F481674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 807 | 415 | 792 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_102616279|Ga0068852_1026162791 |
| Length | 97 |
| Sequence | MSLLSFLLGEKKKTAGVAKERLQIILAHERVGRNAGNAPDYLPALQRDLIAVISKYVKIDPTHLKVNVDRQDNLEVLEVKIELPDPPVGKVVAKVAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 3 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 4 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 5 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 6 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 7 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 8 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 9 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 10 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 11 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 12 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 13 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 14 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 20 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 21 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 24 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 25 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 26 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 27 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 28 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 29 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 115 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 116 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 117 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 131 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 150 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 247 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 254 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 256 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 278 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 279 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 280 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 281 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 291 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 292 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 293 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 294 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 295 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 296 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 297 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 298 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 299 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 300 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 301 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 302 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 303 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 304 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 305 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 306 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 307 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 308 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 309 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 310 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 311 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 312 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 313 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 314 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 315 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 316 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 317 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 318 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 319 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 320 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 321 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 324 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 325 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 326 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 327 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 328 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 329 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 330 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 331 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 379 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 382 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 383 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 399 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 400 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 402 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 403 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 405 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 409 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 412 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 413 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.89 |
| Metatranscriptomes | 0.25 |
| Isolates | 1.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.18 |
| Nodule | 1.24 |
| Rhizoplane | 3.22 |
| Rhizosphere | 65.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000154 | 3300002704 | Bacteria | 31016 |
| 2 | JGI25156J39149_1000067 | 3300002705 | Bacteria | 82796 |
| 3 | JGI25156J39149_1000419 | 3300002705 | Bacteria | 26375 |
| 4 | JGI25156J39149_1026593 | 3300002705 | Bacteria | 915 |
| 5 | JGI25154J39366_1000089 | 3300002738 | Bacteria | 82796 |
| 6 | JGI25154J39366_1002043 | 3300002738 | Bacteria | 5796 |
| 7 | JGI25157J39369_1000084 | 3300002741 | Bacteria | 82796 |
| 8 | JGI25157J39369_1000174 | 3300002741 | Bacteria | 54162 |
| 9 | JGI25164J39214_1003316 | 3300002772 | Bacteria | 2079 |
| 10 | JGI25152J39213_1048253 | 3300002773 | Bacteria | 565 |
| 11 | JGI25150J39212_1006313 | 3300002774 | Bacteria | 2456 |
| 12 | JGI25150J39212_1036639 | 3300002774 | Bacteria | 650 |
| 13 | JGI25159J45721_1000314 | 3300002987 | Bacteria | 22609 |
| 14 | JGI25159J45721_1017200 | 3300002987 | Bacteria | 1505 |
| 15 | JGI25151J46595_10004306 | 3300003187 | Bacteria | 7560 |
| 16 | JGI25151J46595_10013319 | 3300003187 | Bacteria | 3705 |
| 17 | JGI25151J46595_10037114 | 3300003187 | Bacteria | 1830 |
| 18 | rootH1_10022997 | 3300003316 | Bacteria | 4610 |
| 19 | rootH1_10036997 | 3300003316 | Bacteria | 4526 |
| 20 | rootH2_10010510 | 3300003320 | Bacteria | 5487 |
| 21 | rootH2_10037754 | 3300003320 | Bacteria | 3877 |
| 22 | rootH2_10081249 | 3300003320 | Bacteria | 2366 |
| 23 | rootL2_10018076 | 3300003322 | Bacteria | 7888 |
| 24 | rootL2_10025710 | 3300003322 | Bacteria | 4037 |
| 25 | rootH1_10008020 | 3300003323 | Bacteria | 6429 |
| 26 | rootH1_10013777 | 3300003323 | Bacteria | 2190 |
| 27 | rootH1_10013778 | 3300003323 | Bacteria | 1507 |
| 28 | rootH1_10121381 | 3300003323 | Bacteria | 1826 |
| 29 | rootH1_10299180 | 3300003323 | Bacteria | 1307 |
| 30 | JGI25160J50197_1000131 | 3300003354 | Bacteria | 67778 |
| 31 | JGI25160J50197_1036872 | 3300003354 | Bacteria | 1179 |
| 32 | JGI25161J50226_1000009 | 3300003374 | Bacteria | 224699 |
| 33 | Ga0055539_1010866 | 3300003752 | Bacteria | 1126 |
| 34 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 35 | Ga0055525_1000989 | 3300003759 | Bacteria | 7651 |
| 36 | Ga0055535_1000097 | 3300003761 | Bacteria | 95927 |
| 37 | Ga0055535_1024006 | 3300003761 | Bacteria | 706 |
| 38 | Ga0055529_1000202 | 3300003763 | Bacteria | 79179 |
| 39 | Ga0055529_1001828 | 3300003763 | Bacteria | 5060 |
| 40 | Ga0055526_1002155 | 3300003771 | Bacteria | 13493 |
| 41 | Ga0055526_1007332 | 3300003771 | Bacteria | 5762 |
| 42 | Ga0055526_1042022 | 3300003771 | Bacteria | 1131 |
| 43 | Ga0055537_1003449 | 3300003773 | Bacteria | 4860 |
| 44 | Ga0055537_1017660 | 3300003773 | Bacteria | 1165 |
| 45 | Ga0055524_1000047 | 3300003775 | Bacteria | 150887 |
| 46 | Ga0055524_1000554 | 3300003775 | Bacteria | 28221 |
| 47 | Ga0055524_1007049 | 3300003775 | Bacteria | 4826 |
| 48 | Ga0055536_1010008 | 3300003781 | Bacteria | 3832 |
| 49 | Ga0055534_1024781 | 3300003784 | Bacteria | 969 |
| 50 | Ga0055528_1001275 | 3300003790 | Bacteria | 15847 |
| 51 | Ga0055528_1020790 | 3300003790 | Bacteria | 2114 |
| 52 | Ga0055528_1043631 | 3300003790 | Bacteria | 974 |
| 53 | Ga0055530_10001499 | 3300003791 | Bacteria | 16950 |
| 54 | Ga0055530_10026106 | 3300003791 | Bacteria | 1620 |
| 55 | Ga0055530_10033421 | 3300003791 | Bacteria | 1326 |
| 56 | Ga0055540_1000027 | 3300003792 | Bacteria | 187454 |
| 57 | Ga0055540_1006840 | 3300003792 | Bacteria | 4437 |
| 58 | Ga0055540_1029832 | 3300003792 | Bacteria | 1273 |
| 59 | Ga0055531_10000312 | 3300003794 | Bacteria | 47848 |
| 60 | Ga0055531_10002146 | 3300003794 | Bacteria | 13489 |
| 61 | Ga0055531_10003057 | 3300003794 | Bacteria | 10840 |
| 62 | Ga0055531_10009223 | 3300003794 | Bacteria | 5075 |
| 63 | Ga0055543_1000122 | 3300004625 | Bacteria | 65110 |
| 64 | Ga0055543_1076764 | 3300004625 | Bacteria | 518 |
| 65 | Ga0065165_1000283 | 3300005262 | Bacteria | 86141 |
| 66 | Ga0065165_1000935 | 3300005262 | Bacteria | 37344 |
| 67 | Ga0065165_1019851 | 3300005262 | Bacteria | 2385 |
| 68 | Ga0065165_1020045 | 3300005262 | Bacteria | 2368 |
| 69 | Ga0065165_1104882 | 3300005262 | Bacteria | 703 |
| 70 | Ga0065714_10092872 | 3300005288 | Bacteria | 1863 |
| 71 | Ga0065704_10101871 | 3300005289 | Bacteria | 2223 |
| 72 | Ga0065707_10286322 | 3300005295 | Bacteria | 1035 |
| 73 | Ga0070658_10063772 | 3300005327 | Bacteria | 3004 |
| 74 | Ga0070658_10064006 | 3300005327 | Bacteria | 2999 |
| 75 | Ga0070658_10177994 | 3300005327 | Bacteria | 1789 |
| 76 | Ga0070658_10221641 | 3300005327 | Bacteria | 1600 |
| 77 | Ga0070658_10810179 | 3300005327 | Bacteria | 814 |
| 78 | Ga0070658_11241450 | 3300005327 | Bacteria | 648 |
| 79 | Ga0070676_10016974 | 3300005328 | Bacteria | 4024 |
| 80 | Ga0070676_10049433 | 3300005328 | Bacteria | 2462 |
| 81 | Ga0070683_102440058 | 3300005329 | Bacteria | 501 |
| 82 | Ga0070690_100104539 | 3300005330 | Bacteria | 1881 |
| 83 | Ga0070670_100012213 | 3300005331 | Bacteria | 7346 |
| 84 | Ga0070670_100301079 | 3300005331 | Bacteria | 1403 |
| 85 | Ga0070677_10003281 | 3300005333 | Bacteria | 5209 |
| 86 | Ga0070677_10047184 | 3300005333 | Bacteria | 1726 |
| 87 | Ga0068869_100006181 | 3300005334 | Bacteria | 7580 |
| 88 | Ga0068869_100610853 | 3300005334 | Bacteria | 922 |
| 89 | Ga0070666_10190296 | 3300005335 | Bacteria | 1442 |
| 90 | Ga0070666_10443233 | 3300005335 | Bacteria | 937 |
| 91 | Ga0070680_101998320 | 3300005336 | Bacteria | 502 |
| 92 | Ga0068868_100830482 | 3300005338 | Bacteria | 836 |
| 93 | Ga0068868_100853073 | 3300005338 | Bacteria | 825 |
| 94 | Ga0068868_101770327 | 3300005338 | Bacteria | 583 |
| 95 | Ga0070660_100021704 | 3300005339 | Bacteria | 4739 |
| 96 | Ga0070660_100056954 | 3300005339 | Bacteria | 3026 |
| 97 | Ga0070660_100529851 | 3300005339 | Bacteria | 981 |
| 98 | Ga0070689_101084522 | 3300005340 | Bacteria | 715 |
| 99 | Ga0070691_10131246 | 3300005341 | Bacteria | 1270 |
| 100 | Ga0070687_100935021 | 3300005343 | Bacteria | 624 |
| 101 | Ga0070661_101259256 | 3300005344 | Bacteria | 620 |
| 102 | Ga0070661_101501979 | 3300005344 | Bacteria | 568 |
| 103 | Ga0070692_11193217 | 3300005345 | Bacteria | 541 |
| 104 | Ga0070669_100002753 | 3300005353 | Bacteria | 12687 |
| 105 | Ga0070675_100000137 | 3300005354 | Bacteria | 44007 |
| 106 | Ga0070675_100011301 | 3300005354 | Bacteria | 6987 |
| 107 | Ga0070675_101246534 | 3300005354 | Bacteria | 685 |
| 108 | Ga0070671_100006504 | 3300005355 | Bacteria | 9343 |
| 109 | Ga0070671_100021060 | 3300005355 | Bacteria | 5323 |
| 110 | Ga0070671_101174924 | 3300005355 | Bacteria | 675 |
| 111 | Ga0070671_101918997 | 3300005355 | Bacteria | 527 |
| 112 | Ga0070674_100055843 | 3300005356 | Bacteria | 2737 |
| 113 | Ga0070674_100124598 | 3300005356 | Bacteria | 1912 |
| 114 | Ga0070673_100011122 | 3300005364 | Bacteria | 6135 |
| 115 | Ga0070673_100787828 | 3300005364 | Bacteria | 877 |
| 116 | Ga0070673_100922332 | 3300005364 | Bacteria | 811 |
| 117 | Ga0070673_101779635 | 3300005364 | Bacteria | 584 |
| 118 | Ga0070688_100185921 | 3300005365 | Bacteria | 1444 |
| 119 | Ga0070659_100011135 | 3300005366 | Bacteria | 6643 |
| 120 | Ga0070659_100500500 | 3300005366 | Bacteria | 1036 |
| 121 | Ga0070667_100045834 | 3300005367 | Bacteria | 3678 |
| 122 | Ga0070667_101217262 | 3300005367 | Bacteria | 705 |
| 123 | Ga0070700_101956878 | 3300005441 | Bacteria | 508 |
| 124 | Ga0070708_100602428 | 3300005445 | Bacteria | 1036 |
| 125 | Ga0070708_101688532 | 3300005445 | Bacteria | 589 |
| 126 | Ga0070663_101086822 | 3300005455 | Bacteria | 699 |
| 127 | Ga0070678_100085936 | 3300005456 | Bacteria | 2398 |
| 128 | Ga0070678_100129530 | 3300005456 | Bacteria | 2002 |
| 129 | Ga0070678_100136476 | 3300005456 | Bacteria | 1957 |
| 130 | Ga0070662_101533417 | 3300005457 | Bacteria | 575 |
| 131 | Ga0070662_101814173 | 3300005457 | Bacteria | 527 |
| 132 | Ga0070681_11687238 | 3300005458 | Bacteria | 560 |
| 133 | Ga0068867_100005126 | 3300005459 | Bacteria | 9258 |
| 134 | Ga0068867_100015020 | 3300005459 | Bacteria | 5489 |
| 135 | Ga0068867_100134651 | 3300005459 | Bacteria | 1924 |
| 136 | Ga0070685_10148826 | 3300005466 | Bacteria | 1482 |
| 137 | Ga0070685_10483596 | 3300005466 | Bacteria | 873 |
| 138 | Ga0070685_10854841 | 3300005466 | Bacteria | 674 |
| 139 | Ga0070707_100229616 | 3300005468 | Bacteria | 1807 |
| 140 | Ga0070679_100076511 | 3300005530 | Bacteria | 3336 |
| 141 | Ga0070684_100022047 | 3300005535 | Bacteria | 5308 |
| 142 | Ga0068853_100115161 | 3300005539 | Bacteria | 2392 |
| 143 | Ga0068853_100630848 | 3300005539 | Bacteria | 1019 |
| 144 | Ga0068853_100965636 | 3300005539 | Bacteria | 820 |
| 145 | Ga0068853_101486943 | 3300005539 | Bacteria | 656 |
