F480469

General Info

Members Datasets Scaffolds Average Seq Length
779 431 759 210

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10098186|Ga0207643_100981862
Length 233
Sequence MHNGNTRTVGLALGAGKRQVLSMYAVKEIHYTLQGEGAQTGRPAVFCRFAGCNLWSGREQDRAKATCNFCDTDFVGTDGPGGGRFPTPESLAGACRERWRGNSGTPPYVVLTGGEPMLQVDEPLIDALHKVGFEVAIETNGTLPVPRVIDWICVSPKAGARLVQCSGDELKLVYPQDALAPKQVEDLDFAHFLLQPMDEGPRTPANLRAAIDYCLAHPKWRLSMQTHKLLGLP

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
13 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
14 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
15 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
16 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
17 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
18 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
25 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
26 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
327 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
328 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
355 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
381 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
382 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
383 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
409 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
410 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
411 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
412 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
413 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
414 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
415 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
416 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
417 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
420 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
423 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
424 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
425 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
426 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
429 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
430 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
431 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0.13
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.4
Nodule 0.39
Rhizoplane 4.62
Rhizosphere 78.56
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000609 3300001904 Bacteria 6546
2 JGI24741J21665_1000487 3300001915 Bacteria 12106
3 JGI24740J21852_10001921 3300001979 Bacteria 9519
4 JGI24739J22299_10011062 3300001989 Bacteria 3337
5 JGI24739J22299_10041378 3300001989 Bacteria 1533
6 JGI24737J22298_10009364 3300001990 Bacteria 3262
7 JGI24749J21850_1000036 3300002076 Bacteria 24944
8 JGI24751J29686_10000186 3300002459 Bacteria 27944
9 JGI24751J29686_10001664 3300002459 Bacteria 4577
10 JGI24751J29686_10001717 3300002459 Bacteria 4505
11 JGI25406J46586_10022674 3300003203 Bacteria 2496
12 JGI25153J46596_10002864 3300003215 Bacteria 9800
13 rootH1_10105535 3300003323 Bacteria 3798
14 Ga0055525_1000070 3300003759 Bacteria 183047
15 Ga0055542_1000402 3300003762 Bacteria 42527
16 Ga0055529_1000439 3300003763 Bacteria 41829
17 Ga0055526_1007133 3300003771 Bacteria 5892
18 Ga0055536_1001293 3300003781 Bacteria 15394
19 Ga0055536_1005081 3300003781 Bacteria 6530
20 Ga0055536_1005334 3300003781 Bacteria 6312
21 Ga0055534_1007276 3300003784 Bacteria 2664
22 Ga0055530_10000310 3300003791 Bacteria 44225
23 Ga0055531_10001051 3300003794 Bacteria 21776
24 Ga0055531_10005376 3300003794 Bacteria 7505
25 Ga0055543_1016680 3300004625 Bacteria 1393
26 Ga0065165_1001900 3300005262 Bacteria 20047
27 Ga0065707_10104835 3300005295 Bacteria 2676
28 Ga0065707_10177073 3300005295 Bacteria 1443
29 Ga0065707_10283397 3300005295 Bacteria 1042
30 Ga0070658_10008347 3300005327 Bacteria 8330
31 Ga0070658_10110177 3300005327 Bacteria 2280
32 Ga0070676_10005214 3300005328 Bacteria 6909
33 Ga0070676_10199875 3300005328 Bacteria 1310
34 Ga0070683_100054364 3300005329 Bacteria 3713
35 Ga0070690_100005448 3300005330 Bacteria 7151
36 Ga0070670_100000090 3300005331 Bacteria 86222
37 Ga0070670_100000705 3300005331 Bacteria 25890
38 Ga0070670_100002436 3300005331 Bacteria 15344
39 Ga0070670_100428422 3300005331 Bacteria 1170
40 Ga0068869_100018218 3300005334 Bacteria 4776
41 Ga0070666_10012180 3300005335 Bacteria 5418
42 Ga0070666_10120523 3300005335 Bacteria 1819
43 Ga0070680_100011814 3300005336 Bacteria 6773
44 Ga0070680_100081695 3300005336 Bacteria 2666
45 Ga0070682_100007997 3300005337 Bacteria 5952
46 Ga0068868_100007010 3300005338 Bacteria 8012
47 Ga0068868_100072191 3300005338 Bacteria 2753
48 Ga0070660_100006061 3300005339 Bacteria 8359
49 Ga0070660_100169325 3300005339 Bacteria 1764
50 Ga0070689_100008882 3300005340 Bacteria 7102
51 Ga0070691_10000097 3300005341 Bacteria 25341
52 Ga0070687_100005604 3300005343 Bacteria 5095
53 Ga0070661_100000660 3300005344 Bacteria 25350
54 Ga0070661_100013737 3300005344 Bacteria 5688
55 Ga0070661_100051403 3300005344 Bacteria 3016
56 Ga0070661_100113075 3300005344 Bacteria 2029
57 Ga0070692_10000901 3300005345 Bacteria 10061
58 Ga0070692_10013866 3300005345 Bacteria 3767
59 Ga0070668_100000073 3300005347 Bacteria 62170
60 Ga0070668_100000117 3300005347 Bacteria 48801
61 Ga0070669_100000093 3300005353 Bacteria 87563
62 Ga0070669_100001343 3300005353 Bacteria 17726
63 Ga0070669_100112675 3300005353 Bacteria 2066
64 Ga0070669_100189937 3300005353 Bacteria 1611
65 Ga0070669_100492599 3300005353 Bacteria 1016
66 Ga0070675_100077347 3300005354 Bacteria 2769
67 Ga0070671_100000442 3300005355 Bacteria 28835
68 Ga0070671_100000472 3300005355 Bacteria 28061
69 Ga0070674_100003413 3300005356 Bacteria 8912
70 Ga0070674_100003732 3300005356 Bacteria 8590
71 Ga0070674_100032093 3300005356 Bacteria 3486
72 Ga0070673_100007309 3300005364 Bacteria 7272
73 Ga0070688_100002638 3300005365 Bacteria 9095
74 Ga0070667_100000016 3300005367 Bacteria 237028
75 Ga0070667_100000113 3300005367 Bacteria 104015
76 Ga0070667_100001089 3300005367 Bacteria 24880
77 Ga0070667_100002285 3300005367 Bacteria 16870
78 Ga0070667_100052040 3300005367 Bacteria 3454
79 Ga0070709_10000195 3300005434 Bacteria 38758
80 Ga0070714_100004026 3300005435 Bacteria 11046
81 Ga0070701_10000505 3300005438 Bacteria 13389
82 Ga0070705_100000552 3300005440 Bacteria 21776
83 Ga0070694_100033270 3300005444 Bacteria 3391
84 Ga0070663_100021037 3300005455 Bacteria 4331
85 Ga0070663_100028730 3300005455 Bacteria 3790
86 Ga0070678_100003018 3300005456 Bacteria 9327
87 Ga0070678_100003228 3300005456 Bacteria 9056
88 Ga0070662_100000755 3300005457 Bacteria 19849
89 Ga0070662_100083578 3300005457 Bacteria 2383
90 Ga0070681_10041511 3300005458 Bacteria 4611
91 Ga0068867_100010274 3300005459 Bacteria 6605
92 Ga0068867_100239053 3300005459 Bacteria 1472
93 Ga0070685_10002740 3300005466 Bacteria 9026
94 Ga0070707_100327245 3300005468 Bacteria 1489
95 Ga0070699_100037122 3300005518 Bacteria 4216
96 Ga0070697_100005589 3300005536 Bacteria 9691
97 Ga0068853_100000205 3300005539 Bacteria 41773
98 Ga0068853_100115805 3300005539 Bacteria 2386
99 Ga0070672_100006137 3300005543 Bacteria 8044
100 Ga0070686_100005020 3300005544 Bacteria 7307
101 Ga0070695_100000123 3300005545 Bacteria 34747
102 Ga0070693_100000617 3300005547 Bacteria 15789
103 Ga0070665_100000021 3300005548 Bacteria 389668
104 Ga0070665_100006377 3300005548 Bacteria 12024
105 Ga0070665_100074775 3300005548 Bacteria 3394
106 Ga0070665_100217652 3300005548 Bacteria 1910
107 Ga0070665_101093798 3300005548 Bacteria 809
108 Ga0070704_100000048 3300005549 Bacteria 38795
109 Ga0068855_100128518 3300005563 Bacteria 2895
110 Ga0068855_100271769 3300005563 Bacteria 1885
111 Ga0068855_100341332 3300005563 Bacteria 1651
112 Ga0068855_100395493 3300005563 Bacteria 1515
113 Ga0070664_100044789 3300005564 Bacteria 3736
114 Ga0068857_100000232 3300005577 Bacteria 37288
115 Ga0068857_100140951 3300005577 Bacteria 2179
116 Ga0068854_100003719 3300005578 Bacteria 9543
117 Ga0068854_100020568 3300005578 Bacteria 4468
118 Ga0068854_100233762 3300005578 Bacteria 1460
119 Ga0068854_100502780 3300005578 Bacteria 1021
120 Ga0068856_100014757 3300005614 Bacteria 7540
121 Ga0068856_100408103 3300005614 Bacteria 1378
122 Ga0070702_100022914 3300005615 Bacteria 3310
123 Ga0068852_100030638 3300005616 Bacteria 4432
124 Ga0068852_100042333 3300005616 Bacteria 3855
125 Ga0068852_100053415 3300005616 Bacteria 3478
126 Ga0068852_100196920 3300005616 Bacteria 1905
127 Ga0068852_100407186 3300005616 Bacteria 1339
128 Ga0068859_100003700 3300005617 Bacteria 15590
129 Ga0068859_100004142 3300005617 Bacteria 14807
130 Ga0068859_100061394 3300005617 Bacteria 3787
131 Ga0068859_100105885 3300005617 Bacteria 2872
132 Ga0068864_100000127 3300005618 Bacteria 74135
133 Ga0068864_100000968 3300005618 Bacteria 24069
134 Ga0068864_100015911 3300005618 Bacteria 6261
135 Ga0068866_10001010 3300005718 Bacteria 12364
136 Ga0068861_100000202 3300005719 Bacteria 31876
137 Ga0068861_100012077 3300005719 Bacteria 6019
138 Ga0068861_100111314 3300005719 Bacteria 2194
139 Ga0068861_100943286 3300005719 Bacteria 820
140 Ga0068851_10011604 3300005834 Bacteria 4135
141 Ga0068870_10104685 3300005840 Bacteria 1606
142 Ga0068863_100002070 3300005841 Bacteria 19896
143 Ga0068863_100013188 3300005841 Bacteria 7971
144 Ga0068863_100035740 3300005841 Bacteria 4731
145 Ga0068863_100127345 3300005841 Bacteria 2430
146 Ga0068863_100435103 3300005841 Bacteria 1286
147 Ga0068858_100000937 3300005842 Bacteria 30200
148 Ga0068858_100004809 3300005842 Bacteria 13233
149 Ga0068858_100109329 3300005842 Bacteria 2581
150 Ga0068860_100000215 3300005843 Bacteria 90561
151 Ga0068860_100000361 3300005843 Bacteria 60231
152 Ga0068860_100003620 3300005843 Bacteria 15888
153 Ga0068862_100000126 3300005844 Bacteria 89210
154 Ga0068862_100000346 3300005844 Bacteria 50307
155 Ga0068862_100009080 3300005844 Bacteria 8227
156 Ga0081455_10087817 3300005937 Bacteria 2529
157 Ga0075364_10093007 3300006051 Bacteria 2002
158 Ga0075364_10178619 3300006051 Bacteria 1436
159 Ga0070715_10300329 3300006163 Bacteria 859
160 Ga0070716_100000218 3300006173 Bacteria 22937
161 Ga0070712_100002907 3300006175 Bacteria 10617
162 Ga0070712_100135394 3300006175 Bacteria 1873
163 Ga0075367_10063214 3300006178 Bacteria 2212
164 Ga0075369_10113204 3300006186 Bacteria 1224
165 Ga0097621_100116553 3300006237 Bacteria 2262
166 Ga0097621_100206983 3300006237 Bacteria 1705
167 Ga0097621_100960959 3300006237 Bacteria 798
168 Ga0075370_10017233 3300006353 Bacteria 3900
169 Ga0068871_100017042 3300006358 Bacteria 5488
170 Ga0075430_100140689 3300006846 Bacteria 2010
171 Ga0075431_100291442 3300006847 Bacteria 1651
172 Ga0075433_10128482 3300006852 Bacteria 2251
173 Ga0075434_100118043 3300006871 Bacteria 2666
174 Ga0075429_100555429 3300006880 Bacteria 1006
175 Ga0068865_100000115 3300006881 Bacteria 40312
176 Ga0097620_100003699 3300006931 Bacteria 15590
