F480643

General Info

Members Datasets Scaffolds Average Seq Length
783 334 783 68

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10015462|JGI24737J22298_100154621
Length 81
Sequence LVHARHIWDKDVLMITGTVKFFNXDKGYGFIAPESGSGDAFVHISAVERAGMTTLNKDQRVSYELETDRRGKTSAVNLQAA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
212 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
213 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
216 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
220 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
221 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
222 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
223 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
228 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
277 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
278 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
279 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
305 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
306 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
320 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
331 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0.13
Rhizoplane 2.3
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003022 3300001904 Bacteria 2938
2 JGI24752J21851_1000266 3300001976 Bacteria 7281
3 JGI24752J21851_1006110 3300001976 Bacteria 1573
4 JGI24747J21853_1046519 3300001978 Bacteria 522
5 JGI24740J21852_10040019 3300001979 Bacteria 1424
6 JGI24740J21852_10091332 3300001979 Bacteria 785
7 JGI24740J21852_10115243 3300001979 Bacteria 675
8 JGI24739J22299_10007944 3300001989 Bacteria 3969
9 JGI24739J22299_10009390 3300001989 Bacteria 3644
10 JGI24739J22299_10010059 3300001989 Bacteria 3516
11 JGI24739J22299_10036400 3300001989 Bacteria 1663
12 JGI24739J22299_10052693 3300001989 Bacteria 1308
13 JGI24739J22299_10076252 3300001989 Bacteria 1035
14 JGI24739J22299_10098589 3300001989 Bacteria 883
15 JGI24737J22298_10012233 3300001990 Bacteria 2797
16 JGI24737J22298_10015462 3300001990 Bacteria 2471
17 JGI24737J22298_10037437 3300001990 Bacteria 1495
18 JGI24737J22298_10048579 3300001990 Bacteria 1291
19 JGI24737J22298_10081153 3300001990 Bacteria 965
20 JGI24743J22301_10105922 3300001991 Bacteria 608
21 JGI24735J21928_10002885 3300002067 Bacteria 5917
22 JGI24735J21928_10012414 3300002067 Bacteria 2692
23 JGI24735J21928_10018234 3300002067 Bacteria 2165
24 JGI24735J21928_10021374 3300002067 Bacteria 1976
25 JGI24735J21928_10034580 3300002067 Bacteria 1489
26 JGI24735J21928_10036131 3300002067 Bacteria 1450
27 JGI24735J21928_10062145 3300002067 Bacteria 1073
28 JGI24735J21928_10098471 3300002067 Bacteria 839
29 JGI24750J21931_1000495 3300002070 Bacteria 6183
30 JGI24750J21931_1003646 3300002070 Bacteria 1850
31 JGI24748J21848_1000085 3300002074 Bacteria 28073
32 JGI24748J21848_1024167 3300002074 Bacteria 739
33 JGI24738J21930_10003443 3300002075 Bacteria 3991
34 JGI24749J21850_1000574 3300002076 Bacteria 5352
35 JGI24749J21850_1002773 3300002076 Bacteria 2456
36 JGI24035J26624_1003865 3300002126 Bacteria 1418
37 JGI24034J26672_10000069 3300002239 Bacteria 27837
38 JGI24034J26672_10031560 3300002239 Bacteria 865
39 JGI24742J22300_10003304 3300002244 Bacteria 2612
40 JGI24751J29686_10000797 3300002459 Bacteria 7367
41 JGI24751J29686_10011534 3300002459 Bacteria 1822
42 JGI24751J29686_10055603 3300002459 Bacteria 816
43 Ga0006778J45830_1070616 3300003162 Bacteria 567
44 JGI25153J46596_10000007 3300003215 Bacteria 377573
45 Ga0006777J48905_1067120 3300003308 Bacteria 505
46 Ga0032354_1014098 3300003693 Bacteria 529
47 Ga0055525_1000086 3300003759 Bacteria 150228
48 Ga0055542_1000353 3300003762 Bacteria 48131
49 Ga0055542_1014558 3300003762 Bacteria 1288
50 Ga0055529_1000377 3300003763 Bacteria 48143
51 Ga0055536_1009345 3300003781 Bacteria 4064
52 Ga0055530_10089249 3300003791 Bacteria 635
53 Ga0055531_10002547 3300003794 Bacteria 12120
54 Ga0065707_10143914 3300005295 Bacteria 1737
55 Ga0065707_10160867 3300005295 Bacteria 1564
56 Ga0065707_10198694 3300005295 Bacteria 1322
57 Ga0065707_10317993 3300005295 Bacteria 972
58 Ga0070658_10002621 3300005327 Bacteria 14984
59 Ga0070658_10525018 3300005327 Bacteria 1024
60 Ga0070658_11274513 3300005327 Bacteria 638
61 Ga0070658_11947157 3300005327 Bacteria 507
62 Ga0070676_10000416 3300005328 Bacteria 20088
63 Ga0070683_101912835 3300005329 Bacteria 570
64 Ga0070690_100001137 3300005330 Bacteria 13688
65 Ga0070670_100000178 3300005331 Bacteria 57676
66 Ga0070670_100000867 3300005331 Bacteria 23777
67 Ga0070670_100115168 3300005331 Bacteria 2318
68 Ga0070670_100784296 3300005331 Bacteria 860
69 Ga0068869_100001367 3300005334 Bacteria 14466
70 Ga0068869_100207918 3300005334 Bacteria 1546
71 Ga0070666_10000547 3300005335 Bacteria 22737
72 Ga0070666_10001181 3300005335 Bacteria 15838
73 Ga0070666_10017146 3300005335 Bacteria 4641
74 Ga0070666_10042146 3300005335 Bacteria 3053
75 Ga0070666_10062119 3300005335 Bacteria 2530
76 Ga0070680_100000824 3300005336 Bacteria 21888
77 Ga0070680_100223225 3300005336 Bacteria 1591
78 Ga0068868_100002349 3300005338 Bacteria 13095
79 Ga0070660_100002444 3300005339 Bacteria 12761
80 Ga0070660_100064482 3300005339 Bacteria 2850
81 Ga0070660_100214103 3300005339 Bacteria 1565
82 Ga0070660_101297022 3300005339 Bacteria 618
83 Ga0070689_100032724 3300005340 Bacteria 3957
84 Ga0070661_100737519 3300005344 Bacteria 805
85 Ga0070661_101521032 3300005344 Bacteria 565
86 Ga0070668_100000006 3300005347 Bacteria 176486
87 Ga0070668_100018392 3300005347 Bacteria 5246
88 Ga0070668_100039166 3300005347 Bacteria 3625
89 Ga0070668_100052169 3300005347 Bacteria 3152
90 Ga0070668_100110967 3300005347 Bacteria 2183
91 Ga0070669_100000013 3300005353 Bacteria 210577
92 Ga0070669_100000119 3300005353 Bacteria 73001
93 Ga0070669_100000958 3300005353 Bacteria 21065
94 Ga0070669_100018299 3300005353 Bacteria 5007
95 Ga0070669_100027700 3300005353 Bacteria 4079
96 Ga0070669_101088590 3300005353 Bacteria 688
97 Ga0070671_100000009 3300005355 Bacteria 206508
98 Ga0070671_100000310 3300005355 Bacteria 33094
99 Ga0070671_100012517 3300005355 Bacteria 6832
100 Ga0070671_100047789 3300005355 Bacteria 3557
101 Ga0070671_100268198 3300005355 Bacteria 1451
102 Ga0070673_100000002 3300005364 Bacteria 225084
103 Ga0070673_101932498 3300005364 Bacteria 560
104 Ga0070688_100000708 3300005365 Bacteria 16427
105 Ga0070659_100064697 3300005366 Bacteria 2895
106 Ga0070659_100258787 3300005366 Bacteria 1444
107 Ga0070659_100304107 3300005366 Bacteria 1331
108 Ga0070659_101289555 3300005366 Bacteria 647
109 Ga0070667_100000003 3300005367 Bacteria 447715
110 Ga0070667_100000322 3300005367 Bacteria 53499
111 Ga0070667_100001187 3300005367 Bacteria 23675
112 Ga0070667_100002032 3300005367 Bacteria 17924
113 Ga0070667_100007537 3300005367 Bacteria 9028
114 Ga0070667_100270147 3300005367 Bacteria 1524
115 Ga0070667_100635550 3300005367 Bacteria 985
116 Ga0070705_100006419 3300005440 Bacteria 5767
117 Ga0070694_100481958 3300005444 Bacteria 984
118 Ga0070663_100635083 3300005455 Bacteria 901
119 Ga0070678_100706137 3300005456 Bacteria 909
120 Ga0070662_100117431 3300005457 Bacteria 2035
121 Ga0070662_100174849 3300005457 Bacteria 1689
122 Ga0070662_101015642 3300005457 Bacteria 710
123 Ga0070662_101607683 3300005457 Bacteria 561
124 Ga0070681_10299263 3300005458 Bacteria 1519
125 Ga0068867_100000012 3300005459 Bacteria 118831
126 Ga0070685_10014208 3300005466 Bacteria 4212
127 Ga0070685_11297936 3300005466 Bacteria 556
128 Ga0070706_100495418 3300005467 Bacteria 1137
129 Ga0070679_100000002 3300005530 Bacteria 312066
130 Ga0070679_100814717 3300005530 Bacteria 877
131 Ga0068853_100179289 3300005539 Bacteria 1921
132 Ga0068853_100208917 3300005539 Bacteria 1779
133 Ga0068853_100687291 3300005539 Bacteria 975
134 Ga0068853_100726148 3300005539 Bacteria 948
135 Ga0068853_101085053 3300005539 Bacteria 772
136 Ga0068853_101982473 3300005539 Bacteria 564
137 Ga0070672_100358753 3300005543 Bacteria 1244
138 Ga0070686_100000181 3300005544 Bacteria 44461
139 Ga0070693_100940005 3300005547 Bacteria 650
140 Ga0070665_100000004 3300005548 Bacteria 785500
141 Ga0070665_100375971 3300005548 Bacteria 1428
142 Ga0068855_100001671 3300005563 Bacteria 27748
143 Ga0068855_100009919 3300005563 Bacteria 11484
144 Ga0068855_100808364 3300005563 Bacteria 996
145 Ga0070664_100083389 3300005564 Bacteria 2757
146 Ga0068857_100077096 3300005577 Bacteria 2973
147 Ga0068857_100095350 3300005577 Bacteria 2665
148 Ga0068857_100116808 3300005577 Bacteria 2400
149 Ga0068857_100127781 3300005577 Bacteria 2291
150 Ga0068857_100153758 3300005577 Bacteria 2085
151 Ga0068857_100287427 3300005577 Bacteria 1513
152 Ga0068857_100373036 3300005577 Bacteria 1324
153 Ga0068857_101306776 3300005577 Bacteria 704
154 Ga0068857_102340343 3300005577 Bacteria 524
155 Ga0068854_100014478 3300005578 Bacteria 5200
156 Ga0068854_100018166 3300005578 Bacteria 4717
157 Ga0068854_100026542 3300005578 Bacteria 3982
158 Ga0068854_100055570 3300005578 Bacteria 2850
159 Ga0068854_100257475 3300005578 Bacteria 1396
160 Ga0068854_100296442 3300005578 Bacteria 1307
161 Ga0068854_100558147 3300005578 Bacteria 972
162 Ga0068854_101214845 3300005578 Bacteria 676
163 Ga0068856_100045341 3300005614 Bacteria 4329
164 Ga0068856_100060059 3300005614 Bacteria 3756
165 Ga0068856_100316171 3300005614 Bacteria 1579
166 Ga0068856_100620865 3300005614 Bacteria 1102
167 Ga0068852_100001276 3300005616 Bacteria 16811
168 Ga0068852_100187094 3300005616 Bacteria 1951
169 Ga0068852_100210428 3300005616 Bacteria 1844
170 Ga0068852_100384086 3300005616 Bacteria 1378
171 Ga0068852_100442281 3300005616 Bacteria 1286
172 Ga0068852_100670318 3300005616 Bacteria 1046
173 Ga0068859_100003101 3300005617 Bacteria 16871
174 Ga0068859_100003140 3300005617 Bacteria 16798
175 Ga0068859_100005086 3300005617 Bacteria 13363
176 Ga0068859_100126303 3300005617 Bacteria 2627
177 Ga0068859_100315109 3300005617 Bacteria 1658
178 Ga0068864_100000183 3300005618 Bacteria 57684
179 Ga0068864_100001051 3300005618 Bacteria 23179
180 Ga0068864_100001150 3300005618 Bacteria 22087
181 Ga0068864_100002014 3300005618 Bacteria 16753
182 Ga0068866_10456153 3300005718 Bacteria 837
183 Ga0068861_100000687 3300005719 Bacteria 20197
184 Ga0068861_100010768 3300005719 Bacteria 6357
185 Ga0068861_100051576 3300005719 Bacteria 3123
186 Ga0068851_10142940 3300005834 Bacteria 1302
187 Ga0068863_100002515 3300005841 Bacteria 18207
188 Ga0068863_100012020 3300005841 Bacteria 8364
189 Ga0068863_100036402 3300005841 Bacteria 4688
190 Ga0068863_100039200 3300005841 Bacteria 4508
191 Ga0068863_100059963 3300005841 Bacteria 3600
192 Ga0068863_101300127 3300005841 Bacteria 734
193 Ga0068863_101560397 3300005841 Bacteria 669
194 Ga0068858_100000920 3300005842 Bacteria 30532
195 Ga0068858_100002212 3300005842 Bacteria 19691
