F480643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 334 | 783 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10015462|JGI24737J22298_100154621 |
| Length | 81 |
| Sequence | LVHARHIWDKDVLMITGTVKFFNXDKGYGFIAPESGSGDAFVHISAVERAGMTTLNKDQRVSYELETDRRGKTSAVNLQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 212 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 213 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 217 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 220 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 223 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 226 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 227 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 228 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 229 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 230 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 271 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 272 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 277 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 278 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 279 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 305 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 306 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 314 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 315 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 319 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 320 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 321 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 323 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 324 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 327 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 331 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 332 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 1.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.54 |
| Nodule | 0.13 |
| Rhizoplane | 2.3 |
| Rhizosphere | 85.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003022 | 3300001904 | Bacteria | 2938 |
| 2 | JGI24752J21851_1000266 | 3300001976 | Bacteria | 7281 |
| 3 | JGI24752J21851_1006110 | 3300001976 | Bacteria | 1573 |
| 4 | JGI24747J21853_1046519 | 3300001978 | Bacteria | 522 |
| 5 | JGI24740J21852_10040019 | 3300001979 | Bacteria | 1424 |
| 6 | JGI24740J21852_10091332 | 3300001979 | Bacteria | 785 |
| 7 | JGI24740J21852_10115243 | 3300001979 | Bacteria | 675 |
| 8 | JGI24739J22299_10007944 | 3300001989 | Bacteria | 3969 |
| 9 | JGI24739J22299_10009390 | 3300001989 | Bacteria | 3644 |
| 10 | JGI24739J22299_10010059 | 3300001989 | Bacteria | 3516 |
| 11 | JGI24739J22299_10036400 | 3300001989 | Bacteria | 1663 |
| 12 | JGI24739J22299_10052693 | 3300001989 | Bacteria | 1308 |
| 13 | JGI24739J22299_10076252 | 3300001989 | Bacteria | 1035 |
| 14 | JGI24739J22299_10098589 | 3300001989 | Bacteria | 883 |
| 15 | JGI24737J22298_10012233 | 3300001990 | Bacteria | 2797 |
| 16 | JGI24737J22298_10015462 | 3300001990 | Bacteria | 2471 |
| 17 | JGI24737J22298_10037437 | 3300001990 | Bacteria | 1495 |
| 18 | JGI24737J22298_10048579 | 3300001990 | Bacteria | 1291 |
| 19 | JGI24737J22298_10081153 | 3300001990 | Bacteria | 965 |
| 20 | JGI24743J22301_10105922 | 3300001991 | Bacteria | 608 |
| 21 | JGI24735J21928_10002885 | 3300002067 | Bacteria | 5917 |
| 22 | JGI24735J21928_10012414 | 3300002067 | Bacteria | 2692 |
| 23 | JGI24735J21928_10018234 | 3300002067 | Bacteria | 2165 |
| 24 | JGI24735J21928_10021374 | 3300002067 | Bacteria | 1976 |
| 25 | JGI24735J21928_10034580 | 3300002067 | Bacteria | 1489 |
| 26 | JGI24735J21928_10036131 | 3300002067 | Bacteria | 1450 |
| 27 | JGI24735J21928_10062145 | 3300002067 | Bacteria | 1073 |
| 28 | JGI24735J21928_10098471 | 3300002067 | Bacteria | 839 |
| 29 | JGI24750J21931_1000495 | 3300002070 | Bacteria | 6183 |
| 30 | JGI24750J21931_1003646 | 3300002070 | Bacteria | 1850 |
| 31 | JGI24748J21848_1000085 | 3300002074 | Bacteria | 28073 |
| 32 | JGI24748J21848_1024167 | 3300002074 | Bacteria | 739 |
| 33 | JGI24738J21930_10003443 | 3300002075 | Bacteria | 3991 |
| 34 | JGI24749J21850_1000574 | 3300002076 | Bacteria | 5352 |
| 35 | JGI24749J21850_1002773 | 3300002076 | Bacteria | 2456 |
| 36 | JGI24035J26624_1003865 | 3300002126 | Bacteria | 1418 |
| 37 | JGI24034J26672_10000069 | 3300002239 | Bacteria | 27837 |
| 38 | JGI24034J26672_10031560 | 3300002239 | Bacteria | 865 |
| 39 | JGI24742J22300_10003304 | 3300002244 | Bacteria | 2612 |
| 40 | JGI24751J29686_10000797 | 3300002459 | Bacteria | 7367 |
| 41 | JGI24751J29686_10011534 | 3300002459 | Bacteria | 1822 |
| 42 | JGI24751J29686_10055603 | 3300002459 | Bacteria | 816 |
| 43 | Ga0006778J45830_1070616 | 3300003162 | Bacteria | 567 |
| 44 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 45 | Ga0006777J48905_1067120 | 3300003308 | Bacteria | 505 |
| 46 | Ga0032354_1014098 | 3300003693 | Bacteria | 529 |
| 47 | Ga0055525_1000086 | 3300003759 | Bacteria | 150228 |
| 48 | Ga0055542_1000353 | 3300003762 | Bacteria | 48131 |
| 49 | Ga0055542_1014558 | 3300003762 | Bacteria | 1288 |
| 50 | Ga0055529_1000377 | 3300003763 | Bacteria | 48143 |
| 51 | Ga0055536_1009345 | 3300003781 | Bacteria | 4064 |
| 52 | Ga0055530_10089249 | 3300003791 | Bacteria | 635 |
| 53 | Ga0055531_10002547 | 3300003794 | Bacteria | 12120 |
| 54 | Ga0065707_10143914 | 3300005295 | Bacteria | 1737 |
| 55 | Ga0065707_10160867 | 3300005295 | Bacteria | 1564 |
| 56 | Ga0065707_10198694 | 3300005295 | Bacteria | 1322 |
| 57 | Ga0065707_10317993 | 3300005295 | Bacteria | 972 |
| 58 | Ga0070658_10002621 | 3300005327 | Bacteria | 14984 |
| 59 | Ga0070658_10525018 | 3300005327 | Bacteria | 1024 |
| 60 | Ga0070658_11274513 | 3300005327 | Bacteria | 638 |
| 61 | Ga0070658_11947157 | 3300005327 | Bacteria | 507 |
| 62 | Ga0070676_10000416 | 3300005328 | Bacteria | 20088 |
| 63 | Ga0070683_101912835 | 3300005329 | Bacteria | 570 |
| 64 | Ga0070690_100001137 | 3300005330 | Bacteria | 13688 |
| 65 | Ga0070670_100000178 | 3300005331 | Bacteria | 57676 |
| 66 | Ga0070670_100000867 | 3300005331 | Bacteria | 23777 |
| 67 | Ga0070670_100115168 | 3300005331 | Bacteria | 2318 |
| 68 | Ga0070670_100784296 | 3300005331 | Bacteria | 860 |
| 69 | Ga0068869_100001367 | 3300005334 | Bacteria | 14466 |
| 70 | Ga0068869_100207918 | 3300005334 | Bacteria | 1546 |
| 71 | Ga0070666_10000547 | 3300005335 | Bacteria | 22737 |
| 72 | Ga0070666_10001181 | 3300005335 | Bacteria | 15838 |
| 73 | Ga0070666_10017146 | 3300005335 | Bacteria | 4641 |
| 74 | Ga0070666_10042146 | 3300005335 | Bacteria | 3053 |
| 75 | Ga0070666_10062119 | 3300005335 | Bacteria | 2530 |
| 76 | Ga0070680_100000824 | 3300005336 | Bacteria | 21888 |
| 77 | Ga0070680_100223225 | 3300005336 | Bacteria | 1591 |
| 78 | Ga0068868_100002349 | 3300005338 | Bacteria | 13095 |
| 79 | Ga0070660_100002444 | 3300005339 | Bacteria | 12761 |
| 80 | Ga0070660_100064482 | 3300005339 | Bacteria | 2850 |
| 81 | Ga0070660_100214103 | 3300005339 | Bacteria | 1565 |
| 82 | Ga0070660_101297022 | 3300005339 | Bacteria | 618 |
| 83 | Ga0070689_100032724 | 3300005340 | Bacteria | 3957 |
| 84 | Ga0070661_100737519 | 3300005344 | Bacteria | 805 |
| 85 | Ga0070661_101521032 | 3300005344 | Bacteria | 565 |
| 86 | Ga0070668_100000006 | 3300005347 | Bacteria | 176486 |
| 87 | Ga0070668_100018392 | 3300005347 | Bacteria | 5246 |
| 88 | Ga0070668_100039166 | 3300005347 | Bacteria | 3625 |
| 89 | Ga0070668_100052169 | 3300005347 | Bacteria | 3152 |
| 90 | Ga0070668_100110967 | 3300005347 | Bacteria | 2183 |
| 91 | Ga0070669_100000013 | 3300005353 | Bacteria | 210577 |
| 92 | Ga0070669_100000119 | 3300005353 | Bacteria | 73001 |
| 93 | Ga0070669_100000958 | 3300005353 | Bacteria | 21065 |
| 94 | Ga0070669_100018299 | 3300005353 | Bacteria | 5007 |
| 95 | Ga0070669_100027700 | 3300005353 | Bacteria | 4079 |
| 96 | Ga0070669_101088590 | 3300005353 | Bacteria | 688 |
| 97 | Ga0070671_100000009 | 3300005355 | Bacteria | 206508 |
| 98 | Ga0070671_100000310 | 3300005355 | Bacteria | 33094 |
| 99 | Ga0070671_100012517 | 3300005355 | Bacteria | 6832 |
| 100 | Ga0070671_100047789 | 3300005355 | Bacteria | 3557 |
| 101 | Ga0070671_100268198 | 3300005355 | Bacteria | 1451 |
| 102 | Ga0070673_100000002 | 3300005364 | Bacteria | 225084 |
| 103 | Ga0070673_101932498 | 3300005364 | Bacteria | 560 |
| 104 | Ga0070688_100000708 | 3300005365 | Bacteria | 16427 |
| 105 | Ga0070659_100064697 | 3300005366 | Bacteria | 2895 |
| 106 | Ga0070659_100258787 | 3300005366 | Bacteria | 1444 |
| 107 | Ga0070659_100304107 | 3300005366 | Bacteria | 1331 |
| 108 | Ga0070659_101289555 | 3300005366 | Bacteria | 647 |
| 109 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 110 | Ga0070667_100000322 | 3300005367 | Bacteria | 53499 |
| 111 | Ga0070667_100001187 | 3300005367 | Bacteria | 23675 |
| 112 | Ga0070667_100002032 | 3300005367 | Bacteria | 17924 |
| 113 | Ga0070667_100007537 | 3300005367 | Bacteria | 9028 |
| 114 | Ga0070667_100270147 | 3300005367 | Bacteria | 1524 |
| 115 | Ga0070667_100635550 | 3300005367 | Bacteria | 985 |
| 116 | Ga0070705_100006419 | 3300005440 | Bacteria | 5767 |
| 117 | Ga0070694_100481958 | 3300005444 | Bacteria | 984 |
| 118 | Ga0070663_100635083 | 3300005455 | Bacteria | 901 |
| 119 | Ga0070678_100706137 | 3300005456 | Bacteria | 909 |
| 120 | Ga0070662_100117431 | 3300005457 | Bacteria | 2035 |
| 121 | Ga0070662_100174849 | 3300005457 | Bacteria | 1689 |
| 122 | Ga0070662_101015642 | 3300005457 | Bacteria | 710 |
| 123 | Ga0070662_101607683 | 3300005457 | Bacteria | 561 |
| 124 | Ga0070681_10299263 | 3300005458 | Bacteria | 1519 |
| 125 | Ga0068867_100000012 | 3300005459 | Bacteria | 118831 |
| 126 | Ga0070685_10014208 | 3300005466 | Bacteria | 4212 |
| 127 | Ga0070685_11297936 | 3300005466 | Bacteria | 556 |
| 128 | Ga0070706_100495418 | 3300005467 | Bacteria | 1137 |
| 129 | Ga0070679_100000002 | 3300005530 | Bacteria | 312066 |
| 130 | Ga0070679_100814717 | 3300005530 | Bacteria | 877 |
| 131 | Ga0068853_100179289 | 3300005539 | Bacteria | 1921 |
| 132 | Ga0068853_100208917 | 3300005539 | Bacteria | 1779 |
| 133 | Ga0068853_100687291 | 3300005539 | Bacteria | 975 |
| 134 | Ga0068853_100726148 | 3300005539 | Bacteria | 948 |
| 135 | Ga0068853_101085053 | 3300005539 | Bacteria | 772 |
| 136 | Ga0068853_101982473 | 3300005539 | Bacteria | 564 |
| 137 | Ga0070672_100358753 | 3300005543 | Bacteria | 1244 |
| 138 | Ga0070686_100000181 | 3300005544 | Bacteria | 44461 |
| 139 | Ga0070693_100940005 | 3300005547 | Bacteria | 650 |
| 140 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 141 | Ga0070665_100375971 | 3300005548 | Bacteria | 1428 |
| 142 | Ga0068855_100001671 | 3300005563 | Bacteria | 27748 |
| 143 | Ga0068855_100009919 | 3300005563 | Bacteria | 11484 |
| 144 | Ga0068855_100808364 | 3300005563 | Bacteria | 996 |
| 145 | Ga0070664_100083389 | 3300005564 | Bacteria | 2757 |
| 146 | Ga0068857_100077096 | 3300005577 | Bacteria | 2973 |
| 147 | Ga0068857_100095350 | 3300005577 | Bacteria | 2665 |
| 148 | Ga0068857_100116808 | 3300005577 | Bacteria | 2400 |
| 149 | Ga0068857_100127781 | 3300005577 | Bacteria | 2291 |
| 150 | Ga0068857_100153758 | 3300005577 | Bacteria | 2085 |
| 151 | Ga0068857_100287427 | 3300005577 | Bacteria | 1513 |
| 152 | Ga0068857_100373036 | 3300005577 | Bacteria | 1324 |
| 153 | Ga0068857_101306776 | 3300005577 | Bacteria | 704 |
| 154 | Ga0068857_102340343 | 3300005577 | Bacteria | 524 |
| 155 | Ga0068854_100014478 | 3300005578 | Bacteria | 5200 |
| 156 | Ga0068854_100018166 | 3300005578 | Bacteria | 4717 |
| 157 | Ga0068854_100026542 | 3300005578 | Bacteria | 3982 |
| 158 | Ga0068854_100055570 | 3300005578 | Bacteria | 2850 |
| 159 | Ga0068854_100257475 | 3300005578 | Bacteria | 1396 |
| 160 | Ga0068854_100296442 | 3300005578 | Bacteria | 1307 |
| 161 | Ga0068854_100558147 | 3300005578 | Bacteria | 972 |
| 162 | Ga0068854_101214845 | 3300005578 | Bacteria | 676 |
| 163 | Ga0068856_100045341 | 3300005614 | Bacteria | 4329 |
| 164 | Ga0068856_100060059 | 3300005614 | Bacteria | 3756 |
| 165 | Ga0068856_100316171 | 3300005614 | Bacteria | 1579 |
| 166 | Ga0068856_100620865 | 3300005614 | Bacteria | 1102 |
| 167 | Ga0068852_100001276 | 3300005616 | Bacteria | 16811 |
| 168 | Ga0068852_100187094 | 3300005616 | Bacteria | 1951 |
| 169 | Ga0068852_100210428 | 3300005616 | Bacteria | 1844 |
| 170 | Ga0068852_100384086 | 3300005616 | Bacteria | 1378 |
| 171 | Ga0068852_100442281 | 3300005616 | Bacteria | 1286 |
| 172 | Ga0068852_100670318 | 3300005616 | Bacteria | 1046 |
| 173 | Ga0068859_100003101 | 3300005617 | Bacteria | 16871 |
| 174 | Ga0068859_100003140 | 3300005617 | Bacteria | 16798 |
| 175 | Ga0068859_100005086 | 3300005617 | Bacteria | 13363 |
| 176 | Ga0068859_100126303 | 3300005617 | Bacteria | 2627 |
| 177 | Ga0068859_100315109 | 3300005617 | Bacteria | 1658 |
| 178 | Ga0068864_100000183 | 3300005618 | Bacteria | 57684 |
| 179 | Ga0068864_100001051 | 3300005618 | Bacteria | 23179 |
| 180 | Ga0068864_100001150 | 3300005618 | Bacteria | 22087 |
| 181 | Ga0068864_100002014 | 3300005618 | Bacteria | 16753 |
| 182 | Ga0068866_10456153 | 3300005718 | Bacteria | 837 |
| 183 | Ga0068861_100000687 | 3300005719 | Bacteria | 20197 |
| 184 | Ga0068861_100010768 | 3300005719 | Bacteria | 6357 |