177 Ga0097620_100004142 3300006931 Bacteria 14807
178 Ga0097620_100061394 3300006931 Bacteria 3787
179 Ga0105251_10000895 3300009011 Bacteria 26673
180 Ga0105251_10068793 3300009011 Bacteria 1652
181 Ga0105250_10009031 3300009092 Bacteria 4212
182 Ga0105240_10305806 3300009093 Bacteria 1817
183 Ga0105240_10372738 3300009093 Bacteria 1614
184 Ga0111539_10895463 3300009094 Bacteria 1032
185 Ga0105247_10000149 3300009101 Bacteria 68765
186 Ga0105247_10457378 3300009101 Bacteria 921
187 Ga0114129_10059409 3300009147 Bacteria 5345
188 Ga0114129_10390852 3300009147 Bacteria 1835
189 Ga0105243_10000222 3300009148 Bacteria 65448
190 Ga0105243_10002386 3300009148 Bacteria 15738
191 Ga0105241_10001192 3300009174 Bacteria 19871
192 Ga0105241_10021444 3300009174 Bacteria 4775
193 Ga0105242_10001817 3300009176 Bacteria 16766
194 Ga0105248_10000155 3300009177 Bacteria 79121
195 Ga0105248_10000668 3300009177 Bacteria 38918
196 Ga0105248_10247999 3300009177 Bacteria 2004
197 Ga0105237_10000425 3300009545 Bacteria 60053
198 Ga0105238_10039188 3300009551 Bacteria 4806
199 Ga0105238_10063649 3300009551 Bacteria 3689
200 Ga0105238_10153997 3300009551 Bacteria 2273
201 Ga0105249_10000411 3300009553 Bacteria 40983
202 Ga0105239_10006065 3300010375 Bacteria 14070
203 Ga0105239_10255229 3300010375 Bacteria 1970
204 Ga0105239_11380419 3300010375 Bacteria 813
205 Ga0105246_10000889 3300011119 Bacteria 17168
206 Ga0157373_10157697 3300013100 Bacteria 1596
207 Ga0157371_10000066 3300013102 Bacteria 168406
208 Ga0157371_10013764 3300013102 Bacteria 6130
209 Ga0157371_10062904 3300013102 Bacteria 2631
210 Ga0157370_10236117 3300013104 Bacteria 1692
211 Ga0157369_10000371 3300013105 Bacteria 59853
212 Ga0157369_10023956 3300013105 Bacteria 6792
213 Ga0157369_10144410 3300013105 Bacteria 2516
214 Ga0157369_10244961 3300013105 Bacteria 1872
215 Ga0171462_1005 3300013250 Bacteria 598379
216 Ga0157374_10002130 3300013296 Bacteria 16669
217 Ga0157374_10375019 3300013296 Bacteria 1417
218 Ga0157378_10000407 3300013297 Bacteria 42495
219 Ga0157378_10000569 3300013297 Bacteria 34903
220 Ga0163162_10000407 3300013306 Bacteria 39446
221 Ga0157372_10002032 3300013307 Bacteria 22002
222 Ga0157372_10080977 3300013307 Bacteria 3675
223 Ga0157372_10216813 3300013307 Bacteria 2218
224 Ga0157375_10001248 3300013308 Bacteria 21994
225 Ga0157375_10148196 3300013308 Bacteria 2479
226 Ga0157375_10634120 3300013308 Bacteria 1226
227 Ga0163163_10002088 3300014325 Bacteria 16877
228 Ga0163163_11253976 3300014325 Bacteria 804
229 Ga0157380_10000201 3300014326 Bacteria 35120
230 Ga0157380_10000331 3300014326 Bacteria 28551
231 Ga0157379_10000215 3300014968 Bacteria 44881
232 Ga0157376_10002367 3300014969 Bacteria 12725
233 Ga0157376_10398163 3300014969 Bacteria 1331
234 Ga0163161_10004608 3300017792 Bacteria 9595
235 Ga0163161_10025277 3300017792 Bacteria 4202
236 Ga0206353_10250908 3300020082 Bacteria 902
237 Ga0214544_1001527 3300021320 Bacteria 48319
238 Ga0213876_10169321 3300021384 Bacteria 1162
239 Ga0209563_100053 3300025230 Bacteria 332370
240 Ga0207425_1000645 3300025245 Bacteria 19440
241 Ga0209677_105739 3300025253 Bacteria 3152
242 Ga0209148_1000008 3300025254 Bacteria 1504371
243 Ga0209129_1000158 3300025258 Bacteria 103711
244 Ga0209455_1000002 3300025272 Bacteria 1505459
245 Ga0209673_1005778 3300025273 Bacteria 6155
246 Ga0209675_1000025 3300025291 Bacteria 294102
247 Ga0209676_1000238 3300025292 Bacteria 117732
248 Ga0209676_1000259 3300025292 Bacteria 111746
249 Ga0209676_1000571 3300025292 Bacteria 55434
250 Ga0209025_1021125 3300025294 Bacteria 3523
251 Ga0209564_1000282 3300025295 Bacteria 103837
252 Ga0209758_1000023 3300025297 Bacteria 612453
253 Ga0209758_1000500 3300025297 Bacteria 63618
254 Ga0209758_1000630 3300025297 Bacteria 54005
255 Ga0209758_1042779 3300025297 Bacteria 1676
256 Ga0209050_1000104 3300025298 Bacteria 228921
257 Ga0209050_1001457 3300025298 Bacteria 25353
258 Ga0209050_1016416 3300025298 Bacteria 3030
259 Ga0209257_1000120 3300025304 Bacteria 223025
260 Ga0209257_1000323 3300025304 Bacteria 100164
261 Ga0209257_1001790 3300025304 Bacteria 23629
262 Ga0209257_1019677 3300025304 Bacteria 2530
263 Ga0209257_1033610 3300025304 Bacteria 1610
264 Ga0207653_10020586 3300025885 Bacteria 2088
265 Ga0207692_10004025 3300025898 Bacteria 5785
266 Ga0207710_10015435 3300025900 Bacteria 3227
267 Ga0207688_10005787 3300025901 Bacteria 6731
268 Ga0207680_10092513 3300025903 Bacteria 1926
269 Ga0207647_10005153 3300025904 Bacteria 9616
270 Ga0207685_10020815 3300025905 Bacteria 2188
271 Ga0207699_10002236 3300025906 Bacteria 9136
272 Ga0207699_10149565 3300025906 Bacteria 1543
273 Ga0207645_10002334 3300025907 Bacteria 14987
274 Ga0207645_10069990 3300025907 Bacteria 2244
275 Ga0207643_10098186 3300025908 Bacteria 1715
276 Ga0207705_10034288 3300025909 Bacteria 3628
277 Ga0207654_10001275 3300025911 Bacteria 13415
278 Ga0207654_10107501 3300025911 Bacteria 1730
279 Ga0207707_10043695 3300025912 Bacteria 3907
280 Ga0207695_10011705 3300025913 Bacteria 10600
281 Ga0207695_10234411 3300025913 Bacteria 1738
282 Ga0207671_10003444 3300025914 Bacteria 15770
283 Ga0207693_10000426 3300025915 Bacteria 38313
284 Ga0207660_10000186 3300025917 Bacteria 39363
285 Ga0207662_10020869 3300025918 Bacteria 3739
286 Ga0207657_10000034 3300025919 Bacteria 127192
287 Ga0207657_10010683 3300025919 Bacteria 9144
288 Ga0207649_10000471 3300025920 Bacteria 28765
289 Ga0207649_10034077 3300025920 Bacteria 3047
290 Ga0207649_10050263 3300025920 Bacteria 2578
291 Ga0207649_10105879 3300025920 Bacteria 1870
292 Ga0207646_10132159 3300025922 Unclassified 2247
293 Ga0207681_10000005 3300025923 Bacteria 555724
294 Ga0207681_10011328 3300025923 Bacteria 5479
295 Ga0207681_10118449 3300025923 Bacteria 1938
296 Ga0207681_10735745 3300025923 Bacteria 821
297 Ga0207694_10020619 3300025924 Bacteria 4990
298 Ga0207694_10024229 3300025924 Bacteria 4607
299 Ga0207694_10290065 3300025924 Bacteria 1345
300 Ga0207650_10000004 3300025925 Bacteria 743372
301 Ga0207650_10000772 3300025925 Bacteria 24613
302 Ga0207650_10006750 3300025925 Bacteria 7825
303 Ga0207650_10159334 3300025925 Bacteria 1787
304 Ga0207659_10004575 3300025926 Bacteria 8365
305 Ga0207659_10681611 3300025926 Bacteria 879
306 Ga0207664_10020149 3300025929 Bacteria 4938
307 Ga0207644_10000112 3300025931 Bacteria 60600
308 Ga0207690_10003067 3300025932 Bacteria 10064
309 Ga0207690_10055524 3300025932 Bacteria 2668
310 Ga0207706_10000076 3300025933 Bacteria 102376
311 Ga0207706_10021113 3300025933 Bacteria 5849
312 Ga0207686_10104377 3300025934 Bacteria 1898
313 Ga0207709_10000047 3300025935 Bacteria 238649
314 Ga0207669_10000839 3300025937 Bacteria 13129
315 Ga0207669_10042205 3300025937 Bacteria 2660
316 Ga0207704_10013649 3300025938 Bacteria 4075
317 Ga0207704_10243872 3300025938 Bacteria 1344
318 Ga0207665_10000237 3300025939 Bacteria 37657
319 Ga0207691_10002125 3300025940 Bacteria 19383
320 Ga0207711_10002233 3300025941 Bacteria 17372
321 Ga0207711_10011113 3300025941 Bacteria 7482
322 Ga0207711_10093778 3300025941 Bacteria 2645
323 Ga0207689_10026637 3300025942 Bacteria 4842
324 Ga0207661_10154325 3300025944 Bacteria 1987
325 Ga0207679_10014150 3300025945 Bacteria 5238
326 Ga0207667_10000001 3300025949 Bacteria 1178522
327 Ga0207667_10014236 3300025949 Bacteria 9073
328 Ga0207667_10087849 3300025949 Bacteria 3216
329 Ga0207651_10001259 3300025960 Bacteria 11415
330 Ga0207651_10627043 3300025960 Bacteria 942
331 Ga0207668_10000186 3300025972 Bacteria 42321
332 Ga0207668_10021427 3300025972 Bacteria 4121
333 Ga0207640_10001564 3300025981 Bacteria 12294
334 Ga0207640_10003311 3300025981 Bacteria 8684
335 Ga0207640_10017062 3300025981 Bacteria 4240
336 Ga0207658_10000034 3300025986 Bacteria 155561
337 Ga0207658_10000134 3300025986 Bacteria 78342
338 Ga0207658_10001168 3300025986 Bacteria 20967
339 Ga0207658_10013218 3300025986 Bacteria 5636
340 Ga0207677_10018414 3300026023 Bacteria 4190
341 Ga0207677_10019532 3300026023 Bacteria 4094
342 Ga0207703_10001374 3300026035 Bacteria 22243
343 Ga0207703_10029730 3300026035 Bacteria 4312
344 Ga0207639_10000577 3300026041 Bacteria 25254
345 Ga0207639_10115878 3300026041 Bacteria 2192
346 Ga0207678_10000036 3300026067 Bacteria 104164
347 Ga0207678_10009857 3300026067 Bacteria 8392
348 Ga0207678_10017410 3300026067 Bacteria 6311
349 Ga0207708_10001696 3300026075 Bacteria 16310
350 Ga0207702_10018760 3300026078 Bacteria 5721
351 Ga0207702_10068664 3300026078 Bacteria 3045
352 Ga0207641_10001076 3300026088 Bacteria 27468
353 Ga0207641_10001901 3300026088 Bacteria 20051
354 Ga0207641_10003497 3300026088 Bacteria 13902
355 Ga0207641_10013413 3300026088 Bacteria 6719
356 Ga0207648_10020684 3300026089 Bacteria 5923
357 Ga0207648_10042368 3300026089 Bacteria 3996
358 Ga0207676_10000006 3300026095 Bacteria 681936
359 Ga0207676_10001543 3300026095 Bacteria 17000
360 Ga0207676_10053821 3300026095 Bacteria 3151
361 Ga0207674_10012285 3300026116 Bacteria 9576
362 Ga0207674_10013137 3300026116 Bacteria 9215
363 Ga0207674_10022580 3300026116 Bacteria 6754
364 Ga0207674_10052919 3300026116 Bacteria 4139
365 Ga0207674_11106120 3300026116 Bacteria 762
366 Ga0207675_100000115 3300026118 Bacteria 65051
367 Ga0207675_100001165 3300026118 Bacteria 26188
368 Ga0207675_100151667 3300026118 Bacteria 2206
369 Ga0207683_10000015 3300026121 Bacteria 125989
370 Ga0207683_10004185 3300026121 Bacteria 12486
371 Ga0207683_10053962 3300026121 Bacteria 3525
372 Ga0207698_10001455 3300026142 Bacteria 13772
373 Ga0207698_10012189 3300026142 Bacteria 5613
374 Ga0207698_10124633 3300026142 Bacteria 2188
375 Ga0207698_10215963 3300026142 Bacteria 1729
376 Ga0207698_10374869 3300026142 Bacteria 1352
377 Ga0207428_10019287 3300027907 Bacteria 5815
378 Ga0268266_10000015 3300028379 Bacteria 630629
379 Ga0268266_10045238 3300028379 Bacteria 3766
380 Ga0268266_10144254 3300028379 Bacteria 2139
381 Ga0268266_10157592 3300028379 Bacteria 2052
382 Ga0268265_10000001 3300028380 Bacteria 1230727
383 Ga0268265_10000689 3300028380 Bacteria 33191
384 Ga0268265_10034091 3300028380 Bacteria 3708
385 Ga0268264_10000075 3300028381 Bacteria 256011
386 Ga0268264_10000087 3300028381 Bacteria 236696
387 Ga0265319_1022941 3300028563 Bacteria 2267
388 Ga0265338_10016348 3300028800 Bacteria 8081
389 Ga0265330_10029096 3300031235 Bacteria 2486
390 Ga0265332_10044288 3300031238 Bacteria 1920
391 Ga0265328_10020738 3300031239 Bacteria 2513
392 Ga0265339_10028653 3300031249 Bacteria 3165
393 Ga0265339_10075200 3300031249 Bacteria 1794
394 Ga0265331_10001230 3300031250 Bacteria 19256
395 Ga0265327_10000266 3300031251 Bacteria 103308
396 Ga0307513_10037879 3300031456 Bacteria 5361
397 Ga0307513_10182785 3300031456 Bacteria 1958
398 Ga0307408_100012308 3300031548 Bacteria 5665
399 Ga0307408_100052045 3300031548 Bacteria 2953
400 Ga0307408_100060820 3300031548 Bacteria 2755
401 Ga0307508_10001423 3300031616 Bacteria 26934
402 Ga0307508_10243111 3300031616 Bacteria 1397
403 Ga0265314_10003304 3300031711 Bacteria 15748
404 Ga0265342_10019071 3300031712 Bacteria 4427
405 Ga0307405_10201425 3300031731 Bacteria 1446
406 Ga0307406_10030959 3300031901 Bacteria 3254
407 Ga0307406_10285155 3300031901 Bacteria 1262
408 Ga0307412_10035784 3300031911 Bacteria 3175
409 Ga0307412_10055989 3300031911 Bacteria 2626
410 Ga0307412_11002013 3300031911 Bacteria 738
411 Ga0307416_100139996 3300032002 Bacteria 2197
412 Ga0307416_100330979 3300032002 Bacteria 1531
413 Ga0307414_10001258 3300032004 Bacteria 13090
414 Ga0307414_10004998 3300032004 Bacteria 7255
415 Ga0307414_10034316 3300032004 Bacteria 3362
416 Ga0307414_10081538 3300032004 Bacteria 2369
417 Ga0307414_10344968 3300032004 Bacteria 1276
418 Ga0307411_10507224 3300032005 Bacteria 1021
419 Ga0307510_10104363 3300033180 Bacteria 2608
420 Ga0373959_0010324 3300034820 Bacteria 1629
421 Ga0373949_0106723 3300035090 Bacteria 773
422 Ga0373949_0162583 3300035090 Bacteria 652
423 Ga0373952_0010363 3300035092 Bacteria 1800
424 Ga0373932_0003055 3300035112 Bacteria 4092
425 Ga0373962_0016902 3300035242 Bacteria 1886
426 Ga0316574_0195809 3300035398 Bacteria 1299
427 Ga0373927_0021985 3300035695 Bacteria 4180
428 Ga0373927_0025095 3300035695 Bacteria 3897
429 Ga0373927_0108825 3300035695 Bacteria 1805
430 Ga0373933_0163783 3300035724 Bacteria 1413
431 Ga0373933_0221884 3300035724 Bacteria 1213
432 Ga0373947_0042214 3300035725 Bacteria 2722
433 Ga0373947_0084691 3300035725 Bacteria 1968
434 Ga0373937_0124617 3300036401 Bacteria 2403
435 Ga0373937_0668889 3300036401 Bacteria 984
436 Ga0373925_0006973 3300037068 Bacteria 8262
437 Ga0395900_0026543 3300037418 Bacteria 5930
438 Ga0395898_0005988 3300037466 Bacteria 13059
439 Ga0395898_0925160 3300037466 Bacteria 809
440 Ga0395905_0000879 3300037471 Bacteria 39189
441 Ga0395905_0018426 3300037471 Bacteria 6626
442 Ga0395901_0007915 3300038443 Bacteria 10723
443 Ga0436365_1495202 3300039437 Bacteria 8639
444 Ga0436363_0127467 3300039450 Bacteria 1061
445 Ga0436363_1148524 3300039450 Bacteria 1642
446 Ga0439433_0104222 3300041999 Bacteria 706
447 Ga0451577_0407104 3300042876 Bacteria 1235
448 Ga0466973_0369958 3300044659 Bacteria 903
449 Ga0453684_0094808 3300044712 Bacteria 3670
450 Ga0453684_0129192 3300044712 Bacteria 3034
451 Ga0453684_0297785 3300044712 Bacteria 1834
452 Ga0466971_0149536 3300044719 Bacteria 1090
453 Ga0466957_0016753 3300044842 Bacteria 4286
454 Ga0466957_0082838 3300044842 Bacteria 2000
455 Ga0451576_0000805 3300045051 Bacteria 61452
456 Ga0466958_0002574 3300045836 Bacteria 9159
457 Ga0495603_0000161 3300046455 Bacteria 33937
458 Ga0495629_0000451 3300046459 Bacteria 34194
459 Ga0495629_0044152 3300046459 Bacteria 3129
460 Ga0495638_0022944 3300046460 Bacteria 4090
461 Ga0495638_0118210 3300046460 Bacteria 1568
462 Ga0495641_0049008 3300046461 Bacteria 1935
463 Ga0495651_0309776 3300046462 Bacteria 1056
464 Ga0495580_0000067 3300046472 Bacteria 63149
465 Ga0495580_0282681 3300046472 Bacteria 1132
466 Ga0495582_0006294 3300046473 Bacteria 6611
467 Ga0495639_0000655 3300046475 Bacteria 16007
468 Ga0495584_0033609 3300046491 Bacteria 2595
469 Ga0495594_0000022 3300046499 Bacteria 71881
470 Ga0495596_0026363 3300046500 Bacteria 2343
471 Ga0495596_0118806 3300046500 Bacteria 1027
472 Ga0495607_0060305 3300046501 Bacteria 2160
473 Ga0495583_0014884 3300046506 Bacteria 4259
474 Ga0495583_0030931 3300046506 Bacteria 2601
475 Ga0495583_0076721 3300046506 Bacteria 1459
476 Ga0495606_0001772 3300046507 Bacteria 27645
477 Ga0495606_0043764 3300046507 Bacteria 2982
478 Ga0495606_0168476 3300046507 Bacteria 1273
479 Ga0495616_0047415 3300046513 Bacteria 2164
480 Ga0495631_0015864 3300046518 Bacteria 3601
481 Ga0495631_0108191 3300046518 Bacteria 1195
482 Ga0495637_0040280 3300046520 Bacteria 2012
483 Ga0495637_0106403 3300046520 Bacteria 1091
484 Ga0495643_0008837 3300046522 Bacteria 6342
485 Ga0495643_0010013 3300046522 Bacteria 5851
486 Ga0495648_0000444 3300046524 Bacteria 44706
487 Ga0495648_0182042 3300046524 Bacteria 1067
488 Ga0495663_0000943 3300046525 Bacteria 9696
489 Ga0495666_0102451 3300046526 Bacteria 1348
490 Ga0495642_0014869 3300046528 Bacteria 3020
491 Ga0495654_0049587 3300046530 Bacteria 2056
492 Ga0495665_0004923 3300046531 Bacteria 7199
493 Ga0495640_0073972 3300046533 Bacteria 2280
494 Ga0495586_0301200 3300046535 Bacteria 918
495 Ga0495587_0014759 3300046536 Bacteria 4893
496 Ga0495609_0052764 3300046538 Bacteria 1809
497 Ga0495597_0005277 3300046542 Bacteria 6863
498 Ga0495597_0015804 3300046542 Bacteria 3572
499 Ga0495622_0000329 3300046557 Bacteria 34743
500 Ga0495622_0008487 3300046557 Bacteria 4757
501 Ga0495633_0004176 3300046558 Bacteria 9283
502 Ga0495633_0242868 3300046558 Bacteria 822
503 Ga0495667_0318490 3300046559 Bacteria 984
504 Ga0495668_0000001 3300046616 Bacteria 1013420
505 Ga0495668_0000189 3300046616 Bacteria 92042
506 Ga0495668_0000218 3300046616 Bacteria 83540
507 Ga0495634_0040955 3300046642 Bacteria 3148
508 Ga0495611_0011871 3300046648 Bacteria 3698
509 Ga0495611_0046112 3300046648 Bacteria 1953
510 Ga0495625_0001742 3300046660 Bacteria 25169
511 Ga0495625_0028215 3300046660 Bacteria 4213
512 Ga0495625_0034939 3300046660 Bacteria 3707
513 Ga0495625_0038041 3300046660 Bacteria 3524
514 Ga0495625_0098427 3300046660 Bacteria 2012
515 Ga0495635_0175485 3300046663 Bacteria 1457
516 Ga0495635_0339252 3300046663 Bacteria 1004
517 Ga0495661_0278787 3300046665 Bacteria 843
518 Ga0495588_0002181 3300046674 Bacteria 8380
519 Ga0495657_0264240 3300046675 Bacteria 1033
520 Ga0495647_0001107 3300046681 Bacteria 8236
521 Ga0495658_0000760 3300046683 Bacteria 17437
522 Ga0495669_0001178 3300046684 Bacteria 10863
523 Ga0495669_0287165 3300046684 Bacteria 792
524 Ga0495613_0001335 3300046689 Bacteria 18823
525 Ga0495624_0078059 3300046690 Bacteria 2054
526 Ga0495670_0009245 3300046691 Bacteria 4848
527 Ga0495670_0018607 3300046691 Bacteria 3421
528 Ga0495671_0043510 3300046692 Bacteria 2254
529 Ga0495649_0099839 3300046694 Bacteria 1543
530 Ga0495600_0202653 3300046809 Bacteria 1274
531 Ga0495581_0000448 3300047315 Bacteria 21071
532 Ga0495604_0361286 3300047317 Bacteria 963
533 Ga0495674_0063591 3300047319 Bacteria 3210
534 Ga0495676_0058072 3300047321 Bacteria 3047
535 Ga0495676_0430072 3300047321 Bacteria 873
536 Ga0495680_0130361 3300047322 Bacteria 1848
537 Ga0495680_0349392 3300047322 Bacteria 1030
538 Ga0495683_0007754 3300047323 Bacteria 5763
539 Ga0495683_0035459 3300047323 Bacteria 2535
540 Ga0495687_000225 3300047443 Bacteria 79469
541 Ga0495687_000472 3300047443 Bacteria 48797
542 Ga0495677_0001932 3300047445 Bacteria 8282
543 Ga0495677_0057968 3300047445 Bacteria 1432
544 Ga0495681_0063204 3300047470 Bacteria 1699
545 Ga0495686_0001049 3300047472 Bacteria 33132
546 Ga0495686_0002620 3300047472 Bacteria 16673
547 Ga0495686_0049415 3300047472 Bacteria 2647
548 Ga0495686_0060686 3300047472 Bacteria 2350
549 Ga0495593_0000226 3300047673 Bacteria 30158
550 Ga0495593_0049564 3300047673 Bacteria 2227
551 Ga0495602_0373174 3300048088 Bacteria 1024
552 Ga0495614_0024053 3300048089 Bacteria 2629
553 Ga0496100_0014548 3300048903 Bacteria 4570
554 Ga0496100_0021493 3300048903 Bacteria 3887
555 Ga0496101_0049865 3300048904 Bacteria 3012
556 Ga0496101_0655364 3300048904 Bacteria 829
557 Ga0496102_0000036 3300048905 Bacteria 201896
558 Ga0496102_0002378 3300048905 Bacteria 16056
559 Ga0496102_0017574 3300048905 Bacteria 6266
560 Ga0496102_1159735 3300048905 Bacteria 692
561 Ga0496103_0000074 3300048906 Bacteria 116385
562 Ga0496103_0000985 3300048906 Bacteria 20110
563 Ga0496104_0026476 3300048907 Bacteria 5356
564 Ga0496104_0031339 3300048907 Bacteria 4944
565 Ga0496104_0105387 3300048907 Bacteria 2702
566 Ga0496104_0105727 3300048907 Bacteria 2697
567 Ga0496105_0002795 3300048908 Bacteria 12764
568 Ga0496106_0103454 3300048909 Bacteria 2210
569 Ga0496106_0547419 3300048909 Bacteria 929
570 Ga0496106_0575049 3300048909 Bacteria 903
571 Ga0496107_0066900 3300048910 Bacteria 2606
572 Ga0496107_0441289 3300048910 Bacteria 967
573 Ga0496108_0096237 3300048911 Bacteria 2521
574 Ga0496109_0032572 3300048912 Bacteria 4686
575 Ga0496109_0038093 3300048912 Bacteria 4345
576 Ga0496110_0053192 3300048913 Bacteria 3559
577 Ga0496111_0004996 3300048914 Bacteria 8438
578 Ga0496111_0009083 3300048914 Bacteria 6617
579 Ga0496111_0557632 3300048914 Bacteria 841
580 Ga0496112_0023390 3300048915 Bacteria 5904
581 Ga0496112_0328093 3300048915 Bacteria 1474
582 Ga0496114_0012014 3300048917 Bacteria 6925
583 Ga0496114_0072474 3300048917 Bacteria 2897
584 Ga0496115_0001074 3300048918 Bacteria 19797
585 Ga0496115_0065929 3300048918 Bacteria 2925
586 Ga0496115_0236500 3300048918 Bacteria 1506
587 Ga0496115_0380999 3300048918 Bacteria 1147
588 Ga0496115_0624791 3300048918 Bacteria 854
589 Ga0496116_0000405 3300048919 Bacteria 62060
590 Ga0496116_0008174 3300048919 Bacteria 9132
591 Ga0496116_0009577 3300048919 Bacteria 8248
592 Ga0496116_0087731 3300048919 Bacteria 1903
593 Ga0496117_0000093 3300048920 Bacteria 201862
594 Ga0496117_0003072 3300048920 Bacteria 19986
595 Ga0496117_0008526 3300048920 Bacteria 9723
596 Ga0496118_0000070 3300048921 Bacteria 201866
597 Ga0496118_0003365 3300048921 Bacteria 20205
598 Ga0496119_0017057 3300048922 Bacteria 5489
599 Ga0496121_0004119 3300048924 Bacteria 19926
600 Ga0496121_0014770 3300048924 Bacteria 8249
601 Ga0496122_0020341 3300048925 Bacteria 6003
602 Ga0496122_0132021 3300048925 Bacteria 1584
603 Ga0496123_0010678 3300048926 Bacteria 8081
604 Ga0496123_0022334 3300048926 Bacteria 4881
605 Ga0496123_0189458 3300048926 Bacteria 1065
606 Ga0496124_0000225 3300048927 Bacteria 110516
607 Ga0496124_0001385 3300048927 Bacteria 36323
608 Ga0496124_0001412 3300048927 Bacteria 35756
609 Ga0496124_0047593 3300048927 Bacteria 3668
610 Ga0496124_0420344 3300048927 Bacteria 921
611 Ga0496125_0003600 3300048928 Bacteria 18611
612 Ga0496125_0023134 3300048928 Bacteria 5747
613 Ga0496125_0083790 3300048928 Bacteria 2424
614 Ga0496126_0000467 3300048929 Bacteria 80295
615 Ga0495682_0101116 3300049460 Bacteria 1034
616 Ga0501031_0058436 3300049568 Bacteria 2513
617 Ga0501031_0484548 3300049568 Bacteria 798
618 Ga0501032_0014465 3300049569 Bacteria 5588
619 Ga0501032_0095163 3300049569 Bacteria 1975
620 Ga0501032_0387731 3300049569 Bacteria 898
621 Ga0501033_0005724 3300049570 Bacteria 9802
622 Ga0501033_0025957 3300049570 Bacteria 4411
623 Ga0501033_0458129 3300049570 Bacteria 885
624 Ga0501034_0047868 3300049571 Bacteria 4316
625 Ga0501034_0212194 3300049571 Bacteria 1891
626 Ga0501036_0049897 3300049572 Bacteria 3545
627 Ga0501036_0152248 3300049572 Bacteria 1951
628 Ga0501036_0343243 3300049572 Bacteria 1247
629 Ga0501038_0067128 3300049574 Bacteria 3052
630 Ga0501039_0029895 3300049575 Bacteria 4198
631 Ga0501039_0251857 3300049575 Bacteria 1388
632 Ga0501039_0622890 3300049575 Bacteria 845
633 Ga0501040_0043875 3300049576 Bacteria 3048
634 Ga0501040_0082798 3300049576 Bacteria 2225
635 Ga0501041_0089198 3300049577 Bacteria 1904
636 Ga0501042_0075255 3300049578 Bacteria 2416
637 Ga0501042_0080529 3300049578 Bacteria 2333
638 Ga0501042_0319106 3300049578 Bacteria 1122
639 Ga0501043_0004789 3300049579 Bacteria 10963
640 Ga0501043_0306713 3300049579 Bacteria 1212
641 Ga0501043_0521413 3300049579 Bacteria 886
642 Ga0501046_0000023 3300049580 Bacteria 213965
643 Ga0501046_0020160 3300049580 Bacteria 5518
644 Ga0501046_0082122 3300049580 Bacteria 2489
645 Ga0501046_0084684 3300049580 Bacteria 2445
646 Ga0501046_0157632 3300049580 Bacteria 1709
647 Ga0501047_0000944 3300049581 Bacteria 29428
648 Ga0501047_0280975 3300049581 Bacteria 1509
649 Ga0501047_0486726 3300049581 Bacteria 1061
650 Ga0501047_0580423 3300049581 Bacteria 944
651 Ga0501048_0130288 3300049582 Bacteria 1778
652 Ga0501048_0142501 3300049582 Bacteria 1695
653 Ga0501048_0207091 3300049582 Bacteria 1391
654 Ga0501048_0367104 3300049582 Bacteria 1027
655 Ga0501068_0057380 3300049584 Bacteria 2361
656 Ga0501068_0156929 3300049584 Bacteria 1433
657 Ga0501069_0002414 3300049585 Bacteria 9499
658 Ga0501070_0389552 3300049586 Bacteria 1128
659 Ga0501071_0183921 3300049587 Bacteria 1566
660 Ga0501071_0228778 3300049587 Bacteria 1401
661 Ga0501071_0777943 3300049587 Bacteria 738
662 Ga0501072_0038874 3300049588 Bacteria 3735
663 Ga0501072_0165793 3300049588 Bacteria 1763
664 Ga0501074_0024140 3300049590 Bacteria 4418
665 Ga0501074_0154094 3300049590 Bacteria 1642
666 Ga0501074_0156690 3300049590 Bacteria 1627
667 Ga0501075_0125856 3300049591 Bacteria 1951
668 Ga0501075_0145656 3300049591 Bacteria 1805
669 Ga0501075_0317518 3300049591 Bacteria 1187
670 Ga0501076_0094502 3300049592 Bacteria 2407
671 Ga0501076_0162032 3300049592 Bacteria 1822
672 Ga0501076_0208277 3300049592 Bacteria 1597
673 Ga0501077_0011931 3300049593 Bacteria 5436
674 Ga0501223_000026 3300049663 Bacteria 58071
675 Ga0501079_0031650 3300049741 Bacteria 4066
676 Ga0501079_0059512 3300049741 Bacteria 2946
677 Ga0501079_0153622 3300049741 Bacteria 1794
678 Ga0501079_0160615 3300049741 Bacteria 1752
679 Ga0501079_0194035 3300049741 Bacteria 1585
680 Ga0501080_0102158 3300049742 Bacteria 2660
681 Ga0501080_0314920 3300049742 Bacteria 1418
682 Ga0501081_0022104 3300049743 Bacteria 4253
683 Ga0501081_0094696 3300049743 Bacteria 2104
684 Ga0501081_0193236 3300049743 Bacteria 1474
685 Ga0501035_0035555 3300049822 Bacteria 4520
686 Ga0501035_0300102 3300049822 Bacteria 1353
687 Ga0501035_0322270 3300049822 Bacteria 1298
688 Ga0501035_0330260 3300049822 Bacteria 1280
689 Ga0501035_0445061 3300049822 Bacteria 1072
690 Ga0501044_0003422 3300049823 Bacteria 17882
691 Ga0501044_0008905 3300049823 Bacteria 10968
692 Ga0501044_0150853 3300049823 Bacteria 2306
693 Ga0501044_0233000 3300049823 Bacteria 1788
694 Ga0501044_0770728 3300049823 Bacteria 843
695 Ga0501045_0014809 3300049824 Bacteria 5530
696 Ga0501045_0074091 3300049824 Bacteria 2507
697 Ga0501045_0076075 3300049824 Bacteria 2473
698 Ga0501045_0095306 3300049824 Bacteria 2202
699 nmdc:mga00v17_199174_c1 3300050491 Bacteria 1294
700 nmdc:mga0k408_158716_c1 3300050493 Bacteria 1347
701 nmdc:mga0k408_181760_c1 3300050493 Bacteria 1254
702 nmdc:mga0k408_354190_c1 3300050493 Bacteria 875
703 nmdc:mga07m45_552581_c1 3300050496 Bacteria 666
704 nmdc:mga05p37_112104_c1 3300050507 Bacteria 3354
705 nmdc:mga09592_523311_c1 3300050508 Bacteria 1020
706 nmdc:mga0qj67_108333_c1 3300050509 Bacteria 2241
707 nmdc:mga06r32_212800_c1 3300050510 Bacteria 1921
708 nmdc:mga08y16_124674_c1 3300050511 Bacteria 2680
709 nmdc:mga0rr50_58734_c1 3300050513 Bacteria 2884
710 nmdc:mga0a205_9623_c1 3300050515 Bacteria 8848
711 nmdc:mga0sz30_66451_c1 3300050516 Bacteria 1547
712 Ga0495601_0087414 3300053077 Bacteria 2004
713 Ga0495601_0123590 3300053077 Bacteria 1682
714 Ga0495612_0013435 3300053078 Bacteria 3299
715 Ga0500610_0000125 3300053079 Bacteria 23181
716 Ga0495595_0055835 3300053084 Bacteria 1839
717 Ga0495595_0061172 3300053084 Bacteria 1763
718 Ga0495619_0000828 3300053085 Bacteria 20284
719 Ga0495619_0076948 3300053085 Bacteria 2241
720 Ga0500651_0000903 3300053093 Bacteria 14537
721 Ga0500566_0206273 3300053094 Bacteria 988
722 Ga0500641_0004006 3300053096 Bacteria 5204
723 Ga0500641_0013341 3300053096 Bacteria 3017
724 Ga0500556_0000552 3300053104 Bacteria 25172
725 Ga0500556_0003465 3300053104 Bacteria 4634
726 Ga0500562_000826 3300053108 Bacteria 7549
727 Ga0500562_001098 3300053108 Bacteria 6643
728 Ga0500595_024307 3300053119 Bacteria 2116
729 Ga0500597_001105 3300053120 Bacteria 6506
730 Ga0500614_096675 3300053123 Bacteria 846
731 Ga0500626_068041 3300053128 Bacteria 1587
732 Ga0500642_0000265 3300053130 Bacteria 19576
733 Ga0500642_0000578 3300053130 Bacteria 11025
734 Ga0500655_000329 3300053133 Bacteria 10449
735 Ga0500658_0121666 3300053134 Bacteria 1157
736 Ga0500568_0003040 3300053139 Bacteria 9591
737 Ga0500616_0006812 3300053153 Bacteria 7394
738 Ga0500616_0033475 3300053153 Bacteria 2804
739 Ga0500616_0273964 3300053153 Bacteria 711
740 Ga0500619_124571 3300053154 Bacteria 878
741 Ga0500622_0002094 3300053156 Bacteria 14865
742 Ga0500627_0000027 3300053158 Bacteria 99420
743 Ga0500636_0012679 3300053177 Bacteria 4941
744 Ga0500636_0019743 3300053177 Bacteria 3985
745 Ga0500636_0098839 3300053177 Bacteria 1662
746 Ga0500636_0170643 3300053177 Bacteria 1177
747 Ga0500570_000609 3300053724 Bacteria 14346
748 Ga0500645_000372 3300053730 Bacteria 31579
749 Ga0500552_007357 3300053733 Bacteria 1267
750 Ga0501084_0021485 3300054114 Bacteria 5380
751 Ga0501084_0143766 3300054114 Bacteria 2009
752 Ga0501084_0288369 3300054114 Bacteria 1386
753 Ga0501084_0392904 3300054114 Bacteria 1172
754 Ga0501084_0795515 3300054114 Bacteria 796
755 Ga0501082_0262807 3300060353 Bacteria 1501
756 Ga0530510_0031578 3300061734 Bacteria 3808
757 Ga0530510_0119548 3300061734 Bacteria 1933
758 Ga0530510_0414379 3300061734 Bacteria 1016
759 Ga0530510_0756569 3300061734 Bacteria 741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0521413 Ga0501043_0521413_399_872 156
2 3300032004 Ga0307414_10081538 Ga0307414_100815382 177
3 3300048907 Ga0496104_0031339 Ga0496104_0031339_219_800 183
4 3300054114 Ga0501084_0288369 Ga0501084_0288369_803_1369 183
5 3300032004 Ga0307414_10344968 Ga0307414_103449682 184
6 3300049580 Ga0501046_0157632 Ga0501046_0157632_940_1575 184
7 3300049581 Ga0501047_0486726 Ga0501047_0486726_379_1014 184
8 3300053134 Ga0500658_0121666 Ga0500658_0121666_88_720 184
9 3300035090 Ga0373949_0162583 Ga0373949_0162583_30_602 185
10 3300041999 Ga0439433_0104222 Ga0439433_0104222_114_686 185
11 3300042876 Ga0451577_0407104 Ga0451577_0407104_19_585 185
12 3300048919 Ga0496116_0087731 Ga0496116_0087731_1323_1886 185
13 3300006051 Ga0075364_10093007 Ga0075364_100930072 186
14 3300006353 Ga0075370_10017233 Ga0075370_100172332 186
15 3300047673 Ga0495593_0049564 Ga0495593_0049564_1550_2113 186
16 3300050491 nmdc:mga00v17_199174_c1 nmdc:mga00v17_199174_c1_197_829 186
17 3300050493 nmdc:mga0k408_354190_c1 nmdc:mga0k408_354190_c1_115_747 186
18 3300037471 Ga0395905_0018426 Ga0395905_0018426_3536_4099 187
19 3300044842 Ga0466957_0082838 Ga0466957_0082838_134_697 187
20 3300005841 Ga0068863_100035740 Ga0068863_1000357403 188
21 3300032002 Ga0307416_100330979 Ga0307416_1003309791 190
22 3300048910 Ga0496107_0441289 Ga0496107_0441289_64_711 190
23 3300044712 Ga0453684_0129192 Ga0453684_0129192_1498_2118 192
24 3300048909 Ga0496106_0103454 Ga0496106_0103454_895_1527 192
25 3300031456 Ga0307513_10037879 Ga0307513_100378794 193
26 3300005338 Ga0068868_100072191 Ga0068868_1000721911 194
27 3300005344 Ga0070661_100051403 Ga0070661_1000514033 194
28 3300005539 Ga0068853_100115805 Ga0068853_1001158053 194
29 3300005563 Ga0068855_100128518 Ga0068855_1001285184 194
30 3300005616 Ga0068852_100042333 Ga0068852_1000423334 194
31 3300005616 Ga0068852_100196920 Ga0068852_1001969202 194
32 3300005617 Ga0068859_100061394 Ga0068859_1000613942 194
33 3300005842 Ga0068858_100109329 Ga0068858_1001093292 194
34 3300006931 Ga0097620_100061394 Ga0097620_1000613942 194
35 3300009093 Ga0105240_10372738 Ga0105240_103727381 194
36 3300009101 Ga0105247_10457378 Ga0105247_104573782 194
37 3300010375 Ga0105239_10255229 Ga0105239_102552292 194
38 3300013308 Ga0157375_10148196 Ga0157375_101481962 194
39 3300013308 Ga0157375_10634120 Ga0157375_106341201 194
40 3300014969 Ga0157376_10398163 Ga0157376_103981632 194
41 3300025920 Ga0207649_10105879 Ga0207649_101058792 194
42 3300025924 Ga0207694_10290065 Ga0207694_102900652 194
43 3300026023 Ga0207677_10019532 Ga0207677_100195322 194
44 3300026078 Ga0207702_10068664 Ga0207702_100686644 194
45 3300026142 Ga0207698_10215963 Ga0207698_102159632 194
46 3300031249 Ga0265339_10028653 Ga0265339_100286533 194
47 3300031712 Ga0265342_10019071 Ga0265342_100190713 194
48 3300036401 Ga0373937_0668889 Ga0373937_0668889_21_653 194
49 3300046472 Ga0495580_0282681 Ga0495580_0282681_392_1030 194
50 3300046558 Ga0495633_0242868 Ga0495633_0242868_17_610 194
51 3300048903 Ga0496100_0021493 Ga0496100_0021493_2966_3604 194
52 3300048904 Ga0496101_0049865 Ga0496101_0049865_1904_2536 194
53 3300048907 Ga0496104_0105387 Ga0496104_0105387_654_1286 194
54 3300048910 Ga0496107_0066900 Ga0496107_0066900_362_994 194
55 3300048914 Ga0496111_0557632 Ga0496111_0557632_187_825 194
56 3300048917 Ga0496114_0072474 Ga0496114_0072474_785_1417 194
57 3300048918 Ga0496115_0065929 Ga0496115_0065929_2275_2913 194
58 3300053077 Ga0495601_0087414 Ga0495601_0087414_370_1002 194
59 3300053084 Ga0495595_0061172 Ga0495595_0061172_342_974 194
60 3300026116 Ga0207674_11106120 Ga0207674_111061201 195
61 3300028800 Ga0265338_10016348 Ga0265338_1001634811 196
62 3300031249 Ga0265339_10075200 Ga0265339_100752002 196
63 3300031711 Ga0265314_10003304 Ga0265314_1000330411 196
64 3300048925 Ga0496122_0132021 Ga0496122_0132021_730_1362 196
65 3300048926 Ga0496123_0010678 Ga0496123_0010678_6710_7342 196
66 3300048926 Ga0496123_0189458 Ga0496123_0189458_294_926 196
67 3300048927 Ga0496124_0001412 Ga0496124_0001412_7117_7749 196
68 3300048927 Ga0496124_0420344 Ga0496124_0420344_39_671 196
69 3300048928 Ga0496125_0083790 Ga0496125_0083790_922_1554 196
70 3300032004 Ga0307414_10001258 Ga0307414_100012588 197
71 3300049570 Ga0501033_0005724 Ga0501033_0005724_6649_7281 197
72 3300049571 Ga0501034_0212194 Ga0501034_0212194_124_756 197
73 3300049822 Ga0501035_0035555 Ga0501035_0035555_2815_3447 197
74 3300049823 Ga0501044_0003422 Ga0501044_0003422_1240_1872 197
75 3300005548 Ga0070665_100000021 Ga0070665_100000021372 202
76 3300028379 Ga0268266_10000015 Ga0268266_1000001582 202
77 3300039450 Ga0436363_0127467 Ga0436363_0127467_93_725 202
78 3300050513 nmdc:mga0rr50_58734_c1 nmdc:mga0rr50_58734_c1_1428_2048 202
79 iso_pu_bacteria 2841974524 2841976966 202
80 3300003323 rootH1_10105535 rootH1_101055354 203
81 3300050496 nmdc:mga07m45_552581_c1 nmdc:mga07m45_552581_c1_37_648 203
82 3300053094 Ga0500566_0206273 Ga0500566_0206273_199_822 203
83 3300035724 Ga0373933_0221884 Ga0373933_0221884_506_1123 204
84 iso_pu_bacteria 2582581305 2585263220 204
85 iso_pu_bacteria 2842333319 2842337954 204
86 iso_pu_bacteria 2895660088 2895663189 204
87 3300006051 Ga0075364_10178619 Ga0075364_101786192 205
88 3300006178 Ga0075367_10063214 Ga0075367_100632142 205
89 3300013296 Ga0157374_10375019 Ga0157374_103750192 205
90 3300031548 Ga0307408_100052045 Ga0307408_1000520452 205
91 3300031731 Ga0307405_10201425 Ga0307405_102014253 205
92 3300049580 Ga0501046_0000023 Ga0501046_0000023_105005_105634 205
93 3300053104 Ga0500556_0000552 Ga0500556_0000552_22957_23583 205
94 3300053108 Ga0500562_000826 Ga0500562_000826_6812_7438 205
95 iso_pu_bacteria 2643221541 2643729095 205
96 iso_pu_bacteria 2643221605 2644039660 205
97 iso_pu_bacteria 2643221606 2644045108 205
98 iso_pu_bacteria 2643221671 2644391280 205
99 iso_pu_bacteria 641228493 641336902 205
100 iso_pu_bacteria 643348555 643392911 205
101 3300002459 JGI24751J29686_10001664 JGI24751J29686_100016646 206
102 3300005327 Ga0070658_10110177 Ga0070658_101101773 206
103 3300005328 Ga0070676_10005214 Ga0070676_100052148 206
104 3300005329 Ga0070683_100054364 Ga0070683_1000543645 206
105 3300005330 Ga0070690_100005448 Ga0070690_1000054484 206
106 3300005331 Ga0070670_100002436 Ga0070670_10000243617 206
107 3300005334 Ga0068869_100018218 Ga0068869_1000182182 206
108 3300005335 Ga0070666_10012180 Ga0070666_100121805 206
109 3300005336 Ga0070680_100011814 Ga0070680_1000118144 206
110 3300005337 Ga0070682_100007997 Ga0070682_1000079979 206
111 3300005338 Ga0068868_100007010 Ga0068868_1000070106 206
112 3300005339 Ga0070660_100006061 Ga0070660_10000606111 206
113 3300005340 Ga0070689_100008882 Ga0070689_1000088828 206
114 3300005341 Ga0070691_10000097 Ga0070691_100000972 206
115 3300005343 Ga0070687_100005604 Ga0070687_1000056042 206
116 3300005344 Ga0070661_100000660 Ga0070661_10000066011 206
117 3300005345 Ga0070692_10000901 Ga0070692_100009017 206
118 3300005347 Ga0070668_100000073 Ga0070668_1000000733 206
119 3300005353 Ga0070669_100001343 Ga0070669_1000013433 206
120 3300005354 Ga0070675_100077347 Ga0070675_1000773473 206
121 3300005355 Ga0070671_100000472 Ga0070671_10000047225 206
122 3300005356 Ga0070674_100032093 Ga0070674_1000320933 206
123 3300005364 Ga0070673_100007309 Ga0070673_1000073093 206
124 3300005365 Ga0070688_100002638 Ga0070688_1000026384 206
125 3300005367 Ga0070667_100002285 Ga0070667_10000228517 206
126 3300005434 Ga0070709_10000195 Ga0070709_1000019539 206
127 3300005435 Ga0070714_100004026 Ga0070714_10000402613 206
128 3300005438 Ga0070701_10000505 Ga0070701_1000050515 206
129 3300005440 Ga0070705_100000552 Ga0070705_10000055211 206
130 3300005444 Ga0070694_100033270 Ga0070694_1000332705 206
131 3300005455 Ga0070663_100028730 Ga0070663_1000287303 206
132 3300005456 Ga0070678_100003228 Ga0070678_1000032288 206
133 3300005457 Ga0070662_100000755 Ga0070662_10000075523 206
134 3300005458 Ga0070681_10041511 Ga0070681_100415114 206
135 3300005459 Ga0068867_100010274 Ga0068867_1000102745 206
136 3300005466 Ga0070685_10002740 Ga0070685_100027409 206
137 3300005468 Ga0070707_100327245 Ga0070707_1003272452 206
138 3300005518 Ga0070699_100037122 Ga0070699_1000371221 206
139 3300005536 Ga0070697_100005589 Ga0070697_1000055896 206
140 3300005539 Ga0068853_100000205 Ga0068853_10000020537 206
141 3300005543 Ga0070672_100006137 Ga0070672_10000613711 206
142 3300005544 Ga0070686_100005020 Ga0070686_1000050206 206
143 3300005545 Ga0070695_100000123 Ga0070695_10000012319 206
144 3300005547 Ga0070693_100000617 Ga0070693_1000006175 206
145 3300005548 Ga0070665_100006377 Ga0070665_1000063778 206
146 3300005549 Ga0070704_100000048 Ga0070704_1000000483 206
147 3300005577 Ga0068857_100000232 Ga0068857_10000023223 206
148 3300005578 Ga0068854_100003719 Ga0068854_1000037199 206
149 3300005615 Ga0070702_100022914 Ga0070702_1000229142 206
150 3300005616 Ga0068852_100053415 Ga0068852_1000534152 206
151 3300005618 Ga0068864_100015911 Ga0068864_1000159112 206
152 3300005718 Ga0068866_10001010 Ga0068866_1000101014 206
153 3300005719 Ga0068861_100000202 Ga0068861_10000020234 206
154 3300005840 Ga0068870_10104685 Ga0068870_101046853 206
155 3300005841 Ga0068863_100013188 Ga0068863_1000131882 206
156 3300005842 Ga0068858_100004809 Ga0068858_1000048097 206
157 3300005843 Ga0068860_100003620 Ga0068860_1000036205 206
158 3300005844 Ga0068862_100009080 Ga0068862_1000090803 206
159 3300006163 Ga0070715_10300329 Ga0070715_103003291 206
160 3300006173 Ga0070716_100000218 Ga0070716_10000021812 206
161 3300006175 Ga0070712_100002907 Ga0070712_1000029072 206
162 3300006237 Ga0097621_100116553 Ga0097621_1001165533 206
163 3300006846 Ga0075430_100140689 Ga0075430_1001406894 206
164 3300006852 Ga0075433_10128482 Ga0075433_101284823 206
165 3300006871 Ga0075434_100118043 Ga0075434_1001180435 206
166 3300006881 Ga0068865_100000115 Ga0068865_10000011514 206
167 3300009011 Ga0105251_10068793 Ga0105251_100687932 206
168 3300009092 Ga0105250_10009031 Ga0105250_100090313 206
169 3300009093 Ga0105240_10305806 Ga0105240_103058062 206
170 3300009094 Ga0111539_10895463 Ga0111539_108954632 206
171 3300009101 Ga0105247_10000149 Ga0105247_1000014910 206
172 3300009148 Ga0105243_10002386 Ga0105243_1000238612 206
173 3300009174 Ga0105241_10021444 Ga0105241_100214444 206
174 3300009176 Ga0105242_10001817 Ga0105242_1000181716 206
175 3300009177 Ga0105248_10000668 Ga0105248_1000066825 206
176 3300009545 Ga0105237_10000425 Ga0105237_1000042537 206
177 3300009551 Ga0105238_10039188 Ga0105238_100391882 206
178 3300009553 Ga0105249_10000411 Ga0105249_1000041124 206
179 3300010375 Ga0105239_10006065 Ga0105239_1000606514 206
180 3300011119 Ga0105246_10000889 Ga0105246_100008895 206
181 3300013102 Ga0157371_10062904 Ga0157371_100629044 206
182 3300013105 Ga0157369_10000371 Ga0157369_1000037140 206
183 3300013296 Ga0157374_10002130 Ga0157374_100021309 206
184 3300013297 Ga0157378_10000407 Ga0157378_1000040710 206
185 3300013297 Ga0157378_10000569 Ga0157378_1000056913 206
186 3300013306 Ga0163162_10000407 Ga0163162_1000040726 206
187 3300013307 Ga0157372_10002032 Ga0157372_1000203221 206
188 3300013307 Ga0157372_10216813 Ga0157372_102168135 206
189 3300013308 Ga0157375_10001248 Ga0157375_100012489 206
190 3300014325 Ga0163163_10002088 Ga0163163_100020883 206
191 3300014326 Ga0157380_10000331 Ga0157380_1000033127 206
192 3300014968 Ga0157379_10000215 Ga0157379_1000021529 206
193 3300014969 Ga0157376_10002367 Ga0157376_100023674 206
194 3300017792 Ga0163161_10004608 Ga0163161_100046081 206
195 3300021320 Ga0214544_1001527 Ga0214544_100152743 206
196 3300025885 Ga0207653_10020586 Ga0207653_100205861 206
197 3300025898 Ga0207692_10004025 Ga0207692_100040252 206
198 3300025900 Ga0207710_10015435 Ga0207710_100154353 206
199 3300025901 Ga0207688_10005787 Ga0207688_100057876 206
200 3300025904 Ga0207647_10005153 Ga0207647_100051535 206
201 3300025905 Ga0207685_10020815 Ga0207685_100208153 206
202 3300025906 Ga0207699_10002236 Ga0207699_1000223610 206
203 3300025906 Ga0207699_10149565 Ga0207699_101495651 206
204 3300025907 Ga0207645_10002334 Ga0207645_100023348 206
205 3300025911 Ga0207654_10107501 Ga0207654_101075012 206
206 3300025912 Ga0207707_10043695 Ga0207707_100436953 206
207 3300025913 Ga0207695_10234411 Ga0207695_102344112 206
208 3300025915 Ga0207693_10000426 Ga0207693_100004261 206
209 3300025918 Ga0207662_10020869 Ga0207662_100208692 206
210 3300025919 Ga0207657_10000034 Ga0207657_1000003437 206
211 3300025920 Ga0207649_10050263 Ga0207649_100502633 206
212 3300025922 Ga0207646_10132159 Ga0207646_101321593 206
213 3300025923 Ga0207681_10011328 Ga0207681_100113286 206
214 3300025924 Ga0207694_10024229 Ga0207694_100242295 206
215 3300025925 Ga0207650_10006750 Ga0207650_100067508 206
216 3300025926 Ga0207659_10004575 Ga0207659_100045752 206
217 3300025929 Ga0207664_10020149 Ga0207664_100201495 206
218 3300025933 Ga0207706_10000076 Ga0207706_1000007636 206
219 3300025934 Ga0207686_10104377 Ga0207686_101043772 206
220 3300025938 Ga0207704_10013649 Ga0207704_100136494 206
221 3300025939 Ga0207665_10000237 Ga0207665_1000023728 206
222 3300025940 Ga0207691_10002125 Ga0207691_100021252 206
223 3300025941 Ga0207711_10011113 Ga0207711_100111139 206
224 3300025942 Ga0207689_10026637 Ga0207689_100266374 206
225 3300025944 Ga0207661_10154325 Ga0207661_101543252 206
226 3300025949 Ga0207667_10014236 Ga0207667_100142361 206
227 3300025960 Ga0207651_10001259 Ga0207651_100012592 206
228 3300025972 Ga0207668_10021427 Ga0207668_100214276 206
229 3300025981 Ga0207640_10003311 Ga0207640_100033119 206
230 3300026023 Ga0207677_10018414 Ga0207677_100184142 206
231 3300026035 Ga0207703_10029730 Ga0207703_100297302 206
232 3300026041 Ga0207639_10115878 Ga0207639_101158783 206
233 3300026067 Ga0207678_10000036 Ga0207678_1000003666 206
234 3300026075 Ga0207708_10001696 Ga0207708_1000169612 206
235 3300026088 Ga0207641_10003497 Ga0207641_1000349713 206
236 3300026089 Ga0207648_10042368 Ga0207648_100423685 206
237 3300026095 Ga0207676_10053821 Ga0207676_100538212 206
238 3300026116 Ga0207674_10013137 Ga0207674_100131372 206
239 3300026118 Ga0207675_100000115 Ga0207675_10000011538 206
240 3300026121 Ga0207683_10000015 Ga0207683_1000001562 206
241 3300026142 Ga0207698_10124633 Ga0207698_101246332 206
242 3300027907 Ga0207428_10019287 Ga0207428_100192878 206
243 3300028379 Ga0268266_10144254 Ga0268266_101442542 206
244 3300028380 Ga0268265_10034091 Ga0268265_100340914 206
245 3300034820 Ga0373959_0010324 Ga0373959_0010324_600_1235 206
246 3300035090 Ga0373949_0106723 Ga0373949_0106723_52_687 206
247 3300035092 Ga0373952_0010363 Ga0373952_0010363_395_1030 206
248 3300035112 Ga0373932_0003055 Ga0373932_0003055_166_801 206
249 3300035242 Ga0373962_0016902 Ga0373962_0016902_34_669 206
250 3300035695 Ga0373927_0108825 Ga0373927_0108825_896_1531 206
251 3300035724 Ga0373933_0163783 Ga0373933_0163783_80_715 206
252 3300035725 Ga0373947_0042214 Ga0373947_0042214_1195_1830 206
253 3300036401 Ga0373937_0124617 Ga0373937_0124617_785_1420 206
254 3300037068 Ga0373925_0006973 Ga0373925_0006973_6153_6788 206
255 3300037418 Ga0395900_0026543 Ga0395900_0026543_3621_4256 206
256 3300037466 Ga0395898_0005988 Ga0395898_0005988_1748_2383 206
257 3300037471 Ga0395905_0000879 Ga0395905_0000879_25783_26418 206
258 3300038443 Ga0395901_0007915 Ga0395901_0007915_9946_10581 206
259 3300046455 Ga0495603_0000161 Ga0495603_0000161_32113_32748 206
260 3300046459 Ga0495629_0000451 Ga0495629_0000451_8176_8811 206
261 3300046461 Ga0495641_0049008 Ga0495641_0049008_797_1432 206
262 3300046462 Ga0495651_0309776 Ga0495651_0309776_29_664 206
263 3300046472 Ga0495580_0000067 Ga0495580_0000067_33907_34542 206
264 3300046473 Ga0495582_0006294 Ga0495582_0006294_994_1629 206
265 3300046475 Ga0495639_0000655 Ga0495639_0000655_9229_9864 206
266 3300046499 Ga0495594_0000022 Ga0495594_0000022_29506_30141 206
267 3300046526 Ga0495666_0102451 Ga0495666_0102451_696_1331 206
268 3300046531 Ga0495665_0004923 Ga0495665_0004923_1274_1909 206
269 3300046557 Ga0495622_0000329 Ga0495622_0000329_17294_17929 206
270 3300046559 Ga0495667_0318490 Ga0495667_0318490_217_852 206
271 3300046642 Ga0495634_0040955 Ga0495634_0040955_1700_2335 206
272 3300046663 Ga0495635_0175485 Ga0495635_0175485_235_870 206
273 3300046663 Ga0495635_0339252 Ga0495635_0339252_118_753 206
274 3300046674 Ga0495588_0002181 Ga0495588_0002181_1357_1992 206
275 3300046675 Ga0495657_0264240 Ga0495657_0264240_38_673 206
276 3300046681 Ga0495647_0001107 Ga0495647_0001107_314_949 206
277 3300046683 Ga0495658_0000760 Ga0495658_0000760_1870_2505 206
278 3300046689 Ga0495613_0001335 Ga0495613_0001335_16851_17486 206
279 3300046690 Ga0495624_0078059 Ga0495624_0078059_521_1156 206
280 3300046809 Ga0495600_0202653 Ga0495600_0202653_232_867 206
281 3300047315 Ga0495581_0000448 Ga0495581_0000448_8360_8995 206
282 3300047321 Ga0495676_0058072 Ga0495676_0058072_622_1257 206
283 3300047321 Ga0495676_0430072 Ga0495676_0430072_134_769 206
284 3300047322 Ga0495680_0130361 Ga0495680_0130361_789_1424 206
285 3300047322 Ga0495680_0349392 Ga0495680_0349392_18_653 206
286 3300047673 Ga0495593_0000226 Ga0495593_0000226_7474_8109 206
287 3300048088 Ga0495602_0373174 Ga0495602_0373174_68_703 206
288 3300048089 Ga0495614_0024053 Ga0495614_0024053_886_1521 206
289 3300048903 Ga0496100_0014548 Ga0496100_0014548_2968_3603 206
290 3300048905 Ga0496102_0017574 Ga0496102_0017574_3277_3912 206
291 3300048905 Ga0496102_1159735 Ga0496102_1159735_26_661 206
292 3300048907 Ga0496104_0105727 Ga0496104_0105727_1166_1801 206
293 3300048909 Ga0496106_0547419 Ga0496106_0547419_94_729 206
294 3300048911 Ga0496108_0096237 Ga0496108_0096237_468_1103 206
295 3300048912 Ga0496109_0032572 Ga0496109_0032572_373_1008 206
296 3300048912 Ga0496109_0038093 Ga0496109_0038093_3371_4006 206
297 3300048914 Ga0496111_0004996 Ga0496111_0004996_4589_5224 206
298 3300048915 Ga0496112_0023390 Ga0496112_0023390_2095_2730 206
299 3300048915 Ga0496112_0328093 Ga0496112_0328093_388_1023 206
300 3300048918 Ga0496115_0236500 Ga0496115_0236500_419_1054 206
301 3300048918 Ga0496115_0624791 Ga0496115_0624791_58_693 206
302 3300048919 Ga0496116_0008174 Ga0496116_0008174_864_1484 206
303 3300048924 Ga0496121_0014770 Ga0496121_0014770_5349_5981 206
304 3300049568 Ga0501031_0058436 Ga0501031_0058436_439_1074 206
305 3300049569 Ga0501032_0387731 Ga0501032_0387731_26_664 206
306 3300049570 Ga0501033_0458129 Ga0501033_0458129_237_872 206
307 3300049572 Ga0501036_0049897 Ga0501036_0049897_1529_2164 206
308 3300049575 Ga0501039_0029895 Ga0501039_0029895_3305_3940 206
309 3300049575 Ga0501039_0251857 Ga0501039_0251857_257_895 206
310 3300049576 Ga0501040_0043875 Ga0501040_0043875_1667_2305 206
311 3300049576 Ga0501040_0082798 Ga0501040_0082798_766_1401 206
312 3300049578 Ga0501042_0080529 Ga0501042_0080529_799_1437 206
313 3300049578 Ga0501042_0319106 Ga0501042_0319106_287_922 206
314 3300049579 Ga0501043_0306713 Ga0501043_0306713_156_791 206
315 3300049580 Ga0501046_0082122 Ga0501046_0082122_665_1303 206
316 3300049580 Ga0501046_0084684 Ga0501046_0084684_1299_1934 206
317 3300049582 Ga0501048_0130288 Ga0501048_0130288_285_920 206
318 3300049582 Ga0501048_0367104 Ga0501048_0367104_367_1005 206
319 3300049584 Ga0501068_0057380 Ga0501068_0057380_1306_1944 206
320 3300049584 Ga0501068_0156929 Ga0501068_0156929_614_1249 206
321 3300049586 Ga0501070_0389552 Ga0501070_0389552_114_749 206
322 3300049587 Ga0501071_0183921 Ga0501071_0183921_37_672 206
323 3300049587 Ga0501071_0228778 Ga0501071_0228778_689_1324 206
324 3300049587 Ga0501071_0777943 Ga0501071_0777943_87_722 206
325 3300049588 Ga0501072_0038874 Ga0501072_0038874_2848_3486 206
326 3300049588 Ga0501072_0165793 Ga0501072_0165793_678_1316 206
327 3300049590 Ga0501074_0024140 Ga0501074_0024140_1513_2148 206
328 3300049590 Ga0501074_0154094 Ga0501074_0154094_753_1391 206
329 3300049590 Ga0501074_0156690 Ga0501074_0156690_553_1188 206
330 3300049591 Ga0501075_0145656 Ga0501075_0145656_814_1449 206
331 3300049591 Ga0501075_0317518 Ga0501075_0317518_341_979 206
332 3300049592 Ga0501076_0162032 Ga0501076_0162032_93_728 206
333 3300049592 Ga0501076_0208277 Ga0501076_0208277_638_1276 206
334 3300049593 Ga0501077_0011931 Ga0501077_0011931_4084_4722 206
335 3300049741 Ga0501079_0059512 Ga0501079_0059512_1730_2365 206
336 3300049741 Ga0501079_0153622 Ga0501079_0153622_622_1257 206
337 3300049741 Ga0501079_0160615 Ga0501079_0160615_449_1087 206
338 3300049741 Ga0501079_0194035 Ga0501079_0194035_572_1207 206
339 3300049742 Ga0501080_0314920 Ga0501080_0314920_61_696 206
340 3300049743 Ga0501081_0022104 Ga0501081_0022104_1363_2001 206
341 3300049743 Ga0501081_0193236 Ga0501081_0193236_763_1398 206
342 3300049822 Ga0501035_0322270 Ga0501035_0322270_495_1133 206
343 3300049824 Ga0501045_0014809 Ga0501045_0014809_2971_3609 206
344 3300049824 Ga0501045_0076075 Ga0501045_0076075_823_1458 206
345 3300049824 Ga0501045_0095306 Ga0501045_0095306_1216_1851 206
346 3300050509 nmdc:mga0qj67_108333_c1 nmdc:mga0qj67_108333_c1_1479_2114 206
347 3300050510 nmdc:mga06r32_212800_c1 nmdc:mga06r32_212800_c1_868_1503 206
348 3300050511 nmdc:mga08y16_124674_c1 nmdc:mga08y16_124674_c1_439_1074 206
349 3300050515 nmdc:mga0a205_9623_c1 nmdc:mga0a205_9623_c1_7476_8111 206
350 3300053077 Ga0495601_0123590 Ga0495601_0123590_201_836 206
351 3300053078 Ga0495612_0013435 Ga0495612_0013435_386_1021 206
352 3300053084 Ga0495595_0055835 Ga0495595_0055835_591_1226 206
353 3300053085 Ga0495619_0000828 Ga0495619_0000828_19213_19848 206
354 3300053085 Ga0495619_0076948 Ga0495619_0076948_1589_2224 206
355 3300053096 Ga0500641_0013341 Ga0500641_0013341_61_693 206
356 3300053104 Ga0500556_0003465 Ga0500556_0003465_3326_3958 206
357 3300054114 Ga0501084_0021485 Ga0501084_0021485_3213_3848 206
358 3300054114 Ga0501084_0143766 Ga0501084_0143766_955_1590 206
359 3300054114 Ga0501084_0392904 Ga0501084_0392904_187_822 206
360 3300054114 Ga0501084_0795515 Ga0501084_0795515_32_670 206
361 3300060353 Ga0501082_0262807 Ga0501082_0262807_509_1147 206
362 3300061734 Ga0530510_0031578 Ga0530510_0031578_1320_1955 206
363 3300061734 Ga0530510_0414379 Ga0530510_0414379_348_986 206
364 iso_pu_bacteria 2643221560 2643823120 206
365 iso_pu_bacteria 2852653556 2852655168 206
366 iso_pu_bacteria 2852680915 2852681274 206
367 3300003203 JGI25406J46586_10022674 JGI25406J46586_100226743 207
368 3300005295 Ga0065707_10177073 Ga0065707_101770733 207
369 3300005327 Ga0070658_10008347 Ga0070658_100083479 207
370 3300005563 Ga0068855_100271769 Ga0068855_1002717692 207
371 3300005578 Ga0068854_100502780 Ga0068854_1005027801 207
372 3300005614 Ga0068856_100408103 Ga0068856_1004081032 207
373 3300005616 Ga0068852_100030638 Ga0068852_1000306384 207
374 3300005937 Ga0081455_10087817 Ga0081455_100878174 207
375 3300006175 Ga0070712_100135394 Ga0070712_1001353942 207
376 3300006237 Ga0097621_100960959 Ga0097621_1009609592 207
377 3300009147 Ga0114129_10390852 Ga0114129_103908522 207
378 3300021384 Ga0213876_10169321 Ga0213876_101693211 207
379 3300025908 Ga0207643_10098186 Ga0207643_100981862 207
380 3300025909 Ga0207705_10034288 Ga0207705_100342882 207
381 3300035695 Ga0373927_0025095 Ga0373927_0025095_2759_3388 207
382 3300035725 Ga0373947_0084691 Ga0373947_0084691_1086_1715 207
383 3300039437 Ga0436365_1495202 Ga0436365_1495202_513_1142 207
384 3300044719 Ga0466971_0149536 Ga0466971_0149536_75_704 207
385 3300044842 Ga0466957_0016753 Ga0466957_0016753_479_1108 207
386 3300045836 Ga0466958_0002574 Ga0466958_0002574_1168_1797 207
387 3300046520 Ga0495637_0106403 Ga0495637_0106403_364_993 207
388 3300046538 Ga0495609_0052764 Ga0495609_0052764_291_920 207
389 3300046542 Ga0495597_0015804 Ga0495597_0015804_1466_2095 207
390 3300046616 Ga0495668_0000189 Ga0495668_0000189_56892_57527 207
391 3300049585 Ga0501069_0002414 Ga0501069_0002414_1954_2697 207
392 3300049823 Ga0501044_0770728 Ga0501044_0770728_37_666 207
393 3300053093 Ga0500651_0000903 Ga0500651_0000903_4958_5587 207
394 3300053123 Ga0500614_096675 Ga0500614_096675_87_716 207
395 3300053130 Ga0500642_0000578 Ga0500642_0000578_5284_5913 207
396 3300053133 Ga0500655_000329 Ga0500655_000329_547_1176 207
397 3300053156 Ga0500622_0002094 Ga0500622_0002094_5154_5783 207
398 3300053177 Ga0500636_0098839 Ga0500636_0098839_1016_1645 207
399 3300053177 Ga0500636_0170643 Ga0500636_0170643_252_881 207
400 3300053724 Ga0500570_000609 Ga0500570_000609_4638_5267 207
401 3300053733 Ga0500552_007357 Ga0500552_007357_175_804 207
402 3300001989 JGI24739J22299_10011062 JGI24739J22299_100110624 208
403 3300002076 JGI24749J21850_1000036 JGI24749J21850_100003621 208
404 3300002459 JGI24751J29686_10000186 JGI24751J29686_1000018615 208
405 3300002459 JGI24751J29686_10001717 JGI24751J29686_100017172 208
406 3300003215 JGI25153J46596_10002864 JGI25153J46596_100028649 208
407 3300003771 Ga0055526_1007133 Ga0055526_10071332 208
408 3300005295 Ga0065707_10104835 Ga0065707_101048352 208
409 3300005295 Ga0065707_10283397 Ga0065707_102833972 208
410 3300005331 Ga0070670_100000090 Ga0070670_10000009056 208
411 3300005331 Ga0070670_100000705 Ga0070670_10000070523 208
412 3300005331 Ga0070670_100428422 Ga0070670_1004284222 208
413 3300005335 Ga0070666_10120523 Ga0070666_101205233 208
414 3300005345 Ga0070692_10013866 Ga0070692_100138662 208
415 3300005347 Ga0070668_100000117 Ga0070668_10000011732 208
416 3300005353 Ga0070669_100000093 Ga0070669_10000009353 208
417 3300005353 Ga0070669_100112675 Ga0070669_1001126752 208
418 3300005353 Ga0070669_100189937 Ga0070669_1001899372 208
419 3300005353 Ga0070669_100492599 Ga0070669_1004925991 208
420 3300005355 Ga0070671_100000442 Ga0070671_10000044216 208
421 3300005367 Ga0070667_100000016 Ga0070667_10000001633 208
422 3300005367 Ga0070667_100000113 Ga0070667_10000011380 208
423 3300005367 Ga0070667_100001089 Ga0070667_1000010897 208
424 3300005548 Ga0070665_101093798 Ga0070665_1010937981 208
425 3300005577 Ga0068857_100140951 Ga0068857_1001409514 208
426 3300005578 Ga0068854_100020568 Ga0068854_1000205687 208
427 3300005578 Ga0068854_100233762 Ga0068854_1002337622 208
428 3300005616 Ga0068852_100407186 Ga0068852_1004071862 208
429 3300005617 Ga0068859_100003700 Ga0068859_10000370017 208
430 3300005617 Ga0068859_100004142 Ga0068859_10000414212 208
431 3300005617 Ga0068859_100105885 Ga0068859_1001058854 208
432 3300005618 Ga0068864_100000127 Ga0068864_10000012733 208
433 3300005618 Ga0068864_100000968 Ga0068864_10000096818 208
434 3300005719 Ga0068861_100012077 Ga0068861_1000120774 208
435 3300005719 Ga0068861_100111314 Ga0068861_1001113143 208
436 3300005841 Ga0068863_100002070 Ga0068863_1000020709 208
437 3300005841 Ga0068863_100435103 Ga0068863_1004351032 208
438 3300005842 Ga0068858_100000937 Ga0068858_10000093713 208
439 3300005843 Ga0068860_100000215 Ga0068860_10000021584 208
440 3300005843 Ga0068860_100000361 Ga0068860_10000036133 208
441 3300005844 Ga0068862_100000126 Ga0068862_10000012645 208
442 3300005844 Ga0068862_100000346 Ga0068862_10000034638 208