196 Ga0068858_100004181 3300005842 Bacteria 14205
197 Ga0068858_100004950 3300005842 Bacteria 13050
198 Ga0068860_100000068 3300005843 Bacteria 179208
199 Ga0068860_100002805 3300005843 Bacteria 18132
200 Ga0068860_100003455 3300005843 Bacteria 16250
201 Ga0068860_100009225 3300005843 Bacteria 9806
202 Ga0068860_100049782 3300005843 Bacteria 3989
203 Ga0068860_100741843 3300005843 Bacteria 993
204 Ga0068860_101543844 3300005843 Bacteria 686
205 Ga0068860_102651255 3300005843 Bacteria 520
206 Ga0068862_100000006 3300005844 Bacteria 346828
207 Ga0068862_100000160 3300005844 Bacteria 74917
208 Ga0068862_100000894 3300005844 Bacteria 28961
209 Ga0068862_100007026 3300005844 Bacteria 9350
210 Ga0068862_100017369 3300005844 Bacteria 5991
211 Ga0068862_100047193 3300005844 Bacteria 3675
212 Ga0075364_10425274 3300006051 Bacteria 907
213 Ga0075366_10112303 3300006195 Bacteria 1640
214 Ga0075366_10302839 3300006195 Bacteria 978
215 Ga0075366_10747121 3300006195 Bacteria 608
216 Ga0075370_10142822 3300006353 Bacteria 1400
217 Ga0068865_100000004 3300006881 Bacteria 226236
218 Ga0068865_101806364 3300006881 Bacteria 552
219 Ga0097620_100003101 3300006931 Bacteria 16871
220 Ga0097620_100003140 3300006931 Bacteria 16798
221 Ga0097620_100005086 3300006931 Bacteria 13363
222 Ga0097620_100126299 3300006931 Bacteria 2627
223 Ga0097620_100315118 3300006931 Bacteria 1658
224 Ga0079104_1068043 3300006946 Bacteria 753
225 Ga0075435_100728405 3300007076 Bacteria 862
226 Ga0105251_10004083 3300009011 Bacteria 10231
227 Ga0105251_10114818 3300009011 Bacteria 1225
228 Ga0105251_10157131 3300009011 Bacteria 1025
229 Ga0105250_10281365 3300009092 Bacteria 716
230 Ga0105240_10058338 3300009093 Bacteria 4819
231 Ga0105240_10594745 3300009093 Bacteria 1219
232 Ga0105240_11325424 3300009093 Bacteria 759
233 Ga0105245_10004262 3300009098 Bacteria 12680
234 Ga0105247_10002301 3300009101 Bacteria 13054
235 Ga0105247_10003906 3300009101 Bacteria 9623
236 Ga0105247_10074686 3300009101 Bacteria 2127
237 Ga0105247_10900589 3300009101 Bacteria 683
238 Ga0105243_10000146 3300009148 Bacteria 81008
239 Ga0105243_10149830 3300009148 Bacteria 2000
240 Ga0105241_10166380 3300009174 Bacteria 1817
241 Ga0105241_10863534 3300009174 Bacteria 838
242 Ga0105241_11234489 3300009174 Bacteria 709
243 Ga0105242_10000497 3300009176 Bacteria 31053
244 Ga0105248_10000016 3300009177 Bacteria 308151
245 Ga0105248_10003803 3300009177 Bacteria 16733
246 Ga0105248_10030756 3300009177 Bacteria 5997
247 Ga0105248_10046039 3300009177 Bacteria 4890
248 Ga0105248_10046883 3300009177 Bacteria 4846
249 Ga0105248_10047627 3300009177 Bacteria 4808
250 Ga0105248_10056537 3300009177 Bacteria 4402
251 Ga0105248_10306743 3300009177 Bacteria 1788
252 Ga0105248_11444533 3300009177 Bacteria 778
253 Ga0105237_10034455 3300009545 Bacteria 5127
254 Ga0105237_10225531 3300009545 Bacteria 1874
255 Ga0105237_10658202 3300009545 Bacteria 1054
256 Ga0105238_10029748 3300009551 Bacteria 5563
257 Ga0105238_10112959 3300009551 Bacteria 2696
258 Ga0105238_10117478 3300009551 Bacteria 2640
259 Ga0105238_12641540 3300009551 Bacteria 538
260 Ga0105249_10000355 3300009553 Bacteria 45955
261 Ga0105249_10002669 3300009553 Bacteria 15422
262 Ga0105249_10020475 3300009553 Bacteria 5913
263 Ga0105249_10040393 3300009553 Bacteria 4238
264 Ga0105249_10126707 3300009553 Bacteria 2432
265 Ga0105249_10249460 3300009553 Bacteria 1759
266 Ga0105239_10169627 3300010375 Bacteria 2440
267 Ga0105239_10255811 3300010375 Bacteria 1967
268 Ga0105239_10629034 3300010375 Bacteria 1225
269 Ga0105239_10802979 3300010375 Bacteria 1078
270 Ga0105246_10000138 3300011119 Bacteria 33809
271 Ga0157326_1000736 3300012513 Bacteria 3838
272 Ga0157373_11580497 3300013100 Bacteria 502
273 Ga0157371_10000842 3300013102 Bacteria 35113
274 Ga0157371_10019554 3300013102 Bacteria 4991
275 Ga0157371_10487946 3300013102 Bacteria 909
276 Ga0157371_10502727 3300013102 Bacteria 895
277 Ga0157371_10559193 3300013102 Bacteria 848
278 Ga0157370_10030422 3300013104 Bacteria 5290
279 Ga0157370_10204132 3300013104 Bacteria 1833
280 Ga0157370_10800772 3300013104 Bacteria 857
281 Ga0157370_10952631 3300013104 Bacteria 778
282 Ga0157370_11259700 3300013104 Bacteria 667
283 Ga0157369_10135222 3300013105 Bacteria 2610
284 Ga0157369_10917871 3300013105 Bacteria 898
285 Ga0157374_10001104 3300013296 Bacteria 23221
286 Ga0157374_10780796 3300013296 Bacteria 971
287 Ga0157378_10006343 3300013297 Bacteria 10349
288 Ga0157378_10499395 3300013297 Bacteria 1215
289 Ga0163162_10001771 3300013306 Bacteria 20235
290 Ga0163162_10022071 3300013306 Bacteria 6272
291 Ga0163162_10188013 3300013306 Bacteria 2192
292 Ga0163162_10250658 3300013306 Bacteria 1902
293 Ga0157372_10231368 3300013307 Bacteria 2143
294 Ga0157372_10238068 3300013307 Bacteria 2112
295 Ga0157372_10528323 3300013307 Bacteria 1375
296 Ga0157372_10647068 3300013307 Bacteria 1231
297 Ga0157372_12347563 3300013307 Bacteria 612
298 Ga0157375_10000587 3300013308 Bacteria 32327
299 Ga0157375_10536204 3300013308 Bacteria 1333
300 Ga0163163_10047074 3300014325 Bacteria 4238
301 Ga0163163_10161643 3300014325 Bacteria 2285
302 Ga0157380_10000087 3300014326 Bacteria 50956
303 Ga0157380_10017903 3300014326 Bacteria 5253
304 Ga0157380_10188637 3300014326 Bacteria 1818
305 Ga0157380_13483673 3300014326 Bacteria 504
306 Ga0157377_11037338 3300014745 Bacteria 624
307 Ga0157379_10074401 3300014968 Bacteria 3041
308 Ga0157379_10477506 3300014968 Bacteria 1153
309 Ga0157379_11247450 3300014968 Bacteria 716
310 Ga0157376_10000131 3300014969 Bacteria 51790
311 Ga0163161_10002585 3300017792 Bacteria 12911
312 Ga0163161_10620377 3300017792 Bacteria 893
313 Ga0163161_10786492 3300017792 Bacteria 798
314 Ga0207672_1000794 3300025223 Bacteria 3371
315 Ga0209563_100024 3300025230 Bacteria 601155
316 Ga0209646_1008350 3300025246 Bacteria 1667
317 Ga0209026_1012633 3300025250 Bacteria 1464
318 Ga0209148_1000008 3300025254 Bacteria 1504371
319 Ga0209148_1000074 3300025254 Bacteria 314356
320 Ga0209233_1071651 3300025261 Bacteria 639
321 Ga0209455_1000002 3300025272 Bacteria 1505459
322 Ga0209455_1020563 3300025272 Bacteria 1302
323 Ga0207673_1045286 3300025290 Bacteria 620
324 Ga0209676_1000060 3300025292 Bacteria 338238
325 Ga0209676_1000226 3300025292 Bacteria 124004
326 Ga0209758_1000017 3300025297 Bacteria 754393
327 Ga0209050_1003101 3300025298 Bacteria 12745
328 Ga0209050_1102653 3300025298 Bacteria 563
329 Ga0209257_1000392 3300025304 Bacteria 87104
330 Ga0207697_10001743 3300025315 Bacteria 11688
331 Ga0207697_10367646 3300025315 Bacteria 639
332 Ga0207713_1014886 3300025735 Bacteria 4014
333 Ga0207713_1055056 3300025735 Bacteria 1555
334 Ga0207713_1178811 3300025735 Bacteria 664
335 Ga0207642_10270610 3300025899 Bacteria 973
336 Ga0207710_10007517 3300025900 Bacteria 4614
337 Ga0207710_10399660 3300025900 Bacteria 705
338 Ga0207688_10216692 3300025901 Bacteria 1152
339 Ga0207688_11101321 3300025901 Bacteria 501
340 Ga0207680_10000004 3300025903 Bacteria 827324
341 Ga0207680_10000418 3300025903 Bacteria 20249
342 Ga0207680_10033138 3300025903 Bacteria 2944
343 Ga0207680_10099024 3300025903 Bacteria 1870
344 Ga0207680_11080810 3300025903 Bacteria 574
345 Ga0207647_10005831 3300025904 Bacteria 8981
346 Ga0207647_10023553 3300025904 Bacteria 4071
347 Ga0207647_10105475 3300025904 Bacteria 1670
348 Ga0207647_10109834 3300025904 Bacteria 1631
349 Ga0207647_10426139 3300025904 Bacteria 745
350 Ga0207647_10462163 3300025904 Bacteria 711
351 Ga0207647_10774541 3300025904 Bacteria 518
352 Ga0207645_10009635 3300025907 Bacteria 6673
353 Ga0207705_10000084 3300025909 Bacteria 116809
354 Ga0207705_10308546 3300025909 Bacteria 1214
355 Ga0207654_10622447 3300025911 Bacteria 771
356 Ga0207654_10915357 3300025911 Bacteria 636
357 Ga0207707_10752852 3300025912 Bacteria 815
358 Ga0207695_10017127 3300025913 Bacteria 8447
359 Ga0207695_10017716 3300025913 Bacteria 8271
360 Ga0207695_10125643 3300025913 Bacteria 2527
361 Ga0207695_11244698 3300025913 Bacteria 624
362 Ga0207671_10158857 3300025914 Bacteria 1749
363 Ga0207671_10219883 3300025914 Bacteria 1488
364 Ga0207671_11571874 3300025914 Bacteria 506
365 Ga0207660_10003071 3300025917 Bacteria 10911
366 Ga0207660_10287202 3300025917 Bacteria 1307
367 Ga0207657_10004951 3300025919 Bacteria 14018
368 Ga0207657_10074466 3300025919 Bacteria 2867
369 Ga0207657_10218235 3300025919 Bacteria 1529
370 Ga0207649_10025862 3300025920 Bacteria 3428
371 Ga0207649_10124038 3300025920 Bacteria 1745
372 Ga0207652_10000001 3300025921 Bacteria 1006643
373 Ga0207652_10000002 3300025921 Bacteria 878035
374 Ga0207681_10000001 3300025923 Bacteria 1105841
375 Ga0207681_10000008 3300025923 Bacteria 414329
376 Ga0207681_10000704 3300025923 Bacteria 21968
377 Ga0207681_10016779 3300025923 Bacteria 4588
378 Ga0207681_10069647 3300025923 Bacteria 2447
379 Ga0207681_11835153 3300025923 Bacteria 505
380 Ga0207694_10011474 3300025924 Bacteria 6688
381 Ga0207694_10087112 3300025924 Bacteria 2459
382 Ga0207694_10897574 3300025924 Bacteria 749
383 Ga0207694_11302166 3300025924 Bacteria 614
384 Ga0207694_11597144 3300025924 Bacteria 550
385 Ga0207650_10000050 3300025925 Bacteria 169589
386 Ga0207650_10002940 3300025925 Bacteria 11754
387 Ga0207650_10015038 3300025925 Bacteria 5383
388 Ga0207650_10268055 3300025925 Bacteria 1387
389 Ga0207650_10544903 3300025925 Bacteria 972
390 Ga0207687_10039071 3300025927 Bacteria 3247
391 Ga0207644_10000006 3300025931 Bacteria 408793
392 Ga0207644_10000028 3300025931 Bacteria 142921
393 Ga0207644_10000124 3300025931 Bacteria 56579
394 Ga0207644_10000292 3300025931 Bacteria 33037
395 Ga0207644_10001291 3300025931 Bacteria 16119
396 Ga0207644_10127663 3300025931 Bacteria 1943
397 Ga0207690_10126488 3300025932 Bacteria 1864
398 Ga0207690_10520785 3300025932 Bacteria 964
399 Ga0207690_10691990 3300025932 Bacteria 838
400 Ga0207706_10107769 3300025933 Bacteria 2451
401 Ga0207706_10305191 3300025933 Bacteria 1386
402 Ga0207706_10502254 3300025933 Bacteria 1047
403 Ga0207686_10004317 3300025934 Bacteria 7623
404 Ga0207709_10001457 3300025935 Bacteria 16479
405 Ga0207709_10098211 3300025935 Bacteria 1930
406 Ga0207670_10053948 3300025936 Bacteria 2710
407 Ga0207669_11768099 3300025937 Bacteria 528
408 Ga0207704_10000005 3300025938 Bacteria 225353
409 Ga0207704_11783806 3300025938 Bacteria 529
410 Ga0207691_10341864 3300025940 Bacteria 1281
411 Ga0207711_10000022 3300025941 Bacteria 340441
412 Ga0207711_10000662 3300025941 Bacteria 34294
413 Ga0207711_10026087 3300025941 Bacteria 4902
414 Ga0207711_10055697 3300025941 Bacteria 3395
415 Ga0207711_10094318 3300025941 Bacteria 2637
416 Ga0207711_10276754 3300025941 Bacteria 1545
417 Ga0207711_10309852 3300025941 Bacteria 1457
418 Ga0207711_10623807 3300025941 Bacteria 1006
419 Ga0207711_11522888 3300025941 Bacteria 612
420 Ga0207689_10001653 3300025942 Bacteria 21135