| 185 | Ga0068861_100051576 | 3300005719 | Bacteria | 3123 |
| 186 | Ga0068851_10142940 | 3300005834 | Bacteria | 1302 |
| 187 | Ga0068863_100002515 | 3300005841 | Bacteria | 18207 |
| 188 | Ga0068863_100012020 | 3300005841 | Bacteria | 8364 |
| 189 | Ga0068863_100036402 | 3300005841 | Bacteria | 4688 |
| 190 | Ga0068863_100039200 | 3300005841 | Bacteria | 4508 |
| 191 | Ga0068863_100059963 | 3300005841 | Bacteria | 3600 |
| 192 | Ga0068863_101300127 | 3300005841 | Bacteria | 734 |
| 193 | Ga0068863_101560397 | 3300005841 | Bacteria | 669 |
| 194 | Ga0068858_100000920 | 3300005842 | Bacteria | 30532 |
| 195 | Ga0068858_100002212 | 3300005842 | Bacteria | 19691 |
| 196 | Ga0068858_100004181 | 3300005842 | Bacteria | 14205 |
| 197 | Ga0068858_100004950 | 3300005842 | Bacteria | 13050 |
| 198 | Ga0068860_100000068 | 3300005843 | Bacteria | 179208 |
| 199 | Ga0068860_100002805 | 3300005843 | Bacteria | 18132 |
| 200 | Ga0068860_100003455 | 3300005843 | Bacteria | 16250 |
| 201 | Ga0068860_100009225 | 3300005843 | Bacteria | 9806 |
| 202 | Ga0068860_100049782 | 3300005843 | Bacteria | 3989 |
| 203 | Ga0068860_100741843 | 3300005843 | Bacteria | 993 |
| 204 | Ga0068860_101543844 | 3300005843 | Bacteria | 686 |
| 205 | Ga0068860_102651255 | 3300005843 | Bacteria | 520 |
| 206 | Ga0068862_100000006 | 3300005844 | Bacteria | 346828 |
| 207 | Ga0068862_100000160 | 3300005844 | Bacteria | 74917 |
| 208 | Ga0068862_100000894 | 3300005844 | Bacteria | 28961 |
| 209 | Ga0068862_100007026 | 3300005844 | Bacteria | 9350 |
| 210 | Ga0068862_100017369 | 3300005844 | Bacteria | 5991 |
| 211 | Ga0068862_100047193 | 3300005844 | Bacteria | 3675 |
| 212 | Ga0075364_10425274 | 3300006051 | Bacteria | 907 |
| 213 | Ga0075366_10112303 | 3300006195 | Bacteria | 1640 |
| 214 | Ga0075366_10302839 | 3300006195 | Bacteria | 978 |
| 215 | Ga0075366_10747121 | 3300006195 | Bacteria | 608 |
| 216 | Ga0075370_10142822 | 3300006353 | Bacteria | 1400 |
| 217 | Ga0068865_100000004 | 3300006881 | Bacteria | 226236 |
| 218 | Ga0068865_101806364 | 3300006881 | Bacteria | 552 |
| 219 | Ga0097620_100003101 | 3300006931 | Bacteria | 16871 |
| 220 | Ga0097620_100003140 | 3300006931 | Bacteria | 16798 |
| 221 | Ga0097620_100005086 | 3300006931 | Bacteria | 13363 |
| 222 | Ga0097620_100126299 | 3300006931 | Bacteria | 2627 |
| 223 | Ga0097620_100315118 | 3300006931 | Bacteria | 1658 |
| 224 | Ga0079104_1068043 | 3300006946 | Bacteria | 753 |
| 225 | Ga0075435_100728405 | 3300007076 | Bacteria | 862 |
| 226 | Ga0105251_10004083 | 3300009011 | Bacteria | 10231 |
| 227 | Ga0105251_10114818 | 3300009011 | Bacteria | 1225 |
| 228 | Ga0105251_10157131 | 3300009011 | Bacteria | 1025 |
| 229 | Ga0105250_10281365 | 3300009092 | Bacteria | 716 |
| 230 | Ga0105240_10058338 | 3300009093 | Bacteria | 4819 |
| 231 | Ga0105240_10594745 | 3300009093 | Bacteria | 1219 |
| 232 | Ga0105240_11325424 | 3300009093 | Bacteria | 759 |
| 233 | Ga0105245_10004262 | 3300009098 | Bacteria | 12680 |
| 234 | Ga0105247_10002301 | 3300009101 | Bacteria | 13054 |
| 235 | Ga0105247_10003906 | 3300009101 | Bacteria | 9623 |
| 236 | Ga0105247_10074686 | 3300009101 | Bacteria | 2127 |
| 237 | Ga0105247_10900589 | 3300009101 | Bacteria | 683 |
| 238 | Ga0105243_10000146 | 3300009148 | Bacteria | 81008 |
| 239 | Ga0105243_10149830 | 3300009148 | Bacteria | 2000 |
| 240 | Ga0105241_10166380 | 3300009174 | Bacteria | 1817 |
| 241 | Ga0105241_10863534 | 3300009174 | Bacteria | 838 |
| 242 | Ga0105241_11234489 | 3300009174 | Bacteria | 709 |
| 243 | Ga0105242_10000497 | 3300009176 | Bacteria | 31053 |
| 244 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 245 | Ga0105248_10003803 | 3300009177 | Bacteria | 16733 |
| 246 | Ga0105248_10030756 | 3300009177 | Bacteria | 5997 |
| 247 | Ga0105248_10046039 | 3300009177 | Bacteria | 4890 |
| 248 | Ga0105248_10046883 | 3300009177 | Bacteria | 4846 |
| 249 | Ga0105248_10047627 | 3300009177 | Bacteria | 4808 |
| 250 | Ga0105248_10056537 | 3300009177 | Bacteria | 4402 |
| 251 | Ga0105248_10306743 | 3300009177 | Bacteria | 1788 |
| 252 | Ga0105248_11444533 | 3300009177 | Bacteria | 778 |
| 253 | Ga0105237_10034455 | 3300009545 | Bacteria | 5127 |
| 254 | Ga0105237_10225531 | 3300009545 | Bacteria | 1874 |
| 255 | Ga0105237_10658202 | 3300009545 | Bacteria | 1054 |
| 256 | Ga0105238_10029748 | 3300009551 | Bacteria | 5563 |
| 257 | Ga0105238_10112959 | 3300009551 | Bacteria | 2696 |
| 258 | Ga0105238_10117478 | 3300009551 | Bacteria | 2640 |
| 259 | Ga0105238_12641540 | 3300009551 | Bacteria | 538 |
| 260 | Ga0105249_10000355 | 3300009553 | Bacteria | 45955 |
| 261 | Ga0105249_10002669 | 3300009553 | Bacteria | 15422 |
| 262 | Ga0105249_10020475 | 3300009553 | Bacteria | 5913 |
| 263 | Ga0105249_10040393 | 3300009553 | Bacteria | 4238 |
| 264 | Ga0105249_10126707 | 3300009553 | Bacteria | 2432 |
| 265 | Ga0105249_10249460 | 3300009553 | Bacteria | 1759 |
| 266 | Ga0105239_10169627 | 3300010375 | Bacteria | 2440 |
| 267 | Ga0105239_10255811 | 3300010375 | Bacteria | 1967 |
| 268 | Ga0105239_10629034 | 3300010375 | Bacteria | 1225 |
| 269 | Ga0105239_10802979 | 3300010375 | Bacteria | 1078 |
| 270 | Ga0105246_10000138 | 3300011119 | Bacteria | 33809 |
| 271 | Ga0157326_1000736 | 3300012513 | Bacteria | 3838 |
| 272 | Ga0157373_11580497 | 3300013100 | Bacteria | 502 |
| 273 | Ga0157371_10000842 | 3300013102 | Bacteria | 35113 |
| 274 | Ga0157371_10019554 | 3300013102 | Bacteria | 4991 |
| 275 | Ga0157371_10487946 | 3300013102 | Bacteria | 909 |
| 276 | Ga0157371_10502727 | 3300013102 | Bacteria | 895 |
| 277 | Ga0157371_10559193 | 3300013102 | Bacteria | 848 |
| 278 | Ga0157370_10030422 | 3300013104 | Bacteria | 5290 |
| 279 | Ga0157370_10204132 | 3300013104 | Bacteria | 1833 |
| 280 | Ga0157370_10800772 | 3300013104 | Bacteria | 857 |
| 281 | Ga0157370_10952631 | 3300013104 | Bacteria | 778 |
| 282 | Ga0157370_11259700 | 3300013104 | Bacteria | 667 |
| 283 | Ga0157369_10135222 | 3300013105 | Bacteria | 2610 |
| 284 | Ga0157369_10917871 | 3300013105 | Bacteria | 898 |
| 285 | Ga0157374_10001104 | 3300013296 | Bacteria | 23221 |
| 286 | Ga0157374_10780796 | 3300013296 | Bacteria | 971 |
| 287 | Ga0157378_10006343 | 3300013297 | Bacteria | 10349 |
| 288 | Ga0157378_10499395 | 3300013297 | Bacteria | 1215 |
| 289 | Ga0163162_10001771 | 3300013306 | Bacteria | 20235 |
| 290 | Ga0163162_10022071 | 3300013306 | Bacteria | 6272 |
| 291 | Ga0163162_10188013 | 3300013306 | Bacteria | 2192 |
| 292 | Ga0163162_10250658 | 3300013306 | Bacteria | 1902 |
| 293 | Ga0157372_10231368 | 3300013307 | Bacteria | 2143 |
| 294 | Ga0157372_10238068 | 3300013307 | Bacteria | 2112 |
| 295 | Ga0157372_10528323 | 3300013307 | Bacteria | 1375 |
| 296 | Ga0157372_10647068 | 3300013307 | Bacteria | 1231 |
| 297 | Ga0157372_12347563 | 3300013307 | Bacteria | 612 |
| 298 | Ga0157375_10000587 | 3300013308 | Bacteria | 32327 |
| 299 | Ga0157375_10536204 | 3300013308 | Bacteria | 1333 |
| 300 | Ga0163163_10047074 | 3300014325 | Bacteria | 4238 |
| 301 | Ga0163163_10161643 | 3300014325 | Bacteria | 2285 |
| 302 | Ga0157380_10000087 | 3300014326 | Bacteria | 50956 |
| 303 | Ga0157380_10017903 | 3300014326 | Bacteria | 5253 |
| 304 | Ga0157380_10188637 | 3300014326 | Bacteria | 1818 |
| 305 | Ga0157380_13483673 | 3300014326 | Bacteria | 504 |
| 306 | Ga0157377_11037338 | 3300014745 | Bacteria | 624 |
| 307 | Ga0157379_10074401 | 3300014968 | Bacteria | 3041 |
| 308 | Ga0157379_10477506 | 3300014968 | Bacteria | 1153 |
| 309 | Ga0157379_11247450 | 3300014968 | Bacteria | 716 |
| 310 | Ga0157376_10000131 | 3300014969 | Bacteria | 51790 |
| 311 | Ga0163161_10002585 | 3300017792 | Bacteria | 12911 |
| 312 | Ga0163161_10620377 | 3300017792 | Bacteria | 893 |
| 313 | Ga0163161_10786492 | 3300017792 | Bacteria | 798 |
| 314 | Ga0207672_1000794 | 3300025223 | Bacteria | 3371 |
| 315 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 316 | Ga0209646_1008350 | 3300025246 | Bacteria | 1667 |
| 317 | Ga0209026_1012633 | 3300025250 | Bacteria | 1464 |
| 318 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 319 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 320 | Ga0209233_1071651 | 3300025261 | Bacteria | 639 |
| 321 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 322 | Ga0209455_1020563 | 3300025272 | Bacteria | 1302 |
| 323 | Ga0207673_1045286 | 3300025290 | Bacteria | 620 |
| 324 | Ga0209676_1000060 | 3300025292 | Bacteria | 338238 |
| 325 | Ga0209676_1000226 | 3300025292 | Bacteria | 124004 |
| 326 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 327 | Ga0209050_1003101 | 3300025298 | Bacteria | 12745 |
| 328 | Ga0209050_1102653 | 3300025298 | Bacteria | 563 |
| 329 | Ga0209257_1000392 | 3300025304 | Bacteria | 87104 |
| 330 | Ga0207697_10001743 | 3300025315 | Bacteria | 11688 |
| 331 | Ga0207697_10367646 | 3300025315 | Bacteria | 639 |
| 332 | Ga0207713_1014886 | 3300025735 | Bacteria | 4014 |
| 333 | Ga0207713_1055056 | 3300025735 | Bacteria | 1555 |
| 334 | Ga0207713_1178811 | 3300025735 | Bacteria | 664 |
| 335 | Ga0207642_10270610 | 3300025899 | Bacteria | 973 |
| 336 | Ga0207710_10007517 | 3300025900 | Bacteria | 4614 |
| 337 | Ga0207710_10399660 | 3300025900 | Bacteria | 705 |
| 338 | Ga0207688_10216692 | 3300025901 | Bacteria | 1152 |
| 339 | Ga0207688_11101321 | 3300025901 | Bacteria | 501 |
| 340 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 341 | Ga0207680_10000418 | 3300025903 | Bacteria | 20249 |
| 342 | Ga0207680_10033138 | 3300025903 | Bacteria | 2944 |
| 343 | Ga0207680_10099024 | 3300025903 | Bacteria | 1870 |
| 344 | Ga0207680_11080810 | 3300025903 | Bacteria | 574 |
| 345 | Ga0207647_10005831 | 3300025904 | Bacteria | 8981 |
| 346 | Ga0207647_10023553 | 3300025904 | Bacteria | 4071 |
| 347 | Ga0207647_10105475 | 3300025904 | Bacteria | 1670 |
| 348 | Ga0207647_10109834 | 3300025904 | Bacteria | 1631 |
| 349 | Ga0207647_10426139 | 3300025904 | Bacteria | 745 |
| 350 | Ga0207647_10462163 | 3300025904 | Bacteria | 711 |
| 351 | Ga0207647_10774541 | 3300025904 | Bacteria | 518 |
| 352 | Ga0207645_10009635 | 3300025907 | Bacteria | 6673 |
| 353 | Ga0207705_10000084 | 3300025909 | Bacteria | 116809 |
| 354 | Ga0207705_10308546 | 3300025909 | Bacteria | 1214 |
| 355 | Ga0207654_10622447 | 3300025911 | Bacteria | 771 |
| 356 | Ga0207654_10915357 | 3300025911 | Bacteria | 636 |
| 357 | Ga0207707_10752852 | 3300025912 | Bacteria | 815 |
| 358 | Ga0207695_10017127 | 3300025913 | Bacteria | 8447 |
| 359 | Ga0207695_10017716 | 3300025913 | Bacteria | 8271 |
| 360 | Ga0207695_10125643 | 3300025913 | Bacteria | 2527 |
| 361 | Ga0207695_11244698 | 3300025913 | Bacteria | 624 |
| 362 | Ga0207671_10158857 | 3300025914 | Bacteria | 1749 |
| 363 | Ga0207671_10219883 | 3300025914 | Bacteria | 1488 |
| 364 | Ga0207671_11571874 | 3300025914 | Bacteria | 506 |
| 365 | Ga0207660_10003071 | 3300025917 | Bacteria | 10911 |
| 366 | Ga0207660_10287202 | 3300025917 | Bacteria | 1307 |
| 367 | Ga0207657_10004951 | 3300025919 | Bacteria | 14018 |
| 368 | Ga0207657_10074466 | 3300025919 | Bacteria | 2867 |
| 369 | Ga0207657_10218235 | 3300025919 | Bacteria | 1529 |
| 370 | Ga0207649_10025862 | 3300025920 | Bacteria | 3428 |
| 371 | Ga0207649_10124038 | 3300025920 | Bacteria | 1745 |
| 372 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 373 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 374 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 375 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 376 | Ga0207681_10000704 | 3300025923 | Bacteria | 21968 |
| 377 | Ga0207681_10016779 | 3300025923 | Bacteria | 4588 |
| 378 | Ga0207681_10069647 | 3300025923 | Bacteria | 2447 |
| 379 | Ga0207681_11835153 | 3300025923 | Bacteria | 505 |
| 380 | Ga0207694_10011474 | 3300025924 | Bacteria | 6688 |
| 381 | Ga0207694_10087112 | 3300025924 | Bacteria | 2459 |
| 382 | Ga0207694_10897574 | 3300025924 | Bacteria | 749 |
| 383 | Ga0207694_11302166 | 3300025924 | Bacteria | 614 |
| 384 | Ga0207694_11597144 | 3300025924 | Bacteria | 550 |
| 385 | Ga0207650_10000050 | 3300025925 | Bacteria | 169589 |
| 386 | Ga0207650_10002940 | 3300025925 | Bacteria | 11754 |
| 387 | Ga0207650_10015038 | 3300025925 | Bacteria | 5383 |
| 388 | Ga0207650_10268055 | 3300025925 | Bacteria | 1387 |
| 389 | Ga0207650_10544903 | 3300025925 | Bacteria | 972 |
| 390 | Ga0207687_10039071 | 3300025927 | Bacteria | 3247 |
| 391 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 392 | Ga0207644_10000028 | 3300025931 | Bacteria | 142921 |
| 393 | Ga0207644_10000124 | 3300025931 | Bacteria | 56579 |
| 394 | Ga0207644_10000292 | 3300025931 | Bacteria | 33037 |
| 395 | Ga0207644_10001291 | 3300025931 | Bacteria | 16119 |
| 396 | Ga0207644_10127663 | 3300025931 | Bacteria | 1943 |
| 397 | Ga0207690_10126488 | 3300025932 | Bacteria | 1864 |
| 398 | Ga0207690_10520785 | 3300025932 | Bacteria | 964 |
| 399 | Ga0207690_10691990 | 3300025932 | Bacteria | 838 |
| 400 | Ga0207706_10107769 | 3300025933 | Bacteria | 2451 |
| 401 | Ga0207706_10305191 | 3300025933 | Bacteria | 1386 |
| 402 | Ga0207706_10502254 | 3300025933 | Bacteria | 1047 |
| 403 | Ga0207686_10004317 | 3300025934 | Bacteria | 7623 |
| 404 | Ga0207709_10001457 | 3300025935 | Bacteria | 16479 |
| 405 | Ga0207709_10098211 | 3300025935 | Bacteria | 1930 |
| 406 | Ga0207670_10053948 | 3300025936 | Bacteria | 2710 |
| 407 | Ga0207669_11768099 | 3300025937 | Bacteria | 528 |
| 408 | Ga0207704_10000005 | 3300025938 | Bacteria | 225353 |
| 409 | Ga0207704_11783806 | 3300025938 | Bacteria | 529 |
| 410 | Ga0207691_10341864 | 3300025940 | Bacteria | 1281 |
| 411 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 412 | Ga0207711_10000662 | 3300025941 | Bacteria | 34294 |
| 413 | Ga0207711_10026087 | 3300025941 | Bacteria | 4902 |
| 414 | Ga0207711_10055697 | 3300025941 | Bacteria | 3395 |
| 415 | Ga0207711_10094318 | 3300025941 | Bacteria | 2637 |
| 416 | Ga0207711_10276754 | 3300025941 | Bacteria | 1545 |
| 417 | Ga0207711_10309852 | 3300025941 | Bacteria | 1457 |
| 418 | Ga0207711_10623807 | 3300025941 | Bacteria | 1006 |
| 419 | Ga0207711_11522888 | 3300025941 | Bacteria | 612 |
| 420 | Ga0207689_10001653 | 3300025942 | Bacteria | 21135 |
| 421 | Ga0207679_10080824 | 3300025945 | Bacteria | 2483 |
| 422 | Ga0207667_10014616 | 3300025949 | Bacteria | 8939 |
| 423 | Ga0207667_10254280 | 3300025949 | Bacteria | 1797 |
| 424 | Ga0207651_10000007 | 3300025960 | Bacteria | 225286 |
| 425 | Ga0207651_11901788 | 3300025960 | Bacteria | 535 |
| 426 | Ga0207712_10000072 | 3300025961 | Bacteria | 124006 |
| 427 | Ga0207712_10017601 | 3300025961 | Bacteria | 4645 |
| 428 | Ga0207712_10021578 | 3300025961 | Bacteria | 4229 |
| 429 | Ga0207712_10072291 | 3300025961 | Bacteria | 2483 |
| 430 | Ga0207712_10108640 | 3300025961 | Bacteria | 2076 |
| 431 | Ga0207668_10000026 | 3300025972 | Bacteria | 128309 |
| 432 | Ga0207668_10000675 | 3300025972 | Bacteria | 20963 |
| 433 | Ga0207668_10003566 | 3300025972 | Bacteria | 9144 |
| 434 | Ga0207668_10056114 | 3300025972 | Bacteria | 2742 |
| 435 | Ga0207668_10095417 | 3300025972 | Bacteria | 2195 |
| 436 | Ga0207640_10012065 | 3300025981 | Bacteria | 4912 |
| 437 | Ga0207640_10012353 | 3300025981 | Bacteria | 4860 |
| 438 | Ga0207640_10074303 | 3300025981 | Bacteria | 2300 |
| 439 | Ga0207640_10081128 | 3300025981 | Bacteria | 2217 |
| 440 | Ga0207640_10443045 | 3300025981 | Bacteria | 1068 |
| 441 | Ga0207640_10526714 | 3300025981 | Bacteria | 989 |
| 442 | Ga0207640_10872620 | 3300025981 | Bacteria | 784 |
| 443 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 444 | Ga0207658_10000608 | 3300025986 | Bacteria | 31752 |
| 445 | Ga0207658_10000967 | 3300025986 | Bacteria | 23707 |
| 446 | Ga0207658_10001977 | 3300025986 | Bacteria | 15294 |
| 447 | Ga0207658_10003917 | 3300025986 | Bacteria | 10465 |
| 448 | Ga0207658_10082023 | 3300025986 | Bacteria | 2475 |
| 449 | Ga0207677_10001155 | 3300026023 | Bacteria | 14422 |
| 450 | Ga0207703_10000849 | 3300026035 | Bacteria | 29915 |
| 451 | Ga0207703_10002381 | 3300026035 | Bacteria | 16348 |
| 452 | Ga0207703_10010115 | 3300026035 | Bacteria | 7392 |
| 453 | Ga0207703_10011114 | 3300026035 | Bacteria | 7010 |
| 454 | Ga0207639_10093564 | 3300026041 | Bacteria | 2411 |
| 455 | Ga0207639_10300634 | 3300026041 | Bacteria | 1418 |
| 456 | Ga0207639_10385948 | 3300026041 | Bacteria | 1259 |
| 457 | Ga0207639_10391395 | 3300026041 | Bacteria | 1250 |
| 458 | Ga0207639_10846840 | 3300026041 | Bacteria | 853 |
| 459 | Ga0207678_10644277 | 3300026067 | Bacteria | 931 |
| 460 | Ga0207678_10802608 | 3300026067 | Bacteria | 831 |
| 461 | Ga0207702_10013739 | 3300026078 | Bacteria | 6726 |
| 462 | Ga0207702_10049546 | 3300026078 | Bacteria | 3545 |
| 463 | Ga0207702_11819071 | 3300026078 | Bacteria | 601 |
| 464 | Ga0207641_10000179 | 3300026088 | Bacteria | 88061 |
| 465 | Ga0207641_10001414 | 3300026088 | Bacteria | 23667 |
| 466 | Ga0207641_10010071 | 3300026088 | Bacteria | 7773 |
| 467 | Ga0207641_10027742 | 3300026088 | Bacteria | 4677 |
| 468 | Ga0207641_10201653 | 3300026088 | Bacteria | 1834 |
| 469 | Ga0207648_10000005 | 3300026089 | Bacteria | 225083 |
| 470 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 471 | Ga0207676_10000040 | 3300026095 | Bacteria | 167947 |
| 472 | Ga0207676_10000190 | 3300026095 | Bacteria | 53850 |
| 473 | Ga0207676_10000613 | 3300026095 | Bacteria | 29202 |
| 474 | Ga0207676_10003561 | 3300026095 | Bacteria | 11002 |
| 475 | Ga0207676_10004335 | 3300026095 | Bacteria | 10037 |
| 476 | Ga0207676_11078161 | 3300026095 | Bacteria | 793 |
| 477 | Ga0207676_12624123 | 3300026095 | Bacteria | 500 |
| 478 | Ga0207674_10026868 | 3300026116 | Bacteria | 6105 |
| 479 | Ga0207674_10051090 | 3300026116 | Bacteria | 4220 |
| 480 | Ga0207674_10161760 | 3300026116 | Bacteria | 2193 |
| 481 | Ga0207674_10176484 | 3300026116 | Bacteria | 2089 |
| 482 | Ga0207674_10184225 | 3300026116 | Bacteria | 2038 |
| 483 | Ga0207674_11877723 | 3300026116 | Bacteria | 565 |
| 484 | Ga0207675_100002079 | 3300026118 | Bacteria | 19902 |
| 485 | Ga0207675_100002340 | 3300026118 | Bacteria | 18785 |
| 486 | Ga0207675_100113823 | 3300026118 | Bacteria | 2554 |
| 487 | Ga0207675_100131973 | 3300026118 | Bacteria | 2369 |
| 488 | Ga0207675_100332869 | 3300026118 | Bacteria | 1485 |
| 489 | Ga0207675_100626001 | 3300026118 | Bacteria | 1081 |
| 490 | Ga0207698_10008334 | 3300026142 | Bacteria | 6548 |
| 491 | Ga0207698_10024433 | 3300026142 | Bacteria | 4241 |
| 492 | Ga0207698_10059354 | 3300026142 | Bacteria | 2970 |
| 493 | Ga0207698_11033527 | 3300026142 | Bacteria | 833 |
| 494 | Ga0207698_11179418 | 3300026142 | Bacteria | 779 |
| 495 | Ga0207698_12527130 | 3300026142 | Bacteria | 524 |
| 496 | Ga0209967_1028934 | 3300027364 | Bacteria | 827 |
| 497 | Ga0209982_1057082 | 3300027552 | Bacteria | 633 |
| 498 | Ga0210002_1084160 | 3300027617 | Bacteria | 568 |
| 499 | Ga0209971_1042566 | 3300027682 | Bacteria | 1094 |
| 500 | Ga0209974_10157792 | 3300027876 | Bacteria | 822 |
| 501 | Ga0209974_10227135 | 3300027876 | Bacteria | 697 |
| 502 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 503 | Ga0268266_10264270 | 3300028379 | Bacteria | 1595 |
| 504 | Ga0268266_10437299 | 3300028379 | Bacteria | 1242 |
| 505 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 506 | Ga0268265_10000171 | 3300028380 | Bacteria | 77721 |
| 507 | Ga0268265_10001260 | 3300028380 | Bacteria | 21840 |
| 508 | Ga0268265_10010758 | 3300028380 | Bacteria | 6178 |
| 509 | Ga0268265_10025484 | 3300028380 | Bacteria | 4199 |
| 510 | Ga0268265_10187595 | 3300028380 | Bacteria | 1782 |
| 511 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 512 | Ga0268264_10000103 | 3300028381 | Bacteria | 222439 |
| 513 | Ga0268264_10000221 | 3300028381 | Bacteria | 111397 |
| 514 | Ga0268264_10006519 | 3300028381 | Bacteria | 9831 |
| 515 | Ga0268264_10009510 | 3300028381 | Bacteria | 8051 |
| 516 | Ga0307517_10206460 | 3300028786 | Bacteria | 1218 |
| 517 | Ga0316177_1195044 | 3300030731 | Bacteria | 2153 |
| 518 | Ga0307513_10052770 | 3300031456 | Bacteria | 4376 |
| 519 | Ga0307408_100251612 | 3300031548 | Bacteria | 1458 |
| 520 | Ga0307408_100742500 | 3300031548 | Bacteria | 886 |
| 521 | Ga0307408_100825739 | 3300031548 | Bacteria | 843 |
| 522 | Ga0307408_100980730 | 3300031548 | Bacteria | 778 |
| 523 | Ga0307408_101083596 | 3300031548 | Bacteria | 742 |
| 524 | Ga0307405_10064549 | 3300031731 | Bacteria | 2328 |
| 525 | Ga0307405_10113810 | 3300031731 | Bacteria | 1838 |
| 526 | Ga0307405_10345560 | 3300031731 | Bacteria | 1145 |
| 527 | Ga0307405_10533606 | 3300031731 | Bacteria | 946 |
| 528 | Ga0307405_11527357 | 3300031731 | Bacteria | 587 |
| 529 | Ga0307405_11760669 | 3300031731 | Bacteria | 550 |
| 530 | Ga0307405_12080106 | 3300031731 | Bacteria | 509 |
| 531 | Ga0307413_10103574 | 3300031824 | Bacteria | 1887 |
| 532 | Ga0307413_10122485 | 3300031824 | Bacteria | 1764 |
| 533 | Ga0307413_10144419 | 3300031824 | Bacteria | 1649 |
| 534 | Ga0307413_12026844 | 3300031824 | Bacteria | 519 |
| 535 | Ga0307413_12102964 | 3300031824 | Bacteria | 510 |
| 536 | Ga0307410_10017551 | 3300031852 | Bacteria | 4302 |
| 537 | Ga0307410_10034873 | 3300031852 | Bacteria | 3263 |
| 538 | Ga0307410_10112306 | 3300031852 | Bacteria | 1973 |
| 539 | Ga0307406_10077834 | 3300031901 | Bacteria | 2195 |
| 540 | Ga0307406_10202986 | 3300031901 | Bacteria | 1461 |
| 541 | Ga0307406_10839995 | 3300031901 | Bacteria | 778 |
| 542 | Ga0307406_11245948 | 3300031901 | Bacteria | 647 |
| 543 | Ga0307406_12058554 | 3300031901 | Bacteria | 511 |
| 544 | Ga0307407_10039033 | 3300031903 | Bacteria | 2637 |
| 545 | Ga0307407_10068166 | 3300031903 | Bacteria | 2106 |
| 546 | Ga0307412_10012635 | 3300031911 | Bacteria | 4928 |
| 547 | Ga0307412_10014477 | 3300031911 | Bacteria | 4652 |
| 548 | Ga0307412_10023141 | 3300031911 | Bacteria | 3819 |
| 549 | Ga0307412_10027831 | 3300031911 | Bacteria | 3530 |
| 550 | Ga0307412_10041279 | 3300031911 | Bacteria | 2989 |
| 551 | Ga0307412_10134074 | 3300031911 | Bacteria | 1804 |
| 552 | Ga0307412_10238317 | 3300031911 | Bacteria | 1405 |
| 553 | Ga0307412_10279749 | 3300031911 | Bacteria | 1309 |
| 554 | Ga0307412_10346062 | 3300031911 | Bacteria | 1192 |
| 555 | Ga0307412_10591208 | 3300031911 | Bacteria | 938 |
| 556 | Ga0307412_10683218 | 3300031911 | Bacteria | 879 |
| 557 | Ga0307412_11359105 | 3300031911 | Bacteria | 641 |
| 558 | Ga0307409_100104733 | 3300031995 | Bacteria | 2357 |
| 559 | Ga0307409_100121157 | 3300031995 | Bacteria | 2215 |
| 560 | Ga0307409_100188343 | 3300031995 | Bacteria | 1834 |
| 561 | Ga0307416_100081670 | 3300032002 | Bacteria | 2734 |
| 562 | Ga0307416_100276738 | 3300032002 | Bacteria | 1652 |
| 563 | Ga0307416_100606780 | 3300032002 | Bacteria | 1175 |
| 564 | Ga0307416_100926260 | 3300032002 | Bacteria | 972 |
| 565 | Ga0307416_101514025 | 3300032002 | Bacteria | 777 |
| 566 | Ga0307416_103321709 | 3300032002 | Bacteria | 538 |
| 567 | Ga0307414_10000136 | 3300032004 | Bacteria | 49913 |
| 568 | Ga0307414_10002538 | 3300032004 | Bacteria | 9589 |
| 569 | Ga0307414_10013200 | 3300032004 | Bacteria | 4911 |
| 570 | Ga0307414_10164710 | 3300032004 | Bacteria | 1765 |
| 571 | Ga0307414_10234440 | 3300032004 | Bacteria | 1515 |
| 572 | Ga0307414_10391439 | 3300032004 | Bacteria | 1204 |
| 573 | Ga0307414_10536328 | 3300032004 | Bacteria | 1041 |
| 574 | Ga0307414_10887653 | 3300032004 | Bacteria | 817 |
| 575 | Ga0307414_10951832 | 3300032004 | Bacteria | 789 |
| 576 | Ga0307414_11738626 | 3300032004 | Bacteria | 582 |
| 577 | Ga0307414_11990435 | 3300032004 | Bacteria | 542 |
| 578 | Ga0307414_12085014 | 3300032004 | Bacteria | 529 |
| 579 | Ga0307411_10032530 | 3300032005 | Bacteria | 3223 |
| 580 | Ga0307411_10075565 | 3300032005 | Bacteria | 2300 |
| 581 | Ga0307411_10092722 | 3300032005 | Bacteria | 2113 |
| 582 | Ga0307411_10207421 | 3300032005 | Bacteria | 1510 |
| 583 | Ga0307415_100448452 | 3300032126 | Bacteria | 1115 |
| 584 | Ga0307510_10003391 | 3300033180 | Bacteria | 18599 |
| 585 | Ga0307510_10380779 | 3300033180 | Bacteria | 856 |
| 586 | Ga0373948_0169374 | 3300034817 | Bacteria | 555 |
| 587 | Ga0373932_0015327 | 3300035112 | Bacteria | 1942 |
| 588 | Ga0373932_0246634 | 3300035112 | Bacteria | 650 |
| 589 | Ga0373943_0230606 | 3300035170 | Bacteria | 1034 |
| 590 | Ga0373946_0058783 | 3300035171 | Bacteria | 1630 |
| 591 | Ga0373935_0301593 | 3300035692 | Bacteria | 1132 |
| 592 | Ga0373927_0107858 | 3300035695 | Bacteria | 1814 |
| 593 | Ga0373947_0265446 | 3300035725 | Bacteria | 1138 |
| 594 | Ga0395899_0000738 | 3300037312 | Bacteria | 32643 |
| 595 | Ga0395899_0024662 | 3300037312 | Bacteria | 4545 |
| 596 | Ga0395899_0134648 | 3300037312 | Bacteria | 1762 |
| 597 | Ga0395900_0143511 | 3300037418 | Bacteria | 2443 |
| 598 | Ga0395900_1061371 | 3300037418 | Bacteria | 728 |
| 599 | Ga0395900_1464595 | 3300037418 | Bacteria | 595 |
| 600 | Ga0395900_1564069 | 3300037418 | Bacteria | 571 |
| 601 | Ga0395905_0046291 | 3300037471 | Bacteria | 4079 |
| 602 | Ga0395905_0060777 | 3300037471 | Bacteria | 3533 |
| 603 | Ga0395905_0149090 | 3300037471 | Bacteria | 2200 |
| 604 | Ga0395905_0496828 | 3300037471 | Bacteria | 1120 |
| 605 | Ga0395905_0585702 | 3300037471 | Bacteria | 1017 |
| 606 | Ga0395901_0079992 | 3300038443 | Bacteria | 3412 |
| 607 | Ga0395901_0104641 | 3300038443 | Bacteria | 2970 |
| 608 | Ga0395901_0207081 | 3300038443 | Bacteria | 2054 |
| 609 | Ga0395901_0219501 | 3300038443 | Bacteria | 1987 |
| 610 | Ga0395901_1833055 | 3300038443 | Bacteria | 555 |
| 611 | Ga0237819_00702 | 3300038705 | Bacteria | 10872 |
| 612 | Ga0237816_00591 | 3300039145 | Bacteria | 3070 |
| 613 | Ga0451789_0540734 | 3300041443 | Bacteria | 649 |
| 614 | Ga0451789_0943086 | 3300041443 | Bacteria | 639 |
| 615 | Ga0451791_1228639 | 3300041451 | Bacteria | 592 |
| 616 | Ga0451793_0334588 | 3300041452 | Bacteria | 589 |
| 617 | Ga0451801_01071 | 3300041455 | Bacteria | 587 |
| 618 | Ga0451795_0888193 | 3300041456 | Bacteria | 574 |
| 619 | Ga0451802_0602411 | 3300041460 | Bacteria | 517 |
| 620 | Ga0451805_073244 | 3300041461 | Bacteria | 638 |
| 621 | Ga0451804_0674792 | 3300041463 | Bacteria | 601 |
| 622 | Ga0451807_0682885 | 3300041486 | Bacteria | 889 |
| 623 | Ga0451837_0232942 | 3300041494 | Bacteria | 781 |
| 624 | Ga0451837_0932992 | 3300041494 | Bacteria | 557 |
| 625 | Ga0451841_0723032 | 3300041498 | Bacteria | 659 |
| 626 | Ga0451853_3164471 | 3300041512 | Bacteria | 682 |
| 627 | Ga0439448_0002892 | 3300042005 | Bacteria | 4705 |
| 628 | Ga0439432_075293 | 3300042006 | Bacteria | 1026 |
| 629 | Ga0439450_053772 | 3300042008 | Bacteria | 962 |
| 630 | Ga0439454_027297 | 3300042011 | Bacteria | 877 |
| 631 | Ga0439455_0031210 | 3300042012 | Bacteria | 1325 |
| 632 | Ga0439458_0000411 | 3300042157 | Bacteria | 10757 |
| 633 | Ga0439458_0023574 | 3300042157 | Bacteria | 1435 |
| 634 | Ga0451577_0793079 | 3300042876 | Bacteria | 856 |
| 635 | Ga0466963_0764213 | 3300044694 | Bacteria | 682 |
| 636 | Ga0453684_0144988 | 3300044712 | Bacteria | 2830 |
| 637 | Ga0466971_0013453 | 3300044719 | Bacteria | 3595 |
| 638 | Ga0466957_0060779 | 3300044842 | Bacteria | 2317 |
| 639 | Ga0451576_0287511 | 3300045051 | Bacteria | 1719 |
| 640 | Ga0451576_1678546 | 3300045051 | Bacteria | 658 |
| 641 | Ga0466958_0045403 | 3300045836 | Bacteria | 2650 |
| 642 | Ga0466967_0814319 | 3300045976 | Bacteria | 927 |
| 643 | Ga0495592_0433362 | 3300046454 | Bacteria | 827 |
| 644 | Ga0495638_0588644 | 3300046460 | Bacteria | 548 |
| 645 | Ga0495607_0009991 | 3300046501 | Bacteria | 6393 |
| 646 | Ga0495583_0027264 | 3300046506 | Bacteria | 2821 |
| 647 | Ga0495606_0032104 | 3300046507 | Bacteria | 3642 |
| 648 | Ga0495606_0097322 | 3300046507 | Bacteria | 1798 |
| 649 | Ga0495620_0067190 | 3300046515 | Bacteria | 1476 |
| 650 | Ga0495637_0020614 | 3300046520 | Bacteria | 3031 |
| 651 | Ga0495643_0036230 | 3300046522 | Bacteria | 2712 |
| 652 | Ga0495643_0056975 | 3300046522 | Bacteria | 2084 |
| 653 | Ga0495643_0159163 | 3300046522 | Bacteria | 1112 |
| 654 | Ga0495663_0044134 | 3300046525 | Bacteria | 1364 |
| 655 | Ga0495654_0021389 | 3300046530 | Bacteria | 3365 |
| 656 | Ga0495609_0050693 | 3300046538 | Bacteria | 1850 |
| 657 | Ga0495621_0153376 | 3300046539 | Bacteria | 907 |
| 658 | Ga0495597_0096319 | 3300046542 | Bacteria | 1251 |
| 659 | Ga0495633_0164810 | 3300046558 | Bacteria | 1022 |
| 660 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 661 | Ga0495668_0018119 | 3300046616 | Bacteria | 4072 |
| 662 | Ga0495668_0027073 | 3300046616 | Bacteria | 3249 |
| 663 | Ga0495668_0058282 | 3300046616 | Bacteria | 2131 |
| 664 | Ga0495625_0008532 | 3300046660 | Bacteria | 8729 |
| 665 | Ga0495625_0042708 | 3300046660 | Bacteria | 3292 |
| 666 | Ga0495625_0284716 | 3300046660 | Bacteria | 1062 |
| 667 | Ga0495635_1093518 | 3300046663 | Bacteria | 505 |
| 668 | Ga0495669_0132247 | 3300046684 | Bacteria | 1175 |
| 669 | Ga0495670_0300947 | 3300046691 | Bacteria | 859 |
| 670 | Ga0495660_0183195 | 3300046810 | Bacteria | 1012 |
| 671 | Ga0495687_004335 | 3300047443 | Bacteria | 9654 |
| 672 | Ga0495677_0119957 | 3300047445 | Bacteria | 1002 |
| 673 | Ga0496100_0721524 | 3300048903 | Bacteria | 779 |
| 674 | Ga0496102_0234565 | 3300048905 | Bacteria | 1730 |
| 675 | Ga0496103_0061206 | 3300048906 | Bacteria | 2341 |
| 676 | Ga0496103_0247355 | 3300048906 | Bacteria | 1147 |
| 677 | Ga0496104_1028999 | 3300048907 | Bacteria | 727 |
| 678 | Ga0496107_0499920 | 3300048910 | Bacteria | 902 |
| 679 | Ga0496113_0184797 | 3300048916 | Bacteria | 1653 |
| 680 | Ga0496113_0756098 | 3300048916 | Bacteria | 774 |
| 681 | Ga0496117_0003839 | 3300048920 | Bacteria | 17093 |
| 682 | Ga0496117_0007266 | 3300048920 | Bacteria | 10884 |
| 683 | Ga0496117_0496874 | 3300048920 | Bacteria | 592 |
| 684 | Ga0496118_0000901 | 3300048921 | Bacteria | 46540 |
| 685 | Ga0496118_0007049 | 3300048921 | Bacteria | 12084 |
| 686 | Ga0496118_0042347 | 3300048921 | Bacteria | 3594 |
| 687 | Ga0496118_0367527 | 3300048921 | Bacteria | 760 |
| 688 | Ga0496118_0395273 | 3300048921 | Bacteria | 720 |
| 689 | Ga0496121_0090548 | 3300048924 | Bacteria | 2391 |
| 690 | Ga0496121_0167769 | 3300048924 | Bacteria | 1598 |
| 691 | Ga0496121_0289737 | 3300048924 | Bacteria | 1116 |
| 692 | Ga0496122_0221186 | 3300048925 | Bacteria | 1086 |
| 693 | Ga0496123_0029600 | 3300048926 | Bacteria | 4026 |
| 694 | Ga0496123_0038218 | 3300048926 | Bacteria | 3377 |
| 695 | Ga0496124_0000192 | 3300048927 | Bacteria | 120980 |
| 696 | Ga0496124_0001412 | 3300048927 | Bacteria | 35756 |
| 697 | Ga0496124_0028878 | 3300048927 | Bacteria | 4952 |
| 698 | Ga0496124_0079741 | 3300048927 | Bacteria | 2695 |
| 699 | Ga0496124_0096167 | 3300048927 | Bacteria | 2406 |
| 700 | Ga0496125_0066180 | 3300048928 | Bacteria | 2857 |
| 701 | Ga0496125_0118299 | 3300048928 | Bacteria | 1898 |
| 702 | Ga0496126_0433319 | 3300048929 | Bacteria | 1061 |
| 703 | Ga0496126_1157881 | 3300048929 | Bacteria | 571 |
| 704 | Ga0495682_0258250 | 3300049460 | Bacteria | 616 |
| 705 | Ga0501293_012339 | 3300049516 | Bacteria | 757 |
| 706 | Ga0501298_032011 | 3300049521 | Bacteria | 1036 |
| 707 | Ga0501300_034092 | 3300049523 | Bacteria | 756 |
| 708 | Ga0501320_012355 | 3300049536 | Bacteria | 896 |
| 709 | Ga0501320_028028 | 3300049536 | Bacteria | 688 |
| 710 | Ga0501321_075558 | 3300049537 | Bacteria | 530 |
| 711 | Ga0501326_14218 | 3300049542 | Bacteria | 501 |
| 712 | Ga0501333_013451 | 3300049549 | Bacteria | 606 |
| 713 | Ga0501334_20069 | 3300049550 | Bacteria | 534 |
| 714 | Ga0501335_039037 | 3300049551 | Bacteria | 555 |
| 715 | Ga0501336_007516 | 3300049552 | Bacteria | 828 |
| 716 | Ga0501337_012984 | 3300049553 | Bacteria | 626 |
| 717 | Ga0501338_09985 | 3300049554 | Bacteria | 636 |
| 718 | Ga0501032_0010668 | 3300049569 | Bacteria | 6614 |
| 719 | Ga0501032_0056543 | 3300049569 | Bacteria | 2637 |
| 720 | Ga0501033_0001724 | 3300049570 | Bacteria | 19138 |
| 721 | Ga0501034_0004606 | 3300049571 | Bacteria | 15279 |
| 722 | Ga0501036_0529121 | 3300049572 | Bacteria | 980 |
| 723 | Ga0501036_0589414 | 3300049572 | Bacteria | 923 |
| 724 | Ga0501036_0997233 | 3300049572 | Bacteria | 686 |
| 725 | Ga0501038_0337306 | 3300049574 | Bacteria | 1176 |
| 726 | Ga0501042_0961576 | 3300049578 | Bacteria | 622 |
| 727 | Ga0501043_0028300 | 3300049579 | Bacteria | 4399 |
| 728 | Ga0501043_0383773 | 3300049579 | Bacteria | 1063 |
| 729 | Ga0501046_1148120 | 3300049580 | Bacteria | 535 |
| 730 | Ga0501047_0000256 | 3300049581 | Bacteria | 62551 |
| 731 | Ga0501047_0026761 | 3300049581 | Bacteria | 5552 |
| 732 | Ga0501047_0215173 | 3300049581 | Bacteria | 1778 |
| 733 | Ga0501047_0642220 | 3300049581 | Bacteria | 881 |
| 734 | Ga0501048_0536426 | 3300049582 | Bacteria | 839 |
| 735 | Ga0501067_0154694 | 3300049583 | Bacteria | 1277 |
| 736 | Ga0501067_0799899 | 3300049583 | Bacteria | 531 |
| 737 | Ga0501069_0702101 | 3300049585 | Bacteria | 610 |
| 738 | Ga0501223_030647 | 3300049663 | Bacteria | 1046 |
| 739 | Ga0501257_000012 | 3300049686 | Bacteria | 51962 |
| 740 | Ga0501080_0632248 | 3300049742 | Bacteria | 948 |
| 741 | Ga0501083_0411979 | 3300049744 | Bacteria | 879 |
| 742 | Ga0501267_003554 | 3300049764 | Bacteria | 1424 |
| 743 | Ga0501278_006800 | 3300049774 | Bacteria | 861 |
| 744 | Ga0501280_001885 | 3300049776 | Bacteria | 3666 |
| 745 | Ga0501044_0027022 | 3300049823 | Bacteria | 6072 |
| 746 | Ga0501044_0383872 | 3300049823 | Bacteria | 1319 |
| 747 | nmdc:mga0k408_49308_c1 | 3300050493 | Bacteria | 2437 |
| 748 | nmdc:mga07m45_117405_c1 | 3300050496 | Bacteria | 1535 |
| 749 | nmdc:mga0rr50_905959_c1 | 3300050513 | Bacteria | 752 |
| 750 | Ga0500643_000166 | 3300053087 | Bacteria | 65586 |
| 751 | Ga0500643_000590 | 3300053087 | Bacteria | 25096 |
| 752 | Ga0500643_001818 | 3300053087 | Bacteria | 11669 |
| 753 | Ga0500644_0317431 | 3300053088 | Bacteria | 669 |
| 754 | Ga0500647_0140807 | 3300053091 | Bacteria | 1131 |
| 755 | Ga0500651_0039143 | 3300053093 | Bacteria | 2986 |
| 756 | Ga0500566_0059490 | 3300053094 | Bacteria | 2166 |
| 757 | Ga0500592_001082 | 3300053116 | Bacteria | 4437 |
| 758 | Ga0500592_007979 | 3300053116 | Bacteria | 1679 |
| 759 | Ga0500592_028852 | 3300053116 | Bacteria | 895 |
| 760 | Ga0500618_000496 | 3300053125 | Bacteria | 25243 |
| 761 | Ga0500618_008655 | 3300053125 | Bacteria | 2825 |
| 762 | Ga0500642_0001609 | 3300053130 | Bacteria | 6511 |
| 763 | Ga0500652_188894 | 3300053131 | Bacteria | 841 |
| 764 | Ga0500655_000399 | 3300053133 | Bacteria | 9184 |
| 765 | Ga0500658_0004128 | 3300053134 | Bacteria | 5459 |
| 766 | Ga0500658_0040535 | 3300053134 | Bacteria | 1865 |
| 767 | Ga0500568_0036013 | 3300053139 | Bacteria | 2016 |
| 768 | Ga0500577_0003903 | 3300053142 | Bacteria | 3897 |
| 769 | Ga0500577_0249368 | 3300053142 | Bacteria | 771 |
| 770 | Ga0500590_004550 | 3300053148 | Bacteria | 6558 |
| 771 | Ga0500604_0042642 | 3300053151 | Bacteria | 1376 |
| 772 | Ga0500622_0004003 | 3300053156 | Bacteria | 9497 |
| 773 | Ga0500627_0000017 | 3300053158 | Bacteria | 119507 |
| 774 | Ga0500627_0006961 | 3300053158 | Bacteria | 3897 |
| 775 | Ga0500627_0015857 | 3300053158 | Bacteria | 2925 |
| 776 | Ga0500627_0184263 | 3300053158 | Bacteria | 939 |
| 777 | Ga0500639_087162 | 3300053163 | Bacteria | 1562 |
| 778 | Ga0500636_0051013 | 3300053177 | Bacteria | 2432 |
| 779 | Ga0500637_0268426 | 3300053178 | Bacteria | 945 |
| 780 | Ga0500570_000052 | 3300053724 | Bacteria | 28845 |
| 781 | Ga0500645_064009 | 3300053730 | Bacteria | 1061 |
| 782 | Ga0501082_0275057 | 3300060353 | Bacteria | 1466 |
| 783 | Ga0466962_0496147 | 3300061719 | Bacteria | 617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10064549 | Ga0307405_100645492 | 62 |
| 2 | 3300031911 | Ga0307412_10027831 | Ga0307412_100278312 | 62 |
| 3 | 3300006195 | Ga0075366_10302839 | Ga0075366_103028392 | 67 |
| 4 | 3300001904 | JGI24736J21556_1003022 | JGI24736J21556_10030223 | 68 |
| 5 | 3300001976 | JGI24752J21851_1000266 | JGI24752J21851_10002666 | 68 |
| 6 | 3300001976 | JGI24752J21851_1006110 | JGI24752J21851_10061102 | 68 |
| 7 | 3300001978 | JGI24747J21853_1046519 | JGI24747J21853_10465192 | 68 |
| 8 | 3300001979 | JGI24740J21852_10040019 | JGI24740J21852_100400192 | 68 |
| 9 | 3300001979 | JGI24740J21852_10091332 | JGI24740J21852_100913321 | 68 |
| 10 | 3300001979 | JGI24740J21852_10115243 | JGI24740J21852_101152431 | 68 |
| 11 | 3300001989 | JGI24739J22299_10007944 | JGI24739J22299_100079445 | 68 |
| 12 | 3300001989 | JGI24739J22299_10009390 | JGI24739J22299_100093904 | 68 |
| 13 | 3300001989 | JGI24739J22299_10010059 | JGI24739J22299_100100593 | 68 |
| 14 | 3300001989 | JGI24739J22299_10036400 | JGI24739J22299_100364003 | 68 |
| 15 | 3300001989 | JGI24739J22299_10052693 | JGI24739J22299_100526933 | 68 |
| 16 | 3300001989 | JGI24739J22299_10076252 | JGI24739J22299_100762522 | 68 |
| 17 | 3300001989 | JGI24739J22299_10098589 | JGI24739J22299_100985891 | 68 |
| 18 | 3300001990 | JGI24737J22298_10012233 | JGI24737J22298_100122334 | 68 |
| 19 | 3300001990 | JGI24737J22298_10015462 | JGI24737J22298_100154621 | 68 |
| 20 | 3300001990 | JGI24737J22298_10037437 | JGI24737J22298_100374371 | 68 |
| 21 | 3300001990 | JGI24737J22298_10048579 | JGI24737J22298_100485791 | 68 |
| 22 | 3300001990 | JGI24737J22298_10081153 | JGI24737J22298_100811531 | 68 |
| 23 | 3300001991 | JGI24743J22301_10105922 | JGI24743J22301_101059222 | 68 |
| 24 | 3300002067 | JGI24735J21928_10002885 | JGI24735J21928_100028855 | 68 |
| 25 | 3300002067 | JGI24735J21928_10012414 | JGI24735J21928_100124144 | 68 |
| 26 | 3300002067 | JGI24735J21928_10018234 | JGI24735J21928_100182342 | 68 |
| 27 | 3300002067 | JGI24735J21928_10021374 | JGI24735J21928_100213743 | 68 |
| 28 | 3300002067 | JGI24735J21928_10034580 | JGI24735J21928_100345802 | 68 |
| 29 | 3300002067 | JGI24735J21928_10036131 | JGI24735J21928_100361311 | 68 |
| 30 | 3300002067 | JGI24735J21928_10062145 | JGI24735J21928_100621451 | 68 |
| 31 | 3300002067 | JGI24735J21928_10098471 | JGI24735J21928_100984711 | 68 |
| 32 | 3300002070 | JGI24750J21931_1000495 | JGI24750J21931_10004952 | 68 |
| 33 | 3300002070 | JGI24750J21931_1003646 | JGI24750J21931_10036465 | 68 |
| 34 | 3300002074 | JGI24748J21848_1000085 | JGI24748J21848_10000859 | 68 |
| 35 | 3300002074 | JGI24748J21848_1024167 | JGI24748J21848_10241672 | 68 |
| 36 | 3300002075 | JGI24738J21930_10003443 | JGI24738J21930_100034435 | 68 |
| 37 | 3300002076 | JGI24749J21850_1000574 | JGI24749J21850_10005746 | 68 |
| 38 | 3300002076 | JGI24749J21850_1002773 | JGI24749J21850_10027734 | 68 |
| 39 | 3300002126 | JGI24035J26624_1003865 | JGI24035J26624_10038652 | 68 |
| 40 | 3300002239 | JGI24034J26672_10000069 | JGI24034J26672_100000697 | 68 |
| 41 | 3300002239 | JGI24034J26672_10031560 | JGI24034J26672_100315602 | 68 |
| 42 | 3300002244 | JGI24742J22300_10003304 | JGI24742J22300_100033042 | 68 |
| 43 | 3300002459 | JGI24751J29686_10000797 | JGI24751J29686_100007977 | 68 |
| 44 | 3300002459 | JGI24751J29686_10011534 | JGI24751J29686_100115343 | 68 |
| 45 | 3300002459 | JGI24751J29686_10055603 | JGI24751J29686_100556031 | 68 |
| 46 | 3300003162 | Ga0006778J45830_1070616 | Ga0006778J45830_10706161 | 68 |
| 47 | 3300003215 | JGI25153J46596_10000007 | JGI25153J46596_1000000729 | 68 |
| 48 | 3300003308 | Ga0006777J48905_1067120 | Ga0006777J48905_10671201 | 68 |
| 49 | 3300003693 | Ga0032354_1014098 | Ga0032354_10140981 | 68 |
| 50 | 3300003759 | Ga0055525_1000086 | Ga0055525_100008625 | 68 |
| 51 | 3300003762 | Ga0055542_1000353 | Ga0055542_100035324 | 68 |
| 52 | 3300003762 | Ga0055542_1014558 | Ga0055542_10145582 | 68 |
| 53 | 3300003763 | Ga0055529_1000377 | Ga0055529_100037724 | 68 |
| 54 | 3300003781 | Ga0055536_1009345 | Ga0055536_10093453 | 68 |
| 55 | 3300003791 | Ga0055530_10089249 | Ga0055530_100892492 | 68 |
| 56 | 3300003794 | Ga0055531_10002547 | Ga0055531_100025478 | 68 |
| 57 | 3300005295 | Ga0065707_10143914 | Ga0065707_101439144 | 68 |
| 58 | 3300005295 | Ga0065707_10160867 | Ga0065707_101608673 | 68 |
| 59 | 3300005295 | Ga0065707_10198694 | Ga0065707_101986944 | 68 |
| 60 | 3300005295 | Ga0065707_10317993 | Ga0065707_103179932 | 68 |
| 61 | 3300005327 | Ga0070658_10002621 | Ga0070658_100026216 | 68 |
| 62 | 3300005327 | Ga0070658_10525018 | Ga0070658_105250182 | 68 |
| 63 | 3300005327 | Ga0070658_11274513 | Ga0070658_112745131 | 68 |
| 64 | 3300005327 | Ga0070658_11947157 | Ga0070658_119471571 | 68 |
| 65 | 3300005328 | Ga0070676_10000416 | Ga0070676_100004168 | 68 |
| 66 | 3300005329 | Ga0070683_101912835 | Ga0070683_1019128352 | 68 |
| 67 | 3300005330 | Ga0070690_100001137 | Ga0070690_1000011379 | 68 |
| 68 | 3300005331 | Ga0070670_100000178 | Ga0070670_10000017849 | 68 |
| 69 | 3300005331 | Ga0070670_100000867 | Ga0070670_1000008676 | 68 |
| 70 | 3300005331 | Ga0070670_100115168 | Ga0070670_1001151683 | 68 |
| 71 | 3300005331 | Ga0070670_100784296 | Ga0070670_1007842961 | 68 |
| 72 | 3300005334 | Ga0068869_100001367 | Ga0068869_1000013673 | 68 |
| 73 | 3300005334 | Ga0068869_100207918 | Ga0068869_1002079182 | 68 |
| 74 | 3300005335 | Ga0070666_10000547 | Ga0070666_1000054718 | 68 |
| 75 | 3300005335 | Ga0070666_10001181 | Ga0070666_1000118110 | 68 |
| 76 | 3300005335 | Ga0070666_10017146 | Ga0070666_100171467 | 68 |
| 77 | 3300005335 | Ga0070666_10042146 | Ga0070666_100421463 | 68 |
| 78 | 3300005335 | Ga0070666_10062119 | Ga0070666_100621193 | 68 |
| 79 | 3300005336 | Ga0070680_100000824 | Ga0070680_1000008249 | 68 |
| 80 | 3300005336 | Ga0070680_100223225 | Ga0070680_1002232254 | 68 |
| 81 | 3300005338 | Ga0068868_100002349 | Ga0068868_1000023494 | 68 |
| 82 | 3300005339 | Ga0070660_100002444 | Ga0070660_10000244410 | 68 |
| 83 | 3300005339 | Ga0070660_100064482 | Ga0070660_1000644824 | 68 |
| 84 | 3300005339 | Ga0070660_100214103 | Ga0070660_1002141032 | 68 |
| 85 | 3300005339 | Ga0070660_101297022 | Ga0070660_1012970221 | 68 |
| 86 | 3300005340 | Ga0070689_100032724 | Ga0070689_1000327244 | 68 |
| 87 | 3300005344 | Ga0070661_100737519 | Ga0070661_1007375192 | 68 |
| 88 | 3300005344 | Ga0070661_101521032 | Ga0070661_1015210321 | 68 |
| 89 | 3300005347 | Ga0070668_100000006 | Ga0070668_10000000666 | 68 |
| 90 | 3300005347 | Ga0070668_100018392 | Ga0070668_1000183926 | 68 |
| 91 | 3300005347 | Ga0070668_100039166 | Ga0070668_1000391662 | 68 |
| 92 | 3300005347 | Ga0070668_100052169 | Ga0070668_1000521694 | 68 |
| 93 | 3300005347 | Ga0070668_100110967 | Ga0070668_1001109673 | 68 |
| 94 | 3300005353 | Ga0070669_100000013 | Ga0070669_100000013122 | 68 |
| 95 | 3300005353 | Ga0070669_100000119 | Ga0070669_10000011965 | 68 |
| 96 | 3300005353 | Ga0070669_100000958 | Ga0070669_10000095812 | 68 |
| 97 | 3300005353 | Ga0070669_100018299 | Ga0070669_1000182996 | 68 |
| 98 | 3300005353 | Ga0070669_100027700 | Ga0070669_1000277003 | 68 |
| 99 | 3300005353 | Ga0070669_101088590 | Ga0070669_1010885901 | 68 |
| 100 | 3300005355 | Ga0070671_100000009 | Ga0070671_100000009101 | 68 |
| 101 | 3300005355 | Ga0070671_100000310 | Ga0070671_10000031010 | 68 |
| 102 | 3300005355 | Ga0070671_100012517 | Ga0070671_1000125173 | 68 |
| 103 | 3300005355 | Ga0070671_100047789 | Ga0070671_1000477896 | 68 |
| 104 | 3300005355 | Ga0070671_100268198 | Ga0070671_1002681982 | 68 |
| 105 | 3300005364 | Ga0070673_100000002 | Ga0070673_100000002204 | 68 |
| 106 | 3300005364 | Ga0070673_101932498 | Ga0070673_1019324981 | 68 |
| 107 | 3300005365 | Ga0070688_100000708 | Ga0070688_10000070814 | 68 |
| 108 | 3300005366 | Ga0070659_100064697 | Ga0070659_1000646971 | 68 |
| 109 | 3300005366 | Ga0070659_100258787 | Ga0070659_1002587873 | 68 |
| 110 | 3300005366 | Ga0070659_100304107 | Ga0070659_1003041071 | 68 |
| 111 | 3300005366 | Ga0070659_101289555 | Ga0070659_1012895552 | 68 |
| 112 | 3300005367 | Ga0070667_100000003 | Ga0070667_100000003166 | 68 |
| 113 | 3300005367 | Ga0070667_100000322 | Ga0070667_10000032221 | 68 |
| 114 | 3300005367 | Ga0070667_100001187 | Ga0070667_1000011877 | 68 |
| 115 | 3300005367 | Ga0070667_100002032 | Ga0070667_10000203211 | 68 |
| 116 | 3300005367 | Ga0070667_100007537 | Ga0070667_10000753711 | 68 |
| 117 | 3300005367 | Ga0070667_100270147 | Ga0070667_1002701473 | 68 |
| 118 | 3300005367 | Ga0070667_100635550 | Ga0070667_1006355502 | 68 |
| 119 | 3300005440 | Ga0070705_100006419 | Ga0070705_1000064193 | 68 |
| 120 | 3300005444 | Ga0070694_100481958 | Ga0070694_1004819582 | 68 |
| 121 | 3300005455 | Ga0070663_100635083 | Ga0070663_1006350832 | 68 |
| 122 | 3300005456 | Ga0070678_100706137 | Ga0070678_1007061372 | 68 |
| 123 | 3300005457 | Ga0070662_100117431 | Ga0070662_1001174314 | 68 |
| 124 | 3300005457 | Ga0070662_100174849 | Ga0070662_1001748492 | 68 |
| 125 | 3300005457 | Ga0070662_101015642 | Ga0070662_1010156421 | 68 |
| 126 | 3300005457 | Ga0070662_101607683 | Ga0070662_1016076831 | 68 |
| 127 | 3300005458 | Ga0070681_10299263 | Ga0070681_102992632 | 68 |
| 128 | 3300005459 | Ga0068867_100000012 | Ga0068867_10000001210 | 68 |
| 129 | 3300005466 | Ga0070685_10014208 | Ga0070685_100142086 | 68 |
| 130 | 3300005466 | Ga0070685_11297936 | Ga0070685_112979362 | 68 |
| 131 | 3300005467 | Ga0070706_100495418 | Ga0070706_1004954182 | 68 |
| 132 | 3300005530 | Ga0070679_100000002 | Ga0070679_100000002238 | 68 |
| 133 | 3300005530 | Ga0070679_100814717 | Ga0070679_1008147172 | 68 |
| 134 | 3300005539 | Ga0068853_100179289 | Ga0068853_1001792891 | 68 |
| 135 | 3300005539 | Ga0068853_100208917 | Ga0068853_1002089173 | 68 |
| 136 | 3300005539 | Ga0068853_100687291 | Ga0068853_1006872912 | 68 |
| 137 | 3300005539 | Ga0068853_100726148 | Ga0068853_1007261482 | 68 |
| 138 | 3300005539 | Ga0068853_101085053 | Ga0068853_1010850532 | 68 |
| 139 | 3300005539 | Ga0068853_101982473 | Ga0068853_1019824731 | 68 |
| 140 | 3300005543 | Ga0070672_100358753 | Ga0070672_1003587532 | 68 |
| 141 | 3300005544 | Ga0070686_100000181 | Ga0070686_10000018145 | 68 |
| 142 | 3300005547 | Ga0070693_100940005 | Ga0070693_1009400051 | 68 |
| 143 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004763 | 68 |
| 144 | 3300005548 | Ga0070665_100375971 | Ga0070665_1003759714 | 68 |
| 145 | 3300005563 | Ga0068855_100001671 | Ga0068855_10000167132 | 68 |
| 146 | 3300005563 | Ga0068855_100009919 | Ga0068855_1000099191 | 68 |
| 147 | 3300005563 | Ga0068855_100808364 | Ga0068855_1008083641 | 68 |
| 148 | 3300005564 | Ga0070664_100083389 | Ga0070664_1000833895 | 68 |
| 149 | 3300005577 | Ga0068857_100077096 | Ga0068857_1000770964 | 68 |
| 150 | 3300005577 | Ga0068857_100095350 | Ga0068857_1000953504 | 68 |
| 151 | 3300005577 | Ga0068857_100116808 | Ga0068857_1001168084 | 68 |
| 152 | 3300005577 | Ga0068857_100127781 | Ga0068857_1001277814 | 68 |
| 153 | 3300005577 | Ga0068857_100153758 | Ga0068857_1001537583 | 68 |
| 154 | 3300005577 | Ga0068857_100287427 | Ga0068857_1002874273 | 68 |
| 155 | 3300005577 | Ga0068857_100373036 | Ga0068857_1003730362 | 68 |
| 156 | 3300005577 | Ga0068857_101306776 | Ga0068857_1013067763 | 68 |
| 157 | 3300005577 | Ga0068857_102340343 | Ga0068857_1023403431 | 68 |
| 158 | 3300005578 | Ga0068854_100014478 | Ga0068854_1000144781 | 68 |
| 159 | 3300005578 | Ga0068854_100018166 | Ga0068854_1000181664 | 68 |
| 160 | 3300005578 | Ga0068854_100026542 | Ga0068854_1000265424 | 68 |
| 161 | 3300005578 | Ga0068854_100055570 | Ga0068854_1000555705 | 68 |
| 162 | 3300005578 | Ga0068854_100257475 | Ga0068854_1002574751 | 68 |
| 163 | 3300005578 | Ga0068854_100296442 | Ga0068854_1002964423 | 68 |
| 164 | 3300005578 | Ga0068854_100558147 | Ga0068854_1005581473 | 68 |
| 165 | 3300005578 | Ga0068854_101214845 | Ga0068854_1012148452 | 68 |
| 166 | 3300005614 | Ga0068856_100045341 | Ga0068856_1000453417 | 68 |
| 167 | 3300005614 | Ga0068856_100060059 | Ga0068856_1000600596 | 68 |
| 168 | 3300005614 | Ga0068856_100316171 | Ga0068856_1003161712 | 68 |
| 169 | 3300005614 | Ga0068856_100620865 | Ga0068856_1006208653 | 68 |
| 170 | 3300005616 | Ga0068852_100001276 | Ga0068852_1000012764 | 68 |
| 171 | 3300005616 | Ga0068852_100187094 | Ga0068852_1001870944 | 68 |
| 172 | 3300005616 | Ga0068852_100210428 | Ga0068852_1002104284 | 68 |
| 173 | 3300005616 | Ga0068852_100384086 | Ga0068852_1003840863 | 68 |
| 174 | 3300005616 | Ga0068852_100442281 | Ga0068852_1004422813 | 68 |
| 175 | 3300005616 | Ga0068852_100670318 | Ga0068852_1006703183 | 68 |
| 176 | 3300005617 | Ga0068859_100003101 | Ga0068859_1000031015 | 68 |
| 177 | 3300005617 | Ga0068859_100003140 | Ga0068859_10000314018 | 68 |
| 178 | 3300005617 | Ga0068859_100005086 | Ga0068859_1000050866 | 68 |
| 179 | 3300005617 | Ga0068859_100126303 | Ga0068859_1001263033 | 68 |
| 180 | 3300005617 | Ga0068859_100315109 | Ga0068859_1003151094 | 68 |
| 181 | 3300005618 | Ga0068864_100000183 | Ga0068864_10000018349 | 68 |
| 182 | 3300005618 | Ga0068864_100001051 | Ga0068864_10000105125 | 68 |
| 183 | 3300005618 | Ga0068864_100001150 | Ga0068864_10000115014 | 68 |
| 184 | 3300005618 | Ga0068864_100002014 | Ga0068864_10000201411 | 68 |
| 185 | 3300005718 | Ga0068866_10456153 | Ga0068866_104561532 | 68 |
| 186 | 3300005719 | Ga0068861_100000687 | Ga0068861_1000006879 | 68 |
| 187 | 3300005719 | Ga0068861_100010768 | Ga0068861_1000107684 | 68 |
| 188 | 3300005719 | Ga0068861_100051576 | Ga0068861_1000515765 | 68 |
| 189 | 3300005834 | Ga0068851_10142940 | Ga0068851_101429403 | 68 |
| 190 | 3300005841 | Ga0068863_100002515 | Ga0068863_1000025152 | 68 |
| 191 | 3300005841 | Ga0068863_100012020 | Ga0068863_1000120207 | 68 |
| 192 | 3300005841 | Ga0068863_100036402 | Ga0068863_1000364023 | 68 |
| 193 | 3300005841 | Ga0068863_100039200 | Ga0068863_1000392002 | 68 |
| 194 | 3300005841 | Ga0068863_100059963 | Ga0068863_1000599631 | 68 |
| 195 | 3300005841 | Ga0068863_101300127 | Ga0068863_1013001271 | 68 |
| 196 | 3300005841 | Ga0068863_101560397 | Ga0068863_1015603972 | 68 |
| 197 | 3300005842 | Ga0068858_100000920 | Ga0068858_10000092010 | 68 |
| 198 | 3300005842 | Ga0068858_100002212 | Ga0068858_1000022126 | 68 |
| 199 | 3300005842 | Ga0068858_100004181 | Ga0068858_1000041816 | 68 |
| 200 | 3300005842 | Ga0068858_100004950 | Ga0068858_1000049503 | 68 |
| 201 | 3300005843 | Ga0068860_100000068 | Ga0068860_10000006818 | 68 |
| 202 | 3300005843 | Ga0068860_100002805 | Ga0068860_10000280514 | 68 |
| 203 | 3300005843 | Ga0068860_100003455 | Ga0068860_1000034556 | 68 |
| 204 | 3300005843 | Ga0068860_100009225 | Ga0068860_1000092258 | 68 |
| 205 | 3300005843 | Ga0068860_100049782 | Ga0068860_1000497821 | 68 |
| 206 | 3300005843 | Ga0068860_100741843 | Ga0068860_1007418432 | 68 |
| 207 | 3300005843 | Ga0068860_101543844 | Ga0068860_1015438441 | 68 |
| 208 | 3300005843 | Ga0068860_102651255 | Ga0068860_1026512552 | 68 |
| 209 | 3300005844 | Ga0068862_100000006 | Ga0068862_10000000632 | 68 |
| 210 | 3300005844 | Ga0068862_100000160 | Ga0068862_10000016013 | 68 |
| 211 | 3300005844 | Ga0068862_100000894 | Ga0068862_10000089431 | 68 |
| 212 | 3300005844 | Ga0068862_100007026 | Ga0068862_10000702610 | 68 |
| 213 | 3300005844 | Ga0068862_100017369 | Ga0068862_1000173692 | 68 |
| 214 | 3300005844 | Ga0068862_100047193 | Ga0068862_1000471932 | 68 |
| 215 | 3300006051 | Ga0075364_10425274 | Ga0075364_104252742 | 68 |
| 216 | 3300006195 | Ga0075366_10112303 | Ga0075366_101123033 | 68 |
| 217 | 3300006195 | Ga0075366_10747121 | Ga0075366_107471212 | 68 |
| 218 | 3300006353 | Ga0075370_10142822 | Ga0075370_101428223 | 68 |
| 219 | 3300006881 | Ga0068865_100000004 | Ga0068865_100000004203 | 68 |
| 220 | 3300006881 | Ga0068865_101806364 | Ga0068865_1018063642 | 68 |
| 221 | 3300006931 | Ga0097620_100003101 | Ga0097620_10000310120 | 68 |
| 222 | 3300006931 | Ga0097620_100003140 | Ga0097620_10000314018 | 68 |
| 223 | 3300006931 | Ga0097620_100005086 | Ga0097620_10000508616 | 68 |
| 224 | 3300006931 | Ga0097620_100126299 | Ga0097620_1001262993 | 68 |
| 225 | 3300006931 | Ga0097620_100315118 | Ga0097620_1003151184 | 68 |
| 226 | 3300006946 | Ga0079104_1068043 | Ga0079104_10680433 | 68 |
| 227 | 3300007076 | Ga0075435_100728405 | Ga0075435_1007284051 | 68 |
| 228 | 3300009011 | Ga0105251_10004083 | Ga0105251_1000408315 | 68 |
| 229 | 3300009011 | Ga0105251_10114818 | Ga0105251_101148181 | 68 |
| 230 | 3300009011 | Ga0105251_10157131 | Ga0105251_101571311 | 68 |
| 231 | 3300009092 | Ga0105250_10281365 | Ga0105250_102813652 | 68 |
| 232 | 3300009093 | Ga0105240_10058338 | Ga0105240_100583389 | 68 |
| 233 | 3300009093 | Ga0105240_10594745 | Ga0105240_105947453 | 68 |
| 234 | 3300009093 | Ga0105240_11325424 | Ga0105240_113254243 | 68 |
| 235 | 3300009098 | Ga0105245_10004262 | Ga0105245_100042623 | 68 |
| 236 | 3300009101 | Ga0105247_10002301 | Ga0105247_100023016 | 68 |
| 237 | 3300009101 | Ga0105247_10003906 | Ga0105247_100039069 | 68 |
| 238 | 3300009101 | Ga0105247_10074686 | Ga0105247_100746861 | 68 |
| 239 | 3300009101 | Ga0105247_10900589 | Ga0105247_109005891 | 68 |
| 240 | 3300009148 | Ga0105243_10000146 | Ga0105243_100001469 | 68 |
| 241 | 3300009148 | Ga0105243_10149830 | Ga0105243_101498301 | 68 |
| 242 | 3300009174 | Ga0105241_10166380 | Ga0105241_101663802 | 68 |
| 243 | 3300009174 | Ga0105241_10863534 | Ga0105241_108635341 | 68 |
| 244 | 3300009174 | Ga0105241_11234489 | Ga0105241_112344892 | 68 |
| 245 | 3300009176 | Ga0105242_10000497 | Ga0105242_1000049736 | 68 |
| 246 | 3300009177 | Ga0105248_10000016 | Ga0105248_1000001627 | 68 |
| 247 | 3300009177 | Ga0105248_10003803 | Ga0105248_1000380320 | 68 |
| 248 | 3300009177 | Ga0105248_10030756 | Ga0105248_100307562 | 68 |
| 249 | 3300009177 | Ga0105248_10046039 | Ga0105248_100460394 | 68 |
| 250 | 3300009177 | Ga0105248_10046883 | Ga0105248_100468833 | 68 |
| 251 | 3300009177 | Ga0105248_10047627 | Ga0105248_100476272 | 68 |
| 252 | 3300009177 | Ga0105248_10056537 | Ga0105248_100565374 | 68 |
| 253 | 3300009177 | Ga0105248_10306743 | Ga0105248_103067432 | 68 |
| 254 | 3300009177 | Ga0105248_11444533 | Ga0105248_114445331 | 68 |
| 255 | 3300009545 | Ga0105237_10034455 | Ga0105237_100344553 | 68 |
| 256 | 3300009545 | Ga0105237_10225531 | Ga0105237_102255312 | 68 |
| 257 | 3300009545 | Ga0105237_10658202 | Ga0105237_106582024 | 68 |
| 258 | 3300009551 | Ga0105238_10029748 | Ga0105238_100297484 | 68 |
| 259 | 3300009551 | Ga0105238_10112959 | Ga0105238_101129595 | 68 |
| 260 | 3300009551 | Ga0105238_10117478 | Ga0105238_101174783 | 68 |
| 261 | 3300009551 | Ga0105238_12641540 | Ga0105238_126415401 | 68 |
| 262 | 3300009553 | Ga0105249_10000355 | Ga0105249_1000035512 | 68 |
| 263 | 3300009553 | Ga0105249_10002669 | Ga0105249_1000266910 | 68 |
| 264 | 3300009553 | Ga0105249_10020475 | Ga0105249_100204752 | 68 |
| 265 | 3300009553 | Ga0105249_10040393 | Ga0105249_100403934 | 68 |
| 266 | 3300009553 | Ga0105249_10126707 | Ga0105249_101267072 | 68 |
| 267 | 3300009553 | Ga0105249_10249460 | Ga0105249_102494602 | 68 |
| 268 | 3300010375 | Ga0105239_10169627 | Ga0105239_101696272 | 68 |
| 269 | 3300010375 | Ga0105239_10255811 | Ga0105239_102558112 | 68 |
| 270 | 3300010375 | Ga0105239_10629034 | Ga0105239_106290342 | 68 |
| 271 | 3300010375 | Ga0105239_10802979 | Ga0105239_108029793 | 68 |
| 272 | 3300011119 | Ga0105246_10000138 | Ga0105246_1000013811 | 68 |
| 273 | 3300012513 | Ga0157326_1000736 | Ga0157326_10007361 | 68 |
| 274 | 3300013100 | Ga0157373_11580497 | Ga0157373_115804971 | 68 |
| 275 | 3300013102 | Ga0157371_10000842 | Ga0157371_1000084210 | 68 |
| 276 | 3300013102 | Ga0157371_10019554 | Ga0157371_100195544 | 68 |
| 277 | 3300013102 | Ga0157371_10487946 | Ga0157371_104879463 | 68 |
| 278 | 3300013102 | Ga0157371_10502727 | Ga0157371_105027271 | 68 |
| 279 | 3300013102 | Ga0157371_10559193 | Ga0157371_105591931 | 68 |
| 280 | 3300013104 | Ga0157370_10030422 | Ga0157370_100304222 | 68 |
| 281 | 3300013104 | Ga0157370_10204132 | Ga0157370_102041321 | 68 |
| 282 | 3300013104 | Ga0157370_10800772 | Ga0157370_108007721 | 68 |
| 283 | 3300013104 | Ga0157370_10952631 | Ga0157370_109526312 | 68 |
| 284 | 3300013104 | Ga0157370_11259700 | Ga0157370_112597002 | 68 |
| 285 | 3300013105 | Ga0157369_10135222 | Ga0157369_101352223 | 68 |
| 286 | 3300013105 | Ga0157369_10917871 | Ga0157369_109178713 | 68 |
| 287 | 3300013296 | Ga0157374_10001104 | Ga0157374_1000110417 | 68 |
| 288 | 3300013296 | Ga0157374_10780796 | Ga0157374_107807961 | 68 |
| 289 | 3300013297 | Ga0157378_10006343 | Ga0157378_100063439 | 68 |
| 290 | 3300013297 | Ga0157378_10499395 | Ga0157378_104993952 | 68 |
| 291 | 3300013306 | Ga0163162_10001771 | Ga0163162_1000177113 | 68 |
| 292 | 3300013306 | Ga0163162_10022071 | Ga0163162_100220715 | 68 |
| 293 | 3300013306 | Ga0163162_10188013 | Ga0163162_101880133 | 68 |
| 294 | 3300013306 | Ga0163162_10250658 | Ga0163162_102506582 | 68 |
| 295 | 3300013307 | Ga0157372_10231368 | Ga0157372_102313683 | 68 |
| 296 | 3300013307 | Ga0157372_10238068 | Ga0157372_102380685 | 68 |
| 297 | 3300013307 | Ga0157372_10528323 | Ga0157372_105283233 | 68 |
| 298 | 3300013307 | Ga0157372_10647068 | Ga0157372_106470684 | 68 |
| 299 | 3300013307 | Ga0157372_12347563 | Ga0157372_123475632 | 68 |
| 300 | 3300013308 | Ga0157375_10000587 | Ga0157375_100005875 | 68 |
| 301 | 3300013308 | Ga0157375_10536204 | Ga0157375_105362043 | 68 |
| 302 | 3300014325 | Ga0163163_10047074 | Ga0163163_100470744 | 68 |
| 303 | 3300014325 | Ga0163163_10161643 | Ga0163163_101616435 | 68 |
| 304 | 3300014326 | Ga0157380_10000087 | Ga0157380_1000008741 | 68 |
| 305 | 3300014326 | Ga0157380_10017903 | Ga0157380_100179034 | 68 |
| 306 | 3300014326 | Ga0157380_10188637 | Ga0157380_101886372 | 68 |
| 307 | 3300014326 | Ga0157380_13483673 | Ga0157380_134836732 | 68 |
| 308 | 3300014745 | Ga0157377_11037338 | Ga0157377_110373381 | 68 |
| 309 | 3300014968 | Ga0157379_10074401 | Ga0157379_100744016 | 68 |
| 310 | 3300014968 | Ga0157379_10477506 | Ga0157379_104775062 | 68 |
| 311 | 3300014968 | Ga0157379_11247450 | Ga0157379_112474502 | 68 |
| 312 | 3300014969 | Ga0157376_10000131 | Ga0157376_1000013148 | 68 |
| 313 | 3300017792 | Ga0163161_10002585 | Ga0163161_1000258511 | 68 |
| 314 | 3300017792 | Ga0163161_10620377 | Ga0163161_106203772 | 68 |
| 315 | 3300017792 | Ga0163161_10786492 | Ga0163161_107864922 | 68 |
| 316 | 3300025223 | Ga0207672_1000794 | Ga0207672_10007943 | 68 |
| 317 | 3300025230 | Ga0209563_100024 | Ga0209563_100024108 | 68 |
| 318 | 3300025246 | Ga0209646_1008350 | Ga0209646_10083502 | 68 |
| 319 | 3300025250 | Ga0209026_1012633 | Ga0209026_10126332 | 68 |
| 320 | 3300025254 | Ga0209148_1000008 | Ga0209148_100000888 | 68 |
| 321 | 3300025254 | Ga0209148_1000074 | Ga0209148_1000074221 | 68 |
| 322 | 3300025261 | Ga0209233_1071651 | Ga0209233_10716512 | 68 |
| 323 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021337 | 68 |
| 324 | 3300025272 | Ga0209455_1020563 | Ga0209455_10205632 | 68 |
| 325 | 3300025290 | Ga0207673_1045286 | Ga0207673_10452862 | 68 |
| 326 | 3300025292 | Ga0209676_1000060 | Ga0209676_1000060218 | 68 |
| 327 | 3300025292 | Ga0209676_1000226 | Ga0209676_100022673 | 68 |
| 328 | 3300025297 | Ga0209758_1000017 | Ga0209758_100001730 | 68 |
| 329 | 3300025298 | Ga0209050_1003101 | Ga0209050_10031014 | 68 |
| 330 | 3300025298 | Ga0209050_1102653 | Ga0209050_11026532 | 68 |
| 331 | 3300025304 | Ga0209257_1000392 | Ga0209257_100039266 | 68 |
| 332 | 3300025315 | Ga0207697_10001743 | Ga0207697_100017436 | 68 |
| 333 | 3300025315 | Ga0207697_10367646 | Ga0207697_103676461 | 68 |
| 334 | 3300025735 | Ga0207713_1014886 | Ga0207713_10148862 | 68 |
| 335 | 3300025735 | Ga0207713_1055056 | Ga0207713_10550561 | 68 |
| 336 | 3300025735 | Ga0207713_1178811 | Ga0207713_11788111 | 68 |
| 337 | 3300025899 | Ga0207642_10270610 | Ga0207642_102706103 | 68 |
| 338 | 3300025900 | Ga0207710_10007517 | Ga0207710_1000751710 | 68 |
| 339 | 3300025900 | Ga0207710_10399660 | Ga0207710_103996602 | 68 |
| 340 | 3300025901 | Ga0207688_10216692 | Ga0207688_102166922 | 68 |
| 341 | 3300025901 | Ga0207688_11101321 | Ga0207688_111013211 | 68 |
| 342 | 3300025903 | Ga0207680_10000004 | Ga0207680_1000000417 | 68 |
| 343 | 3300025903 | Ga0207680_10000418 | Ga0207680_1000041819 | 68 |
| 344 | 3300025903 | Ga0207680_10033138 | Ga0207680_100331383 | 68 |
| 345 | 3300025903 | Ga0207680_10099024 | Ga0207680_100990243 | 68 |
| 346 | 3300025903 | Ga0207680_11080810 | Ga0207680_110808101 | 68 |
| 347 | 3300025904 | Ga0207647_10005831 | Ga0207647_100058319 | 68 |
| 348 | 3300025904 | Ga0207647_10023553 | Ga0207647_100235536 | 68 |
| 349 | 3300025904 | Ga0207647_10105475 | Ga0207647_101054754 | 68 |
| 350 | 3300025904 | Ga0207647_10109834 | Ga0207647_101098343 | 68 |
| 351 | 3300025904 | Ga0207647_10426139 | Ga0207647_104261391 | 68 |
| 352 | 3300025904 | Ga0207647_10462163 | Ga0207647_104621631 | 68 |
| 353 | 3300025904 | Ga0207647_10774541 | Ga0207647_107745412 | 68 |
| 354 | 3300025907 | Ga0207645_10009635 | Ga0207645_100096358 | 68 |
| 355 | 3300025909 | Ga0207705_10000084 | Ga0207705_1000008445 | 68 |
| 356 | 3300025909 | Ga0207705_10308546 | Ga0207705_103085462 | 68 |
| 357 | 3300025911 | Ga0207654_10622447 | Ga0207654_106224472 | 68 |
| 358 | 3300025911 | Ga0207654_10915357 | Ga0207654_109153571 | 68 |
| 359 | 3300025912 | Ga0207707_10752852 | Ga0207707_107528522 | 68 |
| 360 | 3300025913 | Ga0207695_10017127 | Ga0207695_100171276 | 68 |
| 361 | 3300025913 | Ga0207695_10017716 | Ga0207695_100177164 | 68 |
| 362 | 3300025913 | Ga0207695_10125643 | Ga0207695_101256431 | 68 |
| 363 | 3300025913 | Ga0207695_11244698 | Ga0207695_112446981 | 68 |
| 364 | 3300025914 | Ga0207671_10158857 | Ga0207671_101588572 | 68 |
| 365 | 3300025914 | Ga0207671_10219883 | Ga0207671_102198833 | 68 |
| 366 | 3300025914 | Ga0207671_11571874 | Ga0207671_115718741 | 68 |
| 367 | 3300025917 | Ga0207660_10003071 | Ga0207660_100030719 | 68 |
| 368 | 3300025917 | Ga0207660_10287202 | Ga0207660_102872024 | 68 |
| 369 | 3300025919 | Ga0207657_10004951 | Ga0207657_100049517 | 68 |
| 370 | 3300025919 | Ga0207657_10074466 | Ga0207657_100744662 | 68 |
| 371 | 3300025919 | Ga0207657_10218235 | Ga0207657_102182352 | 68 |
| 372 | 3300025920 | Ga0207649_10025862 | Ga0207649_100258622 | 68 |
| 373 | 3300025920 | Ga0207649_10124038 | Ga0207649_101240381 | 68 |
| 374 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001254 | 68 |
| 375 | 3300025921 | Ga0207652_10000002 | Ga0207652_10000002473 | 68 |
| 376 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001706 | 68 |
| 377 | 3300025923 | Ga0207681_10000008 | Ga0207681_10000008109 | 68 |
| 378 | 3300025923 | Ga0207681_10000704 | Ga0207681_1000070415 | 68 |
| 379 | 3300025923 | Ga0207681_10016779 | Ga0207681_100167795 | 68 |
| 380 | 3300025923 | Ga0207681_10069647 | Ga0207681_100696473 | 68 |
| 381 | 3300025923 | Ga0207681_11835153 | Ga0207681_118351531 | 68 |
| 382 | 3300025924 | Ga0207694_10011474 | Ga0207694_100114746 | 68 |
| 383 | 3300025924 | Ga0207694_10087112 | Ga0207694_100871125 | 68 |
| 384 | 3300025924 | Ga0207694_10897574 | Ga0207694_108975742 | 68 |
| 385 | 3300025924 | Ga0207694_11302166 | Ga0207694_113021662 | 68 |
| 386 | 3300025924 | Ga0207694_11597144 | Ga0207694_115971442 | 68 |
| 387 | 3300025925 | Ga0207650_10000050 | Ga0207650_1000005049 | 68 |
| 388 | 3300025925 | Ga0207650_10002940 | Ga0207650_100029403 | 68 |
| 389 | 3300025925 | Ga0207650_10015038 | Ga0207650_100150386 | 68 |
| 390 | 3300025925 | Ga0207650_10268055 | Ga0207650_102680553 | 68 |
| 391 | 3300025925 | Ga0207650_10544903 | Ga0207650_105449031 | 68 |
| 392 | 3300025927 | Ga0207687_10039071 | Ga0207687_100390714 | 68 |
| 393 | 3300025931 | Ga0207644_10000006 | Ga0207644_1000000699 | 68 |
| 394 | 3300025931 | Ga0207644_10000028 | Ga0207644_1000002817 | 68 |
| 395 | 3300025931 | Ga0207644_10000124 | Ga0207644_1000012438 | 68 |
| 396 | 3300025931 | Ga0207644_10000292 | Ga0207644_1000029217 | 68 |
| 397 | 3300025931 | Ga0207644_10001291 | Ga0207644_100012915 | 68 |
| 398 | 3300025931 | Ga0207644_10127663 | Ga0207644_101276635 | 68 |
| 399 | 3300025932 | Ga0207690_10126488 | Ga0207690_101264882 | 68 |
| 400 | 3300025932 | Ga0207690_10520785 | Ga0207690_105207852 | 68 |
| 401 | 3300025932 | Ga0207690_10691990 | Ga0207690_106919902 | 68 |
| 402 | 3300025933 | Ga0207706_10107769 | Ga0207706_101077691 | 68 |
| 403 | 3300025933 | Ga0207706_10305191 | Ga0207706_103051913 | 68 |
| 404 | 3300025933 | Ga0207706_10502254 | Ga0207706_105022542 | 68 |
| 405 | 3300025934 | Ga0207686_10004317 | Ga0207686_100043172 | 68 |
| 406 | 3300025935 | Ga0207709_10001457 | Ga0207709_100014579 | 68 |
| 407 | 3300025935 | Ga0207709_10098211 | Ga0207709_100982113 | 68 |
| 408 | 3300025936 | Ga0207670_10053948 | Ga0207670_100539483 | 68 |
| 409 | 3300025937 | Ga0207669_11768099 | Ga0207669_117680991 | 68 |
| 410 | 3300025938 | Ga0207704_10000005 | Ga0207704_1000000510 | 68 |
| 411 | 3300025938 | Ga0207704_11783806 | Ga0207704_117838061 | 68 |
| 412 | 3300025940 | Ga0207691_10341864 | Ga0207691_103418643 | 68 |
| 413 | 3300025941 | Ga0207711_10000022 | Ga0207711_1000002227 | 68 |
| 414 | 3300025941 | Ga0207711_10000662 | Ga0207711_100006622 | 68 |
| 415 | 3300025941 | Ga0207711_10026087 | Ga0207711_100260874 | 68 |
| 416 | 3300025941 | Ga0207711_10055697 | Ga0207711_100556974 | 68 |
| 417 | 3300025941 | Ga0207711_10094318 | Ga0207711_100943182 | 68 |
| 418 | 3300025941 | Ga0207711_10276754 | Ga0207711_102767542 | 68 |
| 419 | 3300025941 | Ga0207711_10309852 | Ga0207711_103098523 | 68 |
| 420 | 3300025941 | Ga0207711_10623807 | Ga0207711_106238072 | 68 |
| 421 | 3300025941 | Ga0207711_11522888 | Ga0207711_115228881 | 68 |
| 422 | 3300025942 | Ga0207689_10001653 | Ga0207689_1000165310 | 68 |
| 423 | 3300025945 | Ga0207679_10080824 | Ga0207679_100808244 | 68 |
| 424 | 3300025949 | Ga0207667_10014616 | Ga0207667_100146162 | 68 |
| 425 | 3300025949 | Ga0207667_10254280 | Ga0207667_102542803 | 68 |
| 426 | 3300025960 | Ga0207651_10000007 | Ga0207651_1000000710 | 68 |
| 427 | 3300025960 | Ga0207651_11901788 | Ga0207651_119017881 | 68 |
| 428 | 3300025961 | Ga0207712_10000072 | Ga0207712_10000072109 | 68 |
| 429 | 3300025961 | Ga0207712_10017601 | Ga0207712_100176016 | 68 |
| 430 | 3300025961 | Ga0207712_10021578 | Ga0207712_100215786 | 68 |
| 431 | 3300025961 | Ga0207712_10072291 | Ga0207712_100722912 | 68 |
| 432 | 3300025961 | Ga0207712_10108640 | Ga0207712_101086403 | 68 |
| 433 | 3300025972 | Ga0207668_10000026 | Ga0207668_1000002624 | 68 |
| 434 | 3300025972 | Ga0207668_10000675 | Ga0207668_100006752 | 68 |
| 435 | 3300025972 | Ga0207668_10003566 | Ga0207668_100035665 | 68 |
| 436 | 3300025972 | Ga0207668_10056114 | Ga0207668_100561143 | 68 |
| 437 | 3300025972 | Ga0207668_10095417 | Ga0207668_100954173 | 68 |
| 438 | 3300025981 | Ga0207640_10012065 | Ga0207640_100120655 | 68 |
| 439 | 3300025981 | Ga0207640_10012353 | Ga0207640_100123534 | 68 |
| 440 | 3300025981 | Ga0207640_10074303 | Ga0207640_100743032 | 68 |
| 441 | 3300025981 | Ga0207640_10081128 | Ga0207640_100811285 | 68 |
| 442 | 3300025981 | Ga0207640_10443045 | Ga0207640_104430452 | 68 |
| 443 | 3300025981 | Ga0207640_10526714 | Ga0207640_105267143 | 68 |
| 444 | 3300025981 | Ga0207640_10872620 | Ga0207640_108726202 | 68 |
| 445 | 3300025986 | Ga0207658_10000002 | Ga0207658_100000021068 | 68 |
| 446 | 3300025986 | Ga0207658_10000608 | Ga0207658_1000060822 | 68 |
| 447 | 3300025986 | Ga0207658_10000967 | Ga0207658_100009677 | 68 |
| 448 | 3300025986 | Ga0207658_10001977 | Ga0207658_1000197712 | 68 |
| 449 | 3300025986 | Ga0207658_10003917 | Ga0207658_100039173 | 68 |
| 450 | 3300025986 | Ga0207658_10082023 | Ga0207658_100820235 | 68 |
| 451 | 3300026023 | Ga0207677_10001155 | Ga0207677_100011553 | 68 |
| 452 | 3300026035 | Ga0207703_10000849 | Ga0207703_1000084925 | 68 |
| 453 | 3300026035 | Ga0207703_10002381 | Ga0207703_100023818 | 68 |
| 454 | 3300026035 | Ga0207703_10010115 | Ga0207703_100101157 | 68 |
| 455 | 3300026035 | Ga0207703_10011114 | Ga0207703_100111146 | 68 |
| 456 | 3300026041 | Ga0207639_10093564 | Ga0207639_100935642 | 68 |
| 457 | 3300026041 | Ga0207639_10300634 | Ga0207639_103006342 | 68 |
| 458 | 3300026041 | Ga0207639_10385948 | Ga0207639_103859482 | 68 |
| 459 | 3300026041 | Ga0207639_10391395 | Ga0207639_103913952 | 68 |
| 460 | 3300026041 | Ga0207639_10846840 | Ga0207639_108468402 | 68 |
| 461 | 3300026067 | Ga0207678_10644277 | Ga0207678_106442771 | 68 |
| 462 | 3300026067 | Ga0207678_10802608 | Ga0207678_108026082 | 68 |
| 463 | 3300026078 | Ga0207702_10013739 | Ga0207702_100137392 | 68 |
| 464 | 3300026078 | Ga0207702_10049546 | Ga0207702_100495466 | 68 |
| 465 | 3300026078 | Ga0207702_11819071 | Ga0207702_118190711 | 68 |
| 466 | 3300026088 | Ga0207641_10000179 | Ga0207641_1000017963 | 68 |
| 467 | 3300026088 | Ga0207641_10001414 | Ga0207641_1000141425 | 68 |
| 468 | 3300026088 | Ga0207641_10010071 | Ga0207641_100100712 | 68 |
| 469 | 3300026088 | Ga0207641_10027742 | Ga0207641_100277423 | 68 |
| 470 | 3300026088 | Ga0207641_10201653 | Ga0207641_102016532 | 68 |
| 471 | 3300026089 | Ga0207648_10000005 | Ga0207648_1000000511 | 68 |
| 472 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004346 | 68 |
| 473 | 3300026095 | Ga0207676_10000040 | Ga0207676_1000004046 | 68 |
| 474 | 3300026095 | Ga0207676_10000190 | Ga0207676_1000019047 | 68 |
| 475 | 3300026095 | Ga0207676_10000613 | Ga0207676_100006136 | 68 |
| 476 | 3300026095 | Ga0207676_10003561 | Ga0207676_1000356110 | 68 |
| 477 | 3300026095 | Ga0207676_10004335 | Ga0207676_100043356 | 68 |
| 478 | 3300026095 | Ga0207676_11078161 | Ga0207676_110781612 | 68 |
| 479 | 3300026095 | Ga0207676_12624123 | Ga0207676_126241232 | 68 |
| 480 | 3300026116 | Ga0207674_10026868 | Ga0207674_100268683 | 68 |
| 481 | 3300026116 | Ga0207674_10051090 | Ga0207674_100510904 | 68 |
| 482 | 3300026116 | Ga0207674_10161760 | Ga0207674_101617602 | 68 |
| 483 | 3300026116 | Ga0207674_10176484 | Ga0207674_101764843 | 68 |
| 484 | 3300026116 | Ga0207674_10184225 | Ga0207674_101842252 | 68 |
| 485 | 3300026116 | Ga0207674_11877723 | Ga0207674_118777231 | 68 |
| 486 | 3300026118 | Ga0207675_100002079 | Ga0207675_1000020795 | 68 |
| 487 | 3300026118 | Ga0207675_100002340 | Ga0207675_1000023404 | 68 |
| 488 | 3300026118 | Ga0207675_100113823 | Ga0207675_1001138232 | 68 |
| 489 | 3300026118 | Ga0207675_100131973 | Ga0207675_1001319733 | 68 |
| 490 | 3300026118 | Ga0207675_100332869 | Ga0207675_1003328691 | 68 |
| 491 | 3300026118 | Ga0207675_100626001 | Ga0207675_1006260011 | 68 |
| 492 | 3300026142 | Ga0207698_10008334 | Ga0207698_100083346 | 68 |
| 493 | 3300026142 | Ga0207698_10024433 | Ga0207698_100244333 | 68 |
| 494 | 3300026142 | Ga0207698_10059354 | Ga0207698_100593544 | 68 |
| 495 | 3300026142 | Ga0207698_11033527 | Ga0207698_110335271 | 68 |
| 496 | 3300026142 | Ga0207698_11179418 | Ga0207698_111794182 | 68 |
| 497 | 3300026142 | Ga0207698_12527130 | Ga0207698_125271301 | 68 |
| 498 | 3300027364 | Ga0209967_1028934 | Ga0209967_10289341 | 68 |
| 499 | 3300027552 | Ga0209982_1057082 | Ga0209982_10570822 | 68 |
| 500 | 3300027617 | Ga0210002_1084160 | Ga0210002_10841601 | 68 |
| 501 | 3300027682 | Ga0209971_1042566 | Ga0209971_10425662 | 68 |
| 502 | 3300027876 | Ga0209974_10157792 | Ga0209974_101577922 | 68 |
| 503 | 3300027876 | Ga0209974_10227135 | Ga0209974_102271353 | 68 |
| 504 | 3300028379 | Ga0268266_10000009 | Ga0268266_1000000945 | 68 |
| 505 | 3300028379 | Ga0268266_10264270 | Ga0268266_102642702 | 68 |
| 506 | 3300028379 | Ga0268266_10437299 | Ga0268266_104372991 | 68 |
| 507 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002759 | 68 |
| 508 | 3300028380 | Ga0268265_10000171 | Ga0268265_1000017115 | 68 |
| 509 | 3300028380 | Ga0268265_10001260 | Ga0268265_1000126015 | 68 |
| 510 | 3300028380 | Ga0268265_10010758 | Ga0268265_100107584 | 68 |
| 511 | 3300028380 | Ga0268265_10025484 | Ga0268265_100254845 | 68 |
| 512 | 3300028380 | Ga0268265_10187595 | Ga0268265_101875952 | 68 |
| 513 | 3300028381 | Ga0268264_10000006 | Ga0268264_1000000617 | 68 |
| 514 | 3300028381 | Ga0268264_10000103 | Ga0268264_1000010364 | 68 |
| 515 | 3300028381 | Ga0268264_10000221 | Ga0268264_1000022117 | 68 |
| 516 | 3300028381 | Ga0268264_10006519 | Ga0268264_100065197 | 68 |
| 517 | 3300028381 | Ga0268264_10009510 | Ga0268264_100095105 | 68 |
| 518 | 3300028786 | Ga0307517_10206460 | Ga0307517_102064602 | 68 |
| 519 | 3300030731 | Ga0316177_1195044 | Ga0316177_11950444 | 68 |
| 520 | 3300031456 | Ga0307513_10052770 | Ga0307513_100527704 | 68 |
| 521 | 3300031548 | Ga0307408_100251612 | Ga0307408_1002516123 | 68 |
| 522 | 3300031548 | Ga0307408_100742500 | Ga0307408_1007425003 | 68 |
| 523 | 3300031548 | Ga0307408_100825739 | Ga0307408_1008257392 | 68 |
| 524 | 3300031548 | Ga0307408_100980730 | Ga0307408_1009807301 | 68 |
| 525 | 3300031548 | Ga0307408_101083596 | Ga0307408_1010835962 | 68 |
| 526 | 3300031731 | Ga0307405_10113810 | Ga0307405_101138103 | 68 |
| 527 | 3300031731 | Ga0307405_10345560 | Ga0307405_103455601 | 68 |
| 528 | 3300031731 | Ga0307405_10533606 | Ga0307405_105336061 | 68 |
| 529 | 3300031731 | Ga0307405_11527357 | Ga0307405_115273572 | 68 |
| 530 | 3300031731 | Ga0307405_11760669 | Ga0307405_117606692 | 68 |
| 531 | 3300031731 | Ga0307405_12080106 | Ga0307405_120801062 | 68 |
| 532 | 3300031824 | Ga0307413_10103574 | Ga0307413_101035742 | 68 |
| 533 | 3300031824 | Ga0307413_10122485 | Ga0307413_101224854 | 68 |
| 534 | 3300031824 | Ga0307413_10144419 | Ga0307413_101444193 | 68 |
| 535 | 3300031824 | Ga0307413_12026844 | Ga0307413_120268442 | 68 |
| 536 | 3300031824 | Ga0307413_12102964 | Ga0307413_121029641 | 68 |
| 537 | 3300031852 | Ga0307410_10017551 | Ga0307410_100175513 | 68 |
| 538 | 3300031852 | Ga0307410_10034873 | Ga0307410_100348731 | 68 |
| 539 | 3300031852 | Ga0307410_10112306 | Ga0307410_101123064 | 68 |
| 540 | 3300031901 | Ga0307406_10077834 | Ga0307406_100778342 | 68 |
| 541 | 3300031901 | Ga0307406_10202986 | Ga0307406_102029862 | 68 |
| 542 | 3300031901 | Ga0307406_10839995 | Ga0307406_108399951 | 68 |
| 543 | 3300031901 | Ga0307406_11245948 | Ga0307406_112459482 | 68 |
| 544 | 3300031901 | Ga0307406_12058554 | Ga0307406_120585542 | 68 |
| 545 | 3300031903 | Ga0307407_10039033 | Ga0307407_100390332 | 68 |
| 546 | 3300031903 | Ga0307407_10068166 | Ga0307407_100681663 | 68 |
| 547 | 3300031911 | Ga0307412_10012635 | Ga0307412_100126355 | 68 |
| 548 | 3300031911 | Ga0307412_10014477 | Ga0307412_100144774 | 68 |
| 549 | 3300031911 | Ga0307412_10023141 | Ga0307412_100231414 | 68 |
| 550 | 3300031911 | Ga0307412_10041279 | Ga0307412_100412793 | 68 |
| 551 | 3300031911 | Ga0307412_10134074 | Ga0307412_101340742 | 68 |
| 552 | 3300031911 | Ga0307412_10238317 | Ga0307412_102383172 | 68 |
| 553 | 3300031911 | Ga0307412_10279749 | Ga0307412_102797492 | 68 |
| 554 | 3300031911 | Ga0307412_10346062 | Ga0307412_103460622 | 68 |
| 555 | 3300031911 | Ga0307412_10591208 | Ga0307412_105912081 | 68 |
| 556 | 3300031911 | Ga0307412_10683218 | Ga0307412_106832181 | 68 |
| 557 | 3300031911 | Ga0307412_11359105 | Ga0307412_113591051 | 68 |
| 558 | 3300031995 | Ga0307409_100104733 | Ga0307409_1001047334 | 68 |
| 559 | 3300031995 | Ga0307409_100121157 | Ga0307409_1001211572 | 68 |
| 560 | 3300031995 | Ga0307409_100188343 | Ga0307409_1001883434 | 68 |
| 561 | 3300032002 | Ga0307416_100081670 | Ga0307416_1000816703 | 68 |
| 562 | 3300032002 | Ga0307416_100276738 | Ga0307416_1002767384 | 68 |
| 563 | 3300032002 | Ga0307416_100606780 | Ga0307416_1006067802 | 68 |
| 564 | 3300032002 | Ga0307416_100926260 | Ga0307416_1009262602 | 68 |
| 565 | 3300032002 | Ga0307416_101514025 | Ga0307416_1015140252 | 68 |
| 566 | 3300032002 | Ga0307416_103321709 | Ga0307416_1033217091 | 68 |
| 567 | 3300032004 | Ga0307414_10000136 | Ga0307414_1000013638 | 68 |
| 568 | 3300032004 | Ga0307414_10002538 | Ga0307414_100025385 | 68 |
| 569 | 3300032004 | Ga0307414_10013200 | Ga0307414_100132006 | 68 |
| 570 | 3300032004 | Ga0307414_10164710 | Ga0307414_101647102 | 68 |
| 571 | 3300032004 | Ga0307414_10234440 | Ga0307414_102344401 | 68 |
| 572 | 3300032004 | Ga0307414_10391439 | Ga0307414_103914392 | 68 |
| 573 | 3300032004 | Ga0307414_10536328 | Ga0307414_105363282 | 68 |
| 574 | 3300032004 | Ga0307414_10887653 | Ga0307414_108876533 | 68 |
| 575 | 3300032004 | Ga0307414_10951832 | Ga0307414_109518321 | 68 |
| 576 | 3300032004 | Ga0307414_11738626 | Ga0307414_117386262 | 68 |
| 577 | 3300032004 | Ga0307414_11990435 | Ga0307414_119904351 | 68 |
| 578 | 3300032004 | Ga0307414_12085014 | Ga0307414_120850142 | 68 |
| 579 | 3300032005 | Ga0307411_10032530 | Ga0307411_100325302 | 68 |
| 580 | 3300032005 | Ga0307411_10075565 | Ga0307411_100755654 | 68 |
| 581 | 3300032005 | Ga0307411_10092722 | Ga0307411_100927223 | 68 |
| 582 | 3300032005 | Ga0307411_10207421 | Ga0307411_102074212 | 68 |
| 583 | 3300032126 | Ga0307415_100448452 | Ga0307415_1004484522 | 68 |
| 584 | 3300033180 | Ga0307510_10003391 | Ga0307510_1000339116 | 68 |
| 585 | 3300033180 | Ga0307510_10380779 | Ga0307510_103807791 | 68 |
| 586 | 3300034817 | Ga0373948_0169374 | Ga0373948_0169374_138_344 | 68 |
| 587 | 3300035112 | Ga0373932_0015327 | Ga0373932_0015327_457_663 | 68 |
| 588 | 3300035112 | Ga0373932_0246634 | Ga0373932_0246634_217_423 | 68 |
| 589 | 3300035170 | Ga0373943_0230606 | Ga0373943_0230606_567_773 | 68 |
| 590 | 3300035171 | Ga0373946_0058783 | Ga0373946_0058783_449_655 | 68 |
| 591 | 3300035692 | Ga0373935_0301593 | Ga0373935_0301593_509_733 | 68 |
| 592 | 3300035695 | Ga0373927_0107858 | Ga0373927_0107858_1226_1432 | 68 |
| 593 | 3300035725 | Ga0373947_0265446 | Ga0373947_0265446_580_786 | 68 |
| 594 | 3300037312 | Ga0395899_0000738 | Ga0395899_0000738_13293_13499 | 68 |
| 595 | 3300037312 | Ga0395899_0024662 | Ga0395899_0024662_1801_2007 | 68 |
| 596 | 3300037312 | Ga0395899_0134648 | Ga0395899_0134648_196_402 | 68 |
| 597 | 3300037418 | Ga0395900_0143511 | Ga0395900_0143511_1911_2117 | 68 |
| 598 | 3300037418 | Ga0395900_1061371 | Ga0395900_1061371_331_537 | 68 |
| 599 | 3300037418 | Ga0395900_1464595 | Ga0395900_1464595_309_515 | 68 |
| 600 | 3300037418 | Ga0395900_1564069 | Ga0395900_1564069_291_497 | 68 |
| 601 | 3300037471 | Ga0395905_0046291 | Ga0395905_0046291_817_1023 | 68 |
| 602 | 3300037471 | Ga0395905_0060777 | Ga0395905_0060777_2814_3020 | 68 |
| 603 | 3300037471 | Ga0395905_0149090 | Ga0395905_0149090_224_430 | 68 |
| 604 | 3300037471 | Ga0395905_0496828 | Ga0395905_0496828_467_673 | 68 |
| 605 | 3300037471 | Ga0395905_0585702 | Ga0395905_0585702_25_231 | 68 |
| 606 | 3300038443 | Ga0395901_0079992 | Ga0395901_0079992_1129_1335 | 68 |
| 607 | 3300038443 | Ga0395901_0104641 | Ga0395901_0104641_994_1200 | 68 |
| 608 | 3300038443 | Ga0395901_0207081 | Ga0395901_0207081_128_334 | 68 |
| 609 | 3300038443 | Ga0395901_0219501 | Ga0395901_0219501_1758_1964 | 68 |
| 610 | 3300038443 | Ga0395901_1833055 | Ga0395901_1833055_184_390 | 68 |
| 611 | 3300038705 | Ga0237819_00702 | Ga0237819_00702_9391_9597 | 68 |
| 612 | 3300039145 | Ga0237816_00591 | Ga0237816_00591_1145_1351 | 68 |
| 613 | 3300041443 | Ga0451789_0540734 | Ga0451789_0540734_99_305 | 68 |
| 614 | 3300041443 | Ga0451789_0943086 | Ga0451789_0943086_99_305 | 68 |
| 615 | 3300041451 | Ga0451791_1228639 | Ga0451791_1228639_145_351 | 68 |
| 616 | 3300041452 | Ga0451793_0334588 | Ga0451793_0334588_160_366 | 68 |
| 617 | 3300041455 | Ga0451801_01071 | Ga0451801_01071_83_289 | 68 |
| 618 | 3300041456 | Ga0451795_0888193 | Ga0451795_0888193_60_266 | 68 |
| 619 | 3300041460 | Ga0451802_0602411 | Ga0451802_0602411_150_356 | 68 |
| 620 | 3300041461 | Ga0451805_073244 | Ga0451805_073244_326_532 | 68 |
| 621 | 3300041463 | Ga0451804_0674792 | Ga0451804_0674792_178_384 | 68 |
| 622 | 3300041486 | Ga0451807_0682885 | Ga0451807_0682885_374_580 | 68 |
| 623 | 3300041494 | Ga0451837_0232942 | Ga0451837_0232942_151_357 | 68 |
| 624 | 3300041494 | Ga0451837_0932992 | Ga0451837_0932992_68_274 | 68 |
| 625 | 3300041498 | Ga0451841_0723032 | Ga0451841_0723032_22_228 | 68 |
| 626 | 3300041512 | Ga0451853_3164471 | Ga0451853_3164471_159_365 | 68 |
| 627 | 3300042005 | Ga0439448_0002892 | Ga0439448_0002892_1299_1505 | 68 |
| 628 | 3300042006 | Ga0439432_075293 | Ga0439432_075293_67_276 | 68 |
| 629 | 3300042008 | Ga0439450_053772 | Ga0439450_053772_106_312 | 68 |
| 630 | 3300042011 | Ga0439454_027297 | Ga0439454_027297_459_665 | 68 |
| 631 | 3300042012 | Ga0439455_0031210 | Ga0439455_0031210_776_982 | 68 |
| 632 | 3300042157 | Ga0439458_0000411 | Ga0439458_0000411_5897_6103 | 68 |
| 633 | 3300042157 | Ga0439458_0023574 | Ga0439458_0023574_526_732 | 68 |
| 634 | 3300042876 | Ga0451577_0793079 | Ga0451577_0793079_195_401 | 68 |
| 635 | 3300044694 | Ga0466963_0764213 | Ga0466963_0764213_221_427 | 68 |
| 636 | 3300044712 | Ga0453684_0144988 | Ga0453684_0144988_1738_1944 | 68 |
| 637 | 3300044719 | Ga0466971_0013453 | Ga0466971_0013453_513_719 | 68 |
| 638 | 3300044842 | Ga0466957_0060779 | Ga0466957_0060779_458_664 | 68 |
| 639 | 3300045051 | Ga0451576_0287511 | Ga0451576_0287511_1128_1334 | 68 |
| 640 | 3300045051 | Ga0451576_1678546 | Ga0451576_1678546_440_646 | 68 |
| 641 | 3300045836 | Ga0466958_0045403 | Ga0466958_0045403_503_709 | 68 |
| 642 | 3300045976 | Ga0466967_0814319 | Ga0466967_0814319_244_450 | 68 |
| 643 | 3300046454 | Ga0495592_0433362 | Ga0495592_0433362_444_650 | 68 |
| 644 | 3300046460 | Ga0495638_0588644 | Ga0495638_0588644_304_513 | 68 |
| 645 | 3300046501 | Ga0495607_0009991 | Ga0495607_0009991_3254_3460 | 68 |
| 646 | 3300046506 | Ga0495583_0027264 | Ga0495583_0027264_2587_2796 | 68 |
| 647 | 3300046507 | Ga0495606_0032104 | Ga0495606_0032104_2144_2350 | 68 |
| 648 | 3300046507 | Ga0495606_0097322 | Ga0495606_0097322_1567_1773 | 68 |
| 649 | 3300046515 | Ga0495620_0067190 | Ga0495620_0067190_85_291 | 68 |
| 650 | 3300046520 | Ga0495637_0020614 | Ga0495637_0020614_458_664 | 68 |
| 651 | 3300046522 | Ga0495643_0036230 | Ga0495643_0036230_746_952 | 68 |
| 652 | 3300046522 | Ga0495643_0056975 | Ga0495643_0056975_1804_2010 | 68 |
| 653 | 3300046522 | Ga0495643_0159163 | Ga0495643_0159163_522_728 | 68 |
| 654 | 3300046525 | Ga0495663_0044134 | Ga0495663_0044134_1026_1232 | 68 |
| 655 | 3300046530 | Ga0495654_0021389 | Ga0495654_0021389_721_927 | 68 |
| 656 | 3300046538 | Ga0495609_0050693 | Ga0495609_0050693_1266_1472 | 68 |
| 657 | 3300046539 | Ga0495621_0153376 | Ga0495621_0153376_497_703 | 68 |
| 658 | 3300046542 | Ga0495597_0096319 | Ga0495597_0096319_335_541 | 68 |
| 659 | 3300046558 | Ga0495633_0164810 | Ga0495633_0164810_474_680 | 68 |
| 660 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_569462_569668 | 68 |
| 661 | 3300046616 | Ga0495668_0018119 | Ga0495668_0018119_3512_3721 | 68 |
| 662 | 3300046616 | Ga0495668_0027073 | Ga0495668_0027073_860_1066 | 68 |
| 663 | 3300046616 | Ga0495668_0058282 | Ga0495668_0058282_1330_1536 | 68 |
| 664 | 3300046660 | Ga0495625_0008532 | Ga0495625_0008532_629_835 | 68 |
| 665 | 3300046660 | Ga0495625_0042708 | Ga0495625_0042708_733_942 | 68 |
| 666 | 3300046660 | Ga0495625_0284716 | Ga0495625_0284716_161_367 | 68 |
| 667 | 3300046663 | Ga0495635_1093518 | Ga0495635_1093518_153_359 | 68 |
| 668 | 3300046684 | Ga0495669_0132247 | Ga0495669_0132247_787_993 | 68 |
| 669 | 3300046691 | Ga0495670_0300947 | Ga0495670_0300947_430_636 | 68 |
| 670 | 3300046810 | Ga0495660_0183195 | Ga0495660_0183195_212_418 | 68 |
| 671 | 3300047443 | Ga0495687_004335 | Ga0495687_004335_3130_3336 | 68 |
| 672 | 3300047445 | Ga0495677_0119957 | Ga0495677_0119957_21_230 | 68 |
| 673 | 3300048903 | Ga0496100_0721524 | Ga0496100_0721524_162_368 | 68 |
| 674 | 3300048905 | Ga0496102_0234565 | Ga0496102_0234565_657_863 | 68 |
| 675 | 3300048906 | Ga0496103_0061206 | Ga0496103_0061206_2031_2237 | 68 |
| 676 | 3300048906 | Ga0496103_0247355 | Ga0496103_0247355_230_436 | 68 |
| 677 | 3300048907 | Ga0496104_1028999 | Ga0496104_1028999_155_361 | 68 |
| 678 | 3300048910 | Ga0496107_0499920 | Ga0496107_0499920_613_819 | 68 |
| 679 | 3300048916 | Ga0496113_0184797 | Ga0496113_0184797_1431_1637 | 68 |
| 680 | 3300048916 | Ga0496113_0756098 | Ga0496113_0756098_51_257 | 68 |
| 681 | 3300048920 | Ga0496117_0003839 | Ga0496117_0003839_8396_8602 | 68 |
| 682 | 3300048920 | Ga0496117_0007266 | Ga0496117_0007266_5549_5755 | 68 |
| 683 | 3300048920 | Ga0496117_0496874 | Ga0496117_0496874_117_326 | 68 |
| 684 | 3300048921 | Ga0496118_0000901 | Ga0496118_0000901_19142_19348 | 68 |
| 685 | 3300048921 | Ga0496118_0007049 | Ga0496118_0007049_2197_2403 | 68 |
| 686 | 3300048921 | Ga0496118_0042347 | Ga0496118_0042347_3027_3266 | 68 |
| 687 | 3300048921 | Ga0496118_0367527 | Ga0496118_0367527_35_241 | 68 |
| 688 | 3300048921 | Ga0496118_0395273 | Ga0496118_0395273_159_365 | 68 |
| 689 | 3300048924 | Ga0496121_0090548 | Ga0496121_0090548_1105_1311 | 68 |
| 690 | 3300048924 | Ga0496121_0167769 | Ga0496121_0167769_164_370 | 68 |
| 691 | 3300048924 | Ga0496121_0289737 | Ga0496121_0289737_815_1021 | 68 |
| 692 | 3300048925 | Ga0496122_0221186 | Ga0496122_0221186_845_1051 | 68 |
| 693 | 3300048926 | Ga0496123_0029600 | Ga0496123_0029600_2107_2313 | 68 |
| 694 | 3300048926 | Ga0496123_0038218 | Ga0496123_0038218_662_868 | 68 |
| 695 | 3300048927 | Ga0496124_0000192 | Ga0496124_0000192_52478_52687 | 68 |
| 696 | 3300048927 | Ga0496124_0001412 | Ga0496124_0001412_11066_11272 | 68 |
| 697 | 3300048927 | Ga0496124_0028878 | Ga0496124_0028878_1795_2001 | 68 |
| 698 | 3300048927 | Ga0496124_0079741 | Ga0496124_0079741_1661_1867 | 68 |
| 699 | 3300048927 | Ga0496124_0096167 | Ga0496124_0096167_1990_2196 | 68 |
| 700 | 3300048928 | Ga0496125_0066180 | Ga0496125_0066180_1975_2181 | 68 |
| 701 | 3300048928 | Ga0496125_0118299 | Ga0496125_0118299_1049_1255 | 68 |
| 702 | 3300048929 | Ga0496126_0433319 | Ga0496126_0433319_199_408 | 68 |
| 703 | 3300048929 | Ga0496126_1157881 | Ga0496126_1157881_349_555 | 68 |
| 704 | 3300049460 | Ga0495682_0258250 | Ga0495682_0258250_116_322 | 68 |
| 705 | 3300049516 | Ga0501293_012339 | Ga0501293_012339_115_348 | 68 |
| 706 | 3300049521 | Ga0501298_032011 | Ga0501298_032011_546_776 | 68 |
| 707 | 3300049523 | Ga0501300_034092 | Ga0501300_034092_132_365 | 68 |
| 708 | 3300049536 | Ga0501320_012355 | Ga0501320_012355_585_791 | 68 |
| 709 | 3300049536 | Ga0501320_028028 | Ga0501320_028028_111_317 | 68 |
| 710 | 3300049537 | Ga0501321_075558 | Ga0501321_075558_103_309 | 68 |
| 711 | 3300049542 | Ga0501326_14218 | Ga0501326_14218_189_419 | 68 |
| 712 | 3300049549 | Ga0501333_013451 | Ga0501333_013451_106_312 | 68 |
| 713 | 3300049550 | Ga0501334_20069 | Ga0501334_20069_222_428 | 68 |
| 714 | 3300049551 | Ga0501335_039037 | Ga0501335_039037_318_524 | 68 |
| 715 | 3300049552 | Ga0501336_007516 | Ga0501336_007516_516_749 | 68 |
| 716 | 3300049553 | Ga0501337_012984 | Ga0501337_012984_104_310 | 68 |
| 717 | 3300049554 | Ga0501338_09985 | Ga0501338_09985_111_317 | 68 |
| 718 | 3300049569 | Ga0501032_0010668 | Ga0501032_0010668_306_512 | 68 |
| 719 | 3300049569 | Ga0501032_0056543 | Ga0501032_0056543_875_1081 | 68 |
| 720 | 3300049570 | Ga0501033_0001724 | Ga0501033_0001724_158_364 | 68 |
| 721 | 3300049571 | Ga0501034_0004606 | Ga0501034_0004606_10348_10554 | 68 |
| 722 | 3300049572 | Ga0501036_0529121 | Ga0501036_0529121_421_627 | 68 |
| 723 | 3300049572 | Ga0501036_0589414 | Ga0501036_0589414_122_328 | 68 |
| 724 | 3300049572 | Ga0501036_0997233 | Ga0501036_0997233_308_514 | 68 |
| 725 | 3300049574 | Ga0501038_0337306 | Ga0501038_0337306_232_438 | 68 |
| 726 | 3300049578 | Ga0501042_0961576 | Ga0501042_0961576_68_274 | 68 |
| 727 | 3300049579 | Ga0501043_0028300 | Ga0501043_0028300_4003_4209 | 68 |
| 728 | 3300049579 | Ga0501043_0383773 | Ga0501043_0383773_584_790 | 68 |
| 729 | 3300049580 | Ga0501046_1148120 | Ga0501046_1148120_138_344 | 68 |
| 730 | 3300049581 | Ga0501047_0000256 | Ga0501047_0000256_19062_19268 | 68 |
| 731 | 3300049581 | Ga0501047_0026761 | Ga0501047_0026761_3383_3589 | 68 |
| 732 | 3300049581 | Ga0501047_0215173 | Ga0501047_0215173_1385_1591 | 68 |
| 733 | 3300049581 | Ga0501047_0642220 | Ga0501047_0642220_448_654 | 68 |
| 734 | 3300049582 | Ga0501048_0536426 | Ga0501048_0536426_105_311 | 68 |
| 735 | 3300049583 | Ga0501067_0154694 | Ga0501067_0154694_470_676 | 68 |
| 736 | 3300049583 | Ga0501067_0799899 | Ga0501067_0799899_145_351 | 68 |
| 737 | 3300049585 | Ga0501069_0702101 | Ga0501069_0702101_250_456 | 68 |
| 738 | 3300049663 | Ga0501223_030647 | Ga0501223_030647_230_460 | 68 |
| 739 | 3300049686 | Ga0501257_000012 | Ga0501257_000012_5807_6037 | 68 |
| 740 | 3300049742 | Ga0501080_0632248 | Ga0501080_0632248_122_328 | 68 |
| 741 | 3300049744 | Ga0501083_0411979 | Ga0501083_0411979_416_622 | 68 |
| 742 | 3300049764 | Ga0501267_003554 | Ga0501267_003554_942_1148 | 68 |
| 743 | 3300049774 | Ga0501278_006800 | Ga0501278_006800_461_694 | 68 |
| 744 | 3300049776 | Ga0501280_001885 | Ga0501280_001885_885_1118 | 68 |
| 745 | 3300049823 | Ga0501044_0027022 | Ga0501044_0027022_4060_4266 | 68 |
| 746 | 3300049823 | Ga0501044_0383872 | Ga0501044_0383872_121_327 | 68 |
| 747 | 3300050493 | nmdc:mga0k408_49308_c1 | nmdc:mga0k408_49308_c1_1450_1662 | 68 |
| 748 | 3300050496 | nmdc:mga07m45_117405_c1 | nmdc:mga07m45_117405_c1_62_268 | 68 |
| 749 | 3300050513 | nmdc:mga0rr50_905959_c1 | nmdc:mga0rr50_905959_c1_281_487 | 68 |
| 750 | 3300053087 | Ga0500643_000166 | Ga0500643_000166_6022_6228 | 68 |
| 751 | 3300053087 | Ga0500643_000590 | Ga0500643_000590_19747_19953 | 68 |
| 752 | 3300053087 | Ga0500643_001818 | Ga0500643_001818_4624_4830 | 68 |
| 753 | 3300053088 | Ga0500644_0317431 | Ga0500644_0317431_91_297 | 68 |
| 754 | 3300053091 | Ga0500647_0140807 | Ga0500647_0140807_387_593 | 68 |
| 755 | 3300053093 | Ga0500651_0039143 | Ga0500651_0039143_2104_2310 | 68 |
| 756 | 3300053094 | Ga0500566_0059490 | Ga0500566_0059490_281_487 | 68 |
| 757 | 3300053116 | Ga0500592_001082 | Ga0500592_001082_2739_2945 | 68 |
| 758 | 3300053116 | Ga0500592_007979 | Ga0500592_007979_484_690 | 68 |
| 759 | 3300053116 | Ga0500592_028852 | Ga0500592_028852_379_585 | 68 |
| 760 | 3300053125 | Ga0500618_000496 | Ga0500618_000496_7641_7847 | 68 |
| 761 | 3300053125 | Ga0500618_008655 | Ga0500618_008655_776_982 | 68 |
| 762 | 3300053130 | Ga0500642_0001609 | Ga0500642_0001609_4485_4691 | 68 |
| 763 | 3300053131 | Ga0500652_188894 | Ga0500652_188894_385_591 | 68 |
| 764 | 3300053133 | Ga0500655_000399 | Ga0500655_000399_4121_4327 | 68 |
| 765 | 3300053134 | Ga0500658_0004128 | Ga0500658_0004128_2383_2589 | 68 |
| 766 | 3300053134 | Ga0500658_0040535 | Ga0500658_0040535_667_873 | 68 |
| 767 | 3300053139 | Ga0500568_0036013 | Ga0500568_0036013_620_826 | 68 |
| 768 | 3300053142 | Ga0500577_0003903 | Ga0500577_0003903_2306_2512 | 68 |
| 769 | 3300053142 | Ga0500577_0249368 | Ga0500577_0249368_51_257 | 68 |
| 770 | 3300053148 | Ga0500590_004550 | Ga0500590_004550_1148_1354 | 68 |
| 771 | 3300053151 | Ga0500604_0042642 | Ga0500604_0042642_781_987 | 68 |
| 772 | 3300053156 | Ga0500622_0004003 | Ga0500622_0004003_3156_3362 | 68 |
| 773 | 3300053158 | Ga0500627_0000017 | Ga0500627_0000017_48009_48215 | 68 |
| 774 | 3300053158 | Ga0500627_0006961 | Ga0500627_0006961_683_889 | 68 |
| 775 | 3300053158 | Ga0500627_0015857 | Ga0500627_0015857_1573_1779 | 68 |
| 776 | 3300053158 | Ga0500627_0184263 | Ga0500627_0184263_422_628 | 68 |
| 777 | 3300053163 | Ga0500639_087162 | Ga0500639_087162_820_1026 | 68 |
| 778 | 3300053177 | Ga0500636_0051013 | Ga0500636_0051013_2092_2298 | 68 |
| 779 | 3300053178 | Ga0500637_0268426 | Ga0500637_0268426_172_411 | 68 |
| 780 | 3300053724 | Ga0500570_000052 | Ga0500570_000052_7010_7216 | 68 |
| 781 | 3300053730 | Ga0500645_064009 | Ga0500645_064009_554_760 | 68 |
| 782 | 3300060353 | Ga0501082_0275057 | Ga0501082_0275057_1034_1240 | 68 |
| 783 | 3300061719 | Ga0466962_0496147 | Ga0466962_0496147_168_374 | 68 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.8883 | 2 | 68 |
| 3i2z-assembly2.cif.gz_B | structure of cold shock protein e from salmonella typhimurium | 0.8855 | 1 | 68 |
| 6kug-assembly1.cif.gz_A | crystal structure of ybx1 csd with rna | 0.8825 | 2 | 67 |
| 3a0j-assembly2.cif.gz_B | crystal structure of cold shock protein 1 from thermus thermophilus hb8 | 0.8795 | 1 | 65 |
| 3pf5-assembly2.cif.gz_B | crystal structure of bs-cspb in complex with ru6 | 0.8794 | 1 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8891 | 2 | 66 | 2.40.50.140 |
| 2haxA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8836 | 1 | 33 | 2.40.50.140 |
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8777 | 2 | 67 | 2.40.50.140 |
| af_P92186_48_133_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8752 | 2 | 67 | 2.40.50.140 |
| 2lssA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8703 | 2 | 68 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A437GXQ1-F1-model_v4 | Cold-shock protein | 1.006 | 1 | 68 |
GO:0003676
GO:0005829 |
| AF-A0A2E5BVN1-F1-model_v4 | Cold-shock protein | 1.006 | 1 | 68 |
GO:0003676
GO:0005829 |
| AF-A0A7X2FUF1-F1-model_v4 | Cold-shock protein | 1.005 | 1 | 68 |
GO:0003676
GO:0005829 |
| AF-Q2IX68-F1-model_v4 | Cold-shock DNA-binding protein family | 1.005 | 1 | 68 |
GO:0003677
GO:0005829 |
| AF-A0A1H6FIG3-F1-model_v4 | Cold-shock DNA-binding protein family | 1.004 | 1 | 68 |
GO:0003677
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar