 Bacteria 597
467 Ga0207698_12061032 3300026142 Bacteria 584
468 Ga0209281_1000029 3300027111 Bacteria 431495
469 Ga0209389_1063122 3300027296 Bacteria 2228
470 Ga0209371_1020385 3300027312 Bacteria 1633
471 Ga0209970_1000168 3300027614 Bacteria 10198
472 Ga0209970_1040709 3300027614 Bacteria 826
473 Ga0209983_1037986 3300027665 Bacteria 1038
474 Ga0209971_1015094 3300027682 Bacteria 1831
475 Ga0209971_1128299 3300027682 Bacteria 624
476 Ga0209998_10132945 3300027717 Bacteria 632
477 Ga0209813_10120310 3300027866 Bacteria 913
478 Ga0209974_10078728 3300027876 Bacteria 1131
479 Ga0268266_10221686 3300028379 Bacteria 1739
480 Ga0268264_10210436 3300028381 Bacteria 1785
481 Ga0265334_10043805 3300028573 Bacteria 1740
482 Ga0265336_10000008 3300028666 Bacteria 336082
483 Ga0307515_10103443 3300028794 Bacteria 3413
484 Ga0307515_10218928 3300028794 Bacteria 1727
485 Ga0265324_10003914 3300029957 Bacteria 6927
486 Ga0268256_1022764 3300030500 Bacteria 1638
487 Ga0265330_10000106 3300031235 Bacteria 69731
488 Ga0265332_10000008 3300031238 Bacteria 301609
489 Ga0265325_10049744 3300031241 Bacteria 2161
490 Ga0265340_10071583 3300031247 Bacteria 1643
491 Ga0265327_10067541 3300031251 Bacteria 1801
492 Ga0307513_10000025 3300031456 Bacteria 202918
493 Ga0307513_10000363 3300031456 Bacteria 66311
494 Ga0307513_10058646 3300031456 Bacteria 4089
495 Ga0307513_10159272 3300031456 Bacteria 2152
496 Ga0307513_10570766 3300031456 Bacteria 842
497 Ga0307513_10951852 3300031456 Bacteria 567
498 Ga0307408_100024015 3300031548 Bacteria 4157
499 Ga0307408_100034737 3300031548 Bacteria 3534
500 Ga0307408_100355748 3300031548 Bacteria 1244
501 Ga0307408_100655348 3300031548 Bacteria 939
502 Ga0307408_101491525 3300031548 Bacteria 639
503 Ga0307408_102374295 3300031548 Bacteria 514
504 Ga0265314_10000292 3300031711 Bacteria 71982
505 Ga0265342_10518809 3300031712 Bacteria 606
506 Ga0307516_10067770 3300031730 Bacteria 3438
507 Ga0307516_10091429 3300031730 Bacteria 2871
508 Ga0307405_10045504 3300031731 Bacteria 2690
509 Ga0307405_10191714 3300031731 Bacteria 1477
510 Ga0307405_10950896 3300031731 Bacteria 730
511 Ga0307405_11942204 3300031731 Bacteria 526
512 Ga0307413_10566153 3300031824 Bacteria 924
513 Ga0307413_12188696 3300031824 Bacteria 501
514 Ga0307410_10030505 3300031852 Bacteria 3447
515 Ga0307410_10397686 3300031852 Bacteria 1112
516 Ga0307406_10016088 3300031901 Bacteria 4339
517 Ga0307406_10058110 3300031901 Bacteria 2484
518 Ga0307406_10867813 3300031901 Bacteria 766
519 Ga0307406_11677345 3300031901 Bacteria 563
520 Ga0307406_11922330 3300031901 Bacteria 528
521 Ga0307407_11664232 3300031903 Bacteria 507
522 Ga0307412_10222918 3300031911 Bacteria 1446
523 Ga0307412_10367228 3300031911 Bacteria 1161
524 Ga0307412_10721072 3300031911 Bacteria 858
525 Ga0307412_11758834 3300031911 Bacteria 569
526 Ga0307409_100402085 3300031995 Bacteria 1308
527 Ga0307409_100813565 3300031995 Bacteria 943
528 Ga0307414_10485653 3300032004 Bacteria 1090
529 Ga0307414_10517575 3300032004 Bacteria 1058
530 Ga0307411_10000973 3300032005 Bacteria 10988
531 Ga0307411_10130857 3300032005 Bacteria 1834
532 Ga0307411_10380466 3300032005 Bacteria 1161
533 Ga0307411_10488831 3300032005 Bacteria 1038
534 Ga0307411_11012110 3300032005 Bacteria 744
535 Ga0307411_11118356 3300032005 Bacteria 711
536 Ga0307411_12159208 3300032005 Bacteria 522
537 Ga0307411_12190306 3300032005 Bacteria 518
538 Ga0307415_100021431 3300032126 Bacteria 3973
539 Ga0307415_100778427 3300032126 Bacteria 871
540 Ga0307507_10474021 3300033179 Bacteria 683
541 Ga0373934_0293083 3300035086 Bacteria 674
542 Ga0373923_0375765 3300035111 Bacteria 681
543 Ga0373945_0127353 3300035116 Bacteria 1018
544 Ga0373946_0613344 3300035171 Bacteria 565
545 Ga0373935_1219599 3300035692 Bacteria 561
546 Ga0373925_0436029 3300037068 Bacteria 1072
547 Ga0395899_0005707 3300037312 Bacteria 9664
548 Ga0395899_0038526 3300037312 Bacteria 3580
549 Ga0395899_0039915 3300037312 Bacteria 3512
550 Ga0395900_0007255 3300037418 Bacteria 11476
551 Ga0395900_0018896 3300037418 Bacteria 7029
552 Ga0395900_0023006 3300037418 Bacteria 6378
553 Ga0395900_0137212 3300037418 Bacteria 2506
554 Ga0395900_0184677 3300037418 Bacteria 2117
555 Ga0395900_0702925 3300037418 Bacteria 944
556 Ga0395900_1601164 3300037418 Bacteria 563
557 Ga0395898_0002154 3300037466 Bacteria 24159
558 Ga0395898_0014498 3300037466 Bacteria 8096
559 Ga0395898_0052022 3300037466 Bacteria 4002
560 Ga0395898_0366828 3300037466 Bacteria 1373
561 Ga0395898_0528845 3300037466 Bacteria 1121
562 Ga0395905_0000047 3300037471 Bacteria 237582
563 Ga0395905_0005624 3300037471 Bacteria 12751
564 Ga0395905_0013597 3300037471 Bacteria 7797
565 Ga0395905_0033794 3300037471 Bacteria 4803
566 Ga0395905_0086534 3300037471 Bacteria 2937
567 Ga0395905_0164653 3300037471 Bacteria 2083
568 Ga0395905_0200480 3300037471 Bacteria 1871
569 Ga0395905_0203737 3300037471 Bacteria 1854
570 Ga0395905_0251604 3300037471 Bacteria 1650
571 Ga0395905_0253105 3300037471 Bacteria 1645
572 Ga0395905_0262538 3300037471 Bacteria 1612
573 Ga0395905_0462898 3300037471 Bacteria 1166
574 Ga0395905_0694774 3300037471 Bacteria 919
575 Ga0395905_1063965 3300037471 Bacteria 712
576 Ga0395901_0016167 3300038443 Bacteria 7600
577 Ga0395901_0018542 3300038443 Bacteria 7104
578 Ga0395901_0042905 3300038443 Bacteria 4691
579 Ga0395901_0069333 3300038443 Bacteria 3672
580 Ga0395901_0159781 3300038443 Bacteria 2367
581 Ga0395901_0237974 3300038443 Bacteria 1899
582 Ga0395901_0337430 3300038443 Bacteria 1557
583 Ga0395901_0662866 3300038443 Bacteria 1045
584 Ga0395901_0873229 3300038443 Bacteria 883
585 Ga0436361_0524196 3300039447 Bacteria 11455
586 Ga0439447_144417 3300041407 Bacteria 547
587 Ga0439453_0042819 3300041408 Bacteria 893
588 Ga0439461_0100632 3300041410 Bacteria 703
589 Ga0439465_0259599 3300041413 Bacteria 644
590 Ga0451787_392389 3300041441 Bacteria 732
591 Ga0451789_0978585 3300041443 Bacteria 796
592 Ga0451789_1076770 3300041443 Bacteria 1069
593 Ga0451791_1716037 3300041451 Bacteria 1100
594 Ga0451791_1822544 3300041451 Bacteria 746
595 Ga0451793_0250537 3300041452 Bacteria 561
596 Ga0451793_0899693 3300041452 Bacteria 683
597 Ga0451797_0381324 3300041453 Bacteria 610
598 Ga0451797_1401759 3300041453 Bacteria 575
599 Ga0451797_1490071 3300041453 Bacteria 501
600 Ga0451798_0197861 3300041458 Bacteria 831
601 Ga0451798_0655170 3300041458 Bacteria 872
602 Ga0451800_1282004 3300041459 Bacteria 569
603 Ga0451802_1805873 3300041460 Bacteria 546
604 Ga0451807_0557572 3300041486 Bacteria 727
605 Ga0451807_1313990 3300041486 Bacteria 736
606 Ga0451835_0830645 3300041492 Bacteria 1000
607 Ga0451839_0378695 3300041496 Bacteria 621
608 Ga0451851_0652104 3300041507 Bacteria 639
609 Ga0451851_0727205 3300041507 Bacteria 557
610 Ga0451843_1133688 3300041509 Bacteria 516
611 Ga0451853_1145788 3300041512 Bacteria 560
612 Ga0451853_2527883 3300041512 Bacteria 557
613 Ga0439431_0054675 3300041997 Bacteria 1042
614 Ga0439441_053762 3300042001 Bacteria 835
615 Ga0439443_114022 3300042003 Bacteria 526
616 Ga0439432_089814 3300042006 Bacteria 925
617 Ga0450912_010762 3300042116 Bacteria 788
618 Ga0450921_014108 3300042123 Bacteria 707
619 Ga0450890_001669 3300042127 Bacteria 3168
620 Ga0450897_002399 3300042128 Bacteria 1403
621 Ga0450898_005652 3300042134 Bacteria 1898
622 Ga0450903_028373 3300042138 Bacteria 849
623 Ga0450904_032532 3300042139 Bacteria 547
624 Ga0450910_031874 3300042147 Bacteria 830
625 Ga0439446_0007973 3300042156 Bacteria 2798
626 Ga0439458_0030099 3300042157 Bacteria 1291
627 Ga0450909_011874 3300042185 Bacteria 1276
628 Ga0439434_0036474 3300042435 Bacteria 1504
629 Ga0439434_0089299 3300042435 Bacteria 984
630 Ga0439435_0113389 3300042436 Bacteria 843
631 Ga0450893_0007589 3300042532 Bacteria 1763
632 Ga0450893_0041981 3300042532 Bacteria 840
633 Ga0451577_0008177 3300042876 Bacteria 10196
634 Ga0466969_0013272 3300044656 Bacteria 4338
635 Ga0466969_0071072 3300044656 Bacteria 1674
636 Ga0466969_0226605 3300044656 Bacteria 849
637 Ga0466972_0060165 3300044658 Bacteria 1822
638 Ga0453683_0005225 3300044673 Bacteria 9089
639 Ga0466965_0022570 3300044683 Bacteria 3034
640 Ga0466965_0060420 3300044683 Bacteria 1893
641 Ga0466965_0321573 3300044683 Bacteria 843
642 Ga0466966_0011758 3300044684 Bacteria 5801
643 Ga0466966_0256125 3300044684 Bacteria 1054
644 Ga0466966_0316860 3300044684 Bacteria 937
645 Ga0466961_0016354 3300044693 Bacteria 4765
646 Ga0466961_0128200 3300044693 Bacteria 1591
647 Ga0466963_0711421 3300044694 Bacteria 709
648 Ga0466964_0140840 3300044706 Bacteria 1108
649 Ga0453684_1054740 3300044712 Bacteria 861
650 Ga0453684_1842782 3300044712 Bacteria 614
651 Ga0466971_0233234 3300044719 Bacteria 874
652 Ga0466971_0615827 3300044719 Bacteria 542
653 Ga0466968_0258610 3300044735 Bacteria 828
654 Ga0466970_0422178 3300044765 Bacteria 762
655 Ga0466957_0142263 3300044842 Bacteria 1546
656 Ga0466957_0243256 3300044842 Bacteria 1194
657 Ga0466957_0406995 3300044842 Bacteria 931
658 Ga0466960_0564417 3300044901 Bacteria 672
659 Ga0466960_0653318 3300044901 Bacteria 628
660 Ga0466959_0013672 3300045049 Bacteria 5889
661 Ga0466959_0239009 3300045049 Bacteria 1255
662 Ga0451576_0000914 3300045051 Bacteria 55935
663 Ga0451576_0001036 3300045051 Bacteria 51297
664 Ga0451576_0023020 3300045051 Bacteria 6751
665 Ga0451576_0613620 3300045051 Bacteria 1143
666 Ga0466967_0461389 3300045976 Bacteria 1243
667 Ga0466967_1420234 3300045976 Bacteria 691
668 Ga0495641_0370480 3300046461 Bacteria 649
669 Ga0495650_0095921 3300046471 Bacteria 1120
670 Ga0495639_0013949 3300046475 Bacteria 3476
671 Ga0495607_0000236 3300046501 Bacteria 59283
672 Ga0495583_0000444 3300046506 Bacteria 62022
673 Ga0495606_0002487 3300046507 Bacteria 21331
674 Ga0495606_0441275 3300046507 Bacteria 669
675 Ga0495608_0272110 3300046511 Bacteria 1053
676 Ga0495628_0710962 3300046516 Bacteria 709
677 Ga0495652_0702413 3300046529 Bacteria 680
678 Ga0495621_0129890 3300046539 Bacteria 979
679 Ga0495621_0298990 3300046539 Bacteria 667
680 Ga0495668_0048989 3300046616 Bacteria 2343
681 Ga0495625_0126142 3300046660 Bacteria 1737
682 Ga0495658_0804802 3300046683 Bacteria 602
683 Ga0495669_0070763 3300046684 Bacteria 1589
684 Ga0495670_0427911 3300046691 Bacteria 716
685 Ga0495671_0255894 3300046692 Bacteria 845
686 Ga0495649_0000298 3300046694 Bacteria 43334
687 Ga0495589_0023031 3300046794 Bacteria 3174
688 Ga0495660_0016673 3300046810 Bacteria 4233
689 Ga0495683_0110040 3300047323 Bacteria 1316
690 Ga0495686_0011222 3300047472 Bacteria 6317
691 Ga0495686_0513514 3300047472 Bacteria 630
692 Ga0495615_0006727 3300048090 Bacteria 2148
693 Ga0495615_0174500 3300048090 Bacteria 652
694 Ga0496100_0454932 3300048903 Bacteria 982
695 Ga0496100_0465574 3300048903 Bacteria 971
696 Ga0496102_1265550 3300048905 Bacteria 657
697 Ga0496104_0605612 3300048907 Bacteria 1006
698 Ga0496106_0661220 3300048909 Bacteria 834
699 Ga0496106_1177645 3300048909 Bacteria 598
700 Ga0496108_0402155 3300048911 Bacteria 1196
701 Ga0496108_1502699 3300048911 Bacteria 560
702 Ga0496109_0170210 3300048912 Bacteria 2043
703 Ga0496109_0498978 3300048912 Bacteria 1149
704 Ga0496121_0009710 3300048924 Bacteria 11017
705 Ga0496124_0000458 3300048927 Bacteria 70719
706 Ga0496124_0478632 3300048927 Bacteria 841
707 Ga0496125_0172626 3300048928 Bacteria 1451
708 Ga0496125_0514567 3300048928 Bacteria 670
709 Ga0496126_0591588 3300048929 Bacteria 875
710 Ga0501308_075281 3300049128 Bacteria 530
711 Ga0501311_081458 3300049527 Bacteria 551
712 Ga0501031_0778906 3300049568 Bacteria 613
713 Ga0501032_0453093 3300049569 Bacteria 822
714 Ga0501033_0080077 3300049570 Bacteria 2397
715 Ga0501034_0448863 3300049571 Bacteria 1207
716 Ga0501036_0312163 3300049572 Bacteria 1314
717 Ga0501037_0327581 3300049573 Bacteria 1060
718 Ga0501038_0821070 3300049574 Bacteria 690
719 Ga0501043_0093019 3300049579 Bacteria 2371
720 Ga0501046_0145218 3300049580 Bacteria 1792
721 Ga0501047_0412481 3300049581 Bacteria 1183
722 Ga0501047_0532107 3300049581 Bacteria 1000
723 Ga0501047_0724417 3300049581 Bacteria 811
724 Ga0501048_1021299 3300049582 Bacteria 595
725 Ga0501073_0111340 3300049589 Bacteria 1899
726 Ga0501077_0298533 3300049593 Bacteria 1026
727 Ga0501242_037791 3300049674 Bacteria 674
728 Ga0501249_142411 3300049679 Bacteria 598
729 Ga0501080_0435465 3300049742 Bacteria 1177
730 Ga0501080_0680556 3300049742 Bacteria 908
731 Ga0501241_086545 3300049758 Bacteria 659
732 Ga0501263_009077 3300049760 Bacteria 1199
733 Ga0501275_082232 3300049772 Bacteria 524
734 Ga0501035_0053679 3300049822 Bacteria 3603
735 Ga0501035_0120412 3300049822 Bacteria 2295
736 Ga0501035_0201546 3300049822 Bacteria 1706
737 Ga0501035_0356744 3300049822 Bacteria 1222
738 Ga0501044_0000336 3300049823 Bacteria 59417
739 Ga0501044_0289251 3300049823 Bacteria 1570
740 Ga0501044_1183616 3300049823 Bacteria 632
741 nmdc:mga03683_322259_c1 3300050489 Bacteria 728
742 nmdc:mga03n38_141968_c1 3300050490 Bacteria 1200
743 nmdc:mga03n38_398155_c1 3300050490 Bacteria 757
744 nmdc:mga03n38_512063_c1 3300050490 Bacteria 675
745 nmdc:mga03n38_576315_c1 3300050490 Bacteria 639
746 nmdc:mga03n38_848620_c1 3300050490 Bacteria 534
747 nmdc:mga00v17_143149_c1 3300050491 Bacteria 1534
748 nmdc:mga00v17_749786_c1 3300050491 Bacteria 624
749 nmdc:mga0yw44_40482_c1 3300050492 Bacteria 2769
750 nmdc:mga0yw44_48096_c1 3300050492 Bacteria 2571
751 nmdc:mga0yw44_852805_c1 3300050492 Bacteria 618
752 nmdc:mga0k408_132670_c1 3300050493 Bacteria 1479
753 nmdc:mga0k408_196323_c1 3300050493 Bacteria 1204
754 nmdc:mga0k408_335351_c1 3300050493 Bacteria 902
755 nmdc:mga0k408_398125_c1 3300050493 Bacteria 820
756 nmdc:mga0k408_413454_c1 3300050493 Bacteria 802
757 nmdc:mga06z11_16098_c1 3300050494 Bacteria 3358
758 nmdc:mga06z11_645661_c1 3300050494 Bacteria 644
759 nmdc:mga04h51_141460_c1 3300050495 Bacteria 913
760 nmdc:mga07m45_227298_c1 3300050496 Bacteria 1086
761 nmdc:mga07m45_3289_c1 3300050496 Bacteria 6377
762 nmdc:mga07m45_526690_c1 3300050496 Bacteria 684
763 nmdc:mga05p37_261861_c1 3300050507 Bacteria 2069
764 nmdc:mga09592_151745_c1 3300050508 Bacteria 1999
765 nmdc:mga09592_3332_c1 3300050508 Bacteria 12994
766 nmdc:mga0qj67_266991_c1 3300050509 Bacteria 1388
767 nmdc:mga0qj67_35975_c1 3300050509 Bacteria 3872
768 nmdc:mga0n895_919912_c1 3300050512 Bacteria 859
769 Ga0500635_0000003 3300053080 Bacteria 216927
770 Ga0500578_0020316 3300053086 Bacteria 4269
771 Ga0500644_0172456 3300053088 Bacteria 880
772 Ga0500644_0241564 3300053088 Bacteria 759
773 Ga0500651_0625055 3300053093 Bacteria 582
774 Ga0500660_252547 3300053100 Bacteria 541
775 Ga0500593_129551 3300053117 Bacteria 1009
776 Ga0500608_037775 3300053122 Bacteria 2308
777 Ga0500559_0070831 3300053136 Bacteria 1569
778 Ga0500564_111504 3300053138 Bacteria 1200
779 Ga0500564_244383 3300053138 Bacteria 714
780 Ga0500568_0006764 3300053139 Bacteria 5722
781 Ga0500590_084162 3300053148 Bacteria 1557
782 Ga0500622_0002974 3300053156 Bacteria 11744
783 Ga0500636_0012032 3300053177 Bacteria 5068
784 Ga0500645_000346 3300053730 Bacteria 33036
785 Ga0500645_002236 3300053730 Bacteria 8822
786 Ga0500645_004728 3300053730 Bacteria 5156
787 Ga0500645_162725 3300053730 Bacteria 611
788 Ga0500661_038307 3300055283 Bacteria 848
789 Ga0500661_082206 3300055283 Bacteria 597
790 Ga0590075_037870 3300059424 Bacteria 1230
791 Ga0590075_135525 3300059424 Bacteria 647
792 Ga0466962_0193446 3300061719 Bacteria 993

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2831864461 2831866190 79
2 iso_pu_bacteria 2855730933 2855734691 79
3 iso_pu_bacteria 2855767633 2855770475 79
4 iso_pu_bacteria 2881412998 2881413085 79
5 iso_pu_bacteria 2886848708 2886852429 79
6 iso_pu_bacteria 2886848708 2886853184 79
7 3300005563 Ga0068855_102606391 Ga0068855_1026063911 80
8 3300042001 Ga0439441_053762 Ga0439441_053762_12_266 80
9 3300042127 Ga0450890_001669 Ga0450890_001669_115_369 80
10 3300042436 Ga0439435_0113389 Ga0439435_0113389_194_448 80
11 3300048912 Ga0496109_0498978 Ga0496109_0498978_207_461 80
12 3300048927 Ga0496124_0478632 Ga0496124_0478632_94_348 80
13 3300048928 Ga0496125_0172626 Ga0496125_0172626_1173_1427 80
14 3300048929 Ga0496126_0591588 Ga0496126_0591588_438_692 80
15 3300050493 nmdc:mga0k408_132670_c1 nmdc:mga0k408_132670_c1_520_774 80
16 3300050496 nmdc:mga07m45_3289_c1 nmdc:mga07m45_3289_c1_282_536 80
17 3300053088 Ga0500644_0241564 Ga0500644_0241564_140_403 80
18 3300046691 Ga0495670_0427911 Ga0495670_0427911_332_589 81
19 3300053156 Ga0500622_0002974 Ga0500622_0002974_339_596 81
20 iso_pu_bacteria 2721755523 2722880906 81
21 iso_pu_bacteria 2839138175 2839138290 81
22 iso_pu_bacteria 2857576091 2857577713 81
23 iso_pu_bacteria 2894023352 2894027465 81
24 iso_pu_bacteria 2904479285 2904481220 81
25 iso_pu_bacteria 2919704043 2919708274 81
26 iso_pu_bacteria 8055225921 8055227298 81
27 3300003761 Ga0055535_1024006 Ga0055535_10240062 82
28 3300003763 Ga0055529_1001828 Ga0055529_10018285 82
29 3300005614 Ga0068856_100288493 Ga0068856_1002884932 82
30 3300013307 Ga0157372_12050099 Ga0157372_120500991 82
31 3300025228 Ga0209672_104319 Ga0209672_1043193 82
32 3300025242 Ga0209258_102002 Ga0209258_1020024 82
33 3300025272 Ga0209455_1000687 Ga0209455_100068710 82
34 3300026078 Ga0207702_10575741 Ga0207702_105757412 82
35 3300045976 Ga0466967_0461389 Ga0466967_0461389_166_420 82
36 3300048903 Ga0496100_0465574 Ga0496100_0465574_684_932 82
37 3300049822 Ga0501035_0053679 Ga0501035_0053679_2500_2760 82
38 3300049822 Ga0501035_0120412 Ga0501035_0120412_1860_2120 82
39 3300049823 Ga0501044_0000336 Ga0501044_0000336_52918_53178 82
40 iso_pu_bacteria 2511231002 2511242683 82
41 iso_pu_bacteria 2881101125 2881104492 82
42 3300003320 rootH2_10010510 rootH2_100105102 83
43 3300003322 rootL2_10018076 rootL2_100180766 83
44 3300003323 rootH1_10013777 rootH1_100137772 83
45 3300003323 rootH1_10013778 rootH1_100137783 83
46 3300003771 Ga0055526_1002155 Ga0055526_10021553 83
47 3300003775 Ga0055524_1000554 Ga0055524_100055418 83
48 3300003775 Ga0055524_1007049 Ga0055524_10070492 83
49 3300003790 Ga0055528_1043631 Ga0055528_10436312 83
50 3300003791 Ga0055530_10033421 Ga0055530_100334212 83
51 3300003792 Ga0055540_1029832 Ga0055540_10298322 83
52 3300003794 Ga0055531_10003057 Ga0055531_100030572 83
53 3300003794 Ga0055531_10009223 Ga0055531_100092234 83
54 3300004625 Ga0055543_1076764 Ga0055543_10767642 83
55 3300005262 Ga0065165_1000283 Ga0065165_100028352 83
56 3300005262 Ga0065165_1000935 Ga0065165_100093522 83
57 3300006195 Ga0075366_10064724 Ga0075366_100647243 83
58 3300006353 Ga0075370_10009248 Ga0075370_100092485 83
59 3300006942 Ga0099824_1066035 Ga0099824_10660351 83
60 3300006944 Ga0099823_1007351 Ga0099823_10073512 83
61 3300012497 Ga0157319_1000009 Ga0157319_100000921 83
62 3300013100 Ga0157373_11397829 Ga0157373_113978291 83
63 3300013104 Ga0157370_11387830 Ga0157370_113878302 83
64 3300013104 Ga0157370_11647734 Ga0157370_116477341 83
65 3300021361 Ga0213872_10042110 Ga0213872_100421103 83
66 3300025273 Ga0209673_1007346 Ga0209673_10073466 83
67 3300025273 Ga0209673_1009683 Ga0209673_10096832 83
68 3300025295 Ga0209564_1000003 Ga0209564_1000003369 83
69 3300025297 Ga0209758_1079909 Ga0209758_10799092 83
70 3300025298 Ga0209050_1015921 Ga0209050_10159213 83
71 3300025299 Ga0209256_1002170 Ga0209256_10021705 83
72 3300025299 Ga0209256_1002204 Ga0209256_100220411 83
73 3300025299 Ga0209256_1111211 Ga0209256_11112111 83
74 3300025303 Ga0209051_1008919 Ga0209051_10089192 83
75 3300025304 Ga0209257_1002930 Ga0209257_10029305 83
76 3300025304 Ga0209257_1003485 Ga0209257_100348511 83
77 3300025940 Ga0207691_10894928 Ga0207691_108949281 83
78 3300027296 Ga0209389_1063122 Ga0209389_10631222 83
79 3300027312 Ga0209371_1020385 Ga0209371_10203852 83
80 3300030500 Ga0268256_1022764 Ga0268256_10227642 83
81 3300031911 Ga0307412_10721072 Ga0307412_107210722 83
82 3300039447 Ga0436361_0524196 Ga0436361_0524196_7482_7742 83
83 3300002705 JGI25156J39149_1000419 JGI25156J39149_100041919 84
84 3300002705 JGI25156J39149_1026593 JGI25156J39149_10265932 84
85 3300002738 JGI25154J39366_1002043 JGI25154J39366_10020433 84
86 3300002741 JGI25157J39369_1000174 JGI25157J39369_100017413 84
87 3300002772 JGI25164J39214_1003316 JGI25164J39214_10033163 84
88 3300003316 rootH1_10022997 rootH1_100229976 84
89 3300003316 rootH1_10036997 rootH1_100369976 84
90 3300003320 rootH2_10037754 rootH2_100377542 84
91 3300003320 rootH2_10081249 rootH2_100812492 84
92 3300003322 rootL2_10025710 rootL2_100257105 84
93 3300003323 rootH1_10008020 rootH1_100080208 84
94 3300003323 rootH1_10121381 rootH1_101213812 84
95 3300003752 Ga0055539_1010866 Ga0055539_10108662 84
96 3300003756 Ga0055533_1000011 Ga0055533_1000011252 84
97 3300003759 Ga0055525_1000989 Ga0055525_10009895 84
98 3300003761 Ga0055535_1000097 Ga0055535_100009724 84
99 3300003763 Ga0055529_1000202 Ga0055529_100020262 84
100 3300003792 Ga0055540_1006840 Ga0055540_10068408 84
101 3300003794 Ga0055531_10000312 Ga0055531_1000031219 84
102 3300005295 Ga0065707_10286322 Ga0065707_102863222 84
103 3300005327 Ga0070658_10063772 Ga0070658_100637722 84
104 3300005327 Ga0070658_10064006 Ga0070658_100640062 84
105 3300005327 Ga0070658_10221641 Ga0070658_102216412 84
106 3300005327 Ga0070658_10810179 Ga0070658_108101791 84
107 3300005329 Ga0070683_102440058 Ga0070683_1024400581 84
108 3300005330 Ga0070690_100104539 Ga0070690_1001045392 84
109 3300005334 Ga0068869_100006181 Ga0068869_1000061813 84
110 3300005335 Ga0070666_10443233 Ga0070666_104432332 84
111 3300005336 Ga0070680_101998320 Ga0070680_1019983202 84
112 3300005338 Ga0068868_100853073 Ga0068868_1008530731 84
113 3300005338 Ga0068868_101770327 Ga0068868_1017703271 84
114 3300005339 Ga0070660_100021704 Ga0070660_1000217043 84
115 3300005339 Ga0070660_100529851 Ga0070660_1005298512 84
116 3300005340 Ga0070689_101084522 Ga0070689_1010845221 84
117 3300005344 Ga0070661_101259256 Ga0070661_1012592562 84
118 3300005344 Ga0070661_101501979 Ga0070661_1015019791 84
119 3300005345 Ga0070692_11193217 Ga0070692_111932172 84
120 3300005354 Ga0070675_101246534 Ga0070675_1012465342 84
121 3300005364 Ga0070673_100787828 Ga0070673_1007878282 84
122 3300005364 Ga0070673_100922332 Ga0070673_1009223322 84
123 3300005366 Ga0070659_100011135 Ga0070659_1000111356 84
124 3300005366 Ga0070659_100500500 Ga0070659_1005005002 84
125 3300005441 Ga0070700_101956878 Ga0070700_1019568781 84
126 3300005455 Ga0070663_101086822 Ga0070663_1010868222 84
127 3300005457 Ga0070662_101814173 Ga0070662_1018141732 84
128 3300005458 Ga0070681_11687238 Ga0070681_116872381 84
129 3300005466 Ga0070685_10148826 Ga0070685_101488261 84
130 3300005466 Ga0070685_10854841 Ga0070685_108548412 84
131 3300005535 Ga0070684_100022047 Ga0070684_1000220476 84
132 3300005539 Ga0068853_100115161 Ga0068853_1001151613 84
133 3300005563 Ga0068855_100000971 Ga0068855_10000097124 84
134 3300005563 Ga0068855_100307735 Ga0068855_1003077352 84
135 3300005563 Ga0068855_100744297 Ga0068855_1007442972 84
136 3300005564 Ga0070664_101668593 Ga0070664_1016685932 84
137 3300005577 Ga0068857_100003123 Ga0068857_10000312313 84
138 3300005577 Ga0068857_100531184 Ga0068857_1005311842 84
139 3300005578 Ga0068854_100030573 Ga0068854_1000305732 84
140 3300005614 Ga0068856_100000951 Ga0068856_1000009513 84
141 3300005616 Ga0068852_100777559 Ga0068852_1007775592 84
142 3300005616 Ga0068852_102616279 Ga0068852_1026162791 84
143 3300005618 Ga0068864_100744594 Ga0068864_1007445941 84
144 3300005718 Ga0068866_10562771 Ga0068866_105627712 84
145 3300005719 Ga0068861_100021114 Ga0068861_1000211143 84
146 3300005843 Ga0068860_100203759 Ga0068860_1002037592 84
147 3300005844 Ga0068862_101354676 Ga0068862_1013546762 84
148 3300006038 Ga0075365_10314983 Ga0075365_103149832 84
149 3300006048 Ga0075363_100821783 Ga0075363_1008217832 84
150 3300006178 Ga0075367_10194618 Ga0075367_101946182 84
151 3300006353 Ga0075370_10224485 Ga0075370_102244852 84
152 3300006353 Ga0075370_10611129 Ga0075370_106111292 84
153 3300006846 Ga0075430_100054008 Ga0075430_1000540083 84
154 3300006846 Ga0075430_100085353 Ga0075430_1000853532 84
155 3300006880 Ga0075429_100003208 Ga0075429_1000032088 84
156 3300006880 Ga0075429_100145689 Ga0075429_1001456892 84
157 3300006880 Ga0075429_101799522 Ga0075429_1017995221 84
158 3300009093 Ga0105240_10019163 Ga0105240_100191639 84
159 3300009093 Ga0105240_10027737 Ga0105240_100277373 84
160 3300009093 Ga0105240_11026253 Ga0105240_110262532 84
161 3300009093 Ga0105240_11821040 Ga0105240_118210401 84
162 3300009098 Ga0105245_10648020 Ga0105245_106480202 84
163 3300009148 Ga0105243_10416431 Ga0105243_104164312 84
164 3300009148 Ga0105243_10853324 Ga0105243_108533242 84
165 3300009174 Ga0105241_10206283 Ga0105241_102062832 84
166 3300009176 Ga0105242_10489349 Ga0105242_104893492 84
167 3300009545 Ga0105237_10437550 Ga0105237_104375502 84
168 3300009545 Ga0105237_12759218 Ga0105237_127592181 84
169 3300009551 Ga0105238_10046256 Ga0105238_100462565 84
170 3300009553 Ga0105249_10635990 Ga0105249_106359902 84
171 3300010375 Ga0105239_13090582 Ga0105239_130905822 84
172 3300013105 Ga0157369_10137207 Ga0157369_101372073 84
173 3300013296 Ga0157374_12333335 Ga0157374_123333351 84
174 3300013297 Ga0157378_10055779 Ga0157378_100557792 84
175 3300013306 Ga0163162_11814711 Ga0163162_118147112 84
176 3300013307 Ga0157372_10103908 Ga0157372_101039081 84
177 3300014326 Ga0157380_12032387 Ga0157380_120323872 84
178 3300014326 Ga0157380_12685755 Ga0157380_126857552 84
179 3300014969 Ga0157376_10680492 Ga0157376_106804921 84
180 3300015261 Ga0182006_1250452 Ga0182006_12504521 84
181 3300015262 Ga0182007_10135318 Ga0182007_101353182 84
182 3300025226 Ga0209674_100003 Ga0209674_100003551 84
183 3300025228 Ga0209672_108419 Ga0209672_1084192 84
184 3300025230 Ga0209563_100010 Ga0209563_100010281 84
185 3300025231 Ga0207427_101137 Ga0207427_1011378 84
186 3300025242 Ga0209258_100162 Ga0209258_10016276 84
187 3300025246 Ga0209646_1000066 Ga0209646_1000066157 84
188 3300025250 Ga0209026_1000027 Ga0209026_1000027172 84
189 3300025250 Ga0209026_1048919 Ga0209026_10489192 84
190 3300025253 Ga0209677_100178 Ga0209677_10017810 84
191 3300025253 Ga0209677_100183 Ga0209677_10018313 84
192 3300025253 Ga0209677_104325 Ga0209677_1043256 84
193 3300025256 Ga0209759_1000131 Ga0209759_100013118 84
194 3300025256 Ga0209759_1000662 Ga0209759_100066216 84
195 3300025256 Ga0209759_1005141 Ga0209759_10051413 84
196 3300025256 Ga0209759_1017083 Ga0209759_10170832 84
197 3300025256 Ga0209759_1046348 Ga0209759_10463481 84
198 3300025272 Ga0209455_1000128 Ga0209455_100012871 84
199 3300025273 Ga0209673_1037143 Ga0209673_10371432 84
200 3300025297 Ga0209758_1107255 Ga0209758_11072552 84
201 3300025302 Ga0207426_1090302 Ga0207426_10903022 84
202 3300025303 Ga0209051_1000241 Ga0209051_100024112 84
203 3300025304 Ga0209257_1000015 Ga0209257_1000015152 84
204 3300025903 Ga0207680_10243058 Ga0207680_102430582 84
205 3300025909 Ga0207705_10050795 Ga0207705_100507952 84
206 3300025909 Ga0207705_10112426 Ga0207705_101124263 84
207 3300025909 Ga0207705_10144672 Ga0207705_101446723 84
208 3300025909 Ga0207705_10173874 Ga0207705_101738742 84
209 3300025909 Ga0207705_10470833 Ga0207705_104708332 84
210 3300025911 Ga0207654_10027109 Ga0207654_100271093 84
211 3300025912 Ga0207707_10892295 Ga0207707_108922951 84
212 3300025913 Ga0207695_10011214 Ga0207695_100112149 84
213 3300025913 Ga0207695_10030702 Ga0207695_100307022 84
214 3300025914 Ga0207671_10133918 Ga0207671_101339182 84
215 3300025919 Ga0207657_10005150 Ga0207657_100051503 84
216 3300025919 Ga0207657_10362666 Ga0207657_103626662 84
217 3300025920 Ga0207649_11298560 Ga0207649_112985602 84
218 3300025924 Ga0207694_10049847 Ga0207694_100498472 84
219 3300025927 Ga0207687_10411114 Ga0207687_104111142 84
220 3300025932 Ga0207690_10012639 Ga0207690_100126392 84
221 3300025932 Ga0207690_10248709 Ga0207690_102487092 84
222 3300025935 Ga0207709_10380129 Ga0207709_103801292 84
223 3300025935 Ga0207709_10627962 Ga0207709_106279621 84
224 3300025936 Ga0207670_10657343 Ga0207670_106573431 84
225 3300025942 Ga0207689_10131208 Ga0207689_101312082 84
226 3300025949 Ga0207667_10103966 Ga0207667_101039662 84
227 3300025949 Ga0207667_10276242 Ga0207667_102762422 84
228 3300025949 Ga0207667_10365573 Ga0207667_103655732 84
229 3300025949 Ga0207667_10662083 Ga0207667_106620832 84
230 3300025960 Ga0207651_11904524 Ga0207651_119045242 84
231 3300025972 Ga0207668_10888083 Ga0207668_108880832 84
232 3300025981 Ga0207640_10005583 Ga0207640_100055834 84
233 3300025986 Ga0207658_11559584 Ga0207658_115595841 84
234 3300026023 Ga0207677_10579311 Ga0207677_105793112 84
235 3300026041 Ga0207639_10343987 Ga0207639_103439872 84
236 3300026078 Ga0207702_10000220 Ga0207702_1000022036 84
237 3300026078 Ga0207702_10487159 Ga0207702_104871592 84
238 3300026088 Ga0207641_12334546 Ga0207641_123345462 84
239 3300026116 Ga0207674_10006407 Ga0207674_100064075 84
240 3300026118 Ga0207675_100031693 Ga0207675_1000316935 84
241 3300026142 Ga0207698_10220476 Ga0207698_102204762 84
242 3300026142 Ga0207698_12061032 Ga0207698_120610322 84
243 3300028381 Ga0268264_10210436 Ga0268264_102104363 84
244 3300028573 Ga0265334_10043805 Ga0265334_100438052 84
245 3300028666 Ga0265336_10000008 Ga0265336_10000008154 84
246 3300029957 Ga0265324_10003914 Ga0265324_100039143 84
247 3300031548 Ga0307408_100655348 Ga0307408_1006553482 84
248 3300031548 Ga0307408_101491525 Ga0307408_1014915251 84
249 3300031548 Ga0307408_102374295 Ga0307408_1023742952 84
250 3300031730 Ga0307516_10091429 Ga0307516_100914294 84
251 3300031731 Ga0307405_11942204 Ga0307405_119422042 84
252 3300032005 Ga0307411_10488831 Ga0307411_104888312 84
253 3300032005 Ga0307411_12159208 Ga0307411_121592082 84
254 3300035086 Ga0373934_0293083 Ga0373934_0293083_88_345 84
255 3300035692 Ga0373935_1219599 Ga0373935_1219599_281_538 84
256 3300037312 Ga0395899_0005707 Ga0395899_0005707_2045_2311 84
257 3300037418 Ga0395900_0018896 Ga0395900_0018896_650_916 84
258 3300037418 Ga0395900_0184677 Ga0395900_0184677_306_572 84
259 3300037466 Ga0395898_0014498 Ga0395898_0014498_778_1044 84
260 3300037466 Ga0395898_0366828 Ga0395898_0366828_1048_1305 84
261 3300037466 Ga0395898_0528845 Ga0395898_0528845_476_742 84
262 3300037471 Ga0395905_0086534 Ga0395905_0086534_1309_1575 84
263 3300037471 Ga0395905_0164653 Ga0395905_0164653_1139_1402 84
264 3300037471 Ga0395905_0200480 Ga0395905_0200480_503_769 84
265 3300037471 Ga0395905_1063965 Ga0395905_1063965_186_443 84
266 3300038443 Ga0395901_0016167 Ga0395901_0016167_6496_6753 84
267 3300038443 Ga0395901_0018542 Ga0395901_0018542_2879_3145 84
268 3300038443 Ga0395901_0662866 Ga0395901_0662866_505_771 84
269 3300038443 Ga0395901_0873229 Ga0395901_0873229_582_848 84
270 3300041460 Ga0451802_1805873 Ga0451802_1805873_122_388 84
271 3300041509 Ga0451843_1133688 Ga0451843_1133688_234_494 84
272 3300042876 Ga0451577_0008177 Ga0451577_0008177_7981_8250 84
273 3300044673 Ga0453683_0005225 Ga0453683_0005225_6539_6805 84
274 3300044683 Ga0466965_0060420 Ga0466965_0060420_159_425 84
275 3300044684 Ga0466966_0256125 Ga0466966_0256125_527_793 84
276 3300044684 Ga0466966_0316860 Ga0466966_0316860_62_328 84
277 3300044712 Ga0453684_1054740 Ga0453684_1054740_331_600 84
278 3300044719 Ga0466971_0615827 Ga0466971_0615827_223_489 84
279 3300044842 Ga0466957_0142263 Ga0466957_0142263_1055_1321 84
280 3300044842 Ga0466957_0406995 Ga0466957_0406995_250_516 84
281 3300044901 Ga0466960_0653318 Ga0466960_0653318_178_444 84
282 3300045051 Ga0451576_0000914 Ga0451576_0000914_12789_13058 84
283 3300045051 Ga0451576_0023020 Ga0451576_0023020_5709_5975 84
284 3300046471 Ga0495650_0095921 Ga0495650_0095921_467_724 84
285 3300046475 Ga0495639_0013949 Ga0495639_0013949_3044_3301 84
286 3300046506 Ga0495583_0000444 Ga0495583_0000444_17431_17688 84
287 3300046507 Ga0495606_0002487 Ga0495606_0002487_2923_3180 84
288 3300046507 Ga0495606_0441275 Ga0495606_0441275_26_283 84
289 3300046511 Ga0495608_0272110 Ga0495608_0272110_424_681 84
290 3300046529 Ga0495652_0702413 Ga0495652_0702413_183_440 84
291 3300046539 Ga0495621_0129890 Ga0495621_0129890_338_604 84
292 3300046539 Ga0495621_0298990 Ga0495621_0298990_242_508 84
293 3300046616 Ga0495668_0048989 Ga0495668_0048989_369_626 84
294 3300046660 Ga0495625_0126142 Ga0495625_0126142_1090_1347 84
295 3300046684 Ga0495669_0070763 Ga0495669_0070763_480_737 84
296 3300046692 Ga0495671_0255894 Ga0495671_0255894_445_702 84
297 3300046694 Ga0495649_0000298 Ga0495649_0000298_25701_25958 84
298 3300046794 Ga0495589_0023031 Ga0495589_0023031_107_364 84
299 3300046810 Ga0495660_0016673 Ga0495660_0016673_3874_4134 84
300 3300047323 Ga0495683_0110040 Ga0495683_0110040_413_670 84
301 3300047472 Ga0495686_0011222 Ga0495686_0011222_2014_2271 84
302 3300048090 Ga0495615_0174500 Ga0495615_0174500_205_471 84
303 3300048903 Ga0496100_0454932 Ga0496100_0454932_319_576 84
304 3300048907 Ga0496104_0605612 Ga0496104_0605612_483_740 84
305 3300048909 Ga0496106_0661220 Ga0496106_0661220_376_633 84
306 3300048909 Ga0496106_1177645 Ga0496106_1177645_245_502 84
307 3300048924 Ga0496121_0009710 Ga0496121_0009710_2186_2446 84
308 3300048927 Ga0496124_0000458 Ga0496124_0000458_9131_9391 84
309 3300048928 Ga0496125_0514567 Ga0496125_0514567_153_413 84
310 3300049527 Ga0501311_081458 Ga0501311_081458_121_384 84
311 3300049574 Ga0501038_0821070 Ga0501038_0821070_101_367 84
312 3300049679 Ga0501249_142411 Ga0501249_142411_107_373 84
313 3300049758 Ga0501241_086545 Ga0501241_086545_260_526 84
314 3300049760 Ga0501263_009077 Ga0501263_009077_551_817 84
315 3300049772 Ga0501275_082232 Ga0501275_082232_181_447 84
316 3300050490 nmdc:mga03n38_398155_c1 nmdc:mga03n38_398155_c1_464_730 84
317 3300050493 nmdc:mga0k408_196323_c1 nmdc:mga0k408_196323_c1_338_604 84
318 3300050494 nmdc:mga06z11_645661_c1 nmdc:mga06z11_645661_c1_289_555 84
319 3300050496 nmdc:mga07m45_227298_c1 nmdc:mga07m45_227298_c1_398_655 84
320 3300050508 nmdc:mga09592_151745_c1 nmdc:mga09592_151745_c1_353_613 84
321 3300050508 nmdc:mga09592_3332_c1 nmdc:mga09592_3332_c1_480_740 84
322 3300050509 nmdc:mga0qj67_266991_c1 nmdc:mga0qj67_266991_c1_549_839 84
323 3300050509 nmdc:mga0qj67_35975_c1 nmdc:mga0qj67_35975_c1_2235_2495 84
324 3300053080 Ga0500635_0000003 Ga0500635_0000003_125488_125745 84
325 3300053093 Ga0500651_0625055 Ga0500651_0625055_72_329 84
326 3300053122 Ga0500608_037775 Ga0500608_037775_1404_1658 84
327 3300053136 Ga0500559_0070831 Ga0500559_0070831_370_627 84
328 3300053138 Ga0500564_111504 Ga0500564_111504_788_1045 84
329 3300053138 Ga0500564_244383 Ga0500564_244383_307_564 84
330 3300053148 Ga0500590_084162 Ga0500590_084162_654_908 84
331 3300053177 Ga0500636_0012032 Ga0500636_0012032_4385_4642 84
332 3300055283 Ga0500661_038307 Ga0500661_038307_431_688 84
333 3300003323 rootH1_10299180 rootH1_102991802 85
334 3300005288 Ga0065714_10092872 Ga0065714_100928723 85
335 3300005289 Ga0065704_10101871 Ga0065704_101018713 85
336 3300005327 Ga0070658_11241450 Ga0070658_112414502 85
337 3300005328 Ga0070676_10016974 Ga0070676_100169744 85
338 3300005328 Ga0070676_10049433 Ga0070676_100494334 85
339 3300005331 Ga0070670_100012213 Ga0070670_1000122134 85
340 3300005331 Ga0070670_100301079 Ga0070670_1003010793 85
341 3300005333 Ga0070677_10003281 Ga0070677_100032814 85
342 3300005333 Ga0070677_10047184 Ga0070677_100471841 85
343 3300005334 Ga0068869_100610853 Ga0068869_1006108532 85
344 3300005335 Ga0070666_10190296 Ga0070666_101902962 85
345 3300005338 Ga0068868_100830482 Ga0068868_1008304822 85
346 3300005343 Ga0070687_100935021 Ga0070687_1009350211 85
347 3300005353 Ga0070669_100002753 Ga0070669_10000275311 85
348 3300005354 Ga0070675_100000137 Ga0070675_1000001371 85
349 3300005354 Ga0070675_100011301 Ga0070675_1000113012 85
350 3300005355 Ga0070671_100006504 Ga0070671_1000065042 85
351 3300005355 Ga0070671_100021060 Ga0070671_1000210605 85
352 3300005355 Ga0070671_101918997 Ga0070671_1019189971 85
353 3300005356 Ga0070674_100055843 Ga0070674_1000558434 85
354 3300005356 Ga0070674_100124598 Ga0070674_1001245983 85
355 3300005364 Ga0070673_100011122 Ga0070673_1000111222 85
356 3300005364 Ga0070673_101779635 Ga0070673_1017796351 85
357 3300005365 Ga0070688_100185921 Ga0070688_1001859212 85
358 3300005367 Ga0070667_100045834 Ga0070667_1000458343 85
359 3300005367 Ga0070667_101217262 Ga0070667_1012172622 85
360 3300005445 Ga0070708_100602428 Ga0070708_1006024282 85
361 3300005456 Ga0070678_100085936 Ga0070678_1000859364 85
362 3300005456 Ga0070678_100129530 Ga0070678_1001295302 85
363 3300005456 Ga0070678_100136476 Ga0070678_1001364763 85
364 3300005457 Ga0070662_101533417 Ga0070662_1015334171 85
365 3300005459 Ga0068867_100005126 Ga0068867_1000051266 85
366 3300005459 Ga0068867_100015020 Ga0068867_1000150205 85
367 3300005459 Ga0068867_100134651 Ga0068867_1001346513 85
368 3300005466 Ga0070685_10483596 Ga0070685_104835962 85
369 3300005539 Ga0068853_101486943 Ga0068853_1014869432 85
370 3300005543 Ga0070672_100000520 Ga0070672_10000052011 85
371 3300005548 Ga0070665_100846338 Ga0070665_1008463382 85
372 3300005548 Ga0070665_101994326 Ga0070665_1019943262 85
373 3300005564 Ga0070664_100160216 Ga0070664_1001602163 85
374 3300005564 Ga0070664_102254076 Ga0070664_1022540761 85
375 3300005616 Ga0068852_101828204 Ga0068852_1018282042 85
376 3300005616 Ga0068852_102668876 Ga0068852_1026688762 85
377 3300005618 Ga0068864_100050509 Ga0068864_1000505092 85
378 3300005834 Ga0068851_10019074 Ga0068851_100190742 85
379 3300005840 Ga0068870_10165055 Ga0068870_101650552 85
380 3300005841 Ga0068863_100825863 Ga0068863_1008258632 85
381 3300005841 Ga0068863_101866102 Ga0068863_1018661022 85
382 3300006237 Ga0097621_100060641 Ga0097621_1000606412 85
383 3300006237 Ga0097621_101311968 Ga0097621_1013119682 85
384 3300006237 Ga0097621_102379452 Ga0097621_1023794522 85
385 3300006358 Ga0068871_100030494 Ga0068871_1000304943 85
386 3300006881 Ga0068865_100396283 Ga0068865_1003962832 85
387 3300006881 Ga0068865_100577957 Ga0068865_1005779571 85
388 3300006946 Ga0079104_1000008 Ga0079104_1000008169 85
389 3300009092 Ga0105250_10000043 Ga0105250_1000004347 85
390 3300009093 Ga0105240_10001650 Ga0105240_1000165027 85
391 3300009094 Ga0111539_11262287 Ga0111539_112622871 85
392 3300009098 Ga0105245_11767656 Ga0105245_117676562 85
393 3300009147 Ga0114129_10086267 Ga0114129_100862673 85
394 3300009148 Ga0105243_10002163 Ga0105243_1000216315 85
395 3300009545 Ga0105237_10001445 Ga0105237_1000144518 85
396 3300009551 Ga0105238_10006278 Ga0105238_100062783 85
397 3300009553 Ga0105249_12407406 Ga0105249_124074062 85
398 3300010375 Ga0105239_10002359 Ga0105239_1000235922 85
399 3300013296 Ga0157374_10276489 Ga0157374_102764892 85
400 3300013306 Ga0163162_10706031 Ga0163162_107060312 85
401 3300013308 Ga0157375_10144659 Ga0157375_101446593 85
402 3300014325 Ga0163163_11217692 Ga0163163_112176921 85
403 3300014326 Ga0157380_10897102 Ga0157380_108971022 85
404 3300014326 Ga0157380_11043677 Ga0157380_110436771 85
405 3300014497 Ga0182008_10669119 Ga0182008_106691191 85
406 3300014745 Ga0157377_10394633 Ga0157377_103946332 85
407 3300014968 Ga0157379_11684972 Ga0157379_116849721 85
408 3300014969 Ga0157376_12225864 Ga0157376_122258642 85
409 3300017792 Ga0163161_10079688 Ga0163161_100796882 85
410 3300025315 Ga0207697_10015928 Ga0207697_100159283 85
411 3300025321 Ga0207656_10014495 Ga0207656_100144954 85
412 3300025711 Ga0207696_1000424 Ga0207696_100042414 85
413 3300025893 Ga0207682_10002496 Ga0207682_100024966 85
414 3300025893 Ga0207682_10034562 Ga0207682_100345622 85
415 3300025899 Ga0207642_10379205 Ga0207642_103792052 85
416 3300025899 Ga0207642_10976435 Ga0207642_109764352 85
417 3300025901 Ga0207688_10789625 Ga0207688_107896251 85
418 3300025903 Ga0207680_10255778 Ga0207680_102557782 85
419 3300025907 Ga0207645_10016384 Ga0207645_100163844 85
420 3300025907 Ga0207645_10119290 Ga0207645_101192902 85
421 3300025908 Ga0207643_10021956 Ga0207643_100219564 85
422 3300025909 Ga0207705_10086725 Ga0207705_100867253 85
423 3300025913 Ga0207695_10038286 Ga0207695_100382864 85
424 3300025914 Ga0207671_10004904 Ga0207671_100049044 85
425 3300025923 Ga0207681_10030499 Ga0207681_100304993 85
426 3300025923 Ga0207681_11516900 Ga0207681_115169002 85
427 3300025924 Ga0207694_10010745 Ga0207694_100107454 85
428 3300025925 Ga0207650_10000265 Ga0207650_1000026524 85
429 3300025925 Ga0207650_10580291 Ga0207650_105802912 85
430 3300025926 Ga0207659_10000148 Ga0207659_1000014813 85
431 3300025926 Ga0207659_10433916 Ga0207659_104339162 85
432 3300025927 Ga0207687_10328433 Ga0207687_103284333 85
433 3300025929 Ga0207664_10580353 Ga0207664_105803532 85
434 3300025931 Ga0207644_10209224 Ga0207644_102092243 85
435 3300025931 Ga0207644_11813150 Ga0207644_118131502 85
436 3300025933 Ga0207706_10846812 Ga0207706_108468122 85
437 3300025935 Ga0207709_10000070 Ga0207709_100000705 85
438 3300025937 Ga0207669_10080300 Ga0207669_100803002 85
439 3300025937 Ga0207669_10899010 Ga0207669_108990102 85
440 3300025938 Ga0207704_10037547 Ga0207704_100375474 85
441 3300025940 Ga0207691_10012845 Ga0207691_100128458 85
442 3300025942 Ga0207689_10484882 Ga0207689_104848822 85
443 3300025945 Ga0207679_10652019 Ga0207679_106520192 85
444 3300025945 Ga0207679_11063023 Ga0207679_110630232 85
445 3300025960 Ga0207651_10006277 Ga0207651_100062772 85
446 3300025960 Ga0207651_11404461 Ga0207651_114044612 85
447 3300025972 Ga0207668_10198425 Ga0207668_101984253 85
448 3300025981 Ga0207640_10115473 Ga0207640_101154734 85
449 3300025981 Ga0207640_10558461 Ga0207640_105584612 85
450 3300025986 Ga0207658_10064120 Ga0207658_100641203 85
451 3300025986 Ga0207658_11007677 Ga0207658_110076772 85
452 3300026023 Ga0207677_10008981 Ga0207677_100089816 85
453 3300026041 Ga0207639_11132730 Ga0207639_111327302 85
454 3300026067 Ga0207678_10649317 Ga0207678_106493172 85
455 3300026067 Ga0207678_11450588 Ga0207678_114505881 85
456 3300026088 Ga0207641_10837485 Ga0207641_108374852 85
457 3300026088 Ga0207641_11489245 Ga0207641_114892452 85
458 3300026089 Ga0207648_10034719 Ga0207648_100347195 85
459 3300026089 Ga0207648_10312313 Ga0207648_103123132 85
460 3300026095 Ga0207676_10005934 Ga0207676_100059346 85
461 3300026118 Ga0207675_100879392 Ga0207675_1008793921 85
462 3300026121 Ga0207683_10013304 Ga0207683_100133042 85
463 3300026121 Ga0207683_10035679 Ga0207683_100356793 85
464 3300026121 Ga0207683_10389721 Ga0207683_103897212 85
465 3300026142 Ga0207698_11538011 Ga0207698_115380112 85
466 3300027111 Ga0209281_1000029 Ga0209281_1000029228 85
467 3300027614 Ga0209970_1000168 Ga0209970_10001685 85
468 3300027665 Ga0209983_1037986 Ga0209983_10379862 85
469 3300027682 Ga0209971_1128299 Ga0209971_11282992 85
470 3300027717 Ga0209998_10132945 Ga0209998_101329452 85
471 3300027876 Ga0209974_10078728 Ga0209974_100787282 85
472 3300028379 Ga0268266_10221686 Ga0268266_102216862 85
473 3300028794 Ga0307515_10103443 Ga0307515_101034434 85
474 3300028794 Ga0307515_10218928 Ga0307515_102189283 85
475 3300031251 Ga0265327_10067541 Ga0265327_100675412 85
476 3300031456 Ga0307513_10058646 Ga0307513_100586464 85
477 3300031456 Ga0307513_10159272 Ga0307513_101592722 85
478 3300031548 Ga0307408_100034737 Ga0307408_1000347372 85
479 3300031731 Ga0307405_10045504 Ga0307405_100455044 85
480 3300031731 Ga0307405_10191714 Ga0307405_101917142 85
481 3300031731 Ga0307405_10950896 Ga0307405_109508962 85
482 3300031824 Ga0307413_10566153 Ga0307413_105661532 85
483 3300031852 Ga0307410_10030505 Ga0307410_100305053 85
484 3300031852 Ga0307410_10397686 Ga0307410_103976862 85
485 3300031901 Ga0307406_10016088 Ga0307406_100160885 85
486 3300031901 Ga0307406_10867813 Ga0307406_108678132 85
487 3300031901 Ga0307406_11677345 Ga0307406_116773452 85
488 3300031903 Ga0307407_11664232 Ga0307407_116642321 85
489 3300031911 Ga0307412_10222918 Ga0307412_102229182 85
490 3300031911 Ga0307412_10367228 Ga0307412_103672282 85
491 3300031995 Ga0307409_100402085 Ga0307409_1004020852 85
492 3300031995 Ga0307409_100813565 Ga0307409_1008135652 85
493 3300032004 Ga0307414_10485653 Ga0307414_104856532 85
494 3300032004 Ga0307414_10517575 Ga0307414_105175752 85
495 3300032005 Ga0307411_10000973 Ga0307411_100009736 85
496 3300032005 Ga0307411_10130857 Ga0307411_101308573 85
497 3300032005 Ga0307411_10380466 Ga0307411_103804662 85
498 3300032005 Ga0307411_11012110 Ga0307411_110121101 85
499 3300032005 Ga0307411_11118356 Ga0307411_111183562 85
500 3300032126 Ga0307415_100021431 Ga0307415_1000214312 85
501 3300032126 Ga0307415_100778427 Ga0307415_1007784272 85
502 3300033179 Ga0307507_10474021 Ga0307507_104740212 85
503 3300035111 Ga0373923_0375765 Ga0373923_0375765_150_413 85
504 3300035116 Ga0373945_0127353 Ga0373945_0127353_541_804 85
505 3300035171 Ga0373946_0613344 Ga0373946_0613344_24_287 85
506 3300037068 Ga0373925_0436029 Ga0373925_0436029_414_677 85
507 3300041407 Ga0439447_144417 Ga0439447_144417_212_481 85
508 3300041408 Ga0439453_0042819 Ga0439453_0042819_347_616 85
509 3300041410 Ga0439461_0100632 Ga0439461_0100632_281_544 85
510 3300041413 Ga0439465_0259599 Ga0439465_0259599_191_460 85
511 3300041443 Ga0451789_0978585 Ga0451789_0978585_454_717 85
512 3300041453 Ga0451797_1490071 Ga0451797_1490071_55_315 85
513 3300041458 Ga0451798_0197861 Ga0451798_0197861_76_339 85
514 3300041486 Ga0451807_0557572 Ga0451807_0557572_280_543 85
515 3300041492 Ga0451835_0830645 Ga0451835_0830645_683_946 85
516 3300041507 Ga0451851_0652104 Ga0451851_0652104_80_343 85
517 3300041507 Ga0451851_0727205 Ga0451851_0727205_112_378 85
518 3300041512 Ga0451853_2527883 Ga0451853_2527883_117_377 85
519 3300041997 Ga0439431_0054675 Ga0439431_0054675_722_985 85
520 3300042003 Ga0439443_114022 Ga0439443_114022_158_427 85
521 3300042006 Ga0439432_089814 Ga0439432_089814_169_438 85
522 3300042116 Ga0450912_010762 Ga0450912_010762_41_310 85
523 3300042123 Ga0450921_014108 Ga0450921_014108_66_335 85
524 3300042128 Ga0450897_002399 Ga0450897_002399_612_881 85
525 3300042134 Ga0450898_005652 Ga0450898_005652_505_774 85
526 3300042138 Ga0450903_028373 Ga0450903_028373_354_623 85
527 3300042139 Ga0450904_032532 Ga0450904_032532_91_360 85
528 3300042147 Ga0450910_031874 Ga0450910_031874_281_550 85
529 3300042156 Ga0439446_0007973 Ga0439446_0007973_1478_1747 85
530 3300042157 Ga0439458_0030099 Ga0439458_0030099_623_892 85
531 3300042185 Ga0450909_011874 Ga0450909_011874_534_803 85
532 3300042435 Ga0439434_0036474 Ga0439434_0036474_474_737 85
533 3300042435 Ga0439434_0089299 Ga0439434_0089299_548_817 85
534 3300042532 Ga0450893_0041981 Ga0450893_0041981_216_485 85
535 3300044712 Ga0453684_1842782 Ga0453684_1842782_318_578 85
536 3300045051 Ga0451576_0001036 Ga0451576_0001036_218_478 85
537 3300045051 Ga0451576_0613620 Ga0451576_0613620_385_651 85
538 3300046461 Ga0495641_0370480 Ga0495641_0370480_10_273 85
539 3300046501 Ga0495607_0000236 Ga0495607_0000236_40414_40674 85
540 3300046516 Ga0495628_0710962 Ga0495628_0710962_397_660 85
541 3300046683 Ga0495658_0804802 Ga0495658_0804802_267_530 85
542 3300047472 Ga0495686_0513514 Ga0495686_0513514_222_485 85
543 3300048905 Ga0496102_1265550 Ga0496102_1265550_355_618 85
544 3300048911 Ga0496108_0402155 Ga0496108_0402155_723_986 85
545 3300048911 Ga0496108_1502699 Ga0496108_1502699_257_520 85
546 3300048912 Ga0496109_0170210 Ga0496109_0170210_17_280 85
547 3300049128 Ga0501308_075281 Ga0501308_075281_215_490 85
548 3300049569 Ga0501032_0453093 Ga0501032_0453093_191_460 85
549 3300049570 Ga0501033_0080077 Ga0501033_0080077_1907_2176 85
550 3300049573 Ga0501037_0327581 Ga0501037_0327581_659_928 85
551 3300049579 Ga0501043_0093019 Ga0501043_0093019_40_309 85
552 3300049581 Ga0501047_0412481 Ga0501047_0412481_884_1153 85
553 3300049581 Ga0501047_0724417 Ga0501047_0724417_409_678 85
554 3300049582 Ga0501048_1021299 Ga0501048_1021299_47_310 85
555 3300049593 Ga0501077_0298533 Ga0501077_0298533_595_870 85
556 3300049742 Ga0501080_0435465 Ga0501080_0435465_772_1041 85
557 3300049822 Ga0501035_0201546 Ga0501035_0201546_425_694 85
558 3300049823 Ga0501044_0289251 Ga0501044_0289251_1057_1326 85
559 3300050507 nmdc:mga05p37_261861_c1 nmdc:mga05p37_261861_c1_1186_1449 85
560 3300050512 nmdc:mga0n895_919912_c1 nmdc:mga0n895_919912_c1_76_339 85
561 3300053086 Ga0500578_0020316 Ga0500578_0020316_3674_3937 85
562 3300053730 Ga0500645_002236 Ga0500645_002236_8233_8496 85
563 3300059424 Ga0590075_037870 Ga0590075_037870_898_1164 85
564 3300059424 Ga0590075_135525 Ga0590075_135525_334_603 85
565 3300002704 JGI25155J39150_1000154 JGI25155J39150_100015431 86
566 3300002705 JGI25156J39149_1000067 JGI25156J39149_100006776 86
567 3300002738 JGI25154J39366_1000089 JGI25154J39366_10000894 86
568 3300002741 JGI25157J39369_1000084 JGI25157J39369_100008476 86
569 3300002773 JGI25152J39213_1048253 JGI25152J39213_10482532 86
570 3300002774 JGI25150J39212_1006313 JGI25150J39212_10063134 86
571 3300002774 JGI25150J39212_1036639 JGI25150J39212_10366391 86
572 3300002987 JGI25159J45721_1000314 JGI25159J45721_100031423 86
573 3300002987 JGI25159J45721_1017200 JGI25159J45721_10172003 86
574 3300003187 JGI25151J46595_10004306 JGI25151J46595_100043065 86
575 3300003187 JGI25151J46595_10013319 JGI25151J46595_100133191 86
576 3300003187 JGI25151J46595_10037114 JGI25151J46595_100371142 86
577 3300003354 JGI25160J50197_1000131 JGI25160J50197_100013168 86
578 3300003354 JGI25160J50197_1036872 JGI25160J50197_10368722 86
579 3300003374 JGI25161J50226_1000009 JGI25161J50226_10000094 86
580 3300003771 Ga0055526_1007332 Ga0055526_10073327 86
581 3300003771 Ga0055526_1042022 Ga0055526_10420221 86
582 3300003773 Ga0055537_1003449 Ga0055537_10034491 86
583 3300003773 Ga0055537_1017660 Ga0055537_10176601 86
584 3300003775 Ga0055524_1000047 Ga0055524_1000047142 86
585 3300003781 Ga0055536_1010008 Ga0055536_10100084 86
586 3300003784 Ga0055534_1024781 Ga0055534_10247812 86
587 3300003790 Ga0055528_1001275 Ga0055528_100127515 86
588 3300003790 Ga0055528_1020790 Ga0055528_10207901 86
589 3300003791 Ga0055530_10001499 Ga0055530_1000149917 86
590 3300003791 Ga0055530_10026106 Ga0055530_100261062 86
591 3300003792 Ga0055540_1000027 Ga0055540_10000272 86
592 3300003794 Ga0055531_10002146 Ga0055531_1000214614 86
593 3300004625 Ga0055543_1000122 Ga0055543_100012227 86
594 3300005262 Ga0065165_1019851 Ga0065165_10198512 86
595 3300005262 Ga0065165_1020045 Ga0065165_10200454 86
596 3300005262 Ga0065165_1104882 Ga0065165_11048822 86
597 3300005327 Ga0070658_10177994 Ga0070658_101779943 86
598 3300005339 Ga0070660_100056954 Ga0070660_1000569545 86
599 3300005341 Ga0070691_10131246 Ga0070691_101312462 86
600 3300005355 Ga0070671_101174924 Ga0070671_1011749242 86
601 3300005445 Ga0070708_101688532 Ga0070708_1016885322 86
602 3300005468 Ga0070707_100229616 Ga0070707_1002296162 86
603 3300005530 Ga0070679_100076511 Ga0070679_1000765116 86
604 3300005539 Ga0068853_100630848 Ga0068853_1006308481 86
605 3300005539 Ga0068853_100965636 Ga0068853_1009656362 86
606 3300005563 Ga0068855_100022188 Ga0068855_1000221882 86
607 3300005563 Ga0068855_100029769 Ga0068855_1000297697 86
608 3300005834 Ga0068851_11016655 Ga0068851_110166552 86
609 3300005981 Ga0081538_10061611 Ga0081538_100616112 86
610 3300006038 Ga0075365_10005107 Ga0075365_100051073 86
611 3300006038 Ga0075365_10142421 Ga0075365_101424212 86
612 3300006038 Ga0075365_10182253 Ga0075365_101822532 86
613 3300006038 Ga0075365_10970646 Ga0075365_109706462 86
614 3300006042 Ga0075368_10015246 Ga0075368_100152465 86
615 3300006048 Ga0075363_100015256 Ga0075363_1000152562 86
616 3300006048 Ga0075363_100088103 Ga0075363_1000881032 86
617 3300006048 Ga0075363_100407215 Ga0075363_1004072152 86
618 3300006048 Ga0075363_100696936 Ga0075363_1006969362 86
619 3300006051 Ga0075364_10049130 Ga0075364_100491304 86
620 3300006177 Ga0075362_10055281 Ga0075362_100552813 86
621 3300006177 Ga0075362_10120303 Ga0075362_101203033 86
622 3300006178 Ga0075367_10007807 Ga0075367_100078074 86
623 3300006178 Ga0075367_10737124 Ga0075367_107371241 86
624 3300006195 Ga0075366_10057805 Ga0075366_100578052 86
625 3300006195 Ga0075366_10105355 Ga0075366_101053553 86
626 3300006881 Ga0068865_101581802 Ga0068865_1015818022 86
627 3300006948 Ga0099826_10253071 Ga0099826_102530712 86
628 3300009093 Ga0105240_10026802 Ga0105240_100268026 86
629 3300009093 Ga0105240_10780051 Ga0105240_107800512 86
630 3300009148 Ga0105243_12416204 Ga0105243_124162042 86
631 3300009551 Ga0105238_10023931 Ga0105238_100239319 86
632 3300009553 Ga0105249_12154526 Ga0105249_121545262 86
633 3300010375 Ga0105239_10142228 Ga0105239_101422283 86
634 3300012513 Ga0157326_1003398 Ga0157326_10033981 86
635 3300014969 Ga0157376_10600104 Ga0157376_106001041 86
636 3300015262 Ga0182007_10031429 Ga0182007_100314293 86
637 3300017792 Ga0163161_12091703 Ga0163161_120917032 86
638 3300025206 Ga0209435_100008 Ga0209435_100008130 86
639 3300025245 Ga0207425_1002969 Ga0207425_10029693 86
640 3300025245 Ga0207425_1004534 Ga0207425_10045342 86
641 3300025245 Ga0207425_1040463 Ga0207425_10404632 86
642 3300025246 Ga0209646_1000029 Ga0209646_1000029148 86
643 3300025250 Ga0209026_1000016 Ga0209026_1000016148 86
644 3300025256 Ga0209759_1000016 Ga0209759_1000016148 86
645 3300025258 Ga0209129_1006958 Ga0209129_10069583 86
646 3300025258 Ga0209129_1059409 Ga0209129_10594092 86
647 3300025263 Ga0209565_1000061 Ga0209565_1000061112 86
648 3300025263 Ga0209565_1001227 Ga0209565_100122712 86
649 3300025273 Ga0209673_1000491 Ga0209673_10004916 86
650 3300025284 Ga0209130_1000014 Ga0209130_1000014223 86
651 3300025284 Ga0209130_1000862 Ga0209130_10008621 86
652 3300025291 Ga0209675_1000105 Ga0209675_100010582 86
653 3300025291 Ga0209675_1000703 Ga0209675_100070317 86
654 3300025292 Ga0209676_1000013 Ga0209676_1000013576 86
655 3300025292 Ga0209676_1000153 Ga0209676_1000153146 86
656 3300025292 Ga0209676_1006585 Ga0209676_10065855 86
657 3300025294 Ga0209025_1010455 Ga0209025_10104553 86
658 3300025294 Ga0209025_1013015 Ga0209025_10130156 86
659 3300025294 Ga0209025_1020829 Ga0209025_10208294 86
660 3300025294 Ga0209025_1034780 Ga0209025_10347803 86
661 3300025294 Ga0209025_1091850 Ga0209025_10918501 86
662 3300025295 Ga0209564_1000181 Ga0209564_1000181120 86
663 3300025295 Ga0209564_1000247 Ga0209564_100024721 86
664 3300025297 Ga0209758_1031085 Ga0209758_10310854 86
665 3300025298 Ga0209050_1000008 Ga0209050_1000008576 86
666 3300025298 Ga0209050_1002596 Ga0209050_10025966 86
667 3300025298 Ga0209050_1018285 Ga0209050_10182853 86
668 3300025299 Ga0209256_1000039 Ga0209256_1000039175 86
669 3300025299 Ga0209256_1028537 Ga0209256_10285372 86
670 3300025299 Ga0209256_1049133 Ga0209256_10491332 86
671 3300025302 Ga0207426_1000242 Ga0207426_1000242110 86
672 3300025302 Ga0207426_1001759 Ga0207426_10017595 86
673 3300025303 Ga0209051_1000005 Ga0209051_1000005576 86
674 3300025303 Ga0209051_1071683 Ga0209051_10716832 86
675 3300025304 Ga0209257_1000031 Ga0209257_1000031166 86
676 3300025304 Ga0209257_1030164 Ga0209257_10301642 86
677 3300025909 Ga0207705_10051128 Ga0207705_100511284 86
678 3300025909 Ga0207705_10153312 Ga0207705_101533123 86
679 3300025909 Ga0207705_10337951 Ga0207705_103379512 86
680 3300025913 Ga0207695_10105566 Ga0207695_101055662 86
681 3300025917 Ga0207660_10358589 Ga0207660_103585892 86
682 3300025917 Ga0207660_10661646 Ga0207660_106616461 86
683 3300025918 Ga0207662_10425178 Ga0207662_104251781 86
684 3300025919 Ga0207657_10014524 Ga0207657_100145246 86
685 3300025921 Ga0207652_10098275 Ga0207652_100982752 86
686 3300025921 Ga0207652_10414513 Ga0207652_104145132 86
687 3300025922 Ga0207646_10318474 Ga0207646_103184742 86
688 3300025924 Ga0207694_10703404 Ga0207694_107034042 86
689 3300025949 Ga0207667_10106740 Ga0207667_101067402 86
690 3300025949 Ga0207667_10193771 Ga0207667_101937715 86
691 3300026041 Ga0207639_10377379 Ga0207639_103773792 86
692 3300026041 Ga0207639_10500676 Ga0207639_105006761 86
693 3300026142 Ga0207698_11981318 Ga0207698_119813182 86
694 3300027614 Ga0209970_1040709 Ga0209970_10407092 86
695 3300027682 Ga0209971_1015094 Ga0209971_10150943 86
696 3300027866 Ga0209813_10120310 Ga0209813_101203101 86
697 3300031235 Ga0265330_10000106 Ga0265330_100001062 86
698 3300031238 Ga0265332_10000008 Ga0265332_10000008278 86
699 3300031241 Ga0265325_10049744 Ga0265325_100497444 86
700 3300031247 Ga0265340_10071583 Ga0265340_100715832 86
701 3300031456 Ga0307513_10000025 Ga0307513_10000025138 86
702 3300031456 Ga0307513_10000363 Ga0307513_100003634 86
703 3300031456 Ga0307513_10570766 Ga0307513_105707662 86
704 3300031456 Ga0307513_10951852 Ga0307513_109518521 86
705 3300031548 Ga0307408_100024015 Ga0307408_1000240152 86
706 3300031548 Ga0307408_100355748 Ga0307408_1003557482 86
707 3300031711 Ga0265314_10000292 Ga0265314_1000029226 86
708 3300031712 Ga0265342_10518809 Ga0265342_105188092 86
709 3300031730 Ga0307516_10067770 Ga0307516_100677706 86
710 3300031824 Ga0307413_12188696 Ga0307413_121886962 86
711 3300031901 Ga0307406_10058110 Ga0307406_100581102 86
712 3300031901 Ga0307406_11922330 Ga0307406_119223302 86
713 3300031911 Ga0307412_11758834 Ga0307412_117588341 86
714 3300032005 Ga0307411_12190306 Ga0307411_121903062 86
715 3300037312 Ga0395899_0038526 Ga0395899_0038526_2453_2716 86
716 3300037312 Ga0395899_0039915 Ga0395899_0039915_515_778 86
717 3300037418 Ga0395900_0007255 Ga0395900_0007255_2692_2955 86
718 3300037418 Ga0395900_0023006 Ga0395900_0023006_3959_4222 86
719 3300037418 Ga0395900_0137212 Ga0395900_0137212_2060_2323 86
720 3300037418 Ga0395900_0702925 Ga0395900_0702925_84_347 86
721 3300037418 Ga0395900_1601164 Ga0395900_1601164_162_431 86
722 3300037466 Ga0395898_0002154 Ga0395898_0002154_23226_23489 86
723 3300037466 Ga0395898_0052022 Ga0395898_0052022_2387_2650 86
724 3300037471 Ga0395905_0000047 Ga0395905_0000047_26370_26633 86
725 3300037471 Ga0395905_0005624 Ga0395905_0005624_9889_10152 86
726 3300037471 Ga0395905_0013597 Ga0395905_0013597_3694_3957 86
727 3300037471 Ga0395905_0033794 Ga0395905_0033794_3655_3918 86
728 3300037471 Ga0395905_0203737 Ga0395905_0203737_391_654 86
729 3300037471 Ga0395905_0251604 Ga0395905_0251604_825_1088 86
730 3300037471 Ga0395905_0253105 Ga0395905_0253105_809_1072 86
731 3300037471 Ga0395905_0262538 Ga0395905_0262538_707_973 86
732 3300037471 Ga0395905_0462898 Ga0395905_0462898_702_968 86
733 3300037471 Ga0395905_0694774 Ga0395905_0694774_59_322 86
734 3300038443 Ga0395901_0042905 Ga0395901_0042905_2042_2305 86
735 3300038443 Ga0395901_0069333 Ga0395901_0069333_2975_3238 86
736 3300038443 Ga0395901_0159781 Ga0395901_0159781_929_1192 86
737 3300038443 Ga0395901_0237974 Ga0395901_0237974_1015_1278 86
738 3300038443 Ga0395901_0337430 Ga0395901_0337430_209_475 86
739 3300041441 Ga0451787_392389 Ga0451787_392389_120_416 86
740 3300041443 Ga0451789_1076770 Ga0451789_1076770_538_798 86
741 3300041451 Ga0451791_1716037 Ga0451791_1716037_262_522 86
742 3300041451 Ga0451791_1822544 Ga0451791_1822544_339_602 86
743 3300041452 Ga0451793_0250537 Ga0451793_0250537_235_495 86
744 3300041452 Ga0451793_0899693 Ga0451793_0899693_224_484 86
745 3300041453 Ga0451797_0381324 Ga0451797_0381324_71_331 86
746 3300041453 Ga0451797_1401759 Ga0451797_1401759_226_486 86
747 3300041458 Ga0451798_0655170 Ga0451798_0655170_483_743 86
748 3300041459 Ga0451800_1282004 Ga0451800_1282004_56_316 86
749 3300041486 Ga0451807_1313990 Ga0451807_1313990_278_541 86
750 3300041496 Ga0451839_0378695 Ga0451839_0378695_76_342 86
751 3300041512 Ga0451853_1145788 Ga0451853_1145788_16_276 86
752 3300042532 Ga0450893_0007589 Ga0450893_0007589_176_439 86
753 3300044656 Ga0466969_0013272 Ga0466969_0013272_1258_1521 86
754 3300044656 Ga0466969_0071072 Ga0466969_0071072_594_860 86
755 3300044656 Ga0466969_0226605 Ga0466969_0226605_245_511 86
756 3300044658 Ga0466972_0060165 Ga0466972_0060165_1055_1318 86
757 3300044683 Ga0466965_0022570 Ga0466965_0022570_2255_2518 86
758 3300044683 Ga0466965_0321573 Ga0466965_0321573_259_540 86
759 3300044684 Ga0466966_0011758 Ga0466966_0011758_5269_5532 86
760 3300044693 Ga0466961_0016354 Ga0466961_0016354_453_716 86
761 3300044693 Ga0466961_0128200 Ga0466961_0128200_801_1067 86
762 3300044694 Ga0466963_0711421 Ga0466963_0711421_333_596 86
763 3300044706 Ga0466964_0140840 Ga0466964_0140840_703_966 86
764 3300044719 Ga0466971_0233234 Ga0466971_0233234_346_612 86
765 3300044735 Ga0466968_0258610 Ga0466968_0258610_247_510 86
766 3300044765 Ga0466970_0422178 Ga0466970_0422178_349_612 86
767 3300044842 Ga0466957_0243256 Ga0466957_0243256_160_426 86
768 3300044901 Ga0466960_0564417 Ga0466960_0564417_231_494 86
769 3300045049 Ga0466959_0013672 Ga0466959_0013672_5368_5631 86
770 3300045049 Ga0466959_0239009 Ga0466959_0239009_164_430 86
771 3300045976 Ga0466967_1420234 Ga0466967_1420234_193_456 86
772 3300048090 Ga0495615_0006727 Ga0495615_0006727_1570_1836 86
773 3300049568 Ga0501031_0778906 Ga0501031_0778906_45_311 86
774 3300049571 Ga0501034_0448863 Ga0501034_0448863_325_591 86
775 3300049572 Ga0501036_0312163 Ga0501036_0312163_992_1258 86
776 3300049580 Ga0501046_0145218 Ga0501046_0145218_492_758 86
777 3300049581 Ga0501047_0532107 Ga0501047_0532107_82_348 86
778 3300049589 Ga0501073_0111340 Ga0501073_0111340_1196_1462 86
779 3300049674 Ga0501242_037791 Ga0501242_037791_184_447 86
780 3300049742 Ga0501080_0680556 Ga0501080_0680556_538_804 86
781 3300049822 Ga0501035_0356744 Ga0501035_0356744_604_870 86
782 3300049823 Ga0501044_1183616 Ga0501044_1183616_120_386 86
783 3300050489 nmdc:mga03683_322259_c1 nmdc:mga03683_322259_c1_317_580 86
784 3300050490 nmdc:mga03n38_141968_c1 nmdc:mga03n38_141968_c1_687_950 86
785 3300050490 nmdc:mga03n38_512063_c1 nmdc:mga03n38_512063_c1_72_332 86
786 3300050490 nmdc:mga03n38_576315_c1 nmdc:mga03n38_576315_c1_292_564 86
787 3300050490 nmdc:mga03n38_848620_c1 nmdc:mga03n38_848620_c1_237_497 86
788 3300050491 nmdc:mga00v17_143149_c1 nmdc:mga00v17_143149_c1_680_940 86
789 3300050491 nmdc:mga00v17_749786_c1 nmdc:mga00v17_749786_c1_109_372 86
790 3300050492 nmdc:mga0yw44_40482_c1 nmdc:mga0yw44_40482_c1_1359_1622 86
791 3300050492 nmdc:mga0yw44_48096_c1 nmdc:mga0yw44_48096_c1_1998_2261 86
792 3300050492 nmdc:mga0yw44_852805_c1 nmdc:mga0yw44_852805_c1_215_475 86
793 3300050493 nmdc:mga0k408_335351_c1 nmdc:mga0k408_335351_c1_103_363 86
794 3300050493 nmdc:mga0k408_398125_c1 nmdc:mga0k408_398125_c1_319_582 86
795 3300050493 nmdc:mga0k408_413454_c1 nmdc:mga0k408_413454_c1_239_502 86
796 3300050494 nmdc:mga06z11_16098_c1 nmdc:mga06z11_16098_c1_23_286 86
797 3300050495 nmdc:mga04h51_141460_c1 nmdc:mga04h51_141460_c1_607_870 86
798 3300050496 nmdc:mga07m45_526690_c1 nmdc:mga07m45_526690_c1_250_513 86
799 3300053088 Ga0500644_0172456 Ga0500644_0172456_222_482 86
800 3300053100 Ga0500660_252547 Ga0500660_252547_112_372 86
801 3300053117 Ga0500593_129551 Ga0500593_129551_578_838 86
802 3300053139 Ga0500568_0006764 Ga0500568_0006764_2642_2920 86
803 3300053730 Ga0500645_000346 Ga0500645_000346_13712_13972 86
804 3300053730 Ga0500645_004728 Ga0500645_004728_4545_4805 86
805 3300053730 Ga0500645_162725 Ga0500645_162725_162_422 86
806 3300055283 Ga0500661_082206 Ga0500661_082206_273_533 86
807 3300061719 Ga0466962_0193446 Ga0466962_0193446_687_953 86

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03776

MinE

Septum formation topological specificity factor MinE

14

84

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u6s-assembly1.cif.gz_B solution nmr structure of the i24n-delta10-ngmine protein from neisseria gonorrheae 0.8801 39 82
6u6s-assembly1.cif.gz_B solution nmr structure of the i24n-delta10-ngmine protein from neisseria gonorrheae 0.8633 39 82
6u6r-assembly1.cif.gz_B solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae 0.8454 39 82
6u6r-assembly1.cif.gz_B solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae 0.83 39 82
5lgk-assembly2.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7856 58 83
ID Description Score Start End Superfamily
af_K7L898_13_106_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8567 64 80 2.60.40.790
2kxoB01 Alpha Beta;2-Layer Sandwich;Cell Cycle; Chain A;Cell division topological specificity factor MinE 0.8272 21 80 3.30.1070.10
af_G5EF13_1_128_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8181 63 84 2.60.40.10
2kxoB01 Alpha Beta;2-Layer Sandwich;Cell Cycle; Chain A;Cell division topological specificity factor MinE 0.8048 21 80 3.30.1070.10
af_Q22385_1_133_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7648 63 85 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2N1X9P0-F1-model_v4 deleted 0.8771 21 86
AF-A0A351KWE5-F1-model_v4 Cell division topological specificity factor 0.8644 20 85 GO:0032955
GO:0051301
AF-A0A3N9V707-F1-model_v4 Cell division topological specificity factor 0.8315 13 85 GO:0032955
GO:0051301
AF-K1ZZN3-F1-model_v4 Cell division topological specificity factor 0.8311 5 84 GO:0032955
GO:0051301
AF-A0A2N2N030-F1-model_v4 Cell division topological specificity factor 0.8279 18 82 GO:0032955
GO:0051301

Feature Viewer

pLDDT pTM Quality
75.89 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map