443 3300006847 Ga0075431_100291442 Ga0075431_1002914423 208
444 3300006931 Ga0097620_100003699 Ga0097620_10000369917 208
445 3300006931 Ga0097620_100004142 Ga0097620_10000414212 208
446 3300009011 Ga0105251_10000895 Ga0105251_1000089521 208
447 3300009177 Ga0105248_10000155 Ga0105248_1000015552 208
448 3300009177 Ga0105248_10247999 Ga0105248_102479992 208
449 3300009551 Ga0105238_10063649 Ga0105238_100636492 208
450 3300010375 Ga0105239_11380419 Ga0105239_113804192 208
451 3300013250 Ga0171462_1005 Ga0171462_1005164 208
452 3300014325 Ga0163163_11253976 Ga0163163_112539762 208
453 3300014326 Ga0157380_10000201 Ga0157380_1000020132 208
454 3300025245 Ga0207425_1000645 Ga0207425_100064510 208
455 3300025258 Ga0209129_1000158 Ga0209129_100015868 208
456 3300025273 Ga0209673_1005778 Ga0209673_10057787 208
457 3300025295 Ga0209564_1000282 Ga0209564_100028268 208
458 3300025297 Ga0209758_1000500 Ga0209758_100050013 208
459 3300025297 Ga0209758_1000630 Ga0209758_100063014 208
460 3300025903 Ga0207680_10092513 Ga0207680_100925132 208
461 3300025923 Ga0207681_10000005 Ga0207681_10000005106 208
462 3300025923 Ga0207681_10118449 Ga0207681_101184493 208
463 3300025923 Ga0207681_10735745 Ga0207681_107357451 208
464 3300025925 Ga0207650_10000004 Ga0207650_10000004615 208
465 3300025925 Ga0207650_10000772 Ga0207650_1000077220 208
466 3300025925 Ga0207650_10159334 Ga0207650_101593342 208
467 3300025931 Ga0207644_10000112 Ga0207644_1000011225 208
468 3300025941 Ga0207711_10002233 Ga0207711_100022333 208
469 3300025941 Ga0207711_10093778 Ga0207711_100937783 208
470 3300025972 Ga0207668_10000186 Ga0207668_1000018621 208
471 3300025981 Ga0207640_10017062 Ga0207640_100170621 208
472 3300025986 Ga0207658_10000034 Ga0207658_1000003437 208
473 3300025986 Ga0207658_10000134 Ga0207658_1000013432 208
474 3300025986 Ga0207658_10001168 Ga0207658_1000116824 208
475 3300026035 Ga0207703_10001374 Ga0207703_1000137415 208
476 3300026088 Ga0207641_10001076 Ga0207641_1000107610 208
477 3300026088 Ga0207641_10001901 Ga0207641_1000190117 208
478 3300026088 Ga0207641_10013413 Ga0207641_100134133 208
479 3300026095 Ga0207676_10000006 Ga0207676_1000000697 208
480 3300026095 Ga0207676_10001543 Ga0207676_100015434 208
481 3300026116 Ga0207674_10052919 Ga0207674_100529196 208
482 3300026118 Ga0207675_100001165 Ga0207675_10000116512 208
483 3300026118 Ga0207675_100151667 Ga0207675_1001516673 208
484 3300026142 Ga0207698_10374869 Ga0207698_103748692 208
485 3300028379 Ga0268266_10045238 Ga0268266_100452382 208
486 3300028380 Ga0268265_10000001 Ga0268265_100000011081 208
487 3300028380 Ga0268265_10000689 Ga0268265_1000068928 208
488 3300028381 Ga0268264_10000075 Ga0268264_10000075240 208
489 3300028381 Ga0268264_10000087 Ga0268264_1000008732 208
490 3300028563 Ga0265319_1022941 Ga0265319_10229414 208
491 3300031250 Ga0265331_10001230 Ga0265331_100012306 208
492 3300031251 Ga0265327_10000266 Ga0265327_1000026684 208
493 3300031548 Ga0307408_100060820 Ga0307408_1000608202 208
494 3300031616 Ga0307508_10001423 Ga0307508_1000142314 208
495 3300031901 Ga0307406_10030959 Ga0307406_100309592 208
496 3300032002 Ga0307416_100139996 Ga0307416_1001399963 208
497 3300044659 Ga0466973_0369958 Ga0466973_0369958_187_819 208
498 3300044712 Ga0453684_0297785 Ga0453684_0297785_37_672 208
499 3300046533 Ga0495640_0073972 Ga0495640_0073972_1409_2044 208
500 3300046535 Ga0495586_0301200 Ga0495586_0301200_63_698 208
501 3300047319 Ga0495674_0063591 Ga0495674_0063591_85_720 208
502 3300048909 Ga0496106_0575049 Ga0496106_0575049_135_767 208
503 3300048918 Ga0496115_0380999 Ga0496115_0380999_505_1137 208
504 3300048928 Ga0496125_0023134 Ga0496125_0023134_4134_4766 208
505 3300049569 Ga0501032_0014465 Ga0501032_0014465_191_823 208
506 3300049572 Ga0501036_0343243 Ga0501036_0343243_404_1036 208
507 3300049579 Ga0501043_0004789 Ga0501043_0004789_1068_1700 208
508 3300049580 Ga0501046_0020160 Ga0501046_0020160_3320_3952 208
509 3300049581 Ga0501047_0000944 Ga0501047_0000944_23074_23706 208
510 3300049582 Ga0501048_0142501 Ga0501048_0142501_745_1377 208
511 3300049591 Ga0501075_0125856 Ga0501075_0125856_509_1144 208
512 3300049742 Ga0501080_0102158 Ga0501080_0102158_549_1184 208
513 3300049822 Ga0501035_0330260 Ga0501035_0330260_226_861 208
514 3300049823 Ga0501044_0233000 Ga0501044_0233000_941_1573 208
515 3300050493 nmdc:mga0k408_181760_c1 nmdc:mga0k408_181760_c1_83_715 208
516 3300053177 Ga0500636_0012679 Ga0500636_0012679_803_1435 208
517 3300061734 Ga0530510_0756569 Ga0530510_0756569_62_700 208
518 3300006880 Ga0075429_100555429 Ga0075429_1005554292 209
519 3300009147 Ga0114129_10059409 Ga0114129_100594093 209
520 3300031235 Ga0265330_10029096 Ga0265330_100290961 209
521 3300031238 Ga0265332_10044288 Ga0265332_100442882 209
522 3300031239 Ga0265328_10020738 Ga0265328_100207383 209
523 3300031456 Ga0307513_10182785 Ga0307513_101827852 209
524 3300031616 Ga0307508_10243111 Ga0307508_102431112 209
525 3300035695 Ga0373927_0021985 Ga0373927_0021985_3353_3988 209
526 3300044712 Ga0453684_0094808 Ga0453684_0094808_2138_2782 209
527 3300045051 Ga0451576_0000805 Ga0451576_0000805_30179_30811 209
528 3300048905 Ga0496102_0000036 Ga0496102_0000036_93108_93752 209
529 3300048906 Ga0496103_0000074 Ga0496103_0000074_93082_93726 209
530 3300048919 Ga0496116_0000405 Ga0496116_0000405_16931_17575 209
531 3300048920 Ga0496117_0000093 Ga0496117_0000093_93074_93718 209
532 3300048921 Ga0496118_0000070 Ga0496118_0000070_93078_93722 209
533 3300048927 Ga0496124_0000225 Ga0496124_0000225_92985_93629 209
534 3300049572 Ga0501036_0152248 Ga0501036_0152248_1076_1708 209
535 3300049577 Ga0501041_0089198 Ga0501041_0089198_169_801 209
536 3300049578 Ga0501042_0075255 Ga0501042_0075255_1347_1979 209
537 3300049592 Ga0501076_0094502 Ga0501076_0094502_911_1543 209
538 3300049741 Ga0501079_0031650 Ga0501079_0031650_2102_2734 209
539 3300049743 Ga0501081_0094696 Ga0501081_0094696_197_829 209
540 3300049824 Ga0501045_0074091 Ga0501045_0074091_1135_1767 209
541 3300050507 nmdc:mga05p37_112104_c1 nmdc:mga05p37_112104_c1_807_1439 209
542 3300050508 nmdc:mga09592_523311_c1 nmdc:mga09592_523311_c1_116_748 209
543 3300061734 Ga0530510_0119548 Ga0530510_0119548_571_1203 209
544 3300001915 JGI24741J21665_1000487 JGI24741J21665_100048711 210
545 3300001979 JGI24740J21852_10001921 JGI24740J21852_100019212 210
546 3300001989 JGI24739J22299_10041378 JGI24739J22299_100413782 210
547 3300001990 JGI24737J22298_10009364 JGI24737J22298_100093642 210
548 3300003759 Ga0055525_1000070 Ga0055525_1000070167 210
549 3300003762 Ga0055542_1000402 Ga0055542_100040228 210
550 3300003763 Ga0055529_1000439 Ga0055529_100043928 210
551 3300003781 Ga0055536_1001293 Ga0055536_10012939 210
552 3300003781 Ga0055536_1005081 Ga0055536_10050815 210
553 3300003781 Ga0055536_1005334 Ga0055536_10053348 210
554 3300003784 Ga0055534_1007276 Ga0055534_10072763 210
555 3300003791 Ga0055530_10000310 Ga0055530_100003109 210
556 3300003794 Ga0055531_10001051 Ga0055531_100010516 210
557 3300003794 Ga0055531_10005376 Ga0055531_100053762 210
558 3300004625 Ga0055543_1016680 Ga0055543_10166802 210
559 3300005262 Ga0065165_1001900 Ga0065165_10019002 210
560 3300005328 Ga0070676_10199875 Ga0070676_101998752 210
561 3300005336 Ga0070680_100081695 Ga0070680_1000816954 210
562 3300005339 Ga0070660_100169325 Ga0070660_1001693252 210
563 3300005344 Ga0070661_100013737 Ga0070661_1000137377 210
564 3300005344 Ga0070661_100113075 Ga0070661_1001130752 210
565 3300005356 Ga0070674_100003413 Ga0070674_1000034133 210
566 3300005356 Ga0070674_100003732 Ga0070674_1000037323 210
567 3300005367 Ga0070667_100052040 Ga0070667_1000520401 210
568 3300005455 Ga0070663_100021037 Ga0070663_1000210374 210
569 3300005456 Ga0070678_100003018 Ga0070678_1000030188 210
570 3300005457 Ga0070662_100083578 Ga0070662_1000835782 210
571 3300005459 Ga0068867_100239053 Ga0068867_1002390531 210
572 3300005548 Ga0070665_100217652 Ga0070665_1002176522 210
573 3300005563 Ga0068855_100341332 Ga0068855_1003413322 210
574 3300005563 Ga0068855_100395493 Ga0068855_1003954932 210
575 3300005564 Ga0070664_100044789 Ga0070664_1000447892 210
576 3300005614 Ga0068856_100014757 Ga0068856_1000147578 210
577 3300005719 Ga0068861_100943286 Ga0068861_1009432862 210
578 3300005834 Ga0068851_10011604 Ga0068851_100116046 210
579 3300005841 Ga0068863_100127345 Ga0068863_1001273454 210
580 3300006186 Ga0075369_10113204 Ga0075369_101132042 210
581 3300006237 Ga0097621_100206983 Ga0097621_1002069832 210
582 3300006358 Ga0068871_100017042 Ga0068871_1000170421 210
583 3300009148 Ga0105243_10000222 Ga0105243_1000022260 210
584 3300009174 Ga0105241_10001192 Ga0105241_1000119212 210
585 3300009551 Ga0105238_10153997 Ga0105238_101539973 210
586 3300013100 Ga0157373_10157697 Ga0157373_101576972 210
587 3300013102 Ga0157371_10000066 Ga0157371_10000066125 210
588 3300013102 Ga0157371_10013764 Ga0157371_100137647 210
589 3300013104 Ga0157370_10236117 Ga0157370_102361173 210
590 3300013105 Ga0157369_10023956 Ga0157369_100239563 210
591 3300013105 Ga0157369_10144410 Ga0157369_101444102 210
592 3300013105 Ga0157369_10244961 Ga0157369_102449612 210
593 3300013307 Ga0157372_10080977 Ga0157372_100809774 210
594 3300017792 Ga0163161_10025277 Ga0163161_100252772 210
595 3300020082 Ga0206353_10250908 Ga0206353_102509082 210
596 3300025230 Ga0209563_100053 Ga0209563_10005329 210
597 3300025253 Ga0209677_105739 Ga0209677_1057394 210
598 3300025254 Ga0209148_1000008 Ga0209148_10000081407 210
599 3300025272 Ga0209455_1000002 Ga0209455_100000219 210
600 3300025291 Ga0209675_1000025 Ga0209675_1000025171 210
601 3300025292 Ga0209676_1000238 Ga0209676_1000238108 210
602 3300025292 Ga0209676_1000259 Ga0209676_10002593 210
603 3300025292 Ga0209676_1000571 Ga0209676_100057159 210
604 3300025294 Ga0209025_1021125 Ga0209025_10211255 210
605 3300025297 Ga0209758_1000023 Ga0209758_1000023301 210
606 3300025297 Ga0209758_1042779 Ga0209758_10427792 210
607 3300025298 Ga0209050_1000104 Ga0209050_100010429 210
608 3300025298 Ga0209050_1001457 Ga0209050_100145716 210
609 3300025298 Ga0209050_1016416 Ga0209050_10164164 210
610 3300025304 Ga0209257_1000120 Ga0209257_10001209 210
611 3300025304 Ga0209257_1000323 Ga0209257_1000323100 210
612 3300025304 Ga0209257_1001790 Ga0209257_100179011 210
613 3300025304 Ga0209257_1019677 Ga0209257_10196774 210
614 3300025304 Ga0209257_1033610 Ga0209257_10336101 210
615 3300025907 Ga0207645_10069990 Ga0207645_100699903 210
616 3300025911 Ga0207654_10001275 Ga0207654_100012752 210
617 3300025913 Ga0207695_10011705 Ga0207695_100117057 210
618 3300025914 Ga0207671_10003444 Ga0207671_1000344418 210
619 3300025917 Ga0207660_10000186 Ga0207660_1000018616 210
620 3300025919 Ga0207657_10010683 Ga0207657_100106832 210
621 3300025920 Ga0207649_10000471 Ga0207649_1000047125 210
622 3300025920 Ga0207649_10034077 Ga0207649_100340772 210
623 3300025924 Ga0207694_10020619 Ga0207694_100206193 210
624 3300025926 Ga0207659_10681611 Ga0207659_106816112 210
625 3300025932 Ga0207690_10003067 Ga0207690_1000306711 210
626 3300025932 Ga0207690_10055524 Ga0207690_100555245 210
627 3300025933 Ga0207706_10021113 Ga0207706_100211136 210
628 3300025935 Ga0207709_10000047 Ga0207709_10000047212 210
629 3300025937 Ga0207669_10000839 Ga0207669_100008399 210
630 3300025937 Ga0207669_10042205 Ga0207669_100422052 210
631 3300025938 Ga0207704_10243872 Ga0207704_102438722 210
632 3300025945 Ga0207679_10014150 Ga0207679_100141506 210
633 3300025949 Ga0207667_10000001 Ga0207667_10000001158 210
634 3300025949 Ga0207667_10087849 Ga0207667_100878492 210
635 3300025960 Ga0207651_10627043 Ga0207651_106270431 210
636 3300025981 Ga0207640_10001564 Ga0207640_1000156411 210
637 3300025986 Ga0207658_10013218 Ga0207658_100132183 210
638 3300026041 Ga0207639_10000577 Ga0207639_1000057717 210
639 3300026067 Ga0207678_10009857 Ga0207678_1000985710 210
640 3300026067 Ga0207678_10017410 Ga0207678_100174107 210
641 3300026078 Ga0207702_10018760 Ga0207702_100187604 210
642 3300026089 Ga0207648_10020684 Ga0207648_100206846 210
643 3300026116 Ga0207674_10012285 Ga0207674_100122857 210
644 3300026121 Ga0207683_10004185 Ga0207683_100041856 210
645 3300026121 Ga0207683_10053962 Ga0207683_100539622 210
646 3300026142 Ga0207698_10001455 Ga0207698_1000145515 210
647 3300026142 Ga0207698_10012189 Ga0207698_100121892 210
648 3300028379 Ga0268266_10157592 Ga0268266_101575922 210
649 3300031548 Ga0307408_100012308 Ga0307408_1000123082 210
650 3300031901 Ga0307406_10285155 Ga0307406_102851552 210
651 3300031911 Ga0307412_10035784 Ga0307412_100357843 210
652 3300031911 Ga0307412_10055989 Ga0307412_100559893 210
653 3300031911 Ga0307412_11002013 Ga0307412_110020131 210
654 3300032004 Ga0307414_10004998 Ga0307414_100049989 210
655 3300032004 Ga0307414_10034316 Ga0307414_100343165 210
656 3300032005 Ga0307411_10507224 Ga0307411_105072242 210
657 3300033180 Ga0307510_10104363 Ga0307510_101043634 210
658 3300035398 Ga0316574_0195809 Ga0316574_0195809_97_765 210
659 3300037466 Ga0395898_0925160 Ga0395898_0925160_91_789 210
660 3300039450 Ga0436363_1148524 Ga0436363_1148524_487_1119 210
661 3300046459 Ga0495629_0044152 Ga0495629_0044152_1269_1910 210
662 3300046460 Ga0495638_0022944 Ga0495638_0022944_2671_3315 210
663 3300046460 Ga0495638_0118210 Ga0495638_0118210_519_1163 210
664 3300046491 Ga0495584_0033609 Ga0495584_0033609_785_1426 210
665 3300046500 Ga0495596_0026363 Ga0495596_0026363_453_1094 210
666 3300046500 Ga0495596_0118806 Ga0495596_0118806_294_926 210
667 3300046501 Ga0495607_0060305 Ga0495607_0060305_409_1050 210
668 3300046506 Ga0495583_0014884 Ga0495583_0014884_3351_3992 210
669 3300046506 Ga0495583_0030931 Ga0495583_0030931_753_1394 210
670 3300046506 Ga0495583_0076721 Ga0495583_0076721_430_1071 210
671 3300046507 Ga0495606_0001772 Ga0495606_0001772_2811_3455 210
672 3300046507 Ga0495606_0043764 Ga0495606_0043764_2148_2789 210
673 3300046507 Ga0495606_0168476 Ga0495606_0168476_321_953 210
674 3300046513 Ga0495616_0047415 Ga0495616_0047415_1120_1761 210
675 3300046518 Ga0495631_0015864 Ga0495631_0015864_2772_3413 210
676 3300046518 Ga0495631_0108191 Ga0495631_0108191_46_687 210
677 3300046520 Ga0495637_0040280 Ga0495637_0040280_1292_1933 210
678 3300046522 Ga0495643_0008837 Ga0495643_0008837_4691_5332 210
679 3300046522 Ga0495643_0010013 Ga0495643_0010013_4118_4759 210
680 3300046524 Ga0495648_0000444 Ga0495648_0000444_3053_3694 210
681 3300046524 Ga0495648_0182042 Ga0495648_0182042_301_942 210
682 3300046525 Ga0495663_0000943 Ga0495663_0000943_5457_6098 210
683 3300046528 Ga0495642_0014869 Ga0495642_0014869_79_720 210
684 3300046530 Ga0495654_0049587 Ga0495654_0049587_825_1457 210
685 3300046536 Ga0495587_0014759 Ga0495587_0014759_2941_3582 210
686 3300046542 Ga0495597_0005277 Ga0495597_0005277_6037_6678 210
687 3300046557 Ga0495622_0008487 Ga0495622_0008487_2225_2866 210
688 3300046558 Ga0495633_0004176 Ga0495633_0004176_7012_7653 210
689 3300046616 Ga0495668_0000001 Ga0495668_0000001_340585_341217 210
690 3300046616 Ga0495668_0000218 Ga0495668_0000218_50276_50917 210
691 3300046648 Ga0495611_0011871 Ga0495611_0011871_173_814 210
692 3300046648 Ga0495611_0046112 Ga0495611_0046112_860_1501 210
693 3300046660 Ga0495625_0001742 Ga0495625_0001742_19784_20425 210
694 3300046660 Ga0495625_0028215 Ga0495625_0028215_3426_4067 210
695 3300046660 Ga0495625_0034939 Ga0495625_0034939_1219_1860 210
696 3300046660 Ga0495625_0038041 Ga0495625_0038041_743_1384 210
697 3300046660 Ga0495625_0098427 Ga0495625_0098427_352_993 210
698 3300046665 Ga0495661_0278787 Ga0495661_0278787_15_656 210
699 3300046684 Ga0495669_0001178 Ga0495669_0001178_4010_4654 210
700 3300046684 Ga0495669_0287165 Ga0495669_0287165_87_728 210
701 3300046691 Ga0495670_0009245 Ga0495670_0009245_1652_2314 210
702 3300046691 Ga0495670_0018607 Ga0495670_0018607_900_1541 210
703 3300046692 Ga0495671_0043510 Ga0495671_0043510_1291_1932 210
704 3300046694 Ga0495649_0099839 Ga0495649_0099839_214_855 210
705 3300047317 Ga0495604_0361286 Ga0495604_0361286_84_725 210
706 3300047323 Ga0495683_0007754 Ga0495683_0007754_4207_4848 210
707 3300047323 Ga0495683_0035459 Ga0495683_0035459_705_1346 210
708 3300047443 Ga0495687_000225 Ga0495687_000225_48709_49350 210
709 3300047443 Ga0495687_000472 Ga0495687_000472_16541_17182 210
710 3300047445 Ga0495677_0001932 Ga0495677_0001932_1598_2239 210
711 3300047445 Ga0495677_0057968 Ga0495677_0057968_352_993 210
712 3300047470 Ga0495681_0063204 Ga0495681_0063204_1014_1655 210
713 3300047472 Ga0495686_0001049 Ga0495686_0001049_7593_8237 210
714 3300047472 Ga0495686_0002620 Ga0495686_0002620_11101_11745 210
715 3300047472 Ga0495686_0049415 Ga0495686_0049415_1442_2074 210
716 3300047472 Ga0495686_0060686 Ga0495686_0060686_738_1382 210
717 3300048904 Ga0496101_0655364 Ga0496101_0655364_156_797 210
718 3300048905 Ga0496102_0002378 Ga0496102_0002378_7803_8444 210
719 3300048906 Ga0496103_0000985 Ga0496103_0000985_11597_12238 210
720 3300048907 Ga0496104_0026476 Ga0496104_0026476_3834_4475 210
721 3300048908 Ga0496105_0002795 Ga0496105_0002795_4239_4880 210
722 3300048913 Ga0496110_0053192 Ga0496110_0053192_1788_2429 210
723 3300048914 Ga0496111_0009083 Ga0496111_0009083_2551_3192 210
724 3300048917 Ga0496114_0012014 Ga0496114_0012014_5120_5761 210
725 3300048918 Ga0496115_0001074 Ga0496115_0001074_11496_12137 210
726 3300048919 Ga0496116_0009577 Ga0496116_0009577_3323_3964 210
727 3300048920 Ga0496117_0003072 Ga0496117_0003072_7878_8519 210
728 3300048921 Ga0496118_0003365 Ga0496118_0003365_11519_12160 210
729 3300048922 Ga0496119_0017057 Ga0496119_0017057_4300_4941 210
730 3300048924 Ga0496121_0004119 Ga0496121_0004119_11426_12067 210
731 3300048925 Ga0496122_0020341 Ga0496122_0020341_3242_3883 210
732 3300048926 Ga0496123_0022334 Ga0496123_0022334_781_1422 210
733 3300048927 Ga0496124_0001385 Ga0496124_0001385_24108_24749 210
734 3300048928 Ga0496125_0003600 Ga0496125_0003600_6289_6930 210
735 3300048929 Ga0496126_0000467 Ga0496126_0000467_44338_44979 210
736 3300049460 Ga0495682_0101116 Ga0495682_0101116_236_877 210
737 3300049568 Ga0501031_0484548 Ga0501031_0484548_69_701 210
738 3300049569 Ga0501032_0095163 Ga0501032_0095163_53_685 210
739 3300049570 Ga0501033_0025957 Ga0501033_0025957_819_1451 210
740 3300049571 Ga0501034_0047868 Ga0501034_0047868_81_713 210
741 3300049574 Ga0501038_0067128 Ga0501038_0067128_69_701 210
742 3300049575 Ga0501039_0622890 Ga0501039_0622890_150_782 210
743 3300049581 Ga0501047_0280975 Ga0501047_0280975_478_1110 210
744 3300049581 Ga0501047_0580423 Ga0501047_0580423_165_797 210
745 3300049582 Ga0501048_0207091 Ga0501048_0207091_711_1343 210
746 3300049822 Ga0501035_0300102 Ga0501035_0300102_628_1260 210
747 3300049822 Ga0501035_0445061 Ga0501035_0445061_358_990 210
748 3300049823 Ga0501044_0008905 Ga0501044_0008905_8349_8981 210
749 3300049823 Ga0501044_0150853 Ga0501044_0150853_1261_1893 210
750 3300050493 nmdc:mga0k408_158716_c1 nmdc:mga0k408_158716_c1_487_1128 210
751 3300050516 nmdc:mga0sz30_66451_c1 nmdc:mga0sz30_66451_c1_221_862 210
752 3300053079 Ga0500610_0000125 Ga0500610_0000125_10199_10840 210
753 3300053096 Ga0500641_0004006 Ga0500641_0004006_839_1471 210
754 3300053119 Ga0500595_024307 Ga0500595_024307_75_716 210
755 3300053120 Ga0500597_001105 Ga0500597_001105_2159_2809 210
756 3300053128 Ga0500626_068041 Ga0500626_068041_814_1446 210
757 3300053130 Ga0500642_0000265 Ga0500642_0000265_3590_4231 210
758 3300053139 Ga0500568_0003040 Ga0500568_0003040_3726_4358 210
759 3300053153 Ga0500616_0006812 Ga0500616_0006812_1242_1889 210
760 3300053153 Ga0500616_0033475 Ga0500616_0033475_620_1264 210
761 3300053153 Ga0500616_0273964 Ga0500616_0273964_59_691 210
762 3300053154 Ga0500619_124571 Ga0500619_124571_51_692 210
763 3300053158 Ga0500627_0000027 Ga0500627_0000027_49797_50429 210
764 3300053177 Ga0500636_0019743 Ga0500636_0019743_3267_3908 210
765 3300053730 Ga0500645_000372 Ga0500645_000372_27462_28103 210
766 iso_pu_bacteria 2643221563 2643835566 210
767 iso_pu_bacteria 2643221608 2644056492 210
768 iso_pu_bacteria 2919709256 2919710712 210
769 iso_pu_bacteria 2808606401 2809063201 211
770 iso_pu_bacteria 2808606404 2809079364 211
771 iso_pu_bacteria 2808606405 2809083263 211
772 iso_pu_bacteria 2880518877 2880520470 211
773 3300001904 JGI24736J21556_1000609 JGI24736J21556_10006096 215
774 3300005548 Ga0070665_100074775 Ga0070665_1000747752 215
775 3300026116 Ga0207674_10022580 Ga0207674_100225805 215
776 3300048920 Ga0496117_0008526 Ga0496117_0008526_4110_4757 215
777 3300048927 Ga0496124_0047593 Ga0496124_0047593_1014_1661 215
778 3300049663 Ga0501223_000026 Ga0501223_000026_41206_41853 215
779 3300053108 Ga0500562_001098 Ga0500562_001098_4363_5010 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

61

169

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9808 3 215
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9716 3 215
6nhl-assembly1.cif.gz_B-2 crystal structure of quee from escherichia coli 0.7018 1 209
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.6986 1 209
6nhl-assembly1.cif.gz_B-2 crystal structure of quee from escherichia coli 0.681 1 209
ID Description Score Start End Superfamily
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9808 3 215 3.20.20.70
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9716 3 215 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7245 3 213 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7185 4 212 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7091 3 213 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A382W3Q8-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9991 3 77 GO:0051539
AF-A0A519XYA6-F1-model_v4 deleted 0.999 1 70
AF-A0A5S3YLH1-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.998 1 62 GO:0051539
AF-A0A4V1V1R7-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9957 1 71
AF-A0A3M1DHN7-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.993 1 57 GO:0051539

Feature Viewer

pLDDT pTM Quality
96.33 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map