| 146 | Ga0070672_100000520 | 3300005543 | Bacteria | 22520 |
| 147 | Ga0070665_100846338 | 3300005548 | Bacteria | 928 |
| 148 | Ga0070665_101994326 | 3300005548 | Bacteria | 586 |
| 149 | Ga0068855_100000971 | 3300005563 | Bacteria | 35725 |
| 150 | Ga0068855_100022188 | 3300005563 | Bacteria | 7607 |
| 151 | Ga0068855_100029769 | 3300005563 | Bacteria | 6529 |
| 152 | Ga0068855_100307735 | 3300005563 | Bacteria | 1754 |
| 153 | Ga0068855_100744297 | 3300005563 | Bacteria | 1046 |
| 154 | Ga0068855_102606391 | 3300005563 | Bacteria | 501 |
| 155 | Ga0070664_100160216 | 3300005564 | Bacteria | 1991 |
| 156 | Ga0070664_101668593 | 3300005564 | Bacteria | 604 |
| 157 | Ga0070664_102254076 | 3300005564 | Bacteria | 517 |
| 158 | Ga0068857_100003123 | 3300005577 | Bacteria | 13705 |
| 159 | Ga0068857_100531184 | 3300005577 | Bacteria | 1106 |
| 160 | Ga0068854_100030573 | 3300005578 | Bacteria | 3736 |
| 161 | Ga0068856_100000951 | 3300005614 | Bacteria | 31014 |
| 162 | Ga0068856_100288493 | 3300005614 | Bacteria | 1658 |
| 163 | Ga0068852_100777559 | 3300005616 | Bacteria | 971 |
| 164 | Ga0068852_101828204 | 3300005616 | Bacteria | 630 |
| 165 | Ga0068852_102616279 | 3300005616 | Bacteria | 524 |
| 166 | Ga0068852_102668876 | 3300005616 | Bacteria | 519 |
| 167 | Ga0068864_100050509 | 3300005618 | Bacteria | 3580 |
| 168 | Ga0068864_100744594 | 3300005618 | Bacteria | 960 |
| 169 | Ga0068866_10562771 | 3300005718 | Bacteria | 764 |
| 170 | Ga0068861_100021114 | 3300005719 | Bacteria | 4679 |
| 171 | Ga0068851_10019074 | 3300005834 | Bacteria | 3314 |
| 172 | Ga0068851_11016655 | 3300005834 | Bacteria | 523 |
| 173 | Ga0068870_10165055 | 3300005840 | Bacteria | 1317 |
| 174 | Ga0068863_100825863 | 3300005841 | Bacteria | 925 |
| 175 | Ga0068863_101866102 | 3300005841 | Bacteria | 611 |
| 176 | Ga0068860_100203759 | 3300005843 | Bacteria | 1918 |
| 177 | Ga0068862_101354676 | 3300005844 | Bacteria | 714 |
| 178 | Ga0081538_10061611 | 3300005981 | Bacteria | 2146 |
| 179 | Ga0075365_10005107 | 3300006038 | Bacteria | 7046 |
| 180 | Ga0075365_10142421 | 3300006038 | Bacteria | 1664 |
| 181 | Ga0075365_10182253 | 3300006038 | Bacteria | 1468 |
| 182 | Ga0075365_10314983 | 3300006038 | Bacteria | 1102 |
| 183 | Ga0075365_10970646 | 3300006038 | Bacteria | 599 |
| 184 | Ga0075368_10015246 | 3300006042 | Bacteria | 2848 |
| 185 | Ga0075363_100015256 | 3300006048 | Bacteria | 3774 |
| 186 | Ga0075363_100088103 | 3300006048 | Bacteria | 1706 |
| 187 | Ga0075363_100407215 | 3300006048 | Bacteria | 800 |
| 188 | Ga0075363_100696936 | 3300006048 | Bacteria | 613 |
| 189 | Ga0075363_100821783 | 3300006048 | Bacteria | 566 |
| 190 | Ga0075364_10049130 | 3300006051 | Bacteria | 2750 |
| 191 | Ga0075362_10055281 | 3300006177 | Bacteria | 1785 |
| 192 | Ga0075362_10120303 | 3300006177 | Bacteria | 1242 |
| 193 | Ga0075367_10007807 | 3300006178 | Bacteria | 5503 |
| 194 | Ga0075367_10194618 | 3300006178 | Bacteria | 1266 |
| 195 | Ga0075367_10737124 | 3300006178 | Bacteria | 627 |
| 196 | Ga0075366_10057805 | 3300006195 | Bacteria | 2304 |
| 197 | Ga0075366_10064724 | 3300006195 | Bacteria | 2174 |
| 198 | Ga0075366_10105355 | 3300006195 | Bacteria | 1695 |
| 199 | Ga0097621_100060641 | 3300006237 | Bacteria | 3101 |
| 200 | Ga0097621_101311968 | 3300006237 | Bacteria | 684 |
| 201 | Ga0097621_102379452 | 3300006237 | Bacteria | 507 |
| 202 | Ga0075370_10009248 | 3300006353 | Bacteria | 5108 |
| 203 | Ga0075370_10224485 | 3300006353 | Bacteria | 1111 |
| 204 | Ga0075370_10611129 | 3300006353 | Bacteria | 661 |
| 205 | Ga0068871_100030494 | 3300006358 | Bacteria | 4247 |
| 206 | Ga0075430_100054008 | 3300006846 | Bacteria | 3381 |
| 207 | Ga0075430_100085353 | 3300006846 | Bacteria | 2643 |
| 208 | Ga0075429_100003208 | 3300006880 | Bacteria | 13911 |
| 209 | Ga0075429_100145689 | 3300006880 | Bacteria | 2073 |
| 210 | Ga0075429_101799522 | 3300006880 | Bacteria | 531 |
| 211 | Ga0068865_100396283 | 3300006881 | Bacteria | 1130 |
| 212 | Ga0068865_100577957 | 3300006881 | Bacteria | 947 |
| 213 | Ga0068865_101581802 | 3300006881 | Bacteria | 589 |
| 214 | Ga0099824_1066035 | 3300006942 | Bacteria | 551 |
| 215 | Ga0099823_1007351 | 3300006944 | Bacteria | 11174 |
| 216 | Ga0079104_1000008 | 3300006946 | Bacteria | 371223 |
| 217 | Ga0099826_10253071 | 3300006948 | Bacteria | 927 |
| 218 | Ga0105250_10000043 | 3300009092 | Bacteria | 129336 |
| 219 | Ga0105240_10001650 | 3300009093 | Bacteria | 37876 |
| 220 | Ga0105240_10019163 | 3300009093 | Bacteria | 9148 |
| 221 | Ga0105240_10026802 | 3300009093 | Bacteria | 7558 |
| 222 | Ga0105240_10027737 | 3300009093 | Bacteria | 7411 |
| 223 | Ga0105240_10780051 | 3300009093 | Bacteria | 1037 |
| 224 | Ga0105240_11026253 | 3300009093 | Bacteria | 881 |
| 225 | Ga0105240_11821040 | 3300009093 | Bacteria | 634 |
| 226 | Ga0111539_11262287 | 3300009094 | Bacteria | 857 |
| 227 | Ga0105245_10648020 | 3300009098 | Bacteria | 1086 |
| 228 | Ga0105245_11767656 | 3300009098 | Bacteria | 671 |
| 229 | Ga0114129_10086267 | 3300009147 | Bacteria | 4354 |
| 230 | Ga0105243_10002163 | 3300009148 | Bacteria | 16598 |
| 231 | Ga0105243_10416431 | 3300009148 | Bacteria | 1252 |
| 232 | Ga0105243_10853324 | 3300009148 | Bacteria | 902 |
| 233 | Ga0105243_12416204 | 3300009148 | Bacteria | 564 |
| 234 | Ga0105241_10206283 | 3300009174 | Bacteria | 1645 |
| 235 | Ga0105242_10489349 | 3300009176 | Bacteria | 1167 |
| 236 | Ga0105237_10001445 | 3300009545 | Bacteria | 31382 |
| 237 | Ga0105237_10437550 | 3300009545 | Bacteria | 1313 |
| 238 | Ga0105237_12759218 | 3300009545 | Bacteria | 502 |
| 239 | Ga0105238_10006278 | 3300009551 | Bacteria | 11811 |
| 240 | Ga0105238_10023931 | 3300009551 | Bacteria | 6225 |
| 241 | Ga0105238_10046256 | 3300009551 | Bacteria | 4393 |
| 242 | Ga0105249_10635990 | 3300009553 | Bacteria | 1124 |
| 243 | Ga0105249_12154526 | 3300009553 | Bacteria | 630 |
| 244 | Ga0105249_12407406 | 3300009553 | Bacteria | 599 |
| 245 | Ga0105239_10002359 | 3300010375 | Bacteria | 24075 |
| 246 | Ga0105239_10142228 | 3300010375 | Bacteria | 2674 |
| 247 | Ga0105239_13090582 | 3300010375 | Bacteria | 542 |
| 248 | Ga0157319_1000009 | 3300012497 | Bacteria | 227971 |
| 249 | Ga0157326_1003398 | 3300012513 | Bacteria | 1677 |
| 250 | Ga0157373_11397829 | 3300013100 | Bacteria | 532 |
| 251 | Ga0157370_11387830 | 3300013104 | Bacteria | 632 |
| 252 | Ga0157370_11647734 | 3300013104 | Bacteria | 576 |
| 253 | Ga0157369_10137207 | 3300013105 | Bacteria | 2589 |
| 254 | Ga0157374_10276489 | 3300013296 | Bacteria | 1657 |
| 255 | Ga0157374_12333335 | 3300013296 | Bacteria | 562 |
| 256 | Ga0157378_10055779 | 3300013297 | Bacteria | 3520 |
| 257 | Ga0163162_10706031 | 3300013306 | Bacteria | 1130 |
| 258 | Ga0163162_11814711 | 3300013306 | Bacteria | 697 |
| 259 | Ga0157372_10103908 | 3300013307 | Bacteria | 3247 |
| 260 | Ga0157372_12050099 | 3300013307 | Bacteria | 657 |
| 261 | Ga0157375_10144659 | 3300013308 | Bacteria | 2507 |
| 262 | Ga0163163_11217692 | 3300014325 | Bacteria | 815 |
| 263 | Ga0157380_10897102 | 3300014326 | Bacteria | 912 |
| 264 | Ga0157380_11043677 | 3300014326 | Bacteria | 853 |
| 265 | Ga0157380_12032387 | 3300014326 | Bacteria | 637 |
| 266 | Ga0157380_12685755 | 3300014326 | Bacteria | 564 |
| 267 | Ga0182008_10669119 | 3300014497 | Bacteria | 590 |
| 268 | Ga0157377_10394633 | 3300014745 | Bacteria | 941 |
| 269 | Ga0157379_11684972 | 3300014968 | Bacteria | 621 |
| 270 | Ga0157376_10600104 | 3300014969 | Bacteria | 1096 |
| 271 | Ga0157376_10680492 | 3300014969 | Bacteria | 1032 |
| 272 | Ga0157376_12225864 | 3300014969 | Bacteria | 587 |
| 273 | Ga0182006_1250452 | 3300015261 | Bacteria | 582 |
| 274 | Ga0182007_10031429 | 3300015262 | Bacteria | 1808 |
| 275 | Ga0182007_10135318 | 3300015262 | Bacteria | 831 |
| 276 | Ga0163161_10079688 | 3300017792 | Bacteria | 2409 |
| 277 | Ga0163161_12091703 | 3300017792 | Bacteria | 503 |
| 278 | Ga0213872_10042110 | 3300021361 | Bacteria | 2083 |
| 279 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 280 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 281 | Ga0209672_104319 | 3300025228 | Bacteria | 2663 |
| 282 | Ga0209672_108419 | 3300025228 | Bacteria | 1527 |
| 283 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 284 | Ga0207427_101137 | 3300025231 | Bacteria | 10557 |
| 285 | Ga0209258_100162 | 3300025242 | Bacteria | 151725 |
| 286 | Ga0209258_102002 | 3300025242 | Bacteria | 5889 |
| 287 | Ga0207425_1002969 | 3300025245 | Bacteria | 5672 |
| 288 | Ga0207425_1004534 | 3300025245 | Bacteria | 4134 |
| 289 | Ga0207425_1040463 | 3300025245 | Bacteria | 889 |
| 290 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 291 | Ga0209646_1000066 | 3300025246 | Bacteria | 244823 |
| 292 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 293 | Ga0209026_1000027 | 3300025250 | Bacteria | 351282 |
| 294 | Ga0209026_1048919 | 3300025250 | Bacteria | 603 |
| 295 | Ga0209677_100178 | 3300025253 | Bacteria | 53699 |
| 296 | Ga0209677_100183 | 3300025253 | Bacteria | 51950 |
| 297 | Ga0209677_104325 | 3300025253 | Bacteria | 4151 |
| 298 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 299 | Ga0209759_1000131 | 3300025256 | Bacteria | 130014 |
| 300 | Ga0209759_1000662 | 3300025256 | Bacteria | 31972 |
| 301 | Ga0209759_1005141 | 3300025256 | Bacteria | 4665 |
| 302 | Ga0209759_1017083 | 3300025256 | Bacteria | 1801 |
| 303 | Ga0209759_1046348 | 3300025256 | Bacteria | 704 |
| 304 | Ga0209129_1006958 | 3300025258 | Bacteria | 3491 |
| 305 | Ga0209129_1059409 | 3300025258 | Bacteria | 568 |
| 306 | Ga0209565_1000061 | 3300025263 | Bacteria | 185308 |
| 307 | Ga0209565_1001227 | 3300025263 | Bacteria | 12058 |
| 308 | Ga0209455_1000128 | 3300025272 | Bacteria | 162413 |
| 309 | Ga0209455_1000687 | 3300025272 | Bacteria | 19947 |
| 310 | Ga0209673_1000491 | 3300025273 | Bacteria | 65636 |
| 311 | Ga0209673_1007346 | 3300025273 | Bacteria | 5104 |
| 312 | Ga0209673_1009683 | 3300025273 | Bacteria | 4141 |
| 313 | Ga0209673_1037143 | 3300025273 | Bacteria | 1435 |
| 314 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 315 | Ga0209130_1000862 | 3300025284 | Bacteria | 24952 |
| 316 | Ga0209675_1000105 | 3300025291 | Bacteria | 121013 |
| 317 | Ga0209675_1000703 | 3300025291 | Bacteria | 23088 |
| 318 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 319 | Ga0209676_1000153 | 3300025292 | Bacteria | 166393 |
| 320 | Ga0209676_1006585 | 3300025292 | Bacteria | 5693 |
| 321 | Ga0209025_1010455 | 3300025294 | Bacteria | 6285 |
| 322 | Ga0209025_1013015 | 3300025294 | Bacteria | 5265 |
| 323 | Ga0209025_1020829 | 3300025294 | Bacteria | 3562 |
| 324 | Ga0209025_1034780 | 3300025294 | Bacteria | 2291 |
| 325 | Ga0209025_1091850 | 3300025294 | Bacteria | 990 |
| 326 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 327 | Ga0209564_1000181 | 3300025295 | Bacteria | 151002 |
| 328 | Ga0209564_1000247 | 3300025295 | Bacteria | 116628 |
| 329 | Ga0209758_1031085 | 3300025297 | Bacteria | 2198 |
| 330 | Ga0209758_1079909 | 3300025297 | Bacteria | 993 |
| 331 | Ga0209758_1107255 | 3300025297 | Bacteria | 780 |
| 332 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 333 | Ga0209050_1002596 | 3300025298 | Bacteria | 14968 |
| 334 | Ga0209050_1015921 | 3300025298 | Bacteria | 3116 |
| 335 | Ga0209050_1018285 | 3300025298 | Bacteria | 2732 |
| 336 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 337 | Ga0209256_1002170 | 3300025299 | Bacteria | 16860 |
| 338 | Ga0209256_1002204 | 3300025299 | Bacteria | 16682 |
| 339 | Ga0209256_1028537 | 3300025299 | Bacteria | 1572 |
| 340 | Ga0209256_1049133 | 3300025299 | Bacteria | 1029 |
| 341 | Ga0209256_1111211 | 3300025299 | Bacteria | 551 |
| 342 | Ga0207426_1000242 | 3300025302 | Bacteria | 122839 |
| 343 | Ga0207426_1001759 | 3300025302 | Bacteria | 16401 |
| 344 | Ga0207426_1090302 | 3300025302 | Bacteria | 812 |
| 345 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 346 | Ga0209051_1000241 | 3300025303 | Bacteria | 91816 |
| 347 | Ga0209051_1008919 | 3300025303 | Bacteria | 5238 |
| 348 | Ga0209051_1071683 | 3300025303 | Bacteria | 1040 |
| 349 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 350 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 351 | Ga0209257_1002930 | 3300025304 | Bacteria | 15721 |
| 352 | Ga0209257_1003485 | 3300025304 | Bacteria | 13420 |
| 353 | Ga0209257_1030164 | 3300025304 | Bacteria | 1755 |
| 354 | Ga0207697_10015928 | 3300025315 | Bacteria | 3101 |
| 355 | Ga0207656_10014495 | 3300025321 | Bacteria | 3038 |
| 356 | Ga0207696_1000424 | 3300025711 | Bacteria | 38612 |
| 357 | Ga0207682_10002496 | 3300025893 | Bacteria | 8220 |
| 358 | Ga0207682_10034562 | 3300025893 | Bacteria | 2038 |
| 359 | Ga0207642_10379205 | 3300025899 | Bacteria | 841 |
| 360 | Ga0207642_10976435 | 3300025899 | Bacteria | 545 |
| 361 | Ga0207688_10789625 | 3300025901 | Bacteria | 601 |
| 362 | Ga0207680_10243058 | 3300025903 | Bacteria | 1241 |
| 363 | Ga0207680_10255778 | 3300025903 | Bacteria | 1211 |
| 364 | Ga0207645_10016384 | 3300025907 | Bacteria | 4907 |
| 365 | Ga0207645_10119290 | 3300025907 | Bacteria | 1712 |
| 366 | Ga0207643_10021956 | 3300025908 | Bacteria | 3512 |
| 367 | Ga0207705_10050795 | 3300025909 | Bacteria | 2985 |
| 368 | Ga0207705_10051128 | 3300025909 | Bacteria | 2975 |
| 369 | Ga0207705_10086725 | 3300025909 | Bacteria | 2288 |
| 370 | Ga0207705_10112426 | 3300025909 | Bacteria | 2013 |
| 371 | Ga0207705_10144672 | 3300025909 | Bacteria | 1778 |
| 372 | Ga0207705_10153312 | 3300025909 | Bacteria | 1727 |
| 373 | Ga0207705_10173874 | 3300025909 | Bacteria | 1622 |
| 374 | Ga0207705_10337951 | 3300025909 | Bacteria | 1159 |
| 375 | Ga0207705_10470833 | 3300025909 | Bacteria | 975 |
| 376 | Ga0207654_10027109 | 3300025911 | Bacteria | 3112 |
| 377 | Ga0207707_10892295 | 3300025912 | Bacteria | 735 |
| 378 | Ga0207695_10011214 | 3300025913 | Bacteria | 10870 |
| 379 | Ga0207695_10030702 | 3300025913 | Bacteria | 5913 |