421 Ga0207679_10080824 3300025945 Bacteria 2483
422 Ga0207667_10014616 3300025949 Bacteria 8939
423 Ga0207667_10254280 3300025949 Bacteria 1797
424 Ga0207651_10000007 3300025960 Bacteria 225286
425 Ga0207651_11901788 3300025960 Bacteria 535
426 Ga0207712_10000072 3300025961 Bacteria 124006
427 Ga0207712_10017601 3300025961 Bacteria 4645
428 Ga0207712_10021578 3300025961 Bacteria 4229
429 Ga0207712_10072291 3300025961 Bacteria 2483
430 Ga0207712_10108640 3300025961 Bacteria 2076
431 Ga0207668_10000026 3300025972 Bacteria 128309
432 Ga0207668_10000675 3300025972 Bacteria 20963
433 Ga0207668_10003566 3300025972 Bacteria 9144
434 Ga0207668_10056114 3300025972 Bacteria 2742
435 Ga0207668_10095417 3300025972 Bacteria 2195
436 Ga0207640_10012065 3300025981 Bacteria 4912
437 Ga0207640_10012353 3300025981 Bacteria 4860
438 Ga0207640_10074303 3300025981 Bacteria 2300
439 Ga0207640_10081128 3300025981 Bacteria 2217
440 Ga0207640_10443045 3300025981 Bacteria 1068
441 Ga0207640_10526714 3300025981 Bacteria 989
442 Ga0207640_10872620 3300025981 Bacteria 784
443 Ga0207658_10000002 3300025986 Bacteria 1364188
444 Ga0207658_10000608 3300025986 Bacteria 31752
445 Ga0207658_10000967 3300025986 Bacteria 23707
446 Ga0207658_10001977 3300025986 Bacteria 15294
447 Ga0207658_10003917 3300025986 Bacteria 10465
448 Ga0207658_10082023 3300025986 Bacteria 2475
449 Ga0207677_10001155 3300026023 Bacteria 14422
450 Ga0207703_10000849 3300026035 Bacteria 29915
451 Ga0207703_10002381 3300026035 Bacteria 16348
452 Ga0207703_10010115 3300026035 Bacteria 7392
453 Ga0207703_10011114 3300026035 Bacteria 7010
454 Ga0207639_10093564 3300026041 Bacteria 2411
455 Ga0207639_10300634 3300026041 Bacteria 1418
456 Ga0207639_10385948 3300026041 Bacteria 1259
457 Ga0207639_10391395 3300026041 Bacteria 1250
458 Ga0207639_10846840 3300026041 Bacteria 853
459 Ga0207678_10644277 3300026067 Bacteria 931
460 Ga0207678_10802608 3300026067 Bacteria 831
461 Ga0207702_10013739 3300026078 Bacteria 6726
462 Ga0207702_10049546 3300026078 Bacteria 3545
463 Ga0207702_11819071 3300026078 Bacteria 601
464 Ga0207641_10000179 3300026088 Bacteria 88061
465 Ga0207641_10001414 3300026088 Bacteria 23667
466 Ga0207641_10010071 3300026088 Bacteria 7773
467 Ga0207641_10027742 3300026088 Bacteria 4677
468 Ga0207641_10201653 3300026088 Bacteria 1834
469 Ga0207648_10000005 3300026089 Bacteria 225083
470 Ga0207676_10000004 3300026095 Bacteria 725417
471 Ga0207676_10000040 3300026095 Bacteria 167947
472 Ga0207676_10000190 3300026095 Bacteria 53850
473 Ga0207676_10000613 3300026095 Bacteria 29202
474 Ga0207676_10003561 3300026095 Bacteria 11002
475 Ga0207676_10004335 3300026095 Bacteria 10037
476 Ga0207676_11078161 3300026095 Bacteria 793
477 Ga0207676_12624123 3300026095 Bacteria 500
478 Ga0207674_10026868 3300026116 Bacteria 6105
479 Ga0207674_10051090 3300026116 Bacteria 4220
480 Ga0207674_10161760 3300026116 Bacteria 2193
481 Ga0207674_10176484 3300026116 Bacteria 2089
482 Ga0207674_10184225 3300026116 Bacteria 2038
483 Ga0207674_11877723 3300026116 Bacteria 565
484 Ga0207675_100002079 3300026118 Bacteria 19902
485 Ga0207675_100002340 3300026118 Bacteria 18785
486 Ga0207675_100113823 3300026118 Bacteria 2554
487 Ga0207675_100131973 3300026118 Bacteria 2369
488 Ga0207675_100332869 3300026118 Bacteria 1485
489 Ga0207675_100626001 3300026118 Bacteria 1081
490 Ga0207698_10008334 3300026142 Bacteria 6548
491 Ga0207698_10024433 3300026142 Bacteria 4241
492 Ga0207698_10059354 3300026142 Bacteria 2970
493 Ga0207698_11033527 3300026142 Bacteria 833
494 Ga0207698_11179418 3300026142 Bacteria 779
495 Ga0207698_12527130 3300026142 Bacteria 524
496 Ga0209967_1028934 3300027364 Bacteria 827
497 Ga0209982_1057082 3300027552 Bacteria 633
498 Ga0210002_1084160 3300027617 Bacteria 568
499 Ga0209971_1042566 3300027682 Bacteria 1094
500 Ga0209974_10157792 3300027876 Bacteria 822
501 Ga0209974_10227135 3300027876 Bacteria 697
502 Ga0268266_10000009 3300028379 Bacteria 1097737
503 Ga0268266_10264270 3300028379 Bacteria 1595
504 Ga0268266_10437299 3300028379 Bacteria 1242
505 Ga0268265_10000002 3300028380 Bacteria 1035381
506 Ga0268265_10000171 3300028380 Bacteria 77721
507 Ga0268265_10001260 3300028380 Bacteria 21840
508 Ga0268265_10010758 3300028380 Bacteria 6178
509 Ga0268265_10025484 3300028380 Bacteria 4199
510 Ga0268265_10187595 3300028380 Bacteria 1782
511 Ga0268264_10000006 3300028381 Bacteria 827324
512 Ga0268264_10000103 3300028381 Bacteria 222439
513 Ga0268264_10000221 3300028381 Bacteria 111397
514 Ga0268264_10006519 3300028381 Bacteria 9831
515 Ga0268264_10009510 3300028381 Bacteria 8051
516 Ga0307517_10206460 3300028786 Bacteria 1218
517 Ga0316177_1195044 3300030731 Bacteria 2153
518 Ga0307513_10052770 3300031456 Bacteria 4376
519 Ga0307408_100251612 3300031548 Bacteria 1458
520 Ga0307408_100742500 3300031548 Bacteria 886
521 Ga0307408_100825739 3300031548 Bacteria 843
522 Ga0307408_100980730 3300031548 Bacteria 778
523 Ga0307408_101083596 3300031548 Bacteria 742
524 Ga0307405_10064549 3300031731 Bacteria 2328
525 Ga0307405_10113810 3300031731 Bacteria 1838
526 Ga0307405_10345560 3300031731 Bacteria 1145
527 Ga0307405_10533606 3300031731 Bacteria 946
528 Ga0307405_11527357 3300031731 Bacteria 587
529 Ga0307405_11760669 3300031731 Bacteria 550
530 Ga0307405_12080106 3300031731 Bacteria 509
531 Ga0307413_10103574 3300031824 Bacteria 1887
532 Ga0307413_10122485 3300031824 Bacteria 1764
533 Ga0307413_10144419 3300031824 Bacteria 1649
534 Ga0307413_12026844 3300031824 Bacteria 519
535 Ga0307413_12102964 3300031824 Bacteria 510
536 Ga0307410_10017551 3300031852 Bacteria 4302
537 Ga0307410_10034873 3300031852 Bacteria 3263
538 Ga0307410_10112306 3300031852 Bacteria 1973
539 Ga0307406_10077834 3300031901 Bacteria 2195
540 Ga0307406_10202986 3300031901 Bacteria 1461
541 Ga0307406_10839995 3300031901 Bacteria 778
542 Ga0307406_11245948 3300031901 Bacteria 647
543 Ga0307406_12058554 3300031901 Bacteria 511
544 Ga0307407_10039033 3300031903 Bacteria 2637
545 Ga0307407_10068166 3300031903 Bacteria 2106
546 Ga0307412_10012635 3300031911 Bacteria 4928
547 Ga0307412_10014477 3300031911 Bacteria 4652
548 Ga0307412_10023141 3300031911 Bacteria 3819
549 Ga0307412_10027831 3300031911 Bacteria 3530
550 Ga0307412_10041279 3300031911 Bacteria 2989
551 Ga0307412_10134074 3300031911 Bacteria 1804
552 Ga0307412_10238317 3300031911 Bacteria 1405
553 Ga0307412_10279749 3300031911 Bacteria 1309
554 Ga0307412_10346062 3300031911 Bacteria 1192
555 Ga0307412_10591208 3300031911 Bacteria 938
556 Ga0307412_10683218 3300031911 Bacteria 879
557 Ga0307412_11359105 3300031911 Bacteria 641
558 Ga0307409_100104733 3300031995 Bacteria 2357
559 Ga0307409_100121157 3300031995 Bacteria 2215
560 Ga0307409_100188343 3300031995 Bacteria 1834
561 Ga0307416_100081670 3300032002 Bacteria 2734
562 Ga0307416_100276738 3300032002 Bacteria 1652
563 Ga0307416_100606780 3300032002 Bacteria 1175
564 Ga0307416_100926260 3300032002 Bacteria 972
565 Ga0307416_101514025 3300032002 Bacteria 777
566 Ga0307416_103321709 3300032002 Bacteria 538
567 Ga0307414_10000136 3300032004 Bacteria 49913
568 Ga0307414_10002538 3300032004 Bacteria 9589
569 Ga0307414_10013200 3300032004 Bacteria 4911
570 Ga0307414_10164710 3300032004 Bacteria 1765
571 Ga0307414_10234440 3300032004 Bacteria 1515
572 Ga0307414_10391439 3300032004 Bacteria 1204
573 Ga0307414_10536328 3300032004 Bacteria 1041
574 Ga0307414_10887653 3300032004 Bacteria 817
575 Ga0307414_10951832 3300032004 Bacteria 789
576 Ga0307414_11738626 3300032004 Bacteria 582
577 Ga0307414_11990435 3300032004 Bacteria 542
578 Ga0307414_12085014 3300032004 Bacteria 529
579 Ga0307411_10032530 3300032005 Bacteria 3223
580 Ga0307411_10075565 3300032005 Bacteria 2300
581 Ga0307411_10092722 3300032005 Bacteria 2113
582 Ga0307411_10207421 3300032005 Bacteria 1510
583 Ga0307415_100448452 3300032126 Bacteria 1115
584 Ga0307510_10003391 3300033180 Bacteria 18599
585 Ga0307510_10380779 3300033180 Bacteria 856
586 Ga0373948_0169374 3300034817 Bacteria 555
587 Ga0373932_0015327 3300035112 Bacteria 1942
588 Ga0373932_0246634 3300035112 Bacteria 650
589 Ga0373943_0230606 3300035170 Bacteria 1034
590 Ga0373946_0058783 3300035171 Bacteria 1630
591 Ga0373935_0301593 3300035692 Bacteria 1132
592 Ga0373927_0107858 3300035695 Bacteria 1814
593 Ga0373947_0265446 3300035725 Bacteria 1138
594 Ga0395899_0000738 3300037312 Bacteria 32643
595 Ga0395899_0024662 3300037312 Bacteria 4545
596 Ga0395899_0134648 3300037312 Bacteria 1762
597 Ga0395900_0143511 3300037418 Bacteria 2443
598 Ga0395900_1061371 3300037418 Bacteria 728
599 Ga0395900_1464595 3300037418 Bacteria 595
600 Ga0395900_1564069 3300037418 Bacteria 571
601 Ga0395905_0046291 3300037471 Bacteria 4079
602 Ga0395905_0060777 3300037471 Bacteria 3533
603 Ga0395905_0149090 3300037471 Bacteria 2200
604 Ga0395905_0496828 3300037471 Bacteria 1120
605 Ga0395905_0585702 3300037471 Bacteria 1017
606 Ga0395901_0079992 3300038443 Bacteria 3412
607 Ga0395901_0104641 3300038443 Bacteria 2970
608 Ga0395901_0207081 3300038443 Bacteria 2054
609 Ga0395901_0219501 3300038443 Bacteria 1987
610 Ga0395901_1833055 3300038443 Bacteria 555
611 Ga0237819_00702 3300038705 Bacteria 10872
612 Ga0237816_00591 3300039145 Bacteria 3070
613 Ga0451789_0540734 3300041443 Bacteria 649
614 Ga0451789_0943086 3300041443 Bacteria 639
615 Ga0451791_1228639 3300041451 Bacteria 592
616 Ga0451793_0334588 3300041452 Bacteria 589
617 Ga0451801_01071 3300041455 Bacteria 587
618 Ga0451795_0888193 3300041456 Bacteria 574
619 Ga0451802_0602411 3300041460 Bacteria 517
620 Ga0451805_073244 3300041461 Bacteria 638
621 Ga0451804_0674792 3300041463 Bacteria 601
622 Ga0451807_0682885 3300041486 Bacteria 889
623 Ga0451837_0232942 3300041494 Bacteria 781
624 Ga0451837_0932992 3300041494 Bacteria 557
625 Ga0451841_0723032 3300041498 Bacteria 659
626 Ga0451853_3164471 3300041512 Bacteria 682
627 Ga0439448_0002892 3300042005 Bacteria 4705
628 Ga0439432_075293 3300042006 Bacteria 1026
629 Ga0439450_053772 3300042008 Bacteria 962
630 Ga0439454_027297 3300042011 Bacteria 877
631 Ga0439455_0031210 3300042012 Bacteria 1325
632 Ga0439458_0000411 3300042157 Bacteria 10757
633 Ga0439458_0023574 3300042157 Bacteria 1435
634 Ga0451577_0793079 3300042876 Bacteria 856
635 Ga0466963_0764213 3300044694 Bacteria 682
636 Ga0453684_0144988 3300044712 Bacteria 2830
637 Ga0466971_0013453 3300044719 Bacteria 3595
638 Ga0466957_0060779 3300044842 Bacteria 2317
639 Ga0451576_0287511 3300045051 Bacteria 1719
640 Ga0451576_1678546 3300045051 Bacteria 658
641 Ga0466958_0045403 3300045836 Bacteria 2650
642 Ga0466967_0814319 3300045976 Bacteria 927
643 Ga0495592_0433362 3300046454 Bacteria 827
644 Ga0495638_0588644 3300046460 Bacteria 548
645 Ga0495607_0009991 3300046501 Bacteria 6393
646 Ga0495583_0027264 3300046506 Bacteria 2821
647 Ga0495606_0032104 3300046507 Bacteria 3642