| 380 | Ga0207695_10038286 | 3300025913 | Bacteria | 5165 |
| 381 | Ga0207695_10105566 | 3300025913 | Bacteria | 2804 |
| 382 | Ga0207671_10004904 | 3300025914 | Bacteria | 12572 |
| 383 | Ga0207671_10133918 | 3300025914 | Bacteria | 1904 |
| 384 | Ga0207660_10358589 | 3300025917 | Bacteria | 1169 |
| 385 | Ga0207660_10661646 | 3300025917 | Bacteria | 852 |
| 386 | Ga0207662_10425178 | 3300025918 | Bacteria | 904 |
| 387 | Ga0207657_10005150 | 3300025919 | Bacteria | 13708 |
| 388 | Ga0207657_10014524 | 3300025919 | Bacteria | 7679 |
| 389 | Ga0207657_10362666 | 3300025919 | Bacteria | 1142 |
| 390 | Ga0207649_11298560 | 3300025920 | Bacteria | 576 |
| 391 | Ga0207652_10098275 | 3300025921 | Bacteria | 2581 |
| 392 | Ga0207652_10414513 | 3300025921 | Bacteria | 1215 |
| 393 | Ga0207646_10318474 | 3300025922 | Bacteria | 1405 |
| 394 | Ga0207681_10030499 | 3300025923 | Bacteria | 3515 |
| 395 | Ga0207681_11516900 | 3300025923 | Bacteria | 562 |
| 396 | Ga0207694_10010745 | 3300025924 | Bacteria | 6914 |
| 397 | Ga0207694_10049847 | 3300025924 | Bacteria | 3241 |
| 398 | Ga0207694_10703404 | 3300025924 | Bacteria | 852 |
| 399 | Ga0207650_10000265 | 3300025925 | Bacteria | 55786 |
| 400 | Ga0207650_10580291 | 3300025925 | Bacteria | 942 |
| 401 | Ga0207659_10000148 | 3300025926 | Bacteria | 41151 |
| 402 | Ga0207659_10433916 | 3300025926 | Bacteria | 1104 |
| 403 | Ga0207687_10328433 | 3300025927 | Bacteria | 1240 |
| 404 | Ga0207687_10411114 | 3300025927 | Bacteria | 1115 |
| 405 | Ga0207664_10580353 | 3300025929 | Bacteria | 1007 |
| 406 | Ga0207644_10209224 | 3300025931 | Bacteria | 1541 |
| 407 | Ga0207644_11813150 | 3300025931 | Bacteria | 510 |
| 408 | Ga0207690_10012639 | 3300025932 | Bacteria | 5056 |
| 409 | Ga0207690_10248709 | 3300025932 | Bacteria | 1372 |
| 410 | Ga0207706_10846812 | 3300025933 | Bacteria | 775 |
| 411 | Ga0207709_10000070 | 3300025935 | Bacteria | 183020 |
| 412 | Ga0207709_10380129 | 3300025935 | Bacteria | 1074 |
| 413 | Ga0207709_10627962 | 3300025935 | Bacteria | 853 |
| 414 | Ga0207670_10657343 | 3300025936 | Bacteria | 865 |
| 415 | Ga0207669_10080300 | 3300025937 | Bacteria | 2085 |
| 416 | Ga0207669_10899010 | 3300025937 | Bacteria | 739 |
| 417 | Ga0207704_10037547 | 3300025938 | Bacteria | 2799 |
| 418 | Ga0207691_10012845 | 3300025940 | Bacteria | 8017 |
| 419 | Ga0207691_10894928 | 3300025940 | Bacteria | 743 |
| 420 | Ga0207689_10131208 | 3300025942 | Bacteria | 2062 |
| 421 | Ga0207689_10484882 | 3300025942 | Bacteria | 1035 |
| 422 | Ga0207679_10652019 | 3300025945 | Bacteria | 952 |
| 423 | Ga0207679_11063023 | 3300025945 | Bacteria | 742 |
| 424 | Ga0207667_10103966 | 3300025949 | Bacteria | 2929 |
| 425 | Ga0207667_10106740 | 3300025949 | Bacteria | 2889 |
| 426 | Ga0207667_10193771 | 3300025949 | Bacteria | 2085 |
| 427 | Ga0207667_10276242 | 3300025949 | Bacteria | 1717 |
| 428 | Ga0207667_10365573 | 3300025949 | Bacteria | 1471 |
| 429 | Ga0207667_10662083 | 3300025949 | Bacteria | 1049 |
| 430 | Ga0207651_10006277 | 3300025960 | Bacteria | 6199 |
| 431 | Ga0207651_11404461 | 3300025960 | Bacteria | 628 |
| 432 | Ga0207651_11904524 | 3300025960 | Bacteria | 535 |
| 433 | Ga0207668_10198425 | 3300025972 | Bacteria | 1596 |
| 434 | Ga0207668_10888083 | 3300025972 | Bacteria | 793 |
| 435 | Ga0207640_10005583 | 3300025981 | Bacteria | 6860 |
| 436 | Ga0207640_10115473 | 3300025981 | Bacteria | 1912 |
| 437 | Ga0207640_10558461 | 3300025981 | Bacteria | 963 |
| 438 | Ga0207658_10064120 | 3300025986 | Bacteria | 2755 |
| 439 | Ga0207658_11007677 | 3300025986 | Bacteria | 760 |
| 440 | Ga0207658_11559584 | 3300025986 | Bacteria | 604 |
| 441 | Ga0207677_10008981 | 3300026023 | Bacteria | 5606 |
| 442 | Ga0207677_10579311 | 3300026023 | Bacteria | 982 |
| 443 | Ga0207639_10343987 | 3300026041 | Bacteria | 1330 |
| 444 | Ga0207639_10377379 | 3300026041 | Bacteria | 1272 |
| 445 | Ga0207639_10500676 | 3300026041 | Bacteria | 1110 |
| 446 | Ga0207639_11132730 | 3300026041 | Bacteria | 734 |
| 447 | Ga0207678_10649317 | 3300026067 | Bacteria | 927 |
| 448 | Ga0207678_11450588 | 3300026067 | Bacteria | 606 |
| 449 | Ga0207702_10000220 | 3300026078 | Bacteria | 66634 |
| 450 | Ga0207702_10487159 | 3300026078 | Bacteria | 1201 |
| 451 | Ga0207702_10575741 | 3300026078 | Bacteria | 1103 |
| 452 | Ga0207641_10837485 | 3300026088 | Bacteria | 911 |
| 453 | Ga0207641_11489245 | 3300026088 | Bacteria | 678 |
| 454 | Ga0207641_12334546 | 3300026088 | Bacteria | 534 |
| 455 | Ga0207648_10034719 | 3300026089 | Bacteria | 4444 |
| 456 | Ga0207648_10312313 | 3300026089 | Bacteria | 1411 |
| 457 | Ga0207676_10005934 | 3300026095 | Bacteria | 8622 |
| 458 | Ga0207674_10006407 | 3300026116 | Bacteria | 13844 |
| 459 | Ga0207675_100031693 | 3300026118 | Bacteria | 4925 |
| 460 | Ga0207675_100879392 | 3300026118 | Bacteria | 912 |
| 461 | Ga0207683_10013304 | 3300026121 | Bacteria | 7015 |
| 462 | Ga0207683_10035679 | 3300026121 | Bacteria | 4326 |
| 463 | Ga0207683_10389721 | 3300026121 | Bacteria | 1281 |
| 464 | Ga0207698_10220476 | 3300026142 | Bacteria | 1714 |
| 465 | Ga0207698_11538011 | 3300026142 | Bacteria | 681 |
| 466 | Ga0207698_11981318 | 3300026142 | Bacteria | 597 |
| 467 | Ga0207698_12061032 | 3300026142 | Bacteria | 584 |
| 468 | Ga0209281_1000029 | 3300027111 | Bacteria | 431495 |
| 469 | Ga0209389_1063122 | 3300027296 | Bacteria | 2228 |
| 470 | Ga0209371_1020385 | 3300027312 | Bacteria | 1633 |
| 471 | Ga0209970_1000168 | 3300027614 | Bacteria | 10198 |
| 472 | Ga0209970_1040709 | 3300027614 | Bacteria | 826 |
| 473 | Ga0209983_1037986 | 3300027665 | Bacteria | 1038 |
| 474 | Ga0209971_1015094 | 3300027682 | Bacteria | 1831 |
| 475 | Ga0209971_1128299 | 3300027682 | Bacteria | 624 |
| 476 | Ga0209998_10132945 | 3300027717 | Bacteria | 632 |
| 477 | Ga0209813_10120310 | 3300027866 | Bacteria | 913 |
| 478 | Ga0209974_10078728 | 3300027876 | Bacteria | 1131 |
| 479 | Ga0268266_10221686 | 3300028379 | Bacteria | 1739 |
| 480 | Ga0268264_10210436 | 3300028381 | Bacteria | 1785 |
| 481 | Ga0265334_10043805 | 3300028573 | Bacteria | 1740 |
| 482 | Ga0265336_10000008 | 3300028666 | Bacteria | 336082 |
| 483 | Ga0307515_10103443 | 3300028794 | Bacteria | 3413 |
| 484 | Ga0307515_10218928 | 3300028794 | Bacteria | 1727 |
| 485 | Ga0265324_10003914 | 3300029957 | Bacteria | 6927 |
| 486 | Ga0268256_1022764 | 3300030500 | Bacteria | 1638 |
| 487 | Ga0265330_10000106 | 3300031235 | Bacteria | 69731 |
| 488 | Ga0265332_10000008 | 3300031238 | Bacteria | 301609 |
| 489 | Ga0265325_10049744 | 3300031241 | Bacteria | 2161 |
| 490 | Ga0265340_10071583 | 3300031247 | Bacteria | 1643 |
| 491 | Ga0265327_10067541 | 3300031251 | Bacteria | 1801 |
| 492 | Ga0307513_10000025 | 3300031456 | Bacteria | 202918 |
| 493 | Ga0307513_10000363 | 3300031456 | Bacteria | 66311 |
| 494 | Ga0307513_10058646 | 3300031456 | Bacteria | 4089 |
| 495 | Ga0307513_10159272 | 3300031456 | Bacteria | 2152 |
| 496 | Ga0307513_10570766 | 3300031456 | Bacteria | 842 |
| 497 | Ga0307513_10951852 | 3300031456 | Bacteria | 567 |
| 498 | Ga0307408_100024015 | 3300031548 | Bacteria | 4157 |
| 499 | Ga0307408_100034737 | 3300031548 | Bacteria | 3534 |
| 500 | Ga0307408_100355748 | 3300031548 | Bacteria | 1244 |
| 501 | Ga0307408_100655348 | 3300031548 | Bacteria | 939 |
| 502 | Ga0307408_101491525 | 3300031548 | Bacteria | 639 |
| 503 | Ga0307408_102374295 | 3300031548 | Bacteria | 514 |
| 504 | Ga0265314_10000292 | 3300031711 | Bacteria | 71982 |
| 505 | Ga0265342_10518809 | 3300031712 | Bacteria | 606 |
| 506 | Ga0307516_10067770 | 3300031730 | Bacteria | 3438 |
| 507 | Ga0307516_10091429 | 3300031730 | Bacteria | 2871 |
| 508 | Ga0307405_10045504 | 3300031731 | Bacteria | 2690 |
| 509 | Ga0307405_10191714 | 3300031731 | Bacteria | 1477 |
| 510 | Ga0307405_10950896 | 3300031731 | Bacteria | 730 |
| 511 | Ga0307405_11942204 | 3300031731 | Bacteria | 526 |
| 512 | Ga0307413_10566153 | 3300031824 | Bacteria | 924 |
| 513 | Ga0307413_12188696 | 3300031824 | Bacteria | 501 |
| 514 | Ga0307410_10030505 | 3300031852 | Bacteria | 3447 |
| 515 | Ga0307410_10397686 | 3300031852 | Bacteria | 1112 |
| 516 | Ga0307406_10016088 | 3300031901 | Bacteria | 4339 |
| 517 | Ga0307406_10058110 | 3300031901 | Bacteria | 2484 |
| 518 | Ga0307406_10867813 | 3300031901 | Bacteria | 766 |
| 519 | Ga0307406_11677345 | 3300031901 | Bacteria | 563 |
| 520 | Ga0307406_11922330 | 3300031901 | Bacteria | 528 |
| 521 | Ga0307407_11664232 | 3300031903 | Bacteria | 507 |
| 522 | Ga0307412_10222918 | 3300031911 | Bacteria | 1446 |
| 523 | Ga0307412_10367228 | 3300031911 | Bacteria | 1161 |
| 524 | Ga0307412_10721072 | 3300031911 | Bacteria | 858 |
| 525 | Ga0307412_11758834 | 3300031911 | Bacteria | 569 |
| 526 | Ga0307409_100402085 | 3300031995 | Bacteria | 1308 |
| 527 | Ga0307409_100813565 | 3300031995 | Bacteria | 943 |
| 528 | Ga0307414_10485653 | 3300032004 | Bacteria | 1090 |
| 529 | Ga0307414_10517575 | 3300032004 | Bacteria | 1058 |
| 530 | Ga0307411_10000973 | 3300032005 | Bacteria | 10988 |
| 531 | Ga0307411_10130857 | 3300032005 | Bacteria | 1834 |
| 532 | Ga0307411_10380466 | 3300032005 | Bacteria | 1161 |
| 533 | Ga0307411_10488831 | 3300032005 | Bacteria | 1038 |
| 534 | Ga0307411_11012110 | 3300032005 | Bacteria | 744 |
| 535 | Ga0307411_11118356 | 3300032005 | Bacteria | 711 |
| 536 | Ga0307411_12159208 | 3300032005 | Bacteria | 522 |
| 537 | Ga0307411_12190306 | 3300032005 | Bacteria | 518 |
| 538 | Ga0307415_100021431 | 3300032126 | Bacteria | 3973 |
| 539 | Ga0307415_100778427 | 3300032126 | Bacteria | 871 |
| 540 | Ga0307507_10474021 | 3300033179 | Bacteria | 683 |
| 541 | Ga0373934_0293083 | 3300035086 | Bacteria | 674 |
| 542 | Ga0373923_0375765 | 3300035111 | Bacteria | 681 |
| 543 | Ga0373945_0127353 | 3300035116 | Bacteria | 1018 |
| 544 | Ga0373946_0613344 | 3300035171 | Bacteria | 565 |
| 545 | Ga0373935_1219599 | 3300035692 | Bacteria | 561 |
| 546 | Ga0373925_0436029 | 3300037068 | Bacteria | 1072 |
| 547 | Ga0395899_0005707 | 3300037312 | Bacteria | 9664 |
| 548 | Ga0395899_0038526 | 3300037312 | Bacteria | 3580 |
| 549 | Ga0395899_0039915 | 3300037312 | Bacteria | 3512 |
| 550 | Ga0395900_0007255 | 3300037418 | Bacteria | 11476 |
| 551 | Ga0395900_0018896 | 3300037418 | Bacteria | 7029 |
| 552 | Ga0395900_0023006 | 3300037418 | Bacteria | 6378 |
| 553 | Ga0395900_0137212 | 3300037418 | Bacteria | 2506 |
| 554 | Ga0395900_0184677 | 3300037418 | Bacteria | 2117 |
| 555 | Ga0395900_0702925 | 3300037418 | Bacteria | 944 |
| 556 | Ga0395900_1601164 | 3300037418 | Bacteria | 563 |
| 557 | Ga0395898_0002154 | 3300037466 | Bacteria | 24159 |
| 558 | Ga0395898_0014498 | 3300037466 | Bacteria | 8096 |
| 559 | Ga0395898_0052022 | 3300037466 | Bacteria | 4002 |
| 560 | Ga0395898_0366828 | 3300037466 | Bacteria | 1373 |
| 561 | Ga0395898_0528845 | 3300037466 | Bacteria | 1121 |
| 562 | Ga0395905_0000047 | 3300037471 | Bacteria | 237582 |
| 563 | Ga0395905_0005624 | 3300037471 | Bacteria | 12751 |
| 564 | Ga0395905_0013597 | 3300037471 | Bacteria | 7797 |
| 565 | Ga0395905_0033794 | 3300037471 | Bacteria | 4803 |
| 566 | Ga0395905_0086534 | 3300037471 | Bacteria | 2937 |
| 567 | Ga0395905_0164653 | 3300037471 | Bacteria | 2083 |
| 568 | Ga0395905_0200480 | 3300037471 | Bacteria | 1871 |
| 569 | Ga0395905_0203737 | 3300037471 | Bacteria | 1854 |
| 570 | Ga0395905_0251604 | 3300037471 | Bacteria | 1650 |
| 571 | Ga0395905_0253105 | 3300037471 | Bacteria | 1645 |
| 572 | Ga0395905_0262538 | 3300037471 | Bacteria | 1612 |
| 573 | Ga0395905_0462898 | 3300037471 | Bacteria | 1166 |
| 574 | Ga0395905_0694774 | 3300037471 | Bacteria | 919 |
| 575 | Ga0395905_1063965 | 3300037471 | Bacteria | 712 |
| 576 | Ga0395901_0016167 | 3300038443 | Bacteria | 7600 |
| 577 | Ga0395901_0018542 | 3300038443 | Bacteria | 7104 |
| 578 | Ga0395901_0042905 | 3300038443 | Bacteria | 4691 |
| 579 | Ga0395901_0069333 | 3300038443 | Bacteria | 3672 |
| 580 | Ga0395901_0159781 | 3300038443 | Bacteria | 2367 |
| 581 | Ga0395901_0237974 | 3300038443 | Bacteria | 1899 |
| 582 | Ga0395901_0337430 | 3300038443 | Bacteria | 1557 |
| 583 | Ga0395901_0662866 | 3300038443 | Bacteria | 1045 |
| 584 | Ga0395901_0873229 | 3300038443 | Bacteria | 883 |
| 585 | Ga0436361_0524196 | 3300039447 | Bacteria | 11455 |
| 586 | Ga0439447_144417 | 3300041407 | Bacteria | 547 |
| 587 | Ga0439453_0042819 | 3300041408 | Bacteria | 893 |
| 588 | Ga0439461_0100632 | 3300041410 | Bacteria | 703 |
| 589 | Ga0439465_0259599 | 3300041413 | Bacteria | 644 |
| 590 | Ga0451787_392389 | 3300041441 | Bacteria | 732 |
| 591 | Ga0451789_0978585 | 3300041443 | Bacteria | 796 |
| 592 | Ga0451789_1076770 | 3300041443 | Bacteria | 1069 |
| 593 | Ga0451791_1716037 | 3300041451 | Bacteria | 1100 |
| 594 | Ga0451791_1822544 | 3300041451 | Bacteria | 746 |
| 595 | Ga0451793_0250537 | 3300041452 | Bacteria | 561 |
| 596 | Ga0451793_0899693 | 3300041452 | Bacteria | 683 |
| 597 | Ga0451797_0381324 | 3300041453 | Bacteria | 610 |
| 598 | Ga0451797_1401759 | 3300041453 | Bacteria | 575 |
| 599 | Ga0451797_1490071 | 3300041453 | Bacteria | 501 |
| 600 | Ga0451798_0197861 | 3300041458 | Bacteria | 831 |
| 601 | Ga0451798_0655170 | 3300041458 | Bacteria | 872 |
| 602 | Ga0451800_1282004 | 3300041459 | Bacteria | 569 |
| 603 | Ga0451802_1805873 | 3300041460 | Bacteria | 546 |
| 604 | Ga0451807_0557572 | 3300041486 | Bacteria | 727 |
| 605 | Ga0451807_1313990 | 3300041486 | Bacteria | 736 |
| 606 | Ga0451835_0830645 | 3300041492 | Bacteria | 1000 |
| 607 | Ga0451839_0378695 | 3300041496 | Bacteria | 621 |
| 608 | Ga0451851_0652104 | 3300041507 | Bacteria | 639 |
| 609 | Ga0451851_0727205 | 3300041507 | Bacteria | 557 |
| 610 | Ga0451843_1133688 | 3300041509 | Bacteria | 516 |
| 611 | Ga0451853_1145788 | 3300041512 | Bacteria | 560 |
| 612 | Ga0451853_2527883 | 3300041512 | Bacteria | 557 |
| 613 | Ga0439431_0054675 | 3300041997 | Bacteria | 1042 |