648 Ga0495606_0097322 3300046507 Bacteria 1798
649 Ga0495620_0067190 3300046515 Bacteria 1476
650 Ga0495637_0020614 3300046520 Bacteria 3031
651 Ga0495643_0036230 3300046522 Bacteria 2712
652 Ga0495643_0056975 3300046522 Bacteria 2084
653 Ga0495643_0159163 3300046522 Bacteria 1112
654 Ga0495663_0044134 3300046525 Bacteria 1364
655 Ga0495654_0021389 3300046530 Bacteria 3365
656 Ga0495609_0050693 3300046538 Bacteria 1850
657 Ga0495621_0153376 3300046539 Bacteria 907
658 Ga0495597_0096319 3300046542 Bacteria 1251
659 Ga0495633_0164810 3300046558 Bacteria 1022
660 Ga0495668_0000004 3300046616 Bacteria 574236
661 Ga0495668_0018119 3300046616 Bacteria 4072
662 Ga0495668_0027073 3300046616 Bacteria 3249
663 Ga0495668_0058282 3300046616 Bacteria 2131
664 Ga0495625_0008532 3300046660 Bacteria 8729
665 Ga0495625_0042708 3300046660 Bacteria 3292
666 Ga0495625_0284716 3300046660 Bacteria 1062
667 Ga0495635_1093518 3300046663 Bacteria 505
668 Ga0495669_0132247 3300046684 Bacteria 1175
669 Ga0495670_0300947 3300046691 Bacteria 859
670 Ga0495660_0183195 3300046810 Bacteria 1012
671 Ga0495687_004335 3300047443 Bacteria 9654
672 Ga0495677_0119957 3300047445 Bacteria 1002
673 Ga0496100_0721524 3300048903 Bacteria 779
674 Ga0496102_0234565 3300048905 Bacteria 1730
675 Ga0496103_0061206 3300048906 Bacteria 2341
676 Ga0496103_0247355 3300048906 Bacteria 1147
677 Ga0496104_1028999 3300048907 Bacteria 727
678 Ga0496107_0499920 3300048910 Bacteria 902
679 Ga0496113_0184797 3300048916 Bacteria 1653
680 Ga0496113_0756098 3300048916 Bacteria 774
681 Ga0496117_0003839 3300048920 Bacteria 17093
682 Ga0496117_0007266 3300048920 Bacteria 10884
683 Ga0496117_0496874 3300048920 Bacteria 592
684 Ga0496118_0000901 3300048921 Bacteria 46540
685 Ga0496118_0007049 3300048921 Bacteria 12084
686 Ga0496118_0042347 3300048921 Bacteria 3594
687 Ga0496118_0367527 3300048921 Bacteria 760
688 Ga0496118_0395273 3300048921 Bacteria 720
689 Ga0496121_0090548 3300048924 Bacteria 2391
690 Ga0496121_0167769 3300048924 Bacteria 1598
691 Ga0496121_0289737 3300048924 Bacteria 1116
692 Ga0496122_0221186 3300048925 Bacteria 1086
693 Ga0496123_0029600 3300048926 Bacteria 4026
694 Ga0496123_0038218 3300048926 Bacteria 3377
695 Ga0496124_0000192 3300048927 Bacteria 120980
696 Ga0496124_0001412 3300048927 Bacteria 35756
697 Ga0496124_0028878 3300048927 Bacteria 4952
698 Ga0496124_0079741 3300048927 Bacteria 2695
699 Ga0496124_0096167 3300048927 Bacteria 2406
700 Ga0496125_0066180 3300048928 Bacteria 2857
701 Ga0496125_0118299 3300048928 Bacteria 1898
702 Ga0496126_0433319 3300048929 Bacteria 1061
703 Ga0496126_1157881 3300048929 Bacteria 571
704 Ga0495682_0258250 3300049460 Bacteria 616
705 Ga0501293_012339 3300049516 Bacteria 757
706 Ga0501298_032011 3300049521 Bacteria 1036
707 Ga0501300_034092 3300049523 Bacteria 756
708 Ga0501320_012355 3300049536 Bacteria 896
709 Ga0501320_028028 3300049536 Bacteria 688
710 Ga0501321_075558 3300049537 Bacteria 530
711 Ga0501326_14218 3300049542 Bacteria 501
712 Ga0501333_013451 3300049549 Bacteria 606
713 Ga0501334_20069 3300049550 Bacteria 534
714 Ga0501335_039037 3300049551 Bacteria 555
715 Ga0501336_007516 3300049552 Bacteria 828
716 Ga0501337_012984 3300049553 Bacteria 626
717 Ga0501338_09985 3300049554 Bacteria 636
718 Ga0501032_0010668 3300049569 Bacteria 6614
719 Ga0501032_0056543 3300049569 Bacteria 2637
720 Ga0501033_0001724 3300049570 Bacteria 19138
721 Ga0501034_0004606 3300049571 Bacteria 15279
722 Ga0501036_0529121 3300049572 Bacteria 980
723 Ga0501036_0589414 3300049572 Bacteria 923
724 Ga0501036_0997233 3300049572 Bacteria 686
725 Ga0501038_0337306 3300049574 Bacteria 1176
726 Ga0501042_0961576 3300049578 Bacteria 622
727 Ga0501043_0028300 3300049579 Bacteria 4399
728 Ga0501043_0383773 3300049579 Bacteria 1063
729 Ga0501046_1148120 3300049580 Bacteria 535
730 Ga0501047_0000256 3300049581 Bacteria 62551
731 Ga0501047_0026761 3300049581 Bacteria 5552
732 Ga0501047_0215173 3300049581 Bacteria 1778
733 Ga0501047_0642220 3300049581 Bacteria 881
734 Ga0501048_0536426 3300049582 Bacteria 839
735 Ga0501067_0154694 3300049583 Bacteria 1277
736 Ga0501067_0799899 3300049583 Bacteria 531
737 Ga0501069_0702101 3300049585 Bacteria 610
738 Ga0501223_030647 3300049663 Bacteria 1046
739 Ga0501257_000012 3300049686 Bacteria 51962
740 Ga0501080_0632248 3300049742 Bacteria 948
741 Ga0501083_0411979 3300049744 Bacteria 879
742 Ga0501267_003554 3300049764 Bacteria 1424
743 Ga0501278_006800 3300049774 Bacteria 861
744 Ga0501280_001885 3300049776 Bacteria 3666
745 Ga0501044_0027022 3300049823 Bacteria 6072
746 Ga0501044_0383872 3300049823 Bacteria 1319
747 nmdc:mga0k408_49308_c1 3300050493 Bacteria 2437
748 nmdc:mga07m45_117405_c1 3300050496 Bacteria 1535
749 nmdc:mga0rr50_905959_c1 3300050513 Bacteria 752
750 Ga0500643_000166 3300053087 Bacteria 65586
751 Ga0500643_000590 3300053087 Bacteria 25096
752 Ga0500643_001818 3300053087 Bacteria 11669
753 Ga0500644_0317431 3300053088 Bacteria 669
754 Ga0500647_0140807 3300053091 Bacteria 1131
755 Ga0500651_0039143 3300053093 Bacteria 2986
756 Ga0500566_0059490 3300053094 Bacteria 2166
757 Ga0500592_001082 3300053116 Bacteria 4437
758 Ga0500592_007979 3300053116 Bacteria 1679
759 Ga0500592_028852 3300053116 Bacteria 895
760 Ga0500618_000496 3300053125 Bacteria 25243
761 Ga0500618_008655 3300053125 Bacteria 2825
762 Ga0500642_0001609 3300053130 Bacteria 6511
763 Ga0500652_188894 3300053131 Bacteria 841
764 Ga0500655_000399 3300053133 Bacteria 9184
765 Ga0500658_0004128 3300053134 Bacteria 5459
766 Ga0500658_0040535 3300053134 Bacteria 1865
767 Ga0500568_0036013 3300053139 Bacteria 2016
768 Ga0500577_0003903 3300053142 Bacteria 3897
769 Ga0500577_0249368 3300053142 Bacteria 771
770 Ga0500590_004550 3300053148 Bacteria 6558
771 Ga0500604_0042642 3300053151 Bacteria 1376
772 Ga0500622_0004003 3300053156 Bacteria 9497
773 Ga0500627_0000017 3300053158 Bacteria 119507
774 Ga0500627_0006961 3300053158 Bacteria 3897
775 Ga0500627_0015857 3300053158 Bacteria 2925
776 Ga0500627_0184263 3300053158 Bacteria 939
777 Ga0500639_087162 3300053163 Bacteria 1562
778 Ga0500636_0051013 3300053177 Bacteria 2432
779 Ga0500637_0268426 3300053178 Bacteria 945
780 Ga0500570_000052 3300053724 Bacteria 28845
781 Ga0500645_064009 3300053730 Bacteria 1061
782 Ga0501082_0275057 3300060353 Bacteria 1466
783 Ga0466962_0496147 3300061719 Bacteria 617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10064549 Ga0307405_100645492 62
2 3300031911 Ga0307412_10027831 Ga0307412_100278312 62
3 3300006195 Ga0075366_10302839 Ga0075366_103028392 67
4 3300001904 JGI24736J21556_1003022 JGI24736J21556_10030223 68
5 3300001976 JGI24752J21851_1000266 JGI24752J21851_10002666 68
6 3300001976 JGI24752J21851_1006110 JGI24752J21851_10061102 68
7 3300001978 JGI24747J21853_1046519 JGI24747J21853_10465192 68
8 3300001979 JGI24740J21852_10040019 JGI24740J21852_100400192 68
9 3300001979 JGI24740J21852_10091332 JGI24740J21852_100913321 68
10 3300001979 JGI24740J21852_10115243 JGI24740J21852_101152431 68
11 3300001989 JGI24739J22299_10007944 JGI24739J22299_100079445 68
12 3300001989 JGI24739J22299_10009390 JGI24739J22299_100093904 68
13 3300001989 JGI24739J22299_10010059 JGI24739J22299_100100593 68
14 3300001989 JGI24739J22299_10036400 JGI24739J22299_100364003 68
15 3300001989 JGI24739J22299_10052693 JGI24739J22299_100526933 68
16 3300001989 JGI24739J22299_10076252 JGI24739J22299_100762522 68
17 3300001989 JGI24739J22299_10098589 JGI24739J22299_100985891 68
18 3300001990 JGI24737J22298_10012233 JGI24737J22298_100122334 68
19 3300001990 JGI24737J22298_10015462 JGI24737J22298_100154621 68
20 3300001990 JGI24737J22298_10037437 JGI24737J22298_100374371 68
21 3300001990 JGI24737J22298_10048579 JGI24737J22298_100485791 68
22 3300001990 JGI24737J22298_10081153 JGI24737J22298_100811531 68
23 3300001991 JGI24743J22301_10105922 JGI24743J22301_101059222 68
24 3300002067 JGI24735J21928_10002885 JGI24735J21928_100028855 68
25 3300002067 JGI24735J21928_10012414 JGI24735J21928_100124144 68
26 3300002067 JGI24735J21928_10018234 JGI24735J21928_100182342 68
27 3300002067 JGI24735J21928_10021374 JGI24735J21928_100213743 68
28 3300002067 JGI24735J21928_10034580 JGI24735J21928_100345802 68
29 3300002067 JGI24735J21928_10036131 JGI24735J21928_100361311 68
30 3300002067 JGI24735J21928_10062145 JGI24735J21928_100621451 68
31 3300002067 JGI24735J21928_10098471 JGI24735J21928_100984711 68
32 3300002070 JGI24750J21931_1000495 JGI24750J21931_10004952 68
33 3300002070 JGI24750J21931_1003646 JGI24750J21931_10036465 68
34 3300002074 JGI24748J21848_1000085 JGI24748J21848_10000859 68
35 3300002074 JGI24748J21848_1024167 JGI24748J21848_10241672 68
36 3300002075 JGI24738J21930_10003443 JGI24738J21930_100034435 68
37 3300002076 JGI24749J21850_1000574 JGI24749J21850_10005746 68
38 3300002076 JGI24749J21850_1002773 JGI24749J21850_10027734 68
39 3300002126 JGI24035J26624_1003865 JGI24035J26624_10038652 68
40 3300002239 JGI24034J26672_10000069 JGI24034J26672_100000697 68
41 3300002239 JGI24034J26672_10031560 JGI24034J26672_100315602 68
42 3300002244 JGI24742J22300_10003304 JGI24742J22300_100033042 68
43 3300002459 JGI24751J29686_10000797 JGI24751J29686_100007977 68
44 3300002459 JGI24751J29686_10011534 JGI24751J29686_100115343 68
45 3300002459 JGI24751J29686_10055603 JGI24751J29686_100556031 68
46 3300003162 Ga0006778J45830_1070616 Ga0006778J45830_10706161 68
47 3300003215 JGI25153J46596_10000007 JGI25153J46596_1000000729 68
48 3300003308 Ga0006777J48905_1067120 Ga0006777J48905_10671201 68
49 3300003693 Ga0032354_1014098 Ga0032354_10140981 68
50 3300003759 Ga0055525_1000086 Ga0055525_100008625 68
51 3300003762 Ga0055542_1000353 Ga0055542_100035324 68
52 3300003762 Ga0055542_1014558 Ga0055542_10145582 68
53 3300003763 Ga0055529_1000377 Ga0055529_100037724 68
54 3300003781 Ga0055536_1009345 Ga0055536_10093453 68
55 3300003791 Ga0055530_10089249 Ga0055530_100892492 68
56 3300003794 Ga0055531_10002547 Ga0055531_100025478 68
57 3300005295 Ga0065707_10143914 Ga0065707_101439144 68
58 3300005295 Ga0065707_10160867 Ga0065707_101608673 68
59 3300005295 Ga0065707_10198694 Ga0065707_101986944 68
60 3300005295 Ga0065707_10317993 Ga0065707_103179932 68
61 3300005327 Ga0070658_10002621 Ga0070658_100026216 68
62 3300005327 Ga0070658_10525018 Ga0070658_105250182 68
63 3300005327 Ga0070658_11274513 Ga0070658_112745131 68
64 3300005327 Ga0070658_11947157 Ga0070658_119471571 68
65 3300005328 Ga0070676_10000416 Ga0070676_100004168 68
66 3300005329 Ga0070683_101912835 Ga0070683_1019128352 68
67 3300005330 Ga0070690_100001137 Ga0070690_1000011379 68
68 3300005331 Ga0070670_100000178 Ga0070670_10000017849 68
69 3300005331 Ga0070670_100000867 Ga0070670_1000008676 68
70 3300005331 Ga0070670_100115168 Ga0070670_1001151683 68
71 3300005331 Ga0070670_100784296 Ga0070670_1007842961 68
72 3300005334 Ga0068869_100001367 Ga0068869_1000013673 68
73 3300005334 Ga0068869_100207918 Ga0068869_1002079182 68
74 3300005335 Ga0070666_10000547 Ga0070666_1000054718 68
75 3300005335 Ga0070666_10001181 Ga0070666_1000118110 68
76 3300005335 Ga0070666_10017146 Ga0070666_100171467 68
77 3300005335 Ga0070666_10042146 Ga0070666_100421463 68
78 3300005335 Ga0070666_10062119 Ga0070666_100621193 68
79 3300005336 Ga0070680_100000824 Ga0070680_1000008249 68
80 3300005336 Ga0070680_100223225 Ga0070680_1002232254 68
81 3300005338 Ga0068868_100002349 Ga0068868_1000023494 68
82 3300005339 Ga0070660_100002444 Ga0070660_10000244410 68
83 3300005339 Ga0070660_100064482 Ga0070660_1000644824 68
84 3300005339 Ga0070660_100214103 Ga0070660_1002141032 68
85 3300005339 Ga0070660_101297022 Ga0070660_1012970221 68
86 3300005340 Ga0070689_100032724 Ga0070689_1000327244 68
87 3300005344 Ga0070661_100737519 Ga0070661_1007375192 68
88 3300005344 Ga0070661_101521032 Ga0070661_1015210321 68
89 3300005347 Ga0070668_100000006 Ga0070668_10000000666 68
90 3300005347 Ga0070668_100018392 Ga0070668_1000183926 68
91 3300005347 Ga0070668_100039166 Ga0070668_1000391662 68
92 3300005347 Ga0070668_100052169 Ga0070668_1000521694 68
93 3300005347 Ga0070668_100110967 Ga0070668_1001109673 68
94 3300005353 Ga0070669_100000013 Ga0070669_100000013122 68
95 3300005353 Ga0070669_100000119 Ga0070669_10000011965 68
96 3300005353 Ga0070669_100000958 Ga0070669_10000095812 68
97 3300005353 Ga0070669_100018299 Ga0070669_1000182996 68
98 3300005353 Ga0070669_100027700 Ga0070669_1000277003 68
99 3300005353 Ga0070669_101088590 Ga0070669_1010885901 68
100 3300005355 Ga0070671_100000009 Ga0070671_100000009101 68
101 3300005355 Ga0070671_100000310 Ga0070671_10000031010 68
102 3300005355 Ga0070671_100012517 Ga0070671_1000125173 68
103 3300005355 Ga0070671_100047789 Ga0070671_1000477896 68
104 3300005355 Ga0070671_100268198 Ga0070671_1002681982 68
105 3300005364 Ga0070673_100000002 Ga0070673_100000002204 68
106 3300005364 Ga0070673_101932498 Ga0070673_1019324981 68
107 3300005365 Ga0070688_100000708 Ga0070688_10000070814 68
108 3300005366 Ga0070659_100064697 Ga0070659_1000646971 68
109 3300005366 Ga0070659_100258787 Ga0070659_1002587873 68
110 3300005366 Ga0070659_100304107 Ga0070659_1003041071 68
111 3300005366 Ga0070659_101289555 Ga0070659_1012895552 68
112 3300005367 Ga0070667_100000003 Ga0070667_100000003166 68
113 3300005367 Ga0070667_100000322 Ga0070667_10000032221 68
114 3300005367 Ga0070667_100001187 Ga0070667_1000011877 68
115 3300005367 Ga0070667_100002032 Ga0070667_10000203211 68
116 3300005367 Ga0070667_100007537 Ga0070667_10000753711 68
117 3300005367 Ga0070667_100270147 Ga0070667_1002701473 68
118 3300005367 Ga0070667_100635550 Ga0070667_1006355502 68
119 3300005440 Ga0070705_100006419 Ga0070705_1000064193 68
120 3300005444 Ga0070694_100481958 Ga0070694_1004819582 68
121 3300005455 Ga0070663_100635083 Ga0070663_1006350832 68
122 3300005456 Ga0070678_100706137 Ga0070678_1007061372 68
123 3300005457 Ga0070662_100117431 Ga0070662_1001174314 68
124 3300005457 Ga0070662_100174849 Ga0070662_1001748492 68
125 3300005457 Ga0070662_101015642 Ga0070662_1010156421 68
126 3300005457 Ga0070662_101607683 Ga0070662_1016076831 68
127 3300005458 Ga0070681_10299263 Ga0070681_102992632 68
128 3300005459 Ga0068867_100000012 Ga0068867_10000001210 68
129 3300005466 Ga0070685_10014208 Ga0070685_100142086 68
130 3300005466 Ga0070685_11297936 Ga0070685_112979362 68
131 3300005467 Ga0070706_100495418 Ga0070706_1004954182 68
132 3300005530 Ga0070679_100000002 Ga0070679_100000002238 68
133 3300005530 Ga0070679_100814717 Ga0070679_1008147172 68
134 3300005539 Ga0068853_100179289 Ga0068853_1001792891 68
135 3300005539 Ga0068853_100208917 Ga0068853_1002089173 68
136 3300005539 Ga0068853_100687291 Ga0068853_1006872912 68
137 3300005539 Ga0068853_100726148 Ga0068853_1007261482 68
138 3300005539 Ga0068853_101085053 Ga0068853_1010850532 68
139 3300005539 Ga0068853_101982473 Ga0068853_1019824731 68
140 3300005543 Ga0070672_100358753 Ga0070672_1003587532 68
141 3300005544 Ga0070686_100000181 Ga0070686_10000018145 68
142 3300005547 Ga0070693_100940005 Ga0070693_1009400051 68
143 3300005548 Ga0070665_100000004 Ga0070665_100000004763 68
144 3300005548 Ga0070665_100375971 Ga0070665_1003759714 68
145 3300005563 Ga0068855_100001671 Ga0068855_10000167132 68
146 3300005563 Ga0068855_100009919 Ga0068855_1000099191 68
147 3300005563 Ga0068855_100808364 Ga0068855_1008083641 68
148 3300005564 Ga0070664_100083389 Ga0070664_1000833895 68
149 3300005577 Ga0068857_100077096 Ga0068857_1000770964 68
150 3300005577 Ga0068857_100095350 Ga0068857_1000953504 68
151 3300005577 Ga0068857_100116808 Ga0068857_1001168084 68
152 3300005577 Ga0068857_100127781 Ga0068857_1001277814 68
153 3300005577 Ga0068857_100153758 Ga0068857_1001537583 68
154 3300005577 Ga0068857_100287427 Ga0068857_1002874273 68
155 3300005577 Ga0068857_100373036 Ga0068857_1003730362 68
156 3300005577 Ga0068857_101306776 Ga0068857_1013067763 68
157 3300005577 Ga0068857_102340343 Ga0068857_1023403431 68
158 3300005578 Ga0068854_100014478 Ga0068854_1000144781 68
159 3300005578 Ga0068854_100018166 Ga0068854_1000181664 68
160 3300005578 Ga0068854_100026542 Ga0068854_1000265424 68
161 3300005578 Ga0068854_100055570 Ga0068854_1000555705 68
162 3300005578 Ga0068854_100257475 Ga0068854_1002574751 68
163 3300005578 Ga0068854_100296442 Ga0068854_1002964423 68
164 3300005578 Ga0068854_100558147 Ga0068854_1005581473 68
165 3300005578 Ga0068854_101214845 Ga0068854_1012148452 68
166 3300005614 Ga0068856_100045341 Ga0068856_1000453417 68
167 3300005614 Ga0068856_100060059 Ga0068856_1000600596 68
168 3300005614 Ga0068856_100316171 Ga0068856_1003161712 68
169 3300005614 Ga0068856_100620865 Ga0068856_1006208653 68
170 3300005616 Ga0068852_100001276 Ga0068852_1000012764 68
171 3300005616 Ga0068852_100187094 Ga0068852_1001870944 68
172 3300005616 Ga0068852_100210428 Ga0068852_1002104284 68
173 3300005616 Ga0068852_100384086 Ga0068852_1003840863 68
174 3300005616 Ga0068852_100442281 Ga0068852_1004422813 68
175 3300005616 Ga0068852_100670318 Ga0068852_1006703183 68
176 3300005617 Ga0068859_100003101 Ga0068859_1000031015 68
177 3300005617 Ga0068859_100003140 Ga0068859_10000314018 68
178 3300005617 Ga0068859_100005086 Ga0068859_1000050866 68
179 3300005617 Ga0068859_100126303 Ga0068859_1001263033 68
180 3300005617 Ga0068859_100315109 Ga0068859_1003151094 68
181 3300005618 Ga0068864_100000183 Ga0068864_10000018349 68
182 3300005618 Ga0068864_100001051 Ga0068864_10000105125 68
183 3300005618 Ga0068864_100001150 Ga0068864_10000115014 68
184 3300005618 Ga0068864_100002014 Ga0068864_10000201411 68
185 3300005718 Ga0068866_10456153 Ga0068866_104561532 68
186 3300005719 Ga0068861_100000687 Ga0068861_1000006879 68
187 3300005719 Ga0068861_100010768 Ga0068861_1000107684 68
188 3300005719 Ga0068861_100051576 Ga0068861_1000515765 68
189 3300005834 Ga0068851_10142940 Ga0068851_101429403 68
190 3300005841 Ga0068863_100002515 Ga0068863_1000025152 68
191 3300005841 Ga0068863_100012020 Ga0068863_1000120207 68
192 3300005841 Ga0068863_100036402 Ga0068863_1000364023 68
193 3300005841 Ga0068863_100039200 Ga0068863_1000392002 68
194 3300005841 Ga0068863_100059963 Ga0068863_1000599631 68
195 3300005841 Ga0068863_101300127 Ga0068863_1013001271 68
196 3300005841 Ga0068863_101560397 Ga0068863_1015603972 68
197 3300005842 Ga0068858_100000920 Ga0068858_10000092010 68
198 3300005842 Ga0068858_100002212 Ga0068858_1000022126 68
199 3300005842 Ga0068858_100004181 Ga0068858_1000041816 68
200 3300005842 Ga0068858_100004950 Ga0068858_1000049503 68
201 3300005843 Ga0068860_100000068 Ga0068860_10000006818 68
202 3300005843 Ga0068860_100002805 Ga0068860_10000280514 68
203 3300005843 Ga0068860_100003455 Ga0068860_1000034556 68
204 3300005843 Ga0068860_100009225 Ga0068860_1000092258 68
205 3300005843 Ga0068860_100049782 Ga0068860_1000497821 68
206 3300005843 Ga0068860_100741843 Ga0068860_1007418432 68
207 3300005843 Ga0068860_101543844 Ga0068860_1015438441 68
208 3300005843 Ga0068860_102651255 Ga0068860_1026512552 68
209 3300005844 Ga0068862_100000006 Ga0068862_10000000632 68
210 3300005844 Ga0068862_100000160 Ga0068862_10000016013 68
211 3300005844 Ga0068862_100000894 Ga0068862_10000089431 68
212 3300005844 Ga0068862_100007026 Ga0068862_10000702610 68
213 3300005844 Ga0068862_100017369 Ga0068862_1000173692 68
214 3300005844 Ga0068862_100047193 Ga0068862_1000471932 68
215 3300006051 Ga0075364_10425274 Ga0075364_104252742 68
216 3300006195 Ga0075366_10112303 Ga0075366_101123033 68
217 3300006195 Ga0075366_10747121 Ga0075366_107471212 68
218 3300006353 Ga0075370_10142822 Ga0075370_101428223 68
219 3300006881 Ga0068865_100000004 Ga0068865_100000004203 68
220 3300006881 Ga0068865_101806364 Ga0068865_1018063642 68
221 3300006931 Ga0097620_100003101 Ga0097620_10000310120 68
222 3300006931 Ga0097620_100003140 Ga0097620_10000314018 68
223 3300006931 Ga0097620_100005086 Ga0097620_10000508616 68
224 3300006931 Ga0097620_100126299 Ga0097620_1001262993 68
225 3300006931 Ga0097620_100315118 Ga0097620_1003151184 68
226 3300006946 Ga0079104_1068043 Ga0079104_10680433 68
227 3300007076 Ga0075435_100728405 Ga0075435_1007284051 68
228 3300009011 Ga0105251_10004083 Ga0105251_1000408315 68
229 3300009011 Ga0105251_10114818 Ga0105251_101148181 68
230 3300009011 Ga0105251_10157131 Ga0105251_101571311 68
231 3300009092 Ga0105250_10281365 Ga0105250_102813652 68
232 3300009093 Ga0105240_10058338 Ga0105240_100583389 68
233 3300009093 Ga0105240_10594745 Ga0105240_105947453 68
234 3300009093 Ga0105240_11325424 Ga0105240_113254243 68
235 3300009098 Ga0105245_10004262 Ga0105245_100042623 68
236 3300009101 Ga0105247_10002301 Ga0105247_100023016 68
237 3300009101 Ga0105247_10003906 Ga0105247_100039069 68
238 3300009101 Ga0105247_10074686 Ga0105247_100746861 68
239 3300009101 Ga0105247_10900589 Ga0105247_109005891 68
240 3300009148 Ga0105243_10000146 Ga0105243_100001469 68
241 3300009148 Ga0105243_10149830 Ga0105243_101498301 68
242 3300009174 Ga0105241_10166380 Ga0105241_101663802 68
243 3300009174 Ga0105241_10863534 Ga0105241_108635341 68
244 3300009174 Ga0105241_11234489 Ga0105241_112344892 68
245 3300009176 Ga0105242_10000497 Ga0105242_1000049736 68
246 3300009177 Ga0105248_10000016 Ga0105248_1000001627 68
247 3300009177 Ga0105248_10003803 Ga0105248_1000380320 68
248 3300009177 Ga0105248_10030756 Ga0105248_100307562 68
249 3300009177 Ga0105248_10046039 Ga0105248_100460394 68
250 3300009177 Ga0105248_10046883 Ga0105248_100468833 68
251 3300009177 Ga0105248_10047627 Ga0105248_100476272 68
252 3300009177 Ga0105248_10056537 Ga0105248_100565374 68
253 3300009177 Ga0105248_10306743 Ga0105248_103067432 68
254 3300009177 Ga0105248_11444533 Ga0105248_114445331 68
255 3300009545 Ga0105237_10034455 Ga0105237_100344553 68
256 3300009545 Ga0105237_10225531 Ga0105237_102255312 68
257 3300009545 Ga0105237_10658202 Ga0105237_106582024 68
258 3300009551 Ga0105238_10029748 Ga0105238_100297484 68
259 3300009551 Ga0105238_10112959 Ga0105238_101129595 68
260 3300009551 Ga0105238_10117478 Ga0105238_101174783 68
261 3300009551 Ga0105238_12641540 Ga0105238_126415401 68
262 3300009553 Ga0105249_10000355 Ga0105249_1000035512 68
263 3300009553 Ga0105249_10002669 Ga0105249_1000266910 68
264 3300009553 Ga0105249_10020475 Ga0105249_100204752 68
265 3300009553 Ga0105249_10040393 Ga0105249_100403934 68
266 3300009553 Ga0105249_10126707 Ga0105249_101267072 68
267 3300009553 Ga0105249_10249460 Ga0105249_102494602 68
268 3300010375 Ga0105239_10169627 Ga0105239_101696272 68
269 3300010375 Ga0105239_10255811 Ga0105239_102558112 68
270 3300010375 Ga0105239_10629034 Ga0105239_106290342 68
271 3300010375 Ga0105239_10802979 Ga0105239_108029793 68
272 3300011119 Ga0105246_10000138 Ga0105246_1000013811 68
273 3300012513 Ga0157326_1000736 Ga0157326_10007361 68
274 3300013100 Ga0157373_11580497 Ga0157373_115804971 68
275 3300013102 Ga0157371_10000842 Ga0157371_1000084210 68
276 3300013102 Ga0157371_10019554 Ga0157371_100195544 68
277 3300013102 Ga0157371_10487946 Ga0157371_104879463 68
278 3300013102 Ga0157371_10502727 Ga0157371_105027271 68
279 3300013102 Ga0157371_10559193 Ga0157371_105591931 68
280 3300013104 Ga0157370_10030422 Ga0157370_100304222 68
281 3300013104 Ga0157370_10204132 Ga0157370_102041321 68
282 3300013104 Ga0157370_10800772 Ga0157370_108007721 68
283 3300013104 Ga0157370_10952631 Ga0157370_109526312 68
284 3300013104 Ga0157370_11259700 Ga0157370_112597002 68
285 3300013105 Ga0157369_10135222 Ga0157369_101352223 68
286 3300013105 Ga0157369_10917871 Ga0157369_109178713 68
287 3300013296 Ga0157374_10001104 Ga0157374_1000110417 68
288 3300013296 Ga0157374_10780796 Ga0157374_107807961 68
289 3300013297 Ga0157378_10006343 Ga0157378_100063439 68
290 3300013297 Ga0157378_10499395 Ga0157378_104993952 68
291 3300013306 Ga0163162_10001771 Ga0163162_1000177113 68
292 3300013306 Ga0163162_10022071 Ga0163162_100220715 68
293 3300013306 Ga0163162_10188013 Ga0163162_101880133 68
294 3300013306 Ga0163162_10250658 Ga0163162_102506582 68
295 3300013307 Ga0157372_10231368 Ga0157372_102313683 68
296 3300013307 Ga0157372_10238068 Ga0157372_102380685 68
297 3300013307 Ga0157372_10528323 Ga0157372_105283233 68
298 3300013307 Ga0157372_10647068 Ga0157372_106470684 68
299 3300013307 Ga0157372_12347563 Ga0157372_123475632 68
300 3300013308 Ga0157375_10000587 Ga0157375_100005875 68
301 3300013308 Ga0157375_10536204 Ga0157375_105362043 68
302 3300014325 Ga0163163_10047074 Ga0163163_100470744 68
303 3300014325 Ga0163163_10161643 Ga0163163_101616435 68
304 3300014326 Ga0157380_10000087 Ga0157380_1000008741 68
305 3300014326 Ga0157380_10017903 Ga0157380_100179034 68
306 3300014326 Ga0157380_10188637 Ga0157380_101886372 68
307 3300014326 Ga0157380_13483673 Ga0157380_134836732 68
308 3300014745 Ga0157377_11037338 Ga0157377_110373381 68
309 3300014968 Ga0157379_10074401 Ga0157379_100744016 68
310 3300014968 Ga0157379_10477506 Ga0157379_104775062 68
311 3300014968 Ga0157379_11247450 Ga0157379_112474502 68
312 3300014969 Ga0157376_10000131 Ga0157376_1000013148 68
313 3300017792 Ga0163161_10002585 Ga0163161_1000258511 68
314 3300017792 Ga0163161_10620377 Ga0163161_106203772 68
315 3300017792 Ga0163161_10786492 Ga0163161_107864922 68
316 3300025223 Ga0207672_1000794 Ga0207672_10007943 68
317 3300025230 Ga0209563_100024 Ga0209563_100024108 68
318 3300025246 Ga0209646_1008350 Ga0209646_10083502 68
319 3300025250 Ga0209026_1012633 Ga0209026_10126332 68
320 3300025254 Ga0209148_1000008 Ga0209148_100000888 68
321 3300025254 Ga0209148_1000074 Ga0209148_1000074221 68
322 3300025261 Ga0209233_1071651 Ga0209233_10716512 68
323 3300025272 Ga0209455_1000002 Ga0209455_10000021337 68
324 3300025272 Ga0209455_1020563 Ga0209455_10205632 68
325 3300025290 Ga0207673_1045286 Ga0207673_10452862 68
326 3300025292 Ga0209676_1000060 Ga0209676_1000060218 68
327 3300025292 Ga0209676_1000226 Ga0209676_100022673 68
328 3300025297 Ga0209758_1000017 Ga0209758_100001730 68
329 3300025298 Ga0209050_1003101 Ga0209050_10031014 68
330 3300025298 Ga0209050_1102653 Ga0209050_11026532 68
331 3300025304 Ga0209257_1000392 Ga0209257_100039266 68
332 3300025315 Ga0207697_10001743 Ga0207697_100017436 68
333 3300025315 Ga0207697_10367646 Ga0207697_103676461 68
334 3300025735 Ga0207713_1014886 Ga0207713_10148862 68
335 3300025735 Ga0207713_1055056 Ga0207713_10550561 68
336 3300025735 Ga0207713_1178811 Ga0207713_11788111 68
337 3300025899 Ga0207642_10270610 Ga0207642_102706103 68
338 3300025900 Ga0207710_10007517 Ga0207710_1000751710 68
339 3300025900 Ga0207710_10399660 Ga0207710_103996602 68
340 3300025901 Ga0207688_10216692 Ga0207688_102166922 68
341 3300025901 Ga0207688_11101321 Ga0207688_111013211 68
342 3300025903 Ga0207680_10000004 Ga0207680_1000000417 68
343 3300025903 Ga0207680_10000418 Ga0207680_1000041819 68
344 3300025903 Ga0207680_10033138 Ga0207680_100331383 68
345 3300025903 Ga0207680_10099024 Ga0207680_100990243 68
346 3300025903 Ga0207680_11080810 Ga0207680_110808101 68
347 3300025904 Ga0207647_10005831 Ga0207647_100058319 68
348 3300025904 Ga0207647_10023553 Ga0207647_100235536 68
349 3300025904 Ga0207647_10105475 Ga0207647_101054754 68
350 3300025904 Ga0207647_10109834 Ga0207647_101098343 68
351 3300025904 Ga0207647_10426139 Ga0207647_104261391 68
352 3300025904 Ga0207647_10462163 Ga0207647_104621631 68
353 3300025904 Ga0207647_10774541 Ga0207647_107745412 68
354 3300025907 Ga0207645_10009635 Ga0207645_100096358 68
355 3300025909 Ga0207705_10000084 Ga0207705_1000008445 68
356 3300025909 Ga0207705_10308546 Ga0207705_103085462 68
357 3300025911 Ga0207654_10622447 Ga0207654_106224472 68
358 3300025911 Ga0207654_10915357 Ga0207654_109153571 68
359 3300025912 Ga0207707_10752852 Ga0207707_107528522 68
360 3300025913 Ga0207695_10017127 Ga0207695_100171276 68
361 3300025913 Ga0207695_10017716 Ga0207695_100177164 68
362 3300025913 Ga0207695_10125643 Ga0207695_101256431 68
363 3300025913 Ga0207695_11244698 Ga0207695_112446981 68
364 3300025914 Ga0207671_10158857 Ga0207671_101588572 68
365 3300025914 Ga0207671_10219883 Ga0207671_102198833 68
366 3300025914 Ga0207671_11571874 Ga0207671_115718741 68
367 3300025917 Ga0207660_10003071 Ga0207660_100030719 68
368 3300025917 Ga0207660_10287202 Ga0207660_102872024 68
369 3300025919 Ga0207657_10004951 Ga0207657_100049517 68
370 3300025919 Ga0207657_10074466 Ga0207657_100744662 68
371 3300025919 Ga0207657_10218235 Ga0207657_102182352 68
372 3300025920 Ga0207649_10025862 Ga0207649_100258622 68
373 3300025920 Ga0207649_10124038 Ga0207649_101240381 68
374 3300025921 Ga0207652_10000001 Ga0207652_10000001254 68
375 3300025921 Ga0207652_10000002 Ga0207652_10000002473 68
376 3300025923 Ga0207681_10000001 Ga0207681_10000001706 68
377 3300025923 Ga0207681_10000008 Ga0207681_10000008109 68
378 3300025923 Ga0207681_10000704 Ga0207681_1000070415 68
379 3300025923 Ga0207681_10016779 Ga0207681_100167795 68
380 3300025923 Ga0207681_10069647 Ga0207681_100696473 68
381 3300025923 Ga0207681_11835153 Ga0207681_118351531 68
382 3300025924 Ga0207694_10011474 Ga0207694_100114746 68
383 3300025924 Ga0207694_10087112 Ga0207694_100871125 68
384 3300025924 Ga0207694_10897574 Ga0207694_108975742 68
385 3300025924 Ga0207694_11302166 Ga0207694_113021662 68
386 3300025924 Ga0207694_11597144 Ga0207694_115971442 68
387 3300025925 Ga0207650_10000050 Ga0207650_1000005049 68
388 3300025925 Ga0207650_10002940 Ga0207650_100029403 68
389 3300025925 Ga0207650_10015038 Ga0207650_100150386 68
390 3300025925 Ga0207650_10268055 Ga0207650_102680553 68
391 3300025925 Ga0207650_10544903 Ga0207650_105449031 68
392 3300025927 Ga0207687_10039071 Ga0207687_100390714 68
393 3300025931 Ga0207644_10000006 Ga0207644_1000000699 68
394 3300025931 Ga0207644_10000028 Ga0207644_1000002817 68
395 3300025931 Ga0207644_10000124 Ga0207644_1000012438 68
396 3300025931 Ga0207644_10000292 Ga0207644_1000029217 68
397 3300025931 Ga0207644_10001291 Ga0207644_100012915 68
398 3300025931 Ga0207644_10127663 Ga0207644_101276635 68
399 3300025932 Ga0207690_10126488 Ga0207690_101264882 68
400 3300025932 Ga0207690_10520785 Ga0207690_105207852 68
401 3300025932 Ga0207690_10691990 Ga0207690_106919902 68
402 3300025933 Ga0207706_10107769 Ga0207706_101077691 68
403 3300025933 Ga0207706_10305191 Ga0207706_103051913 68
404 3300025933 Ga0207706_10502254 Ga0207706_105022542 68
405 3300025934 Ga0207686_10004317 Ga0207686_100043172 68
406 3300025935 Ga0207709_10001457 Ga0207709_100014579 68
407 3300025935 Ga0207709_10098211 Ga0207709_100982113 68
408 3300025936 Ga0207670_10053948 Ga0207670_100539483 68
409 3300025937 Ga0207669_11768099 Ga0207669_117680991 68
410 3300025938 Ga0207704_10000005 Ga0207704_1000000510 68
411 3300025938 Ga0207704_11783806 Ga0207704_117838061 68
412 3300025940 Ga0207691_10341864 Ga0207691_103418643 68
413 3300025941 Ga0207711_10000022 Ga0207711_1000002227 68
414 3300025941 Ga0207711_10000662 Ga0207711_100006622 68
415 3300025941 Ga0207711_10026087 Ga0207711_100260874 68
416 3300025941 Ga0207711_10055697 Ga0207711_100556974 68
417 3300025941 Ga0207711_10094318 Ga0207711_100943182 68
418 3300025941 Ga0207711_10276754 Ga0207711_102767542 68
419 3300025941 Ga0207711_10309852 Ga0207711_103098523 68
420 3300025941 Ga0207711_10623807 Ga0207711_106238072 68
421 3300025941 Ga0207711_11522888 Ga0207711_115228881 68
422 3300025942 Ga0207689_10001653 Ga0207689_1000165310 68
423 3300025945 Ga0207679_10080824 Ga0207679_100808244 68
424 3300025949 Ga0207667_10014616 Ga0207667_100146162 68
425 3300025949 Ga0207667_10254280 Ga0207667_102542803 68
426 3300025960 Ga0207651_10000007 Ga0207651_1000000710 68
427 3300025960 Ga0207651_11901788 Ga0207651_119017881 68
428 3300025961 Ga0207712_10000072 Ga0207712_10000072109 68
429 3300025961 Ga0207712_10017601 Ga0207712_100176016 68
430 3300025961 Ga0207712_10021578 Ga0207712_100215786 68
431 3300025961 Ga0207712_10072291 Ga0207712_100722912 68
432 3300025961 Ga0207712_10108640 Ga0207712_101086403 68
433 3300025972 Ga0207668_10000026 Ga0207668_1000002624 68
434 3300025972 Ga0207668_10000675 Ga0207668_100006752 68
435 3300025972 Ga0207668_10003566 Ga0207668_100035665 68
436 3300025972 Ga0207668_10056114 Ga0207668_100561143 68
437 3300025972 Ga0207668_10095417 Ga0207668_100954173 68
438 3300025981 Ga0207640_10012065 Ga0207640_100120655 68
439 3300025981 Ga0207640_10012353 Ga0207640_100123534 68
440 3300025981 Ga0207640_10074303 Ga0207640_100743032 68
441 3300025981 Ga0207640_10081128 Ga0207640_100811285 68
442 3300025981 Ga0207640_10443045 Ga0207640_104430452 68
443 3300025981 Ga0207640_10526714 Ga0207640_105267143 68
444 3300025981 Ga0207640_10872620 Ga0207640_108726202 68
445 3300025986 Ga0207658_10000002 Ga0207658_100000021068 68
446 3300025986 Ga0207658_10000608 Ga0207658_1000060822 68
447 3300025986 Ga0207658_10000967 Ga0207658_100009677 68
448 3300025986 Ga0207658_10001977 Ga0207658_1000197712 68
449 3300025986 Ga0207658_10003917 Ga0207658_100039173 68
450 3300025986 Ga0207658_10082023 Ga0207658_100820235 68
451 3300026023 Ga0207677_10001155 Ga0207677_100011553 68
452 3300026035 Ga0207703_10000849 Ga0207703_1000084925 68
453 3300026035 Ga0207703_10002381 Ga0207703_100023818 68
454 3300026035 Ga0207703_10010115 Ga0207703_100101157 68
455 3300026035 Ga0207703_10011114 Ga0207703_100111146 68
456 3300026041 Ga0207639_10093564 Ga0207639_100935642 68
457 3300026041 Ga0207639_10300634 Ga0207639_103006342 68
458 3300026041 Ga0207639_10385948 Ga0207639_103859482 68
459 3300026041 Ga0207639_10391395 Ga0207639_103913952 68
460 3300026041 Ga0207639_10846840 Ga0207639_108468402 68
461 3300026067 Ga0207678_10644277 Ga0207678_106442771 68
462 3300026067 Ga0207678_10802608 Ga0207678_108026082 68
463 3300026078 Ga0207702_10013739 Ga0207702_100137392 68
464 3300026078 Ga0207702_10049546 Ga0207702_100495466 68
465 3300026078 Ga0207702_11819071 Ga0207702_118190711 68
466 3300026088 Ga0207641_10000179 Ga0207641_1000017963 68
467 3300026088 Ga0207641_10001414 Ga0207641_1000141425 68
468 3300026088 Ga0207641_10010071 Ga0207641_100100712 68
469 3300026088 Ga0207641_10027742 Ga0207641_100277423 68
470 3300026088 Ga0207641_10201653 Ga0207641_102016532 68
471 3300026089 Ga0207648_10000005 Ga0207648_1000000511 68
472 3300026095 Ga0207676_10000004 Ga0207676_10000004346 68
473 3300026095 Ga0207676_10000040 Ga0207676_1000004046 68
474 3300026095 Ga0207676_10000190 Ga0207676_1000019047 68
475 3300026095 Ga0207676_10000613 Ga0207676_100006136 68
476 3300026095 Ga0207676_10003561 Ga0207676_1000356110 68
477 3300026095 Ga0207676_10004335 Ga0207676_100043356 68
478 3300026095 Ga0207676_11078161 Ga0207676_110781612 68
479 3300026095 Ga0207676_12624123 Ga0207676_126241232 68
480 3300026116 Ga0207674_10026868 Ga0207674_100268683 68
481 3300026116 Ga0207674_10051090 Ga0207674_100510904 68
482 3300026116 Ga0207674_10161760 Ga0207674_101617602 68
483 3300026116 Ga0207674_10176484 Ga0207674_101764843 68
484 3300026116 Ga0207674_10184225 Ga0207674_101842252 68
485 3300026116 Ga0207674_11877723 Ga0207674_118777231 68
486 3300026118 Ga0207675_100002079 Ga0207675_1000020795 68
487 3300026118 Ga0207675_100002340 Ga0207675_1000023404 68
488 3300026118 Ga0207675_100113823 Ga0207675_1001138232 68
489 3300026118 Ga0207675_100131973 Ga0207675_1001319733 68
490 3300026118 Ga0207675_100332869 Ga0207675_1003328691 68
491 3300026118 Ga0207675_100626001 Ga0207675_1006260011 68
492 3300026142 Ga0207698_10008334 Ga0207698_100083346 68
493 3300026142 Ga0207698_10024433 Ga0207698_100244333 68
494 3300026142 Ga0207698_10059354 Ga0207698_100593544 68
495 3300026142 Ga0207698_11033527 Ga0207698_110335271 68
496 3300026142 Ga0207698_11179418 Ga0207698_111794182 68
497 3300026142 Ga0207698_12527130 Ga0207698_125271301 68
498 3300027364 Ga0209967_1028934 Ga0209967_10289341 68
499 3300027552 Ga0209982_1057082 Ga0209982_10570822 68
500 3300027617 Ga0210002_1084160 Ga0210002_10841601 68
501 3300027682 Ga0209971_1042566 Ga0209971_10425662 68
502 3300027876 Ga0209974_10157792 Ga0209974_101577922 68
503 3300027876 Ga0209974_10227135 Ga0209974_102271353 68
504 3300028379 Ga0268266_10000009 Ga0268266_1000000945 68
505 3300028379 Ga0268266_10264270 Ga0268266_102642702 68
506 3300028379 Ga0268266_10437299 Ga0268266_104372991 68
507 3300028380 Ga0268265_10000002 Ga0268265_10000002759 68
508 3300028380 Ga0268265_10000171 Ga0268265_1000017115 68
509 3300028380 Ga0268265_10001260 Ga0268265_1000126015 68
510 3300028380 Ga0268265_10010758 Ga0268265_100107584 68
511 3300028380 Ga0268265_10025484 Ga0268265_100254845 68
512 3300028380 Ga0268265_10187595 Ga0268265_101875952 68
513 3300028381 Ga0268264_10000006 Ga0268264_1000000617 68
514 3300028381 Ga0268264_10000103 Ga0268264_1000010364 68
515 3300028381 Ga0268264_10000221 Ga0268264_1000022117 68
516 3300028381 Ga0268264_10006519 Ga0268264_100065197 68
517 3300028381 Ga0268264_10009510 Ga0268264_100095105 68
518 3300028786 Ga0307517_10206460 Ga0307517_102064602 68
519 3300030731 Ga0316177_1195044 Ga0316177_11950444 68
520 3300031456 Ga0307513_10052770 Ga0307513_100527704 68
521 3300031548 Ga0307408_100251612 Ga0307408_1002516123 68
522 3300031548 Ga0307408_100742500 Ga0307408_1007425003 68
523 3300031548 Ga0307408_100825739 Ga0307408_1008257392 68
524 3300031548 Ga0307408_100980730 Ga0307408_1009807301 68
525 3300031548 Ga0307408_101083596 Ga0307408_1010835962 68
526 3300031731 Ga0307405_10113810 Ga0307405_101138103 68
527 3300031731 Ga0307405_10345560 Ga0307405_103455601 68
528 3300031731 Ga0307405_10533606 Ga0307405_105336061 68
529 3300031731 Ga0307405_11527357 Ga0307405_115273572 68
530 3300031731 Ga0307405_11760669 Ga0307405_117606692 68
531 3300031731 Ga0307405_12080106 Ga0307405_120801062 68
532 3300031824 Ga0307413_10103574 Ga0307413_101035742 68
533 3300031824 Ga0307413_10122485 Ga0307413_101224854 68
534 3300031824 Ga0307413_10144419 Ga0307413_101444193 68
535 3300031824 Ga0307413_12026844 Ga0307413_120268442 68
536 3300031824 Ga0307413_12102964 Ga0307413_121029641 68
537 3300031852 Ga0307410_10017551 Ga0307410_100175513 68
538 3300031852 Ga0307410_10034873 Ga0307410_100348731 68
539 3300031852 Ga0307410_10112306 Ga0307410_101123064 68
540 3300031901 Ga0307406_10077834 Ga0307406_100778342 68
541 3300031901 Ga0307406_10202986 Ga0307406_102029862 68
542 3300031901 Ga0307406_10839995 Ga0307406_108399951 68
543 3300031901 Ga0307406_11245948 Ga0307406_112459482 68
544 3300031901 Ga0307406_12058554 Ga0307406_120585542 68
545 3300031903 Ga0307407_10039033 Ga0307407_100390332 68
546 3300031903 Ga0307407_10068166 Ga0307407_100681663 68
547 3300031911 Ga0307412_10012635 Ga0307412_100126355 68
548 3300031911 Ga0307412_10014477 Ga0307412_100144774 68
549 3300031911 Ga0307412_10023141 Ga0307412_100231414 68
550 3300031911 Ga0307412_10041279 Ga0307412_100412793 68
551 3300031911 Ga0307412_10134074 Ga0307412_101340742 68
552 3300031911 Ga0307412_10238317 Ga0307412_102383172 68
553 3300031911 Ga0307412_10279749 Ga0307412_102797492 68
554 3300031911 Ga0307412_10346062 Ga0307412_103460622 68
555 3300031911 Ga0307412_10591208 Ga0307412_105912081 68
556 3300031911 Ga0307412_10683218 Ga0307412_106832181 68
557 3300031911 Ga0307412_11359105 Ga0307412_113591051 68
558 3300031995 Ga0307409_100104733 Ga0307409_1001047334 68
559 3300031995 Ga0307409_100121157 Ga0307409_1001211572 68
560 3300031995 Ga0307409_100188343 Ga0307409_1001883434 68
561 3300032002 Ga0307416_100081670 Ga0307416_1000816703 68
562 3300032002 Ga0307416_100276738 Ga0307416_1002767384 68
563 3300032002 Ga0307416_100606780 Ga0307416_1006067802 68
564 3300032002 Ga0307416_100926260 Ga0307416_1009262602 68
565 3300032002 Ga0307416_101514025 Ga0307416_1015140252 68
566 3300032002 Ga0307416_103321709 Ga0307416_1033217091 68
567 3300032004 Ga0307414_10000136 Ga0307414_1000013638 68
568 3300032004 Ga0307414_10002538 Ga0307414_100025385 68
569 3300032004 Ga0307414_10013200 Ga0307414_100132006 68
570 3300032004 Ga0307414_10164710 Ga0307414_101647102 68
571 3300032004 Ga0307414_10234440 Ga0307414_102344401 68
572 3300032004 Ga0307414_10391439 Ga0307414_103914392 68
573 3300032004 Ga0307414_10536328 Ga0307414_105363282 68
574 3300032004 Ga0307414_10887653 Ga0307414_108876533 68
575 3300032004 Ga0307414_10951832 Ga0307414_109518321 68
576 3300032004 Ga0307414_11738626 Ga0307414_117386262 68
577 3300032004 Ga0307414_11990435 Ga0307414_119904351 68
578 3300032004 Ga0307414_12085014 Ga0307414_120850142 68
579 3300032005 Ga0307411_10032530 Ga0307411_100325302 68
580 3300032005 Ga0307411_10075565 Ga0307411_100755654 68
581 3300032005 Ga0307411_10092722 Ga0307411_100927223 68
582 3300032005 Ga0307411_10207421 Ga0307411_102074212 68
583 3300032126 Ga0307415_100448452 Ga0307415_1004484522 68
584 3300033180 Ga0307510_10003391 Ga0307510_1000339116 68
585 3300033180 Ga0307510_10380779 Ga0307510_103807791 68
586 3300034817 Ga0373948_0169374 Ga0373948_0169374_138_344 68
587 3300035112 Ga0373932_0015327 Ga0373932_0015327_457_663 68
588 3300035112 Ga0373932_0246634 Ga0373932_0246634_217_423 68
589 3300035170 Ga0373943_0230606 Ga0373943_0230606_567_773 68
590 3300035171 Ga0373946_0058783 Ga0373946_0058783_449_655 68
591 3300035692 Ga0373935_0301593 Ga0373935_0301593_509_733 68
592 3300035695 Ga0373927_0107858 Ga0373927_0107858_1226_1432 68
593 3300035725 Ga0373947_0265446 Ga0373947_0265446_580_786 68
594 3300037312 Ga0395899_0000738 Ga0395899_0000738_13293_13499 68
595 3300037312 Ga0395899_0024662 Ga0395899_0024662_1801_2007 68
596 3300037312 Ga0395899_0134648 Ga0395899_0134648_196_402 68
597 3300037418 Ga0395900_0143511 Ga0395900_0143511_1911_2117 68
598 3300037418 Ga0395900_1061371 Ga0395900_1061371_331_537 68
599 3300037418 Ga0395900_1464595 Ga0395900_1464595_309_515 68
600 3300037418 Ga0395900_1564069 Ga0395900_1564069_291_497 68
601 3300037471 Ga0395905_0046291 Ga0395905_0046291_817_1023 68
602 3300037471 Ga0395905_0060777 Ga0395905_0060777_2814_3020 68
603 3300037471 Ga0395905_0149090 Ga0395905_0149090_224_430 68
604 3300037471 Ga0395905_0496828 Ga0395905_0496828_467_673 68
605 3300037471 Ga0395905_0585702 Ga0395905_0585702_25_231 68
606 3300038443 Ga0395901_0079992 Ga0395901_0079992_1129_1335 68
607 3300038443 Ga0395901_0104641 Ga0395901_0104641_994_1200 68
608 3300038443 Ga0395901_0207081 Ga0395901_0207081_128_334 68
609 3300038443 Ga0395901_0219501 Ga0395901_0219501_1758_1964 68
610 3300038443 Ga0395901_1833055 Ga0395901_1833055_184_390 68
611 3300038705 Ga0237819_00702 Ga0237819_00702_9391_9597 68
612 3300039145 Ga0237816_00591 Ga0237816_00591_1145_1351 68
613 3300041443 Ga0451789_0540734 Ga0451789_0540734_99_305 68
614 3300041443 Ga0451789_0943086 Ga0451789_0943086_99_305 68
615 3300041451 Ga0451791_1228639 Ga0451791_1228639_145_351 68
616 3300041452 Ga0451793_0334588 Ga0451793_0334588_160_366 68
617 3300041455 Ga0451801_01071 Ga0451801_01071_83_289 68
618 3300041456 Ga0451795_0888193 Ga0451795_0888193_60_266 68
619 3300041460 Ga0451802_0602411 Ga0451802_0602411_150_356 68
620 3300041461 Ga0451805_073244 Ga0451805_073244_326_532 68
621 3300041463 Ga0451804_0674792 Ga0451804_0674792_178_384 68
622 3300041486 Ga0451807_0682885 Ga0451807_0682885_374_580 68
623 3300041494 Ga0451837_0232942 Ga0451837_0232942_151_357 68
624 3300041494 Ga0451837_0932992 Ga0451837_0932992_68_274 68
625 3300041498 Ga0451841_0723032 Ga0451841_0723032_22_228 68
626 3300041512 Ga0451853_3164471 Ga0451853_3164471_159_365 68
627 3300042005 Ga0439448_0002892 Ga0439448_0002892_1299_1505 68
628 3300042006 Ga0439432_075293 Ga0439432_075293_67_276 68
629 3300042008 Ga0439450_053772 Ga0439450_053772_106_312 68
630 3300042011 Ga0439454_027297 Ga0439454_027297_459_665 68
631 3300042012 Ga0439455_0031210 Ga0439455_0031210_776_982 68
632 3300042157 Ga0439458_0000411 Ga0439458_0000411_5897_6103 68
633 3300042157 Ga0439458_0023574 Ga0439458_0023574_526_732 68
634 3300042876 Ga0451577_0793079 Ga0451577_0793079_195_401 68
635 3300044694 Ga0466963_0764213 Ga0466963_0764213_221_427 68
636 3300044712 Ga0453684_0144988 Ga0453684_0144988_1738_1944 68
637 3300044719 Ga0466971_0013453 Ga0466971_0013453_513_719 68
638 3300044842 Ga0466957_0060779 Ga0466957_0060779_458_664 68
639 3300045051 Ga0451576_0287511 Ga0451576_0287511_1128_1334 68
640 3300045051 Ga0451576_1678546 Ga0451576_1678546_440_646 68
641 3300045836 Ga0466958_0045403 Ga0466958_0045403_503_709 68
642 3300045976 Ga0466967_0814319 Ga0466967_0814319_244_450 68
643 3300046454 Ga0495592_0433362 Ga0495592_0433362_444_650 68
644 3300046460 Ga0495638_0588644 Ga0495638_0588644_304_513 68
645 3300046501 Ga0495607_0009991 Ga0495607_0009991_3254_3460 68
646 3300046506 Ga0495583_0027264 Ga0495583_0027264_2587_2796 68
647 3300046507 Ga0495606_0032104 Ga0495606_0032104_2144_2350 68
648 3300046507 Ga0495606_0097322 Ga0495606_0097322_1567_1773 68
649 3300046515 Ga0495620_0067190 Ga0495620_0067190_85_291 68
650 3300046520 Ga0495637_0020614 Ga0495637_0020614_458_664 68
651 3300046522 Ga0495643_0036230 Ga0495643_0036230_746_952 68
652 3300046522 Ga0495643_0056975 Ga0495643_0056975_1804_2010 68
653 3300046522 Ga0495643_0159163 Ga0495643_0159163_522_728 68
654 3300046525 Ga0495663_0044134 Ga0495663_0044134_1026_1232 68
655 3300046530 Ga0495654_0021389 Ga0495654_0021389_721_927 68
656 3300046538 Ga0495609_0050693 Ga0495609_0050693_1266_1472 68
657 3300046539 Ga0495621_0153376 Ga0495621_0153376_497_703 68
658 3300046542 Ga0495597_0096319 Ga0495597_0096319_335_541 68
659 3300046558 Ga0495633_0164810 Ga0495633_0164810_474_680 68
660 3300046616 Ga0495668_0000004 Ga0495668_0000004_569462_569668 68
661 3300046616 Ga0495668_0018119 Ga0495668_0018119_3512_3721 68
662 3300046616 Ga0495668_0027073 Ga0495668_0027073_860_1066 68
663 3300046616 Ga0495668_0058282 Ga0495668_0058282_1330_1536 68
664 3300046660 Ga0495625_0008532 Ga0495625_0008532_629_835 68
665 3300046660 Ga0495625_0042708 Ga0495625_0042708_733_942 68
666 3300046660 Ga0495625_0284716 Ga0495625_0284716_161_367 68
667 3300046663 Ga0495635_1093518 Ga0495635_1093518_153_359 68
668 3300046684 Ga0495669_0132247 Ga0495669_0132247_787_993 68
669 3300046691 Ga0495670_0300947 Ga0495670_0300947_430_636 68
670 3300046810 Ga0495660_0183195 Ga0495660_0183195_212_418 68
671 3300047443 Ga0495687_004335 Ga0495687_004335_3130_3336 68
672 3300047445 Ga0495677_0119957 Ga0495677_0119957_21_230 68
673 3300048903 Ga0496100_0721524 Ga0496100_0721524_162_368 68
674 3300048905 Ga0496102_0234565 Ga0496102_0234565_657_863 68
675 3300048906 Ga0496103_0061206 Ga0496103_0061206_2031_2237 68
676 3300048906 Ga0496103_0247355 Ga0496103_0247355_230_436 68
677 3300048907 Ga0496104_1028999 Ga0496104_1028999_155_361 68
678 3300048910 Ga0496107_0499920 Ga0496107_0499920_613_819 68
679 3300048916 Ga0496113_0184797 Ga0496113_0184797_1431_1637 68
680 3300048916 Ga0496113_0756098 Ga0496113_0756098_51_257 68
681 3300048920 Ga0496117_0003839 Ga0496117_0003839_8396_8602 68
682 3300048920 Ga0496117_0007266 Ga0496117_0007266_5549_5755 68
683 3300048920 Ga0496117_0496874 Ga0496117_0496874_117_326 68
684 3300048921 Ga0496118_0000901 Ga0496118_0000901_19142_19348 68
685 3300048921 Ga0496118_0007049 Ga0496118_0007049_2197_2403 68
686 3300048921 Ga0496118_0042347 Ga0496118_0042347_3027_3266 68
687 3300048921 Ga0496118_0367527 Ga0496118_0367527_35_241 68
688 3300048921 Ga0496118_0395273 Ga0496118_0395273_159_365 68
689 3300048924 Ga0496121_0090548 Ga0496121_0090548_1105_1311 68
690 3300048924 Ga0496121_0167769 Ga0496121_0167769_164_370 68
691 3300048924 Ga0496121_0289737 Ga0496121_0289737_815_1021 68
692 3300048925 Ga0496122_0221186 Ga0496122_0221186_845_1051 68
693 3300048926 Ga0496123_0029600 Ga0496123_0029600_2107_2313 68
694 3300048926 Ga0496123_0038218 Ga0496123_0038218_662_868 68
695 3300048927 Ga0496124_0000192 Ga0496124_0000192_52478_52687 68
696 3300048927 Ga0496124_0001412 Ga0496124_0001412_11066_11272 68
697 3300048927 Ga0496124_0028878 Ga0496124_0028878_1795_2001 68
698 3300048927 Ga0496124_0079741 Ga0496124_0079741_1661_1867 68
699 3300048927 Ga0496124_0096167 Ga0496124_0096167_1990_2196 68
700 3300048928 Ga0496125_0066180 Ga0496125_0066180_1975_2181 68
701 3300048928 Ga0496125_0118299 Ga0496125_0118299_1049_1255 68
702 3300048929 Ga0496126_0433319 Ga0496126_0433319_199_408 68
703 3300048929 Ga0496126_1157881 Ga0496126_1157881_349_555 68
704 3300049460 Ga0495682_0258250 Ga0495682_0258250_116_322 68
705 3300049516 Ga0501293_012339 Ga0501293_012339_115_348 68
706 3300049521 Ga0501298_032011 Ga0501298_032011_546_776 68
707 3300049523 Ga0501300_034092 Ga0501300_034092_132_365 68
708 3300049536 Ga0501320_012355 Ga0501320_012355_585_791 68
709 3300049536 Ga0501320_028028 Ga0501320_028028_111_317 68
710 3300049537 Ga0501321_075558 Ga0501321_075558_103_309 68
711 3300049542 Ga0501326_14218 Ga0501326_14218_189_419 68
712 3300049549 Ga0501333_013451 Ga0501333_013451_106_312 68
713 3300049550 Ga0501334_20069 Ga0501334_20069_222_428 68
714 3300049551 Ga0501335_039037 Ga0501335_039037_318_524 68
715 3300049552 Ga0501336_007516 Ga0501336_007516_516_749 68
716 3300049553 Ga0501337_012984 Ga0501337_012984_104_310 68
717 3300049554 Ga0501338_09985 Ga0501338_09985_111_317 68
718 3300049569 Ga0501032_0010668 Ga0501032_0010668_306_512 68
719 3300049569 Ga0501032_0056543 Ga0501032_0056543_875_1081 68
720 3300049570 Ga0501033_0001724 Ga0501033_0001724_158_364 68
721 3300049571 Ga0501034_0004606 Ga0501034_0004606_10348_10554 68
722 3300049572 Ga0501036_0529121 Ga0501036_0529121_421_627 68
723 3300049572 Ga0501036_0589414 Ga0501036_0589414_122_328 68
724 3300049572 Ga0501036_0997233 Ga0501036_0997233_308_514 68
725 3300049574 Ga0501038_0337306 Ga0501038_0337306_232_438 68
726 3300049578 Ga0501042_0961576 Ga0501042_0961576_68_274 68
727 3300049579 Ga0501043_0028300 Ga0501043_0028300_4003_4209 68
728 3300049579 Ga0501043_0383773 Ga0501043_0383773_584_790 68
729 3300049580 Ga0501046_1148120 Ga0501046_1148120_138_344 68
730 3300049581 Ga0501047_0000256 Ga0501047_0000256_19062_19268 68
731 3300049581 Ga0501047_0026761 Ga0501047_0026761_3383_3589 68
732 3300049581 Ga0501047_0215173 Ga0501047_0215173_1385_1591 68
733 3300049581 Ga0501047_0642220 Ga0501047_0642220_448_654 68
734 3300049582 Ga0501048_0536426 Ga0501048_0536426_105_311 68
735 3300049583 Ga0501067_0154694 Ga0501067_0154694_470_676 68
736 3300049583 Ga0501067_0799899 Ga0501067_0799899_145_351 68
737 3300049585 Ga0501069_0702101 Ga0501069_0702101_250_456 68
738 3300049663 Ga0501223_030647 Ga0501223_030647_230_460 68
739 3300049686 Ga0501257_000012 Ga0501257_000012_5807_6037 68
740 3300049742 Ga0501080_0632248 Ga0501080_0632248_122_328 68
741 3300049744 Ga0501083_0411979 Ga0501083_0411979_416_622 68
742 3300049764 Ga0501267_003554 Ga0501267_003554_942_1148 68
743 3300049774 Ga0501278_006800 Ga0501278_006800_461_694 68
744 3300049776 Ga0501280_001885 Ga0501280_001885_885_1118 68
745 3300049823 Ga0501044_0027022 Ga0501044_0027022_4060_4266 68
746 3300049823 Ga0501044_0383872 Ga0501044_0383872_121_327 68
747 3300050493 nmdc:mga0k408_49308_c1 nmdc:mga0k408_49308_c1_1450_1662 68
748 3300050496 nmdc:mga07m45_117405_c1 nmdc:mga07m45_117405_c1_62_268 68
749 3300050513 nmdc:mga0rr50_905959_c1 nmdc:mga0rr50_905959_c1_281_487 68
750 3300053087 Ga0500643_000166 Ga0500643_000166_6022_6228 68
751 3300053087 Ga0500643_000590 Ga0500643_000590_19747_19953 68
752 3300053087 Ga0500643_001818 Ga0500643_001818_4624_4830 68
753 3300053088 Ga0500644_0317431 Ga0500644_0317431_91_297 68
754 3300053091 Ga0500647_0140807 Ga0500647_0140807_387_593 68
755 3300053093 Ga0500651_0039143 Ga0500651_0039143_2104_2310 68
756 3300053094 Ga0500566_0059490 Ga0500566_0059490_281_487 68
757 3300053116 Ga0500592_001082 Ga0500592_001082_2739_2945 68
758 3300053116 Ga0500592_007979 Ga0500592_007979_484_690 68
759 3300053116 Ga0500592_028852 Ga0500592_028852_379_585 68
760 3300053125 Ga0500618_000496 Ga0500618_000496_7641_7847 68
761 3300053125 Ga0500618_008655 Ga0500618_008655_776_982 68
762 3300053130 Ga0500642_0001609 Ga0500642_0001609_4485_4691 68
763 3300053131 Ga0500652_188894 Ga0500652_188894_385_591 68
764 3300053133 Ga0500655_000399 Ga0500655_000399_4121_4327 68
765 3300053134 Ga0500658_0004128 Ga0500658_0004128_2383_2589 68
766 3300053134 Ga0500658_0040535 Ga0500658_0040535_667_873 68
767 3300053139 Ga0500568_0036013 Ga0500568_0036013_620_826 68
768 3300053142 Ga0500577_0003903 Ga0500577_0003903_2306_2512 68
769 3300053142 Ga0500577_0249368 Ga0500577_0249368_51_257 68
770 3300053148 Ga0500590_004550 Ga0500590_004550_1148_1354 68
771 3300053151 Ga0500604_0042642 Ga0500604_0042642_781_987 68
772 3300053156 Ga0500622_0004003 Ga0500622_0004003_3156_3362 68
773 3300053158 Ga0500627_0000017 Ga0500627_0000017_48009_48215 68
774 3300053158 Ga0500627_0006961 Ga0500627_0006961_683_889 68
775 3300053158 Ga0500627_0015857 Ga0500627_0015857_1573_1779 68
776 3300053158 Ga0500627_0184263 Ga0500627_0184263_422_628 68
777 3300053163 Ga0500639_087162 Ga0500639_087162_820_1026 68
778 3300053177 Ga0500636_0051013 Ga0500636_0051013_2092_2298 68
779 3300053178 Ga0500637_0268426 Ga0500637_0268426_172_411 68
780 3300053724 Ga0500570_000052 Ga0500570_000052_7010_7216 68
781 3300053730 Ga0500645_064009 Ga0500645_064009_554_760 68
782 3300060353 Ga0501082_0275057 Ga0501082_0275057_1034_1240 68
783 3300061719 Ga0466962_0496147 Ga0466962_0496147_168_374 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

15

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.8883 2 68
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.8855 1 68
6kug-assembly1.cif.gz_A crystal structure of ybx1 csd with rna 0.8825 2 67
3a0j-assembly2.cif.gz_B crystal structure of cold shock protein 1 from thermus thermophilus hb8 0.8795 1 65
3pf5-assembly2.cif.gz_B crystal structure of bs-cspb in complex with ru6 0.8794 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8891 2 66 2.40.50.140
2haxA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8836 1 33 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8777 2 67 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8752 2 67 2.40.50.140
2lssA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8703 2 68 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A437GXQ1-F1-model_v4 Cold-shock protein 1.006 1 68 GO:0003676
GO:0005829
AF-A0A2E5BVN1-F1-model_v4 Cold-shock protein 1.006 1 68 GO:0003676
GO:0005829
AF-A0A7X2FUF1-F1-model_v4 Cold-shock protein 1.005 1 68 GO:0003676
GO:0005829
AF-Q2IX68-F1-model_v4 Cold-shock DNA-binding protein family 1.005 1 68 GO:0003677
GO:0005829
AF-A0A1H6FIG3-F1-model_v4 Cold-shock DNA-binding protein family 1.004 1 68 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
93.64 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map