| 614 | Ga0439441_053762 | 3300042001 | Bacteria | 835 |
| 615 | Ga0439443_114022 | 3300042003 | Bacteria | 526 |
| 616 | Ga0439432_089814 | 3300042006 | Bacteria | 925 |
| 617 | Ga0450912_010762 | 3300042116 | Bacteria | 788 |
| 618 | Ga0450921_014108 | 3300042123 | Bacteria | 707 |
| 619 | Ga0450890_001669 | 3300042127 | Bacteria | 3168 |
| 620 | Ga0450897_002399 | 3300042128 | Bacteria | 1403 |
| 621 | Ga0450898_005652 | 3300042134 | Bacteria | 1898 |
| 622 | Ga0450903_028373 | 3300042138 | Bacteria | 849 |
| 623 | Ga0450904_032532 | 3300042139 | Bacteria | 547 |
| 624 | Ga0450910_031874 | 3300042147 | Bacteria | 830 |
| 625 | Ga0439446_0007973 | 3300042156 | Bacteria | 2798 |
| 626 | Ga0439458_0030099 | 3300042157 | Bacteria | 1291 |
| 627 | Ga0450909_011874 | 3300042185 | Bacteria | 1276 |
| 628 | Ga0439434_0036474 | 3300042435 | Bacteria | 1504 |
| 629 | Ga0439434_0089299 | 3300042435 | Bacteria | 984 |
| 630 | Ga0439435_0113389 | 3300042436 | Bacteria | 843 |
| 631 | Ga0450893_0007589 | 3300042532 | Bacteria | 1763 |
| 632 | Ga0450893_0041981 | 3300042532 | Bacteria | 840 |
| 633 | Ga0451577_0008177 | 3300042876 | Bacteria | 10196 |
| 634 | Ga0466969_0013272 | 3300044656 | Bacteria | 4338 |
| 635 | Ga0466969_0071072 | 3300044656 | Bacteria | 1674 |
| 636 | Ga0466969_0226605 | 3300044656 | Bacteria | 849 |
| 637 | Ga0466972_0060165 | 3300044658 | Bacteria | 1822 |
| 638 | Ga0453683_0005225 | 3300044673 | Bacteria | 9089 |
| 639 | Ga0466965_0022570 | 3300044683 | Bacteria | 3034 |
| 640 | Ga0466965_0060420 | 3300044683 | Bacteria | 1893 |
| 641 | Ga0466965_0321573 | 3300044683 | Bacteria | 843 |
| 642 | Ga0466966_0011758 | 3300044684 | Bacteria | 5801 |
| 643 | Ga0466966_0256125 | 3300044684 | Bacteria | 1054 |
| 644 | Ga0466966_0316860 | 3300044684 | Bacteria | 937 |
| 645 | Ga0466961_0016354 | 3300044693 | Bacteria | 4765 |
| 646 | Ga0466961_0128200 | 3300044693 | Bacteria | 1591 |
| 647 | Ga0466963_0711421 | 3300044694 | Bacteria | 709 |
| 648 | Ga0466964_0140840 | 3300044706 | Bacteria | 1108 |
| 649 | Ga0453684_1054740 | 3300044712 | Bacteria | 861 |
| 650 | Ga0453684_1842782 | 3300044712 | Bacteria | 614 |
| 651 | Ga0466971_0233234 | 3300044719 | Bacteria | 874 |
| 652 | Ga0466971_0615827 | 3300044719 | Bacteria | 542 |
| 653 | Ga0466968_0258610 | 3300044735 | Bacteria | 828 |
| 654 | Ga0466970_0422178 | 3300044765 | Bacteria | 762 |
| 655 | Ga0466957_0142263 | 3300044842 | Bacteria | 1546 |
| 656 | Ga0466957_0243256 | 3300044842 | Bacteria | 1194 |
| 657 | Ga0466957_0406995 | 3300044842 | Bacteria | 931 |
| 658 | Ga0466960_0564417 | 3300044901 | Bacteria | 672 |
| 659 | Ga0466960_0653318 | 3300044901 | Bacteria | 628 |
| 660 | Ga0466959_0013672 | 3300045049 | Bacteria | 5889 |
| 661 | Ga0466959_0239009 | 3300045049 | Bacteria | 1255 |
| 662 | Ga0451576_0000914 | 3300045051 | Bacteria | 55935 |
| 663 | Ga0451576_0001036 | 3300045051 | Bacteria | 51297 |
| 664 | Ga0451576_0023020 | 3300045051 | Bacteria | 6751 |
| 665 | Ga0451576_0613620 | 3300045051 | Bacteria | 1143 |
| 666 | Ga0466967_0461389 | 3300045976 | Bacteria | 1243 |
| 667 | Ga0466967_1420234 | 3300045976 | Bacteria | 691 |
| 668 | Ga0495641_0370480 | 3300046461 | Bacteria | 649 |
| 669 | Ga0495650_0095921 | 3300046471 | Bacteria | 1120 |
| 670 | Ga0495639_0013949 | 3300046475 | Bacteria | 3476 |
| 671 | Ga0495607_0000236 | 3300046501 | Bacteria | 59283 |
| 672 | Ga0495583_0000444 | 3300046506 | Bacteria | 62022 |
| 673 | Ga0495606_0002487 | 3300046507 | Bacteria | 21331 |
| 674 | Ga0495606_0441275 | 3300046507 | Bacteria | 669 |
| 675 | Ga0495608_0272110 | 3300046511 | Bacteria | 1053 |
| 676 | Ga0495628_0710962 | 3300046516 | Bacteria | 709 |
| 677 | Ga0495652_0702413 | 3300046529 | Bacteria | 680 |
| 678 | Ga0495621_0129890 | 3300046539 | Bacteria | 979 |
| 679 | Ga0495621_0298990 | 3300046539 | Bacteria | 667 |
| 680 | Ga0495668_0048989 | 3300046616 | Bacteria | 2343 |
| 681 | Ga0495625_0126142 | 3300046660 | Bacteria | 1737 |
| 682 | Ga0495658_0804802 | 3300046683 | Bacteria | 602 |
| 683 | Ga0495669_0070763 | 3300046684 | Bacteria | 1589 |
| 684 | Ga0495670_0427911 | 3300046691 | Bacteria | 716 |
| 685 | Ga0495671_0255894 | 3300046692 | Bacteria | 845 |
| 686 | Ga0495649_0000298 | 3300046694 | Bacteria | 43334 |
| 687 | Ga0495589_0023031 | 3300046794 | Bacteria | 3174 |
| 688 | Ga0495660_0016673 | 3300046810 | Bacteria | 4233 |
| 689 | Ga0495683_0110040 | 3300047323 | Bacteria | 1316 |
| 690 | Ga0495686_0011222 | 3300047472 | Bacteria | 6317 |
| 691 | Ga0495686_0513514 | 3300047472 | Bacteria | 630 |
| 692 | Ga0495615_0006727 | 3300048090 | Bacteria | 2148 |
| 693 | Ga0495615_0174500 | 3300048090 | Bacteria | 652 |
| 694 | Ga0496100_0454932 | 3300048903 | Bacteria | 982 |
| 695 | Ga0496100_0465574 | 3300048903 | Bacteria | 971 |
| 696 | Ga0496102_1265550 | 3300048905 | Bacteria | 657 |
| 697 | Ga0496104_0605612 | 3300048907 | Bacteria | 1006 |
| 698 | Ga0496106_0661220 | 3300048909 | Bacteria | 834 |
| 699 | Ga0496106_1177645 | 3300048909 | Bacteria | 598 |
| 700 | Ga0496108_0402155 | 3300048911 | Bacteria | 1196 |
| 701 | Ga0496108_1502699 | 3300048911 | Bacteria | 560 |
| 702 | Ga0496109_0170210 | 3300048912 | Bacteria | 2043 |
| 703 | Ga0496109_0498978 | 3300048912 | Bacteria | 1149 |
| 704 | Ga0496121_0009710 | 3300048924 | Bacteria | 11017 |
| 705 | Ga0496124_0000458 | 3300048927 | Bacteria | 70719 |
| 706 | Ga0496124_0478632 | 3300048927 | Bacteria | 841 |
| 707 | Ga0496125_0172626 | 3300048928 | Bacteria | 1451 |
| 708 | Ga0496125_0514567 | 3300048928 | Bacteria | 670 |
| 709 | Ga0496126_0591588 | 3300048929 | Bacteria | 875 |
| 710 | Ga0501308_075281 | 3300049128 | Bacteria | 530 |
| 711 | Ga0501311_081458 | 3300049527 | Bacteria | 551 |
| 712 | Ga0501031_0778906 | 3300049568 | Bacteria | 613 |
| 713 | Ga0501032_0453093 | 3300049569 | Bacteria | 822 |
| 714 | Ga0501033_0080077 | 3300049570 | Bacteria | 2397 |
| 715 | Ga0501034_0448863 | 3300049571 | Bacteria | 1207 |
| 716 | Ga0501036_0312163 | 3300049572 | Bacteria | 1314 |
| 717 | Ga0501037_0327581 | 3300049573 | Bacteria | 1060 |
| 718 | Ga0501038_0821070 | 3300049574 | Bacteria | 690 |
| 719 | Ga0501043_0093019 | 3300049579 | Bacteria | 2371 |
| 720 | Ga0501046_0145218 | 3300049580 | Bacteria | 1792 |
| 721 | Ga0501047_0412481 | 3300049581 | Bacteria | 1183 |
| 722 | Ga0501047_0532107 | 3300049581 | Bacteria | 1000 |
| 723 | Ga0501047_0724417 | 3300049581 | Bacteria | 811 |
| 724 | Ga0501048_1021299 | 3300049582 | Bacteria | 595 |
| 725 | Ga0501073_0111340 | 3300049589 | Bacteria | 1899 |
| 726 | Ga0501077_0298533 | 3300049593 | Bacteria | 1026 |
| 727 | Ga0501242_037791 | 3300049674 | Bacteria | 674 |
| 728 | Ga0501249_142411 | 3300049679 | Bacteria | 598 |
| 729 | Ga0501080_0435465 | 3300049742 | Bacteria | 1177 |
| 730 | Ga0501080_0680556 | 3300049742 | Bacteria | 908 |
| 731 | Ga0501241_086545 | 3300049758 | Bacteria | 659 |
| 732 | Ga0501263_009077 | 3300049760 | Bacteria | 1199 |
| 733 | Ga0501275_082232 | 3300049772 | Bacteria | 524 |
| 734 | Ga0501035_0053679 | 3300049822 | Bacteria | 3603 |
| 735 | Ga0501035_0120412 | 3300049822 | Bacteria | 2295 |
| 736 | Ga0501035_0201546 | 3300049822 | Bacteria | 1706 |
| 737 | Ga0501035_0356744 | 3300049822 | Bacteria | 1222 |
| 738 | Ga0501044_0000336 | 3300049823 | Bacteria | 59417 |
| 739 | Ga0501044_0289251 | 3300049823 | Bacteria | 1570 |
| 740 | Ga0501044_1183616 | 3300049823 | Bacteria | 632 |
| 741 | nmdc:mga03683_322259_c1 | 3300050489 | Bacteria | 728 |
| 742 | nmdc:mga03n38_141968_c1 | 3300050490 | Bacteria | 1200 |
| 743 | nmdc:mga03n38_398155_c1 | 3300050490 | Bacteria | 757 |
| 744 | nmdc:mga03n38_512063_c1 | 3300050490 | Bacteria | 675 |
| 745 | nmdc:mga03n38_576315_c1 | 3300050490 | Bacteria | 639 |
| 746 | nmdc:mga03n38_848620_c1 | 3300050490 | Bacteria | 534 |
| 747 | nmdc:mga00v17_143149_c1 | 3300050491 | Bacteria | 1534 |
| 748 | nmdc:mga00v17_749786_c1 | 3300050491 | Bacteria | 624 |
| 749 | nmdc:mga0yw44_40482_c1 | 3300050492 | Bacteria | 2769 |
| 750 | nmdc:mga0yw44_48096_c1 | 3300050492 | Bacteria | 2571 |
| 751 | nmdc:mga0yw44_852805_c1 | 3300050492 | Bacteria | 618 |
| 752 | nmdc:mga0k408_132670_c1 | 3300050493 | Bacteria | 1479 |
| 753 | nmdc:mga0k408_196323_c1 | 3300050493 | Bacteria | 1204 |
| 754 | nmdc:mga0k408_335351_c1 | 3300050493 | Bacteria | 902 |
| 755 | nmdc:mga0k408_398125_c1 | 3300050493 | Bacteria | 820 |
| 756 | nmdc:mga0k408_413454_c1 | 3300050493 | Bacteria | 802 |
| 757 | nmdc:mga06z11_16098_c1 | 3300050494 | Bacteria | 3358 |
| 758 | nmdc:mga06z11_645661_c1 | 3300050494 | Bacteria | 644 |
| 759 | nmdc:mga04h51_141460_c1 | 3300050495 | Bacteria | 913 |
| 760 | nmdc:mga07m45_227298_c1 | 3300050496 | Bacteria | 1086 |
| 761 | nmdc:mga07m45_3289_c1 | 3300050496 | Bacteria | 6377 |
| 762 | nmdc:mga07m45_526690_c1 | 3300050496 | Bacteria | 684 |
| 763 | nmdc:mga05p37_261861_c1 | 3300050507 | Bacteria | 2069 |
| 764 | nmdc:mga09592_151745_c1 | 3300050508 | Bacteria | 1999 |
| 765 | nmdc:mga09592_3332_c1 | 3300050508 | Bacteria | 12994 |
| 766 | nmdc:mga0qj67_266991_c1 | 3300050509 | Bacteria | 1388 |
| 767 | nmdc:mga0qj67_35975_c1 | 3300050509 | Bacteria | 3872 |
| 768 | nmdc:mga0n895_919912_c1 | 3300050512 | Bacteria | 859 |
| 769 | Ga0500635_0000003 | 3300053080 | Bacteria | 216927 |
| 770 | Ga0500578_0020316 | 3300053086 | Bacteria | 4269 |
| 771 | Ga0500644_0172456 | 3300053088 | Bacteria | 880 |
| 772 | Ga0500644_0241564 | 3300053088 | Bacteria | 759 |
| 773 | Ga0500651_0625055 | 3300053093 | Bacteria | 582 |
| 774 | Ga0500660_252547 | 3300053100 | Bacteria | 541 |
| 775 | Ga0500593_129551 | 3300053117 | Bacteria | 1009 |
| 776 | Ga0500608_037775 | 3300053122 | Bacteria | 2308 |
| 777 | Ga0500559_0070831 | 3300053136 | Bacteria | 1569 |
| 778 | Ga0500564_111504 | 3300053138 | Bacteria | 1200 |
| 779 | Ga0500564_244383 | 3300053138 | Bacteria | 714 |
| 780 | Ga0500568_0006764 | 3300053139 | Bacteria | 5722 |
| 781 | Ga0500590_084162 | 3300053148 | Bacteria | 1557 |
| 782 | Ga0500622_0002974 | 3300053156 | Bacteria | 11744 |
| 783 | Ga0500636_0012032 | 3300053177 | Bacteria | 5068 |
| 784 | Ga0500645_000346 | 3300053730 | Bacteria | 33036 |
| 785 | Ga0500645_002236 | 3300053730 | Bacteria | 8822 |
| 786 | Ga0500645_004728 | 3300053730 | Bacteria | 5156 |
| 787 | Ga0500645_162725 | 3300053730 | Bacteria | 611 |
| 788 | Ga0500661_038307 | 3300055283 | Bacteria | 848 |
| 789 | Ga0500661_082206 | 3300055283 | Bacteria | 597 |
| 790 | Ga0590075_037870 | 3300059424 | Bacteria | 1230 |
| 791 | Ga0590075_135525 | 3300059424 | Bacteria | 647 |
| 792 | Ga0466962_0193446 | 3300061719 | Bacteria | 993 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2831864461 | 2831866190 | 79 |
| 2 | iso_pu_bacteria | 2855730933 | 2855734691 | 79 |
| 3 | iso_pu_bacteria | 2855767633 | 2855770475 | 79 |
| 4 | iso_pu_bacteria | 2881412998 | 2881413085 | 79 |
| 5 | iso_pu_bacteria | 2886848708 | 2886852429 | 79 |
| 6 | iso_pu_bacteria | 2886848708 | 2886853184 | 79 |
| 7 | 3300005563 | Ga0068855_102606391 | Ga0068855_1026063911 | 80 |
| 8 | 3300042001 | Ga0439441_053762 | Ga0439441_053762_12_266 | 80 |
| 9 | 3300042127 | Ga0450890_001669 | Ga0450890_001669_115_369 | 80 |
| 10 | 3300042436 | Ga0439435_0113389 | Ga0439435_0113389_194_448 | 80 |
| 11 | 3300048912 | Ga0496109_0498978 | Ga0496109_0498978_207_461 | 80 |
| 12 | 3300048927 | Ga0496124_0478632 | Ga0496124_0478632_94_348 | 80 |
| 13 | 3300048928 | Ga0496125_0172626 | Ga0496125_0172626_1173_1427 | 80 |
| 14 | 3300048929 | Ga0496126_0591588 | Ga0496126_0591588_438_692 | 80 |
| 15 | 3300050493 | nmdc:mga0k408_132670_c1 | nmdc:mga0k408_132670_c1_520_774 | 80 |
| 16 | 3300050496 | nmdc:mga07m45_3289_c1 | nmdc:mga07m45_3289_c1_282_536 | 80 |
| 17 | 3300053088 | Ga0500644_0241564 | Ga0500644_0241564_140_403 | 80 |
| 18 | 3300046691 | Ga0495670_0427911 | Ga0495670_0427911_332_589 | 81 |
| 19 | 3300053156 | Ga0500622_0002974 | Ga0500622_0002974_339_596 | 81 |
| 20 | iso_pu_bacteria | 2721755523 | 2722880906 | 81 |
| 21 | iso_pu_bacteria | 2839138175 | 2839138290 | 81 |
| 22 | iso_pu_bacteria | 2857576091 | 2857577713 | 81 |
| 23 | iso_pu_bacteria | 2894023352 | 2894027465 | 81 |
| 24 | iso_pu_bacteria | 2904479285 | 2904481220 | 81 |
| 25 | iso_pu_bacteria | 2919704043 | 2919708274 | 81 |
| 26 | iso_pu_bacteria | 8055225921 | 8055227298 | 81 |
| 27 | 3300003761 | Ga0055535_1024006 | Ga0055535_10240062 | 82 |
| 28 | 3300003763 | Ga0055529_1001828 | Ga0055529_10018285 | 82 |
| 29 | 3300005614 | Ga0068856_100288493 | Ga0068856_1002884932 | 82 |
| 30 | 3300013307 | Ga0157372_12050099 | Ga0157372_120500991 | 82 |
| 31 | 3300025228 | Ga0209672_104319 | Ga0209672_1043193 | 82 |
| 32 | 3300025242 | Ga0209258_102002 | Ga0209258_1020024 | 82 |
| 33 | 3300025272 | Ga0209455_1000687 | Ga0209455_100068710 | 82 |
| 34 | 3300026078 | Ga0207702_10575741 | Ga0207702_105757412 | 82 |
| 35 | 3300045976 | Ga0466967_0461389 | Ga0466967_0461389_166_420 | 82 |
| 36 | 3300048903 | Ga0496100_0465574 | Ga0496100_0465574_684_932 | 82 |
| 37 | 3300049822 | Ga0501035_0053679 | Ga0501035_0053679_2500_2760 | 82 |
| 38 | 3300049822 | Ga0501035_0120412 | Ga0501035_0120412_1860_2120 | 82 |
| 39 | 3300049823 | Ga0501044_0000336 | Ga0501044_0000336_52918_53178 | 82 |
| 40 | iso_pu_bacteria | 2511231002 | 2511242683 | 82 |
| 41 | iso_pu_bacteria | 2881101125 | 2881104492 | 82 |
| 42 | 3300003320 | rootH2_10010510 | rootH2_100105102 | 83 |
| 43 | 3300003322 | rootL2_10018076 | rootL2_100180766 | 83 |
| 44 | 3300003323 | rootH1_10013777 | rootH1_100137772 | 83 |
| 45 | 3300003323 | rootH1_10013778 | rootH1_100137783 | 83 |
| 46 | 3300003771 | Ga0055526_1002155 | Ga0055526_10021553 | 83 |
| 47 | 3300003775 | Ga0055524_1000554 | Ga0055524_100055418 | 83 |
| 48 | 3300003775 | Ga0055524_1007049 | Ga0055524_10070492 | 83 |
| 49 | 3300003790 | Ga0055528_1043631 | Ga0055528_10436312 | 83 |
| 50 | 3300003791 | Ga0055530_10033421 | Ga0055530_100334212 | 83 |
| 51 | 3300003792 | Ga0055540_1029832 | Ga0055540_10298322 | 83 |
| 52 | 3300003794 | Ga0055531_10003057 | Ga0055531_100030572 | 83 |
| 53 | 3300003794 | Ga0055531_10009223 | Ga0055531_100092234 | 83 |
| 54 | 3300004625 | Ga0055543_1076764 | Ga0055543_10767642 | 83 |
| 55 | 3300005262 | Ga0065165_1000283 | Ga0065165_100028352 | 83 |
| 56 | 3300005262 | Ga0065165_1000935 | Ga0065165_100093522 | 83 |
| 57 | 3300006195 | Ga0075366_10064724 | Ga0075366_100647243 | 83 |
| 58 | 3300006353 | Ga0075370_10009248 | Ga0075370_100092485 | 83 |
| 59 | 3300006942 | Ga0099824_1066035 | Ga0099824_10660351 | 83 |
| 60 | 3300006944 | Ga0099823_1007351 | Ga0099823_10073512 | 83 |
| 61 | 3300012497 | Ga0157319_1000009 | Ga0157319_100000921 | 83 |
| 62 | 3300013100 | Ga0157373_11397829 | Ga0157373_113978291 | 83 |
| 63 | 3300013104 | Ga0157370_11387830 | Ga0157370_113878302 | 83 |
| 64 | 3300013104 | Ga0157370_11647734 | Ga0157370_116477341 | 83 |
| 65 | 3300021361 | Ga0213872_10042110 | Ga0213872_100421103 | 83 |
| 66 | 3300025273 | Ga0209673_1007346 | Ga0209673_10073466 | 83 |
| 67 | 3300025273 | Ga0209673_1009683 | Ga0209673_10096832 | 83 |
| 68 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003369 | 83 |
| 69 | 3300025297 | Ga0209758_1079909 | Ga0209758_10799092 | 83 |
| 70 | 3300025298 | Ga0209050_1015921 | Ga0209050_10159213 | 83 |
| 71 | 3300025299 | Ga0209256_1002170 | Ga0209256_10021705 | 83 |
| 72 | 3300025299 | Ga0209256_1002204 | Ga0209256_100220411 | 83 |
| 73 | 3300025299 | Ga0209256_1111211 | Ga0209256_11112111 | 83 |
| 74 | 3300025303 | Ga0209051_1008919 | Ga0209051_10089192 | 83 |
| 75 | 3300025304 | Ga0209257_1002930 | Ga0209257_10029305 | 83 |
| 76 | 3300025304 | Ga0209257_1003485 | Ga0209257_100348511 | 83 |
| 77 | 3300025940 | Ga0207691_10894928 | Ga0207691_108949281 | 83 |
| 78 | 3300027296 | Ga0209389_1063122 | Ga0209389_10631222 | 83 |
| 79 | 3300027312 | Ga0209371_1020385 | Ga0209371_10203852 | 83 |
| 80 | 3300030500 | Ga0268256_1022764 | Ga0268256_10227642 | 83 |
| 81 | 3300031911 | Ga0307412_10721072 | Ga0307412_107210722 | 83 |
| 82 | 3300039447 | Ga0436361_0524196 | Ga0436361_0524196_7482_7742 | 83 |
| 83 | 3300002705 | JGI25156J39149_1000419 | JGI25156J39149_100041919 | 84 |
| 84 | 3300002705 | JGI25156J39149_1026593 | JGI25156J39149_10265932 | 84 |
| 85 | 3300002738 | JGI25154J39366_1002043 | JGI25154J39366_10020433 | 84 |
| 86 | 3300002741 | JGI25157J39369_1000174 | JGI25157J39369_100017413 | 84 |
| 87 | 3300002772 | JGI25164J39214_1003316 | JGI25164J39214_10033163 | 84 |
| 88 | 3300003316 | rootH1_10022997 | rootH1_100229976 | 84 |
| 89 | 3300003316 | rootH1_10036997 | rootH1_100369976 | 84 |
| 90 | 3300003320 | rootH2_10037754 | rootH2_100377542 | 84 |
| 91 | 3300003320 | rootH2_10081249 | rootH2_100812492 | 84 |
| 92 | 3300003322 | rootL2_10025710 | rootL2_100257105 | 84 |
| 93 | 3300003323 | rootH1_10008020 | rootH1_100080208 | 84 |
| 94 | 3300003323 | rootH1_10121381 | rootH1_101213812 | 84 |
| 95 | 3300003752 | Ga0055539_1010866 | Ga0055539_10108662 | 84 |
| 96 | 3300003756 | Ga0055533_1000011 | Ga0055533_1000011252 | 84 |
| 97 | 3300003759 | Ga0055525_1000989 | Ga0055525_10009895 | 84 |
| 98 | 3300003761 | Ga0055535_1000097 | Ga0055535_100009724 | 84 |
| 99 | 3300003763 | Ga0055529_1000202 | Ga0055529_100020262 | 84 |
| 100 | 3300003792 | Ga0055540_1006840 | Ga0055540_10068408 | 84 |
| 101 | 3300003794 | Ga0055531_10000312 | Ga0055531_1000031219 | 84 |
| 102 | 3300005295 | Ga0065707_10286322 | Ga0065707_102863222 | 84 |
| 103 | 3300005327 | Ga0070658_10063772 | Ga0070658_100637722 | 84 |
| 104 | 3300005327 | Ga0070658_10064006 | Ga0070658_100640062 | 84 |
| 105 | 3300005327 | Ga0070658_10221641 | Ga0070658_102216412 | 84 |
| 106 | 3300005327 | Ga0070658_10810179 | Ga0070658_108101791 | 84 |
| 107 | 3300005329 | Ga0070683_102440058 | Ga0070683_1024400581 | 84 |
| 108 | 3300005330 | Ga0070690_100104539 | Ga0070690_1001045392 | 84 |
| 109 | 3300005334 | Ga0068869_100006181 | Ga0068869_1000061813 | 84 |
| 110 | 3300005335 | Ga0070666_10443233 | Ga0070666_104432332 | 84 |
| 111 | 3300005336 | Ga0070680_101998320 | Ga0070680_1019983202 | 84 |
| 112 | 3300005338 | Ga0068868_100853073 | Ga0068868_1008530731 | 84 |
| 113 | 3300005338 | Ga0068868_101770327 | Ga0068868_1017703271 | 84 |
| 114 | 3300005339 | Ga0070660_100021704 | Ga0070660_1000217043 | 84 |
| 115 | 3300005339 | Ga0070660_100529851 | Ga0070660_1005298512 | 84 |
| 116 | 3300005340 | Ga0070689_101084522 | Ga0070689_1010845221 | 84 |
| 117 | 3300005344 | Ga0070661_101259256 | Ga0070661_1012592562 | 84 |
| 118 | 3300005344 | Ga0070661_101501979 | Ga0070661_1015019791 | 84 |
| 119 | 3300005345 | Ga0070692_11193217 | Ga0070692_111932172 | 84 |
| 120 | 3300005354 | Ga0070675_101246534 | Ga0070675_1012465342 | 84 |
| 121 | 3300005364 | Ga0070673_100787828 | Ga0070673_1007878282 | 84 |
| 122 | 3300005364 | Ga0070673_100922332 | Ga0070673_1009223322 | 84 |
| 123 | 3300005366 | Ga0070659_100011135 | Ga0070659_1000111356 | 84 |
| 124 | 3300005366 | Ga0070659_100500500 | Ga0070659_1005005002 | 84 |
| 125 | 3300005441 | Ga0070700_101956878 | Ga0070700_1019568781 | 84 |
| 126 | 3300005455 | Ga0070663_101086822 | Ga0070663_1010868222 | 84 |
| 127 | 3300005457 | Ga0070662_101814173 | Ga0070662_1018141732 | 84 |
| 128 | 3300005458 | Ga0070681_11687238 | Ga0070681_116872381 | 84 |
| 129 | 3300005466 | Ga0070685_10148826 | Ga0070685_101488261 | 84 |
| 130 | 3300005466 | Ga0070685_10854841 | Ga0070685_108548412 | 84 |
| 131 | 3300005535 | Ga0070684_100022047 | Ga0070684_1000220476 | 84 |
| 132 | 3300005539 | Ga0068853_100115161 | Ga0068853_1001151613 | 84 |
| 133 | 3300005563 | Ga0068855_100000971 | Ga0068855_10000097124 | 84 |
| 134 | 3300005563 | Ga0068855_100307735 | Ga0068855_1003077352 | 84 |
| 135 | 3300005563 | Ga0068855_100744297 | Ga0068855_1007442972 | 84 |
| 136 | 3300005564 | Ga0070664_101668593 | Ga0070664_1016685932 | 84 |
| 137 | 3300005577 | Ga0068857_100003123 | Ga0068857_10000312313 | 84 |
| 138 | 3300005577 | Ga0068857_100531184 | Ga0068857_1005311842 | 84 |
| 139 | 3300005578 | Ga0068854_100030573 | Ga0068854_1000305732 | 84 |
| 140 | 3300005614 | Ga0068856_100000951 | Ga0068856_1000009513 | 84 |
| 141 | 3300005616 | Ga0068852_100777559 | Ga0068852_1007775592 | 84 |
| 142 | 3300005616 | Ga0068852_102616279 | Ga0068852_1026162791 | 84 |
| 143 | 3300005618 | Ga0068864_100744594 | Ga0068864_1007445941 | 84 |
| 144 | 3300005718 | Ga0068866_10562771 | Ga0068866_105627712 | 84 |
| 145 | 3300005719 | Ga0068861_100021114 | Ga0068861_1000211143 | 84 |
| 146 | 3300005843 | Ga0068860_100203759 | Ga0068860_1002037592 | 84 |
| 147 | 3300005844 | Ga0068862_101354676 | Ga0068862_1013546762 | 84 |
| 148 | 3300006038 | Ga0075365_10314983 | Ga0075365_103149832 | 84 |
| 149 | 3300006048 | Ga0075363_100821783 | Ga0075363_1008217832 | 84 |
| 150 | 3300006178 | Ga0075367_10194618 | Ga0075367_101946182 | 84 |
| 151 | 3300006353 | Ga0075370_10224485 | Ga0075370_102244852 | 84 |
| 152 | 3300006353 | Ga0075370_10611129 | Ga0075370_106111292 | 84 |
| 153 | 3300006846 | Ga0075430_100054008 | Ga0075430_1000540083 | 84 |
| 154 | 3300006846 | Ga0075430_100085353 | Ga0075430_1000853532 | 84 |
| 155 | 3300006880 | Ga0075429_100003208 | Ga0075429_1000032088 | 84 |
| 156 | 3300006880 | Ga0075429_100145689 | Ga0075429_1001456892 | 84 |
| 157 | 3300006880 | Ga0075429_101799522 | Ga0075429_1017995221 | 84 |
| 158 | 3300009093 | Ga0105240_10019163 | Ga0105240_100191639 | 84 |
| 159 | 3300009093 | Ga0105240_10027737 | Ga0105240_100277373 | 84 |
| 160 | 3300009093 | Ga0105240_11026253 | Ga0105240_110262532 | 84 |
| 161 | 3300009093 | Ga0105240_11821040 | Ga0105240_118210401 | 84 |
| 162 | 3300009098 | Ga0105245_10648020 | Ga0105245_106480202 | 84 |
| 163 | 3300009148 | Ga0105243_10416431 | Ga0105243_104164312 | 84 |
| 164 | 3300009148 | Ga0105243_10853324 | Ga0105243_108533242 | 84 |
| 165 | 3300009174 | Ga0105241_10206283 | Ga0105241_102062832 | 84 |
| 166 | 3300009176 | Ga0105242_10489349 | Ga0105242_104893492 | 84 |
| 167 | 3300009545 | Ga0105237_10437550 | Ga0105237_104375502 | 84 |
| 168 | 3300009545 | Ga0105237_12759218 | Ga0105237_127592181 | 84 |
| 169 | 3300009551 | Ga0105238_10046256 | Ga0105238_100462565 | 84 |
| 170 | 3300009553 | Ga0105249_10635990 | Ga0105249_106359902 | 84 |
| 171 | 3300010375 | Ga0105239_13090582 | Ga0105239_130905822 | 84 |
| 172 | 3300013105 | Ga0157369_10137207 | Ga0157369_101372073 | 84 |
| 173 | 3300013296 | Ga0157374_12333335 | Ga0157374_123333351 | 84 |
| 174 | 3300013297 | Ga0157378_10055779 | Ga0157378_100557792 | 84 |
| 175 | 3300013306 | Ga0163162_11814711 | Ga0163162_118147112 | 84 |
| 176 | 3300013307 | Ga0157372_10103908 | Ga0157372_101039081 | 84 |
| 177 | 3300014326 | Ga0157380_12032387 | Ga0157380_120323872 | 84 |
| 178 | 3300014326 | Ga0157380_12685755 | Ga0157380_126857552 | 84 |
| 179 | 3300014969 | Ga0157376_10680492 | Ga0157376_106804921 | 84 |
| 180 | 3300015261 | Ga0182006_1250452 | Ga0182006_12504521 | 84 |
| 181 | 3300015262 | Ga0182007_10135318 | Ga0182007_101353182 | 84 |
| 182 | 3300025226 | Ga0209674_100003 | Ga0209674_100003551 | 84 |
| 183 | 3300025228 | Ga0209672_108419 | Ga0209672_1084192 | 84 |
| 184 | 3300025230 | Ga0209563_100010 | Ga0209563_100010281 | 84 |
| 185 | 3300025231 | Ga0207427_101137 | Ga0207427_1011378 | 84 |
| 186 | 3300025242 | Ga0209258_100162 | Ga0209258_10016276 | 84 |
| 187 | 3300025246 | Ga0209646_1000066 | Ga0209646_1000066157 | 84 |
| 188 | 3300025250 | Ga0209026_1000027 | Ga0209026_1000027172 | 84 |
| 189 | 3300025250 | Ga0209026_1048919 | Ga0209026_10489192 | 84 |
| 190 | 3300025253 | Ga0209677_100178 | Ga0209677_10017810 | 84 |
| 191 | 3300025253 | Ga0209677_100183 | Ga0209677_10018313 | 84 |
| 192 | 3300025253 | Ga0209677_104325 | Ga0209677_1043256 | 84 |
| 193 | 3300025256 | Ga0209759_1000131 | Ga0209759_100013118 | 84 |
| 194 | 3300025256 | Ga0209759_1000662 | Ga0209759_100066216 | 84 |
| 195 | 3300025256 | Ga0209759_1005141 | Ga0209759_10051413 | 84 |
| 196 | 3300025256 | Ga0209759_1017083 | Ga0209759_10170832 | 84 |
| 197 | 3300025256 | Ga0209759_1046348 | Ga0209759_10463481 | 84 |
| 198 | 3300025272 | Ga0209455_1000128 | Ga0209455_100012871 | 84 |
| 199 | 3300025273 | Ga0209673_1037143 | Ga0209673_10371432 | 84 |
| 200 | 3300025297 | Ga0209758_1107255 | Ga0209758_11072552 | 84 |
| 201 | 3300025302 | Ga0207426_1090302 | Ga0207426_10903022 | 84 |
| 202 | 3300025303 | Ga0209051_1000241 | Ga0209051_100024112 | 84 |
| 203 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015152 | 84 |
| 204 | 3300025903 | Ga0207680_10243058 | Ga0207680_102430582 | 84 |
| 205 | 3300025909 | Ga0207705_10050795 | Ga0207705_100507952 | 84 |
| 206 | 3300025909 | Ga0207705_10112426 | Ga0207705_101124263 | 84 |
| 207 | 3300025909 | Ga0207705_10144672 | Ga0207705_101446723 | 84 |
| 208 | 3300025909 | Ga0207705_10173874 | Ga0207705_101738742 | 84 |
| 209 | 3300025909 | Ga0207705_10470833 | Ga0207705_104708332 | 84 |
| 210 | 3300025911 | Ga0207654_10027109 | Ga0207654_100271093 | 84 |
| 211 | 3300025912 | Ga0207707_10892295 | Ga0207707_108922951 | 84 |
| 212 | 3300025913 | Ga0207695_10011214 | Ga0207695_100112149 | 84 |
| 213 | 3300025913 | Ga0207695_10030702 | Ga0207695_100307022 | 84 |
| 214 | 3300025914 | Ga0207671_10133918 | Ga0207671_101339182 | 84 |
| 215 | 3300025919 | Ga0207657_10005150 | Ga0207657_100051503 | 84 |
| 216 | 3300025919 | Ga0207657_10362666 | Ga0207657_103626662 | 84 |
| 217 | 3300025920 | Ga0207649_11298560 | Ga0207649_112985602 | 84 |
| 218 | 3300025924 | Ga0207694_10049847 | Ga0207694_100498472 | 84 |
| 219 | 3300025927 | Ga0207687_10411114 | Ga0207687_104111142 | 84 |
| 220 | 3300025932 | Ga0207690_10012639 | Ga0207690_100126392 | 84 |
| 221 | 3300025932 | Ga0207690_10248709 | Ga0207690_102487092 | 84 |
| 222 | 3300025935 | Ga0207709_10380129 | Ga0207709_103801292 | 84 |
| 223 | 3300025935 | Ga0207709_10627962 | Ga0207709_106279621 | 84 |
| 224 | 3300025936 | Ga0207670_10657343 | Ga0207670_106573431 | 84 |
| 225 | 3300025942 | Ga0207689_10131208 | Ga0207689_101312082 | 84 |
| 226 | 3300025949 | Ga0207667_10103966 | Ga0207667_101039662 | 84 |
| 227 | 3300025949 | Ga0207667_10276242 | Ga0207667_102762422 | 84 |
| 228 | 3300025949 | Ga0207667_10365573 | Ga0207667_103655732 | 84 |
| 229 | 3300025949 | Ga0207667_10662083 | Ga0207667_106620832 | 84 |
| 230 | 3300025960 | Ga0207651_11904524 | Ga0207651_119045242 | 84 |
| 231 | 3300025972 | Ga0207668_10888083 | Ga0207668_108880832 | 84 |
| 232 | 3300025981 | Ga0207640_10005583 | Ga0207640_100055834 | 84 |
| 233 | 3300025986 | Ga0207658_11559584 | Ga0207658_115595841 | 84 |
| 234 | 3300026023 | Ga0207677_10579311 | Ga0207677_105793112 | 84 |
| 235 | 3300026041 | Ga0207639_10343987 | Ga0207639_103439872 | 84 |
| 236 | 3300026078 | Ga0207702_10000220 | Ga0207702_1000022036 | 84 |
| 237 | 3300026078 | Ga0207702_10487159 | Ga0207702_104871592 | 84 |
| 238 | 3300026088 | Ga0207641_12334546 | Ga0207641_123345462 | 84 |
| 239 | 3300026116 | Ga0207674_10006407 | Ga0207674_100064075 | 84 |
| 240 | 3300026118 | Ga0207675_100031693 | Ga0207675_1000316935 | 84 |
| 241 | 3300026142 | Ga0207698_10220476 | Ga0207698_102204762 | 84 |
| 242 | 3300026142 | Ga0207698_12061032 | Ga0207698_120610322 | 84 |
| 243 | 3300028381 | Ga0268264_10210436 | Ga0268264_102104363 | 84 |
| 244 | 3300028573 | Ga0265334_10043805 | Ga0265334_100438052 | 84 |
| 245 | 3300028666 | Ga0265336_10000008 | Ga0265336_10000008154 | 84 |
| 246 | 3300029957 | Ga0265324_10003914 | Ga0265324_100039143 | 84 |
| 247 | 3300031548 | Ga0307408_100655348 | Ga0307408_1006553482 | 84 |
| 248 | 3300031548 | Ga0307408_101491525 | Ga0307408_1014915251 | 84 |
| 249 | 3300031548 | Ga0307408_102374295 | Ga0307408_1023742952 | 84 |
| 250 | 3300031730 | Ga0307516_10091429 | Ga0307516_100914294 | 84 |
| 251 | 3300031731 | Ga0307405_11942204 | Ga0307405_119422042 | 84 |
| 252 | 3300032005 | Ga0307411_10488831 | Ga0307411_104888312 | 84 |
| 253 | 3300032005 | Ga0307411_12159208 | Ga0307411_121592082 | 84 |
| 254 | 3300035086 | Ga0373934_0293083 | Ga0373934_0293083_88_345 | 84 |
| 255 | 3300035692 | Ga0373935_1219599 | Ga0373935_1219599_281_538 | 84 |
| 256 | 3300037312 | Ga0395899_0005707 | Ga0395899_0005707_2045_2311 | 84 |
| 257 | 3300037418 | Ga0395900_0018896 | Ga0395900_0018896_650_916 | 84 |
| 258 | 3300037418 | Ga0395900_0184677 | Ga0395900_0184677_306_572 | 84 |
| 259 | 3300037466 | Ga0395898_0014498 | Ga0395898_0014498_778_1044 | 84 |
| 260 | 3300037466 | Ga0395898_0366828 | Ga0395898_0366828_1048_1305 | 84 |
| 261 | 3300037466 | Ga0395898_0528845 | Ga0395898_0528845_476_742 | 84 |
| 262 | 3300037471 | Ga0395905_0086534 | Ga0395905_0086534_1309_1575 | 84 |
| 263 | 3300037471 | Ga0395905_0164653 | Ga0395905_0164653_1139_1402 | 84 |
| 264 | 3300037471 | Ga0395905_0200480 | Ga0395905_0200480_503_769 | 84 |
| 265 | 3300037471 | Ga0395905_1063965 | Ga0395905_1063965_186_443 | 84 |
| 266 | 3300038443 | Ga0395901_0016167 | Ga0395901_0016167_6496_6753 | 84 |
| 267 | 3300038443 | Ga0395901_0018542 | Ga0395901_0018542_2879_3145 | 84 |
| 268 | 3300038443 | Ga0395901_0662866 | Ga0395901_0662866_505_771 | 84 |
| 269 | 3300038443 | Ga0395901_0873229 | Ga0395901_0873229_582_848 | 84 |
| 270 | 3300041460 | Ga0451802_1805873 | Ga0451802_1805873_122_388 | 84 |
| 271 | 3300041509 | Ga0451843_1133688 | Ga0451843_1133688_234_494 | 84 |
| 272 | 3300042876 | Ga0451577_0008177 | Ga0451577_0008177_7981_8250 | 84 |
| 273 | 3300044673 | Ga0453683_0005225 | Ga0453683_0005225_6539_6805 | 84 |
| 274 | 3300044683 | Ga0466965_0060420 | Ga0466965_0060420_159_425 | 84 |
| 275 | 3300044684 | Ga0466966_0256125 | Ga0466966_0256125_527_793 | 84 |
| 276 | 3300044684 | Ga0466966_0316860 | Ga0466966_0316860_62_328 | 84 |
| 277 | 3300044712 | Ga0453684_1054740 | Ga0453684_1054740_331_600 | 84 |
| 278 | 3300044719 | Ga0466971_0615827 | Ga0466971_0615827_223_489 | 84 |
| 279 | 3300044842 | Ga0466957_0142263 | Ga0466957_0142263_1055_1321 | 84 |
| 280 | 3300044842 | Ga0466957_0406995 | Ga0466957_0406995_250_516 | 84 |
| 281 | 3300044901 | Ga0466960_0653318 | Ga0466960_0653318_178_444 | 84 |
| 282 | 3300045051 | Ga0451576_0000914 | Ga0451576_0000914_12789_13058 | 84 |
| 283 | 3300045051 | Ga0451576_0023020 | Ga0451576_0023020_5709_5975 | 84 |
| 284 | 3300046471 | Ga0495650_0095921 | Ga0495650_0095921_467_724 | 84 |
| 285 | 3300046475 | Ga0495639_0013949 | Ga0495639_0013949_3044_3301 | 84 |
| 286 | 3300046506 | Ga0495583_0000444 | Ga0495583_0000444_17431_17688 | 84 |
| 287 | 3300046507 | Ga0495606_0002487 | Ga0495606_0002487_2923_3180 | 84 |
| 288 | 3300046507 | Ga0495606_0441275 | Ga0495606_0441275_26_283 | 84 |
| 289 | 3300046511 | Ga0495608_0272110 | Ga0495608_0272110_424_681 | 84 |
| 290 | 3300046529 | Ga0495652_0702413 | Ga0495652_0702413_183_440 | 84 |
| 291 | 3300046539 | Ga0495621_0129890 | Ga0495621_0129890_338_604 | 84 |
| 292 | 3300046539 | Ga0495621_0298990 | Ga0495621_0298990_242_508 | 84 |
| 293 | 3300046616 | Ga0495668_0048989 | Ga0495668_0048989_369_626 | 84 |
| 294 | 3300046660 | Ga0495625_0126142 | Ga0495625_0126142_1090_1347 | 84 |
| 295 | 3300046684 | Ga0495669_0070763 | Ga0495669_0070763_480_737 | 84 |
| 296 | 3300046692 | Ga0495671_0255894 | Ga0495671_0255894_445_702 | 84 |
| 297 | 3300046694 | Ga0495649_0000298 | Ga0495649_0000298_25701_25958 | 84 |
| 298 | 3300046794 | Ga0495589_0023031 | Ga0495589_0023031_107_364 | 84 |
| 299 | 3300046810 | Ga0495660_0016673 | Ga0495660_0016673_3874_4134 | 84 |
| 300 | 3300047323 | Ga0495683_0110040 | Ga0495683_0110040_413_670 | 84 |
| 301 | 3300047472 | Ga0495686_0011222 | Ga0495686_0011222_2014_2271 | 84 |
| 302 | 3300048090 | Ga0495615_0174500 | Ga0495615_0174500_205_471 | 84 |
| 303 | 3300048903 | Ga0496100_0454932 | Ga0496100_0454932_319_576 | 84 |
| 304 | 3300048907 | Ga0496104_0605612 | Ga0496104_0605612_483_740 | 84 |
| 305 | 3300048909 | Ga0496106_0661220 | Ga0496106_0661220_376_633 | 84 |
| 306 | 3300048909 | Ga0496106_1177645 | Ga0496106_1177645_245_502 | 84 |
| 307 | 3300048924 | Ga0496121_0009710 | Ga0496121_0009710_2186_2446 | 84 |
| 308 | 3300048927 | Ga0496124_0000458 | Ga0496124_0000458_9131_9391 | 84 |
| 309 | 3300048928 | Ga0496125_0514567 | Ga0496125_0514567_153_413 | 84 |
| 310 | 3300049527 | Ga0501311_081458 | Ga0501311_081458_121_384 | 84 |
| 311 | 3300049574 | Ga0501038_0821070 | Ga0501038_0821070_101_367 | 84 |
| 312 | 3300049679 | Ga0501249_142411 | Ga0501249_142411_107_373 | 84 |
| 313 | 3300049758 | Ga0501241_086545 | Ga0501241_086545_260_526 | 84 |
| 314 | 3300049760 | Ga0501263_009077 | Ga0501263_009077_551_817 | 84 |
| 315 | 3300049772 | Ga0501275_082232 | Ga0501275_082232_181_447 | 84 |
| 316 | 3300050490 | nmdc:mga03n38_398155_c1 | nmdc:mga03n38_398155_c1_464_730 | 84 |
| 317 | 3300050493 | nmdc:mga0k408_196323_c1 | nmdc:mga0k408_196323_c1_338_604 | 84 |
| 318 | 3300050494 | nmdc:mga06z11_645661_c1 | nmdc:mga06z11_645661_c1_289_555 | 84 |
| 319 | 3300050496 | nmdc:mga07m45_227298_c1 | nmdc:mga07m45_227298_c1_398_655 | 84 |
| 320 | 3300050508 | nmdc:mga09592_151745_c1 | nmdc:mga09592_151745_c1_353_613 | 84 |
| 321 | 3300050508 | nmdc:mga09592_3332_c1 | nmdc:mga09592_3332_c1_480_740 | 84 |
| 322 | 3300050509 | nmdc:mga0qj67_266991_c1 | nmdc:mga0qj67_266991_c1_549_839 | 84 |
| 323 | 3300050509 | nmdc:mga0qj67_35975_c1 | nmdc:mga0qj67_35975_c1_2235_2495 | 84 |
| 324 | 3300053080 | Ga0500635_0000003 | Ga0500635_0000003_125488_125745 | 84 |
| 325 | 3300053093 | Ga0500651_0625055 | Ga0500651_0625055_72_329 | 84 |
| 326 | 3300053122 | Ga0500608_037775 | Ga0500608_037775_1404_1658 | 84 |
| 327 | 3300053136 | Ga0500559_0070831 | Ga0500559_0070831_370_627 | 84 |
| 328 | 3300053138 | Ga0500564_111504 | Ga0500564_111504_788_1045 | 84 |
| 329 | 3300053138 | Ga0500564_244383 | Ga0500564_244383_307_564 | 84 |
| 330 | 3300053148 | Ga0500590_084162 | Ga0500590_084162_654_908 | 84 |
| 331 | 3300053177 | Ga0500636_0012032 | Ga0500636_0012032_4385_4642 | 84 |
| 332 | 3300055283 | Ga0500661_038307 | Ga0500661_038307_431_688 | 84 |
| 333 | 3300003323 | rootH1_10299180 | rootH1_102991802 | 85 |
| 334 | 3300005288 | Ga0065714_10092872 | Ga0065714_100928723 | 85 |
| 335 | 3300005289 | Ga0065704_10101871 | Ga0065704_101018713 | 85 |
| 336 | 3300005327 | Ga0070658_11241450 | Ga0070658_112414502 | 85 |
| 337 | 3300005328 | Ga0070676_10016974 | Ga0070676_100169744 | 85 |
| 338 | 3300005328 | Ga0070676_10049433 | Ga0070676_100494334 | 85 |
| 339 | 3300005331 | Ga0070670_100012213 | Ga0070670_1000122134 | 85 |
| 340 | 3300005331 | Ga0070670_100301079 | Ga0070670_1003010793 | 85 |
| 341 | 3300005333 | Ga0070677_10003281 | Ga0070677_100032814 | 85 |
| 342 | 3300005333 | Ga0070677_10047184 | Ga0070677_100471841 | 85 |
| 343 | 3300005334 | Ga0068869_100610853 | Ga0068869_1006108532 | 85 |
| 344 | 3300005335 | Ga0070666_10190296 | Ga0070666_101902962 | 85 |
| 345 | 3300005338 | Ga0068868_100830482 | Ga0068868_1008304822 | 85 |
| 346 | 3300005343 | Ga0070687_100935021 | Ga0070687_1009350211 | 85 |
| 347 | 3300005353 | Ga0070669_100002753 | Ga0070669_10000275311 | 85 |
| 348 | 3300005354 | Ga0070675_100000137 | Ga0070675_1000001371 | 85 |
| 349 | 3300005354 | Ga0070675_100011301 | Ga0070675_1000113012 | 85 |
| 350 | 3300005355 | Ga0070671_100006504 | Ga0070671_1000065042 | 85 |
| 351 | 3300005355 | Ga0070671_100021060 | Ga0070671_1000210605 | 85 |
| 352 | 3300005355 | Ga0070671_101918997 | Ga0070671_1019189971 | 85 |
| 353 | 3300005356 | Ga0070674_100055843 | Ga0070674_1000558434 | 85 |
| 354 | 3300005356 | Ga0070674_100124598 | Ga0070674_1001245983 | 85 |
| 355 | 3300005364 | Ga0070673_100011122 | Ga0070673_1000111222 | 85 |
| 356 | 3300005364 | Ga0070673_101779635 | Ga0070673_1017796351 | 85 |
| 357 | 3300005365 | Ga0070688_100185921 | Ga0070688_1001859212 | 85 |
| 358 | 3300005367 | Ga0070667_100045834 | Ga0070667_1000458343 | 85 |
| 359 | 3300005367 | Ga0070667_101217262 | Ga0070667_1012172622 | 85 |
| 360 | 3300005445 | Ga0070708_100602428 | Ga0070708_1006024282 | 85 |
| 361 | 3300005456 | Ga0070678_100085936 | Ga0070678_1000859364 | 85 |
| 362 | 3300005456 | Ga0070678_100129530 | Ga0070678_1001295302 | 85 |
| 363 | 3300005456 | Ga0070678_100136476 | Ga0070678_1001364763 | 85 |
| 364 | 3300005457 | Ga0070662_101533417 | Ga0070662_1015334171 | 85 |
| 365 | 3300005459 | Ga0068867_100005126 | Ga0068867_1000051266 | 85 |
| 366 | 3300005459 | Ga0068867_100015020 | Ga0068867_1000150205 | 85 |
| 367 | 3300005459 | Ga0068867_100134651 | Ga0068867_1001346513 | 85 |
| 368 | 3300005466 | Ga0070685_10483596 | Ga0070685_104835962 | 85 |
| 369 | 3300005539 | Ga0068853_101486943 | Ga0068853_1014869432 | 85 |
| 370 | 3300005543 | Ga0070672_100000520 | Ga0070672_10000052011 | 85 |
| 371 | 3300005548 | Ga0070665_100846338 | Ga0070665_1008463382 | 85 |
| 372 | 3300005548 | Ga0070665_101994326 | Ga0070665_1019943262 | 85 |
| 373 | 3300005564 | Ga0070664_100160216 | Ga0070664_1001602163 | 85 |
| 374 | 3300005564 | Ga0070664_102254076 | Ga0070664_1022540761 | 85 |
| 375 | 3300005616 | Ga0068852_101828204 | Ga0068852_1018282042 | 85 |
| 376 | 3300005616 | Ga0068852_102668876 | Ga0068852_1026688762 | 85 |
| 377 | 3300005618 | Ga0068864_100050509 | Ga0068864_1000505092 | 85 |
| 378 | 3300005834 | Ga0068851_10019074 | Ga0068851_100190742 | 85 |
| 379 | 3300005840 | Ga0068870_10165055 | Ga0068870_101650552 | 85 |
| 380 | 3300005841 | Ga0068863_100825863 | Ga0068863_1008258632 | 85 |
| 381 | 3300005841 | Ga0068863_101866102 | Ga0068863_1018661022 | 85 |
| 382 | 3300006237 | Ga0097621_100060641 | Ga0097621_1000606412 | 85 |
| 383 | 3300006237 | Ga0097621_101311968 | Ga0097621_1013119682 | 85 |
| 384 | 3300006237 | Ga0097621_102379452 | Ga0097621_1023794522 | 85 |
| 385 | 3300006358 | Ga0068871_100030494 | Ga0068871_1000304943 | 85 |
| 386 | 3300006881 | Ga0068865_100396283 | Ga0068865_1003962832 | 85 |
| 387 | 3300006881 | Ga0068865_100577957 | Ga0068865_1005779571 | 85 |
| 388 | 3300006946 | Ga0079104_1000008 | Ga0079104_1000008169 | 85 |
| 389 | 3300009092 | Ga0105250_10000043 | Ga0105250_1000004347 | 85 |
| 390 | 3300009093 | Ga0105240_10001650 | Ga0105240_1000165027 | 85 |
| 391 | 3300009094 | Ga0111539_11262287 | Ga0111539_112622871 | 85 |
| 392 | 3300009098 | Ga0105245_11767656 | Ga0105245_117676562 | 85 |
| 393 | 3300009147 | Ga0114129_10086267 | Ga0114129_100862673 | 85 |
| 394 | 3300009148 | Ga0105243_10002163 | Ga0105243_1000216315 | 85 |
| 395 | 3300009545 | Ga0105237_10001445 | Ga0105237_1000144518 | 85 |
| 396 | 3300009551 | Ga0105238_10006278 | Ga0105238_100062783 | 85 |
| 397 | 3300009553 | Ga0105249_12407406 | Ga0105249_124074062 | 85 |
| 398 | 3300010375 | Ga0105239_10002359 | Ga0105239_1000235922 | 85 |
| 399 | 3300013296 | Ga0157374_10276489 | Ga0157374_102764892 | 85 |
| 400 | 3300013306 | Ga0163162_10706031 | Ga0163162_107060312 | 85 |
| 401 | 3300013308 | Ga0157375_10144659 | Ga0157375_101446593 | 85 |
| 402 | 3300014325 | Ga0163163_11217692 | Ga0163163_112176921 | 85 |
| 403 | 3300014326 | Ga0157380_10897102 | Ga0157380_108971022 | 85 |
| 404 | 3300014326 | Ga0157380_11043677 | Ga0157380_110436771 | 85 |
| 405 | 3300014497 | Ga0182008_10669119 | Ga0182008_106691191 | 85 |
| 406 | 3300014745 | Ga0157377_10394633 | Ga0157377_103946332 | 85 |
| 407 | 3300014968 | Ga0157379_11684972 | Ga0157379_116849721 | 85 |
| 408 | 3300014969 | Ga0157376_12225864 | Ga0157376_122258642 | 85 |
| 409 | 3300017792 | Ga0163161_10079688 | Ga0163161_100796882 | 85 |
| 410 | 3300025315 | Ga0207697_10015928 | Ga0207697_100159283 | 85 |
| 411 | 3300025321 | Ga0207656_10014495 | Ga0207656_100144954 | 85 |
| 412 | 3300025711 | Ga0207696_1000424 | Ga0207696_100042414 | 85 |
| 413 | 3300025893 | Ga0207682_10002496 | Ga0207682_100024966 | 85 |
| 414 | 3300025893 | Ga0207682_10034562 | Ga0207682_100345622 | 85 |
| 415 | 3300025899 | Ga0207642_10379205 | Ga0207642_103792052 | 85 |
| 416 | 3300025899 | Ga0207642_10976435 | Ga0207642_109764352 | 85 |
| 417 | 3300025901 | Ga0207688_10789625 | Ga0207688_107896251 | 85 |
| 418 | 3300025903 | Ga0207680_10255778 | Ga0207680_102557782 | 85 |
| 419 | 3300025907 | Ga0207645_10016384 | Ga0207645_100163844 | 85 |
| 420 | 3300025907 | Ga0207645_10119290 | Ga0207645_101192902 | 85 |
| 421 | 3300025908 | Ga0207643_10021956 | Ga0207643_100219564 | 85 |
| 422 | 3300025909 | Ga0207705_10086725 | Ga0207705_100867253 | 85 |
| 423 | 3300025913 | Ga0207695_10038286 | Ga0207695_100382864 | 85 |
| 424 | 3300025914 | Ga0207671_10004904 | Ga0207671_100049044 | 85 |
| 425 | 3300025923 | Ga0207681_10030499 | Ga0207681_100304993 | 85 |
| 426 | 3300025923 | Ga0207681_11516900 | Ga0207681_115169002 | 85 |
| 427 | 3300025924 | Ga0207694_10010745 | Ga0207694_100107454 | 85 |
| 428 | 3300025925 | Ga0207650_10000265 | Ga0207650_1000026524 | 85 |
| 429 | 3300025925 | Ga0207650_10580291 | Ga0207650_105802912 | 85 |
| 430 | 3300025926 | Ga0207659_10000148 | Ga0207659_1000014813 | 85 |
| 431 | 3300025926 | Ga0207659_10433916 | Ga0207659_104339162 | 85 |
| 432 | 3300025927 | Ga0207687_10328433 | Ga0207687_103284333 | 85 |
| 433 | 3300025929 | Ga0207664_10580353 | Ga0207664_105803532 | 85 |
| 434 | 3300025931 | Ga0207644_10209224 | Ga0207644_102092243 | 85 |
| 435 | 3300025931 | Ga0207644_11813150 | Ga0207644_118131502 | 85 |
| 436 | 3300025933 | Ga0207706_10846812 | Ga0207706_108468122 | 85 |
| 437 | 3300025935 | Ga0207709_10000070 | Ga0207709_100000705 | 85 |
| 438 | 3300025937 | Ga0207669_10080300 | Ga0207669_100803002 | 85 |
| 439 | 3300025937 | Ga0207669_10899010 | Ga0207669_108990102 | 85 |
| 440 | 3300025938 | Ga0207704_10037547 | Ga0207704_100375474 | 85 |
| 441 | 3300025940 | Ga0207691_10012845 | Ga0207691_100128458 | 85 |
| 442 | 3300025942 | Ga0207689_10484882 | Ga0207689_104848822 | 85 |
| 443 | 3300025945 | Ga0207679_10652019 | Ga0207679_106520192 | 85 |
| 444 | 3300025945 | Ga0207679_11063023 | Ga0207679_110630232 | 85 |
| 445 | 3300025960 | Ga0207651_10006277 | Ga0207651_100062772 | 85 |
| 446 | 3300025960 | Ga0207651_11404461 | Ga0207651_114044612 | 85 |
| 447 | 3300025972 | Ga0207668_10198425 | Ga0207668_101984253 | 85 |
| 448 | 3300025981 | Ga0207640_10115473 | Ga0207640_101154734 | 85 |
| 449 | 3300025981 | Ga0207640_10558461 | Ga0207640_105584612 | 85 |
| 450 | 3300025986 | Ga0207658_10064120 | Ga0207658_100641203 | 85 |
| 451 | 3300025986 | Ga0207658_11007677 | Ga0207658_110076772 | 85 |
| 452 | 3300026023 | Ga0207677_10008981 | Ga0207677_100089816 | 85 |
| 453 | 3300026041 | Ga0207639_11132730 | Ga0207639_111327302 | 85 |
| 454 | 3300026067 | Ga0207678_10649317 | Ga0207678_106493172 | 85 |
| 455 | 3300026067 | Ga0207678_11450588 | Ga0207678_114505881 | 85 |
| 456 | 3300026088 | Ga0207641_10837485 | Ga0207641_108374852 | 85 |
| 457 | 3300026088 | Ga0207641_11489245 | Ga0207641_114892452 | 85 |
| 458 | 3300026089 | Ga0207648_10034719 | Ga0207648_100347195 | 85 |
| 459 | 3300026089 | Ga0207648_10312313 | Ga0207648_103123132 | 85 |
| 460 | 3300026095 | Ga0207676_10005934 | Ga0207676_100059346 | 85 |
| 461 | 3300026118 | Ga0207675_100879392 | Ga0207675_1008793921 | 85 |
| 462 | 3300026121 | Ga0207683_10013304 | Ga0207683_100133042 | 85 |
| 463 | 3300026121 | Ga0207683_10035679 | Ga0207683_100356793 | 85 |
| 464 | 3300026121 | Ga0207683_10389721 | Ga0207683_103897212 | 85 |
| 465 | 3300026142 | Ga0207698_11538011 | Ga0207698_115380112 | 85 |
| 466 | 3300027111 | Ga0209281_1000029 | Ga0209281_1000029228 | 85 |
| 467 | 3300027614 | Ga0209970_1000168 | Ga0209970_10001685 | 85 |
| 468 | 3300027665 | Ga0209983_1037986 | Ga0209983_10379862 | 85 |
| 469 | 3300027682 | Ga0209971_1128299 | Ga0209971_11282992 | 85 |
| 470 | 3300027717 | Ga0209998_10132945 | Ga0209998_101329452 | 85 |
| 471 | 3300027876 | Ga0209974_10078728 | Ga0209974_100787282 | 85 |
| 472 | 3300028379 | Ga0268266_10221686 | Ga0268266_102216862 | 85 |
| 473 | 3300028794 | Ga0307515_10103443 | Ga0307515_101034434 | 85 |
| 474 | 3300028794 | Ga0307515_10218928 | Ga0307515_102189283 | 85 |
| 475 | 3300031251 | Ga0265327_10067541 | Ga0265327_100675412 | 85 |
| 476 | 3300031456 | Ga0307513_10058646 | Ga0307513_100586464 | 85 |
| 477 | 3300031456 | Ga0307513_10159272 | Ga0307513_101592722 | 85 |
| 478 | 3300031548 | Ga0307408_100034737 | Ga0307408_1000347372 | 85 |
| 479 | 3300031731 | Ga0307405_10045504 | Ga0307405_100455044 | 85 |
| 480 | 3300031731 | Ga0307405_10191714 | Ga0307405_101917142 | 85 |
| 481 | 3300031731 | Ga0307405_10950896 | Ga0307405_109508962 | 85 |
| 482 | 3300031824 | Ga0307413_10566153 | Ga0307413_105661532 | 85 |
| 483 | 3300031852 | Ga0307410_10030505 | Ga0307410_100305053 | 85 |
| 484 | 3300031852 | Ga0307410_10397686 | Ga0307410_103976862 | 85 |
| 485 | 3300031901 | Ga0307406_10016088 | Ga0307406_100160885 | 85 |
| 486 | 3300031901 | Ga0307406_10867813 | Ga0307406_108678132 | 85 |
| 487 | 3300031901 | Ga0307406_11677345 | Ga0307406_116773452 | 85 |
| 488 | 3300031903 | Ga0307407_11664232 | Ga0307407_116642321 | 85 |
| 489 | 3300031911 | Ga0307412_10222918 | Ga0307412_102229182 | 85 |
| 490 | 3300031911 | Ga0307412_10367228 | Ga0307412_103672282 | 85 |
| 491 | 3300031995 | Ga0307409_100402085 | Ga0307409_1004020852 | 85 |
| 492 | 3300031995 | Ga0307409_100813565 | Ga0307409_1008135652 | 85 |
| 493 | 3300032004 | Ga0307414_10485653 | Ga0307414_104856532 | 85 |
| 494 | 3300032004 | Ga0307414_10517575 | Ga0307414_105175752 | 85 |
| 495 | 3300032005 | Ga0307411_10000973 | Ga0307411_100009736 | 85 |
| 496 | 3300032005 | Ga0307411_10130857 | Ga0307411_101308573 | 85 |
| 497 | 3300032005 | Ga0307411_10380466 | Ga0307411_103804662 | 85 |
| 498 | 3300032005 | Ga0307411_11012110 | Ga0307411_110121101 | 85 |
| 499 | 3300032005 | Ga0307411_11118356 | Ga0307411_111183562 | 85 |
| 500 | 3300032126 | Ga0307415_100021431 | Ga0307415_1000214312 | 85 |
| 501 | 3300032126 | Ga0307415_100778427 | Ga0307415_1007784272 | 85 |
| 502 | 3300033179 | Ga0307507_10474021 | Ga0307507_104740212 | 85 |
| 503 | 3300035111 | Ga0373923_0375765 | Ga0373923_0375765_150_413 | 85 |
| 504 | 3300035116 | Ga0373945_0127353 | Ga0373945_0127353_541_804 | 85 |
| 505 | 3300035171 | Ga0373946_0613344 | Ga0373946_0613344_24_287 | 85 |
| 506 | 3300037068 | Ga0373925_0436029 | Ga0373925_0436029_414_677 | 85 |
| 507 | 3300041407 | Ga0439447_144417 | Ga0439447_144417_212_481 | 85 |
| 508 | 3300041408 | Ga0439453_0042819 | Ga0439453_0042819_347_616 | 85 |
| 509 | 3300041410 | Ga0439461_0100632 | Ga0439461_0100632_281_544 | 85 |
| 510 | 3300041413 | Ga0439465_0259599 | Ga0439465_0259599_191_460 | 85 |
| 511 | 3300041443 | Ga0451789_0978585 | Ga0451789_0978585_454_717 | 85 |
| 512 | 3300041453 | Ga0451797_1490071 | Ga0451797_1490071_55_315 | 85 |
| 513 | 3300041458 | Ga0451798_0197861 | Ga0451798_0197861_76_339 | 85 |
| 514 | 3300041486 | Ga0451807_0557572 | Ga0451807_0557572_280_543 | 85 |
| 515 | 3300041492 | Ga0451835_0830645 | Ga0451835_0830645_683_946 | 85 |
| 516 | 3300041507 | Ga0451851_0652104 | Ga0451851_0652104_80_343 | 85 |
| 517 | 3300041507 | Ga0451851_0727205 | Ga0451851_0727205_112_378 | 85 |
| 518 | 3300041512 | Ga0451853_2527883 | Ga0451853_2527883_117_377 | 85 |
| 519 | 3300041997 | Ga0439431_0054675 | Ga0439431_0054675_722_985 | 85 |
| 520 | 3300042003 | Ga0439443_114022 | Ga0439443_114022_158_427 | 85 |
| 521 | 3300042006 | Ga0439432_089814 | Ga0439432_089814_169_438 | 85 |
| 522 | 3300042116 | Ga0450912_010762 | Ga0450912_010762_41_310 | 85 |
| 523 | 3300042123 | Ga0450921_014108 | Ga0450921_014108_66_335 | 85 |
| 524 | 3300042128 | Ga0450897_002399 | Ga0450897_002399_612_881 | 85 |
| 525 | 3300042134 | Ga0450898_005652 | Ga0450898_005652_505_774 | 85 |
| 526 | 3300042138 | Ga0450903_028373 | Ga0450903_028373_354_623 | 85 |
| 527 | 3300042139 | Ga0450904_032532 | Ga0450904_032532_91_360 | 85 |
| 528 | 3300042147 | Ga0450910_031874 | Ga0450910_031874_281_550 | 85 |
| 529 | 3300042156 | Ga0439446_0007973 | Ga0439446_0007973_1478_1747 | 85 |
| 530 | 3300042157 | Ga0439458_0030099 | Ga0439458_0030099_623_892 | 85 |
| 531 | 3300042185 | Ga0450909_011874 | Ga0450909_011874_534_803 | 85 |
| 532 | 3300042435 | Ga0439434_0036474 | Ga0439434_0036474_474_737 | 85 |
| 533 | 3300042435 | Ga0439434_0089299 | Ga0439434_0089299_548_817 | 85 |
| 534 | 3300042532 | Ga0450893_0041981 | Ga0450893_0041981_216_485 | 85 |
| 535 | 3300044712 | Ga0453684_1842782 | Ga0453684_1842782_318_578 | 85 |
| 536 | 3300045051 | Ga0451576_0001036 | Ga0451576_0001036_218_478 | 85 |
| 537 | 3300045051 | Ga0451576_0613620 | Ga0451576_0613620_385_651 | 85 |
| 538 | 3300046461 | Ga0495641_0370480 | Ga0495641_0370480_10_273 | 85 |
| 539 | 3300046501 | Ga0495607_0000236 | Ga0495607_0000236_40414_40674 | 85 |
| 540 | 3300046516 | Ga0495628_0710962 | Ga0495628_0710962_397_660 | 85 |
| 541 | 3300046683 | Ga0495658_0804802 | Ga0495658_0804802_267_530 | 85 |
| 542 | 3300047472 | Ga0495686_0513514 | Ga0495686_0513514_222_485 | 85 |
| 543 | 3300048905 | Ga0496102_1265550 | Ga0496102_1265550_355_618 | 85 |
| 544 | 3300048911 | Ga0496108_0402155 | Ga0496108_0402155_723_986 | 85 |
| 545 | 3300048911 | Ga0496108_1502699 | Ga0496108_1502699_257_520 | 85 |
| 546 | 3300048912 | Ga0496109_0170210 | Ga0496109_0170210_17_280 | 85 |
| 547 | 3300049128 | Ga0501308_075281 | Ga0501308_075281_215_490 | 85 |
| 548 | 3300049569 | Ga0501032_0453093 | Ga0501032_0453093_191_460 | 85 |
| 549 | 3300049570 | Ga0501033_0080077 | Ga0501033_0080077_1907_2176 | 85 |
| 550 | 3300049573 | Ga0501037_0327581 | Ga0501037_0327581_659_928 | 85 |
| 551 | 3300049579 | Ga0501043_0093019 | Ga0501043_0093019_40_309 | 85 |
| 552 | 3300049581 | Ga0501047_0412481 | Ga0501047_0412481_884_1153 | 85 |
| 553 | 3300049581 | Ga0501047_0724417 | Ga0501047_0724417_409_678 | 85 |
| 554 | 3300049582 | Ga0501048_1021299 | Ga0501048_1021299_47_310 | 85 |
| 555 | 3300049593 | Ga0501077_0298533 | Ga0501077_0298533_595_870 | 85 |
| 556 | 3300049742 | Ga0501080_0435465 | Ga0501080_0435465_772_1041 | 85 |
| 557 | 3300049822 | Ga0501035_0201546 | Ga0501035_0201546_425_694 | 85 |
| 558 | 3300049823 | Ga0501044_0289251 | Ga0501044_0289251_1057_1326 | 85 |
| 559 | 3300050507 | nmdc:mga05p37_261861_c1 | nmdc:mga05p37_261861_c1_1186_1449 | 85 |
| 560 | 3300050512 | nmdc:mga0n895_919912_c1 | nmdc:mga0n895_919912_c1_76_339 | 85 |
| 561 | 3300053086 | Ga0500578_0020316 | Ga0500578_0020316_3674_3937 | 85 |
| 562 | 3300053730 | Ga0500645_002236 | Ga0500645_002236_8233_8496 | 85 |
| 563 | 3300059424 | Ga0590075_037870 | Ga0590075_037870_898_1164 | 85 |
| 564 | 3300059424 | Ga0590075_135525 | Ga0590075_135525_334_603 | 85 |
| 565 | 3300002704 | JGI25155J39150_1000154 | JGI25155J39150_100015431 | 86 |
| 566 | 3300002705 | JGI25156J39149_1000067 | JGI25156J39149_100006776 | 86 |
| 567 | 3300002738 | JGI25154J39366_1000089 | JGI25154J39366_10000894 | 86 |
| 568 | 3300002741 | JGI25157J39369_1000084 | JGI25157J39369_100008476 | 86 |
| 569 | 3300002773 | JGI25152J39213_1048253 | JGI25152J39213_10482532 | 86 |
| 570 | 3300002774 | JGI25150J39212_1006313 | JGI25150J39212_10063134 | 86 |
| 571 | 3300002774 | JGI25150J39212_1036639 | JGI25150J39212_10366391 | 86 |
| 572 | 3300002987 | JGI25159J45721_1000314 | JGI25159J45721_100031423 | 86 |
| 573 | 3300002987 | JGI25159J45721_1017200 | JGI25159J45721_10172003 | 86 |
| 574 | 3300003187 | JGI25151J46595_10004306 | JGI25151J46595_100043065 | 86 |
| 575 | 3300003187 | JGI25151J46595_10013319 | JGI25151J46595_100133191 | 86 |
| 576 | 3300003187 | JGI25151J46595_10037114 | JGI25151J46595_100371142 | 86 |
| 577 | 3300003354 | JGI25160J50197_1000131 | JGI25160J50197_100013168 | 86 |
| 578 | 3300003354 | JGI25160J50197_1036872 | JGI25160J50197_10368722 | 86 |
| 579 | 3300003374 | JGI25161J50226_1000009 | JGI25161J50226_10000094 | 86 |
| 580 | 3300003771 | Ga0055526_1007332 | Ga0055526_10073327 | 86 |
| 581 | 3300003771 | Ga0055526_1042022 | Ga0055526_10420221 | 86 |
| 582 | 3300003773 | Ga0055537_1003449 | Ga0055537_10034491 | 86 |
| 583 | 3300003773 | Ga0055537_1017660 | Ga0055537_10176601 | 86 |
| 584 | 3300003775 | Ga0055524_1000047 | Ga0055524_1000047142 | 86 |
| 585 | 3300003781 | Ga0055536_1010008 | Ga0055536_10100084 | 86 |
| 586 | 3300003784 | Ga0055534_1024781 | Ga0055534_10247812 | 86 |
| 587 | 3300003790 | Ga0055528_1001275 | Ga0055528_100127515 | 86 |
| 588 | 3300003790 | Ga0055528_1020790 | Ga0055528_10207901 | 86 |
| 589 | 3300003791 | Ga0055530_10001499 | Ga0055530_1000149917 | 86 |
| 590 | 3300003791 | Ga0055530_10026106 | Ga0055530_100261062 | 86 |
| 591 | 3300003792 | Ga0055540_1000027 | Ga0055540_10000272 | 86 |
| 592 | 3300003794 | Ga0055531_10002146 | Ga0055531_1000214614 | 86 |
| 593 | 3300004625 | Ga0055543_1000122 | Ga0055543_100012227 | 86 |
| 594 | 3300005262 | Ga0065165_1019851 | Ga0065165_10198512 | 86 |
| 595 | 3300005262 | Ga0065165_1020045 | Ga0065165_10200454 | 86 |
| 596 | 3300005262 | Ga0065165_1104882 | Ga0065165_11048822 | 86 |
| 597 | 3300005327 | Ga0070658_10177994 | Ga0070658_101779943 | 86 |
| 598 | 3300005339 | Ga0070660_100056954 | Ga0070660_1000569545 | 86 |
| 599 | 3300005341 | Ga0070691_10131246 | Ga0070691_101312462 | 86 |
| 600 | 3300005355 | Ga0070671_101174924 | Ga0070671_1011749242 | 86 |
| 601 | 3300005445 | Ga0070708_101688532 | Ga0070708_1016885322 | 86 |
| 602 | 3300005468 | Ga0070707_100229616 | Ga0070707_1002296162 | 86 |
| 603 | 3300005530 | Ga0070679_100076511 | Ga0070679_1000765116 | 86 |
| 604 | 3300005539 | Ga0068853_100630848 | Ga0068853_1006308481 | 86 |
| 605 | 3300005539 | Ga0068853_100965636 | Ga0068853_1009656362 | 86 |
| 606 | 3300005563 | Ga0068855_100022188 | Ga0068855_1000221882 | 86 |
| 607 | 3300005563 | Ga0068855_100029769 | Ga0068855_1000297697 | 86 |
| 608 | 3300005834 | Ga0068851_11016655 | Ga0068851_110166552 | 86 |
| 609 | 3300005981 | Ga0081538_10061611 | Ga0081538_100616112 | 86 |
| 610 | 3300006038 | Ga0075365_10005107 | Ga0075365_100051073 | 86 |
| 611 | 3300006038 | Ga0075365_10142421 | Ga0075365_101424212 | 86 |
| 612 | 3300006038 | Ga0075365_10182253 | Ga0075365_101822532 | 86 |
| 613 | 3300006038 | Ga0075365_10970646 | Ga0075365_109706462 | 86 |
| 614 | 3300006042 | Ga0075368_10015246 | Ga0075368_100152465 | 86 |
| 615 | 3300006048 | Ga0075363_100015256 | Ga0075363_1000152562 | 86 |
| 616 | 3300006048 | Ga0075363_100088103 | Ga0075363_1000881032 | 86 |
| 617 | 3300006048 | Ga0075363_100407215 | Ga0075363_1004072152 | 86 |
| 618 | 3300006048 | Ga0075363_100696936 | Ga0075363_1006969362 | 86 |
| 619 | 3300006051 | Ga0075364_10049130 | Ga0075364_100491304 | 86 |
| 620 | 3300006177 | Ga0075362_10055281 | Ga0075362_100552813 | 86 |
| 621 | 3300006177 | Ga0075362_10120303 | Ga0075362_101203033 | 86 |
| 622 | 3300006178 | Ga0075367_10007807 | Ga0075367_100078074 | 86 |
| 623 | 3300006178 | Ga0075367_10737124 | Ga0075367_107371241 | 86 |
| 624 | 3300006195 | Ga0075366_10057805 | Ga0075366_100578052 | 86 |
| 625 | 3300006195 | Ga0075366_10105355 | Ga0075366_101053553 | 86 |
| 626 | 3300006881 | Ga0068865_101581802 | Ga0068865_1015818022 | 86 |
| 627 | 3300006948 | Ga0099826_10253071 | Ga0099826_102530712 | 86 |
| 628 | 3300009093 | Ga0105240_10026802 | Ga0105240_100268026 | 86 |
| 629 | 3300009093 | Ga0105240_10780051 | Ga0105240_107800512 | 86 |
| 630 | 3300009148 | Ga0105243_12416204 | Ga0105243_124162042 | 86 |
| 631 | 3300009551 | Ga0105238_10023931 | Ga0105238_100239319 | 86 |
| 632 | 3300009553 | Ga0105249_12154526 | Ga0105249_121545262 | 86 |
| 633 | 3300010375 | Ga0105239_10142228 | Ga0105239_101422283 | 86 |
| 634 | 3300012513 | Ga0157326_1003398 | Ga0157326_10033981 | 86 |
| 635 | 3300014969 | Ga0157376_10600104 | Ga0157376_106001041 | 86 |
| 636 | 3300015262 | Ga0182007_10031429 | Ga0182007_100314293 | 86 |
| 637 | 3300017792 | Ga0163161_12091703 | Ga0163161_120917032 | 86 |
| 638 | 3300025206 | Ga0209435_100008 | Ga0209435_100008130 | 86 |
| 639 | 3300025245 | Ga0207425_1002969 | Ga0207425_10029693 | 86 |
| 640 | 3300025245 | Ga0207425_1004534 | Ga0207425_10045342 | 86 |
| 641 | 3300025245 | Ga0207425_1040463 | Ga0207425_10404632 | 86 |
| 642 | 3300025246 | Ga0209646_1000029 | Ga0209646_1000029148 | 86 |
| 643 | 3300025250 | Ga0209026_1000016 | Ga0209026_1000016148 | 86 |
| 644 | 3300025256 | Ga0209759_1000016 | Ga0209759_1000016148 | 86 |
| 645 | 3300025258 | Ga0209129_1006958 | Ga0209129_10069583 | 86 |
| 646 | 3300025258 | Ga0209129_1059409 | Ga0209129_10594092 | 86 |
| 647 | 3300025263 | Ga0209565_1000061 | Ga0209565_1000061112 | 86 |
| 648 | 3300025263 | Ga0209565_1001227 | Ga0209565_100122712 | 86 |
| 649 | 3300025273 | Ga0209673_1000491 | Ga0209673_10004916 | 86 |
| 650 | 3300025284 | Ga0209130_1000014 | Ga0209130_1000014223 | 86 |
| 651 | 3300025284 | Ga0209130_1000862 | Ga0209130_10008621 | 86 |
| 652 | 3300025291 | Ga0209675_1000105 | Ga0209675_100010582 | 86 |
| 653 | 3300025291 | Ga0209675_1000703 | Ga0209675_100070317 | 86 |
| 654 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013576 | 86 |
| 655 | 3300025292 | Ga0209676_1000153 | Ga0209676_1000153146 | 86 |
| 656 | 3300025292 | Ga0209676_1006585 | Ga0209676_10065855 | 86 |
| 657 | 3300025294 | Ga0209025_1010455 | Ga0209025_10104553 | 86 |
| 658 | 3300025294 | Ga0209025_1013015 | Ga0209025_10130156 | 86 |
| 659 | 3300025294 | Ga0209025_1020829 | Ga0209025_10208294 | 86 |
| 660 | 3300025294 | Ga0209025_1034780 | Ga0209025_10347803 | 86 |
| 661 | 3300025294 | Ga0209025_1091850 | Ga0209025_10918501 | 86 |
| 662 | 3300025295 | Ga0209564_1000181 | Ga0209564_1000181120 | 86 |
| 663 | 3300025295 | Ga0209564_1000247 | Ga0209564_100024721 | 86 |
| 664 | 3300025297 | Ga0209758_1031085 | Ga0209758_10310854 | 86 |
| 665 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008576 | 86 |
| 666 | 3300025298 | Ga0209050_1002596 | Ga0209050_10025966 | 86 |
| 667 | 3300025298 | Ga0209050_1018285 | Ga0209050_10182853 | 86 |
| 668 | 3300025299 | Ga0209256_1000039 | Ga0209256_1000039175 | 86 |
| 669 | 3300025299 | Ga0209256_1028537 | Ga0209256_10285372 | 86 |
| 670 | 3300025299 | Ga0209256_1049133 | Ga0209256_10491332 | 86 |
| 671 | 3300025302 | Ga0207426_1000242 | Ga0207426_1000242110 | 86 |
| 672 | 3300025302 | Ga0207426_1001759 | Ga0207426_10017595 | 86 |
| 673 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005576 | 86 |
| 674 | 3300025303 | Ga0209051_1071683 | Ga0209051_10716832 | 86 |
| 675 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031166 | 86 |
| 676 | 3300025304 | Ga0209257_1030164 | Ga0209257_10301642 | 86 |
| 677 | 3300025909 | Ga0207705_10051128 | Ga0207705_100511284 | 86 |
| 678 | 3300025909 | Ga0207705_10153312 | Ga0207705_101533123 | 86 |
| 679 | 3300025909 | Ga0207705_10337951 | Ga0207705_103379512 | 86 |
| 680 | 3300025913 | Ga0207695_10105566 | Ga0207695_101055662 | 86 |
| 681 | 3300025917 | Ga0207660_10358589 | Ga0207660_103585892 | 86 |
| 682 | 3300025917 | Ga0207660_10661646 | Ga0207660_106616461 | 86 |
| 683 | 3300025918 | Ga0207662_10425178 | Ga0207662_104251781 | 86 |
| 684 | 3300025919 | Ga0207657_10014524 | Ga0207657_100145246 | 86 |
| 685 | 3300025921 | Ga0207652_10098275 | Ga0207652_100982752 | 86 |
| 686 | 3300025921 | Ga0207652_10414513 | Ga0207652_104145132 | 86 |
| 687 | 3300025922 | Ga0207646_10318474 | Ga0207646_103184742 | 86 |
| 688 | 3300025924 | Ga0207694_10703404 | Ga0207694_107034042 | 86 |
| 689 | 3300025949 | Ga0207667_10106740 | Ga0207667_101067402 | 86 |
| 690 | 3300025949 | Ga0207667_10193771 | Ga0207667_101937715 | 86 |
| 691 | 3300026041 | Ga0207639_10377379 | Ga0207639_103773792 | 86 |
| 692 | 3300026041 | Ga0207639_10500676 | Ga0207639_105006761 | 86 |
| 693 | 3300026142 | Ga0207698_11981318 | Ga0207698_119813182 | 86 |
| 694 | 3300027614 | Ga0209970_1040709 | Ga0209970_10407092 | 86 |
| 695 | 3300027682 | Ga0209971_1015094 | Ga0209971_10150943 | 86 |
| 696 | 3300027866 | Ga0209813_10120310 | Ga0209813_101203101 | 86 |
| 697 | 3300031235 | Ga0265330_10000106 | Ga0265330_100001062 | 86 |
| 698 | 3300031238 | Ga0265332_10000008 | Ga0265332_10000008278 | 86 |
| 699 | 3300031241 | Ga0265325_10049744 | Ga0265325_100497444 | 86 |
| 700 | 3300031247 | Ga0265340_10071583 | Ga0265340_100715832 | 86 |
| 701 | 3300031456 | Ga0307513_10000025 | Ga0307513_10000025138 | 86 |
| 702 | 3300031456 | Ga0307513_10000363 | Ga0307513_100003634 | 86 |
| 703 | 3300031456 | Ga0307513_10570766 | Ga0307513_105707662 | 86 |
| 704 | 3300031456 | Ga0307513_10951852 | Ga0307513_109518521 | 86 |
| 705 | 3300031548 | Ga0307408_100024015 | Ga0307408_1000240152 | 86 |
| 706 | 3300031548 | Ga0307408_100355748 | Ga0307408_1003557482 | 86 |
| 707 | 3300031711 | Ga0265314_10000292 | Ga0265314_1000029226 | 86 |
| 708 | 3300031712 | Ga0265342_10518809 | Ga0265342_105188092 | 86 |
| 709 | 3300031730 | Ga0307516_10067770 | Ga0307516_100677706 | 86 |
| 710 | 3300031824 | Ga0307413_12188696 | Ga0307413_121886962 | 86 |
| 711 | 3300031901 | Ga0307406_10058110 | Ga0307406_100581102 | 86 |
| 712 | 3300031901 | Ga0307406_11922330 | Ga0307406_119223302 | 86 |
| 713 | 3300031911 | Ga0307412_11758834 | Ga0307412_117588341 | 86 |
| 714 | 3300032005 | Ga0307411_12190306 | Ga0307411_121903062 | 86 |
| 715 | 3300037312 | Ga0395899_0038526 | Ga0395899_0038526_2453_2716 | 86 |
| 716 | 3300037312 | Ga0395899_0039915 | Ga0395899_0039915_515_778 | 86 |
| 717 | 3300037418 | Ga0395900_0007255 | Ga0395900_0007255_2692_2955 | 86 |
| 718 | 3300037418 | Ga0395900_0023006 | Ga0395900_0023006_3959_4222 | 86 |
| 719 | 3300037418 | Ga0395900_0137212 | Ga0395900_0137212_2060_2323 | 86 |
| 720 | 3300037418 | Ga0395900_0702925 | Ga0395900_0702925_84_347 | 86 |
| 721 | 3300037418 | Ga0395900_1601164 | Ga0395900_1601164_162_431 | 86 |
| 722 | 3300037466 | Ga0395898_0002154 | Ga0395898_0002154_23226_23489 | 86 |
| 723 | 3300037466 | Ga0395898_0052022 | Ga0395898_0052022_2387_2650 | 86 |
| 724 | 3300037471 | Ga0395905_0000047 | Ga0395905_0000047_26370_26633 | 86 |
| 725 | 3300037471 | Ga0395905_0005624 | Ga0395905_0005624_9889_10152 | 86 |
| 726 | 3300037471 | Ga0395905_0013597 | Ga0395905_0013597_3694_3957 | 86 |
| 727 | 3300037471 | Ga0395905_0033794 | Ga0395905_0033794_3655_3918 | 86 |
| 728 | 3300037471 | Ga0395905_0203737 | Ga0395905_0203737_391_654 | 86 |
| 729 | 3300037471 | Ga0395905_0251604 | Ga0395905_0251604_825_1088 | 86 |
| 730 | 3300037471 | Ga0395905_0253105 | Ga0395905_0253105_809_1072 | 86 |
| 731 | 3300037471 | Ga0395905_0262538 | Ga0395905_0262538_707_973 | 86 |
| 732 | 3300037471 | Ga0395905_0462898 | Ga0395905_0462898_702_968 | 86 |
| 733 | 3300037471 | Ga0395905_0694774 | Ga0395905_0694774_59_322 | 86 |
| 734 | 3300038443 | Ga0395901_0042905 | Ga0395901_0042905_2042_2305 | 86 |
| 735 | 3300038443 | Ga0395901_0069333 | Ga0395901_0069333_2975_3238 | 86 |
| 736 | 3300038443 | Ga0395901_0159781 | Ga0395901_0159781_929_1192 | 86 |
| 737 | 3300038443 | Ga0395901_0237974 | Ga0395901_0237974_1015_1278 | 86 |
| 738 | 3300038443 | Ga0395901_0337430 | Ga0395901_0337430_209_475 | 86 |
| 739 | 3300041441 | Ga0451787_392389 | Ga0451787_392389_120_416 | 86 |
| 740 | 3300041443 | Ga0451789_1076770 | Ga0451789_1076770_538_798 | 86 |
| 741 | 3300041451 | Ga0451791_1716037 | Ga0451791_1716037_262_522 | 86 |
| 742 | 3300041451 | Ga0451791_1822544 | Ga0451791_1822544_339_602 | 86 |
| 743 | 3300041452 | Ga0451793_0250537 | Ga0451793_0250537_235_495 | 86 |
| 744 | 3300041452 | Ga0451793_0899693 | Ga0451793_0899693_224_484 | 86 |
| 745 | 3300041453 | Ga0451797_0381324 | Ga0451797_0381324_71_331 | 86 |
| 746 | 3300041453 | Ga0451797_1401759 | Ga0451797_1401759_226_486 | 86 |
| 747 | 3300041458 | Ga0451798_0655170 | Ga0451798_0655170_483_743 | 86 |
| 748 | 3300041459 | Ga0451800_1282004 | Ga0451800_1282004_56_316 | 86 |
| 749 | 3300041486 | Ga0451807_1313990 | Ga0451807_1313990_278_541 | 86 |
| 750 | 3300041496 | Ga0451839_0378695 | Ga0451839_0378695_76_342 | 86 |
| 751 | 3300041512 | Ga0451853_1145788 | Ga0451853_1145788_16_276 | 86 |
| 752 | 3300042532 | Ga0450893_0007589 | Ga0450893_0007589_176_439 | 86 |
| 753 | 3300044656 | Ga0466969_0013272 | Ga0466969_0013272_1258_1521 | 86 |
| 754 | 3300044656 | Ga0466969_0071072 | Ga0466969_0071072_594_860 | 86 |
| 755 | 3300044656 | Ga0466969_0226605 | Ga0466969_0226605_245_511 | 86 |
| 756 | 3300044658 | Ga0466972_0060165 | Ga0466972_0060165_1055_1318 | 86 |
| 757 | 3300044683 | Ga0466965_0022570 | Ga0466965_0022570_2255_2518 | 86 |
| 758 | 3300044683 | Ga0466965_0321573 | Ga0466965_0321573_259_540 | 86 |
| 759 | 3300044684 | Ga0466966_0011758 | Ga0466966_0011758_5269_5532 | 86 |
| 760 | 3300044693 | Ga0466961_0016354 | Ga0466961_0016354_453_716 | 86 |
| 761 | 3300044693 | Ga0466961_0128200 | Ga0466961_0128200_801_1067 | 86 |
| 762 | 3300044694 | Ga0466963_0711421 | Ga0466963_0711421_333_596 | 86 |
| 763 | 3300044706 | Ga0466964_0140840 | Ga0466964_0140840_703_966 | 86 |
| 764 | 3300044719 | Ga0466971_0233234 | Ga0466971_0233234_346_612 | 86 |
| 765 | 3300044735 | Ga0466968_0258610 | Ga0466968_0258610_247_510 | 86 |
| 766 | 3300044765 | Ga0466970_0422178 | Ga0466970_0422178_349_612 | 86 |
| 767 | 3300044842 | Ga0466957_0243256 | Ga0466957_0243256_160_426 | 86 |
| 768 | 3300044901 | Ga0466960_0564417 | Ga0466960_0564417_231_494 | 86 |
| 769 | 3300045049 | Ga0466959_0013672 | Ga0466959_0013672_5368_5631 | 86 |
| 770 | 3300045049 | Ga0466959_0239009 | Ga0466959_0239009_164_430 | 86 |
| 771 | 3300045976 | Ga0466967_1420234 | Ga0466967_1420234_193_456 | 86 |
| 772 | 3300048090 | Ga0495615_0006727 | Ga0495615_0006727_1570_1836 | 86 |
| 773 | 3300049568 | Ga0501031_0778906 | Ga0501031_0778906_45_311 | 86 |
| 774 | 3300049571 | Ga0501034_0448863 | Ga0501034_0448863_325_591 | 86 |
| 775 | 3300049572 | Ga0501036_0312163 | Ga0501036_0312163_992_1258 | 86 |
| 776 | 3300049580 | Ga0501046_0145218 | Ga0501046_0145218_492_758 | 86 |
| 777 | 3300049581 | Ga0501047_0532107 | Ga0501047_0532107_82_348 | 86 |
| 778 | 3300049589 | Ga0501073_0111340 | Ga0501073_0111340_1196_1462 | 86 |
| 779 | 3300049674 | Ga0501242_037791 | Ga0501242_037791_184_447 | 86 |
| 780 | 3300049742 | Ga0501080_0680556 | Ga0501080_0680556_538_804 | 86 |
| 781 | 3300049822 | Ga0501035_0356744 | Ga0501035_0356744_604_870 | 86 |
| 782 | 3300049823 | Ga0501044_1183616 | Ga0501044_1183616_120_386 | 86 |
| 783 | 3300050489 | nmdc:mga03683_322259_c1 | nmdc:mga03683_322259_c1_317_580 | 86 |
| 784 | 3300050490 | nmdc:mga03n38_141968_c1 | nmdc:mga03n38_141968_c1_687_950 | 86 |
| 785 | 3300050490 | nmdc:mga03n38_512063_c1 | nmdc:mga03n38_512063_c1_72_332 | 86 |
| 786 | 3300050490 | nmdc:mga03n38_576315_c1 | nmdc:mga03n38_576315_c1_292_564 | 86 |
| 787 | 3300050490 | nmdc:mga03n38_848620_c1 | nmdc:mga03n38_848620_c1_237_497 | 86 |
| 788 | 3300050491 | nmdc:mga00v17_143149_c1 | nmdc:mga00v17_143149_c1_680_940 | 86 |
| 789 | 3300050491 | nmdc:mga00v17_749786_c1 | nmdc:mga00v17_749786_c1_109_372 | 86 |
| 790 | 3300050492 | nmdc:mga0yw44_40482_c1 | nmdc:mga0yw44_40482_c1_1359_1622 | 86 |
| 791 | 3300050492 | nmdc:mga0yw44_48096_c1 | nmdc:mga0yw44_48096_c1_1998_2261 | 86 |
| 792 | 3300050492 | nmdc:mga0yw44_852805_c1 | nmdc:mga0yw44_852805_c1_215_475 | 86 |
| 793 | 3300050493 | nmdc:mga0k408_335351_c1 | nmdc:mga0k408_335351_c1_103_363 | 86 |
| 794 | 3300050493 | nmdc:mga0k408_398125_c1 | nmdc:mga0k408_398125_c1_319_582 | 86 |
| 795 | 3300050493 | nmdc:mga0k408_413454_c1 | nmdc:mga0k408_413454_c1_239_502 | 86 |
| 796 | 3300050494 | nmdc:mga06z11_16098_c1 | nmdc:mga06z11_16098_c1_23_286 | 86 |
| 797 | 3300050495 | nmdc:mga04h51_141460_c1 | nmdc:mga04h51_141460_c1_607_870 | 86 |
| 798 | 3300050496 | nmdc:mga07m45_526690_c1 | nmdc:mga07m45_526690_c1_250_513 | 86 |
| 799 | 3300053088 | Ga0500644_0172456 | Ga0500644_0172456_222_482 | 86 |
| 800 | 3300053100 | Ga0500660_252547 | Ga0500660_252547_112_372 | 86 |
| 801 | 3300053117 | Ga0500593_129551 | Ga0500593_129551_578_838 | 86 |
| 802 | 3300053139 | Ga0500568_0006764 | Ga0500568_0006764_2642_2920 | 86 |
| 803 | 3300053730 | Ga0500645_000346 | Ga0500645_000346_13712_13972 | 86 |
| 804 | 3300053730 | Ga0500645_004728 | Ga0500645_004728_4545_4805 | 86 |
| 805 | 3300053730 | Ga0500645_162725 | Ga0500645_162725_162_422 | 86 |
| 806 | 3300055283 | Ga0500661_082206 | Ga0500661_082206_273_533 | 86 |
| 807 | 3300061719 | Ga0466962_0193446 | Ga0466962_0193446_687_953 | 86 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6u6s-assembly1.cif.gz_B | solution nmr structure of the i24n-delta10-ngmine protein from neisseria gonorrheae | 0.8801 | 39 | 82 |
| 6u6s-assembly1.cif.gz_B | solution nmr structure of the i24n-delta10-ngmine protein from neisseria gonorrheae | 0.8633 | 39 | 82 |
| 6u6r-assembly1.cif.gz_B | solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae | 0.8454 | 39 | 82 |
| 6u6r-assembly1.cif.gz_B | solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae | 0.83 | 39 | 82 |
| 5lgk-assembly2.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7856 | 58 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7L898_13_106_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8567 | 64 | 80 | 2.60.40.790 |
| 2kxoB01 | Alpha Beta;2-Layer Sandwich;Cell Cycle; Chain A;Cell division topological specificity factor MinE | 0.8272 | 21 | 80 | 3.30.1070.10 |
| af_G5EF13_1_128_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8181 | 63 | 84 | 2.60.40.10 |
| 2kxoB01 | Alpha Beta;2-Layer Sandwich;Cell Cycle; Chain A;Cell division topological specificity factor MinE | 0.8048 | 21 | 80 | 3.30.1070.10 |
| af_Q22385_1_133_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7648 | 63 | 85 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1X9P0-F1-model_v4 | deleted | 0.8771 | 21 | 86 |
|
| AF-A0A351KWE5-F1-model_v4 | Cell division topological specificity factor | 0.8644 | 20 | 85 |
GO:0032955
GO:0051301 |
| AF-A0A3N9V707-F1-model_v4 | Cell division topological specificity factor | 0.8315 | 13 | 85 |
GO:0032955
GO:0051301 |
| AF-K1ZZN3-F1-model_v4 | Cell division topological specificity factor | 0.8311 | 5 | 84 |
GO:0032955
GO:0051301 |
| AF-A0A2N2N030-F1-model_v4 | Cell division topological specificity factor | 0.8279 | 18 | 82 |
GO:0032955
GO:0051301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar