F480201

General Info

Members Datasets Scaffolds Average Seq Length
773 441 728 394

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221583|2643924190
Length 455
Sequence KFERNKPHCNIGTIGHVDHGKTTLTAAITITLAKSGGGKAMNYADIDAAPEEKARGITINTAHVEYETAARHYAHXIGHVDHGKTTLTAAITITLAKSGGGKAMNYADIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPALVVYMNKVDLVDDEELLELVEMEVRELLSSYDFPGDDIPITKGSAKVAIDGGNPTIGEESVLALMQTVDDYIPQPARPLDLPFLMPVEDVFSISGRGTVVTGRIEKGIVKVGEEVEIVGIRPVQKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLCKPGSITPHTKFVAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIIKLREGVEMIMPGDNAELDVELITPIAMDQGLRFAIREGGRTVGAGVVAKIVE

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
4 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
5 2643221580 Devosia sp. Root635 Isolate Unclassified
6 2643221583 Caulobacter sp. Root655 Isolate Unclassified
7 2643221591 Devosia sp. Root685 Isolate Unclassified
8 2643221640 Caulobacter sp. Root342 Isolate Unclassified
9 2643221642 Caulobacter sp. Root343 Isolate Unclassified
10 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
11 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
12 2643221674 Devosia sp. Root436 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
15 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
16 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
17 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
18 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
19 2849560528 Caulobacter zeae 410 Isolate Unclassified
20 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
21 2851153111 Caulobacter radicis 736 Isolate Unclassified
22 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
23 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
24 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
25 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
26 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
27 2932401849 Devosia sp. 2618 Isolate Rhizosphere
28 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
29 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
30 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
31 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
32 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
33 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
36 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
37 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
190 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
195 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
255 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
378 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
404 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
405 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
406 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
407 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
408 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
409 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
414 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
415 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
416 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
417 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
418 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
441 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.65
Metatranscriptomes 4.66
Isolates 5.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.18
Nodule 0.91
Rhizoplane 7.37
Rhizosphere 75.03
Stem 0
Stem Tuber 0.13
Unclassified 7.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002379 3300000546 Bacteria 2281
2 JGI24746J21847_1000007 3300001977 Bacteria 20037
3 JGI24740J21852_10004417 3300001979 Bacteria 6046
4 JGI24748J21848_1000332 3300002074 Bacteria 5454
5 JGI24034J26672_10000068 3300002239 Bacteria 28347
6 JGI24742J22300_10000389 3300002244 Bacteria 6508
7 JGI25165J46597_1000961 3300003214 Bacteria 19619
8 JGI25153J46596_10019154 3300003215 Bacteria 2630
9 JGI25407J50210_10000001 3300003373 Bacteria 28150
10 Ga0055537_1003463 3300003773 Bacteria 4850
11 Ga0055537_1005190 3300003773 Bacteria 3543
12 Ga0055534_1011560 3300003784 Bacteria 1789
13 Ga0055534_1015199 3300003784 Bacteria 1417
14 Ga0055531_10005224 3300003794 Bacteria 7632
15 Ga0058863_10019511 3300004799 Bacteria 1422
16 Ga0058862_10006495 3300004803 Bacteria 1724
17 Ga0058862_10084521 3300004803 Bacteria 2045
18 Ga0070683_100002370 3300005329 Bacteria 14968
19 Ga0070683_100293863 3300005329 Bacteria 1545
20 Ga0070670_100003031 3300005331 Bacteria 13896
21 Ga0070677_10000017 3300005333 Bacteria 52010
22 Ga0070666_10059071 3300005335 Bacteria 2593
23 Ga0070666_10079916 3300005335 Bacteria 2234
24 Ga0070680_100083838 3300005336 Bacteria 2632
25 Ga0070682_100000009 3300005337 Bacteria 291635
26 Ga0068868_100003492 3300005338 Bacteria 10940
27 Ga0068868_100112874 3300005338 Bacteria 2209
28 Ga0070668_100041840 3300005347 Bacteria 3510
29 Ga0070669_100109408 3300005353 Bacteria 2095
30 Ga0070671_100001396 3300005355 Bacteria 18034
31 Ga0070674_100000021 3300005356 Bacteria 87134
32 Ga0070674_100000047 3300005356 Bacteria 52597
33 Ga0070659_100000160 3300005366 Bacteria 51528
34 Ga0070659_100041891 3300005366 Bacteria 3580
35 Ga0070667_100033809 3300005367 Bacteria 4277
36 Ga0070667_100129510 3300005367 Bacteria 2201
37 Ga0070713_100061429 3300005436 Bacteria 3143
38 Ga0070710_10000005 3300005437 Bacteria 238049
39 Ga0070711_100001729 3300005439 Bacteria 12118
40 Ga0070711_100124810 3300005439 Bacteria 1909
41 Ga0070705_100004488 3300005440 Bacteria 6796
42 Ga0070663_100079574 3300005455 Bacteria 2405
43 Ga0070662_100000007 3300005457 Bacteria 168761
44 Ga0070681_10035006 3300005458 Bacteria 5044
45 Ga0070679_100067285 3300005530 Bacteria 3572
46 Ga0070684_100016808 3300005535 Bacteria 5990
47 Ga0070693_100001510 3300005547 Bacteria 10483
48 Ga0070693_100103499 3300005547 Bacteria 1738
49 Ga0070665_100000005 3300005548 Bacteria 734905
50 Ga0070665_100000022 3300005548 Bacteria 379286
51 Ga0070665_100044175 3300005548 Bacteria 4475
52 Ga0070665_100049555 3300005548 Bacteria 4213
53 Ga0070665_100052636 3300005548 Bacteria 4082
54 Ga0070704_100012434 3300005549 Bacteria 5259
55 Ga0068855_100099763 3300005563 Bacteria 3344
56 Ga0068855_100390135 3300005563 Bacteria 1527
57 Ga0070664_100173116 3300005564 Bacteria 1916
58 Ga0068856_100069110 3300005614 Bacteria 3492
59 Ga0068856_100328330 3300005614 Bacteria 1547
60 Ga0068852_100007244 3300005616 Bacteria 8091
61 Ga0068859_100009443 3300005617 Bacteria 9849
62 Ga0068859_100009530 3300005617 Bacteria 9805
63 Ga0068859_100044984 3300005617 Bacteria 4436
64 Ga0068859_100165595 3300005617 Bacteria 2291
65 Ga0068859_100217799 3300005617 Bacteria 1997
66 Ga0068859_100314217 3300005617 Bacteria 1660
67 Ga0068864_100016896 3300005618 Bacteria 6081
68 Ga0068866_10000007 3300005718 Bacteria 121729
69 Ga0068866_10000274 3300005718 Bacteria 24536
70 Ga0068863_100008077 3300005841 Bacteria 10275
71 Ga0068863_100195270 3300005841 Bacteria 1946
72 Ga0068858_100000150 3300005842 Bacteria 73075
73 Ga0068858_100117388 3300005842 Bacteria 2487
74 Ga0068860_100039842 3300005843 Bacteria 4493
75 Ga0068862_100062233 3300005844 Bacteria 3209
76 Ga0068862_100066022 3300005844 Bacteria 3117
77 Ga0068862_100071259 3300005844 Bacteria 3001
78 Ga0081455_10035476 3300005937 Bacteria 4456
79 Ga0081538_10004242 3300005981 Bacteria 13295
80 Ga0081540_1037311 3300005983 Bacteria 2578
81 Ga0081540_1073811 3300005983 Bacteria 1566
82 Ga0081539_10003958 3300005985 Bacteria 17147
83 Ga0070717_10000069 3300006028 Bacteria 86039
84 Ga0070717_10024370 3300006028 Bacteria 4804
85 Ga0070717_10157967 3300006028 Bacteria 1965
86 Ga0070717_10161271 3300006028 Bacteria 1945
87 Ga0075365_10054607 3300006038 Bacteria 2649
88 Ga0075368_10005365 3300006042 Bacteria 4406
89 Ga0075363_100093713 3300006048 Bacteria 1655
90 Ga0075364_10143435 3300006051 Bacteria 1607
91 Ga0075432_10000042 3300006058 Bacteria 24212
92 Ga0070715_10000003 3300006163 Bacteria 345282
93 Ga0070712_100000350 3300006175 Bacteria 26114
94 Ga0097621_100216228 3300006237 Bacteria 1668
95 Ga0075370_10111186 3300006353 Bacteria 1591
96 Ga0075430_100036366 3300006846 Bacteria 4176
97 Ga0075430_100205507 3300006846 Bacteria 1635
98 Ga0075431_100154252 3300006847 Bacteria 2363
99 Ga0075433_10001498 3300006852 Bacteria 17252
100 Ga0068865_100007443 3300006881 Bacteria 6735
101 Ga0097620_100009444 3300006931 Bacteria 9849
102 Ga0097620_100009531 3300006931 Bacteria 9805
103 Ga0097620_100044985 3300006931 Bacteria 4436
104 Ga0097620_100165595 3300006931 Bacteria 2291
105 Ga0097620_100217802 3300006931 Bacteria 1997
106 Ga0097620_100314216 3300006931 Bacteria 1660
107 Ga0079104_1011968 3300006946 Bacteria 2753
108 Ga0105251_10074873 3300009011 Bacteria 1572
109 Ga0105240_10006736 3300009093 Bacteria 16822
110 Ga0105240_10011097 3300009093 Bacteria 12598
111 Ga0105240_10122585 3300009093 Bacteria 3128
112 Ga0105245_10000022 3300009098 Bacteria 181225
113 Ga0105247_10000064 3300009101 Bacteria 123994
114 Ga0105247_10029622 3300009101 Bacteria 3318
115 Ga0105248_10088373 3300009177 Bacteria 3488
116 Ga0105248_10090574 3300009177 Bacteria 3444
117 Ga0105237_10000795 3300009545 Bacteria 43136
118 Ga0105238_10000014 3300009551 Bacteria 241954
119 Ga0105238_10269312 3300009551 Bacteria 1684
120 Ga0105249_10018050 3300009553 Bacteria 6271
121 Ga0157372_10091383 3300013307 Bacteria 3462
122 Ga0157375_10000126 3300013308 Bacteria 75410
123 Ga0157375_10008331 3300013308 Bacteria 9080
124 Ga0157375_10173955 3300013308 Bacteria 2302
125 Ga0163163_10098331 3300014325 Bacteria 2947
126 Ga0163163_10181092 3300014325 Bacteria 2154
127 Ga0157380_10000560 3300014326 Bacteria 22835
128 Ga0157380_10038641 3300014326 Bacteria 3707
129 Ga0182008_10007915 3300014497 Bacteria 5831
130 Ga0182008_10027906 3300014497 Bacteria 2856
131 Ga0157379_10026179 3300014968 Bacteria 5190
132 Ga0157379_10061801 3300014968 Bacteria 3350
133 Ga0182007_10032563 3300015262 Bacteria 1770
134 Ga0163161_10000013 3300017792 Bacteria 258747
135 Ga0197907_10106601 3300020069 Bacteria 2106
136 Ga0206356_11626451 3300020070 Bacteria 3606
137 Ga0206349_1658903 3300020075 Bacteria 2015
138 Ga0206352_10123011 3300020078 Bacteria 1784
139 Ga0206350_11565878 3300020080 Bacteria 2033
140 Ga0213872_10018990 3300021361 Bacteria 3167
141 Ga0213876_10001317 3300021384 Bacteria 15593
142 Ga0213876_10016428 3300021384 Bacteria 3912
143 Ga0213875_10000154 3300021388 Bacteria 72534
144 Ga0224712_10028045 3300022467 Bacteria 2008
145 Ga0224712_10029260 3300022467 Bacteria 1976
146 Ga0207427_101449 3300025231 Bacteria 8554
147 Ga0209026_1004620 3300025250 Bacteria 4012
148 Ga0209026_1004741 3300025250 Bacteria 3916
149 Ga0209233_1000293 3300025261 Bacteria 63470
150 Ga0209233_1004407 3300025261 Bacteria 4791
151 Ga0209233_1016401 3300025261 Bacteria 2041
152 Ga0209455_1015467 3300025272 Bacteria 1675
153 Ga0209675_1010141 3300025291 Bacteria 3246
154 Ga0209676_1001296 3300025292 Bacteria 25682
155 Ga0209758_1001435 3300025297 Bacteria 28157
156 Ga0209758_1013790 3300025297 Bacteria 4369
157 Ga0209050_1000161 3300025298 Bacteria 155713
158 Ga0209050_1015450 3300025298 Bacteria 3206
159 Ga0209051_1000877 3300025303 Bacteria 30359
160 Ga0209257_1000252 3300025304 Bacteria 123718
161 Ga0209257_1000409 3300025304 Bacteria 83301
162 Ga0209257_1000552 3300025304 Bacteria 64315
163 Ga0209257_1003348 3300025304 Bacteria 13870
164 Ga0207697_10015765 3300025315 Bacteria 3118
165 Ga0207697_10083476 3300025315 Bacteria 1348
166 Ga0207682_10000008 3300025893 Bacteria 87020
167 Ga0207692_10000003 3300025898 Bacteria 431531
168 Ga0207642_10000008 3300025899 Bacteria 132651
169 Ga0207642_10000979 3300025899 Bacteria 8909
170 Ga0207710_10000220 3300025900 Bacteria 50023
171 Ga0207710_10088046 3300025900 Bacteria 1450
172 Ga0207647_10153064 3300025904 Bacteria 1347
173 Ga0207685_10000003 3300025905 Bacteria 344527
174 Ga0207645_10040174 3300025907 Bacteria 2996
175 Ga0207705_10128982 3300025909 Bacteria 1881
176 Ga0207707_10007402 3300025912 Bacteria 9561
177 Ga0207707_10113656 3300025912 Bacteria 2366
178 Ga0207707_10123548 3300025912 Bacteria 2263
179 Ga0207695_10016319 3300025913 Bacteria 8695
180 Ga0207695_10041220 3300025913 Bacteria 4942
181 Ga0207695_10084973 3300025913 Bacteria 3194
182 Ga0207695_10178435 3300025913 Bacteria 2046
183 Ga0207695_10200353 3300025913 Bacteria 1911
184 Ga0207695_10243997 3300025913 Bacteria 1697
185 Ga0207671_10001074 3300025914 Bacteria 33173
186 Ga0207671_10005921 3300025914 Bacteria 11087
187 Ga0207693_10000138 3300025915 Bacteria 66126
188 Ga0207663_10174851 3300025916 Bacteria 1528
189 Ga0207660_10052069 3300025917 Bacteria 2913
190 Ga0207660_10106414 3300025917 Bacteria 2103
191 Ga0207657_10092245 3300025919 Bacteria 2525
192 Ga0207657_10213381 3300025919 Bacteria 1548
193 Ga0207652_10000242 3300025921 Bacteria 56966
194 Ga0207652_10116411 3300025921 Bacteria 2374
195 Ga0207681_10036263 3300025923 Bacteria 3252
196 Ga0207694_10000008 3300025924 Bacteria 484902
197 Ga0207694_10015447 3300025924 Bacteria 5758
198 Ga0207687_10000039 3300025927 Bacteria 114303
199 Ga0207687_10000132 3300025927 Bacteria 50024
200 Ga0207700_10104123 3300025928 Bacteria 2270
201 Ga0207664_10040931 3300025929 Bacteria 3607
202 Ga0207664_10052171 3300025929 Bacteria 3233
203 Ga0207664_10052775 3300025929 Bacteria 3216
204 Ga0207644_10001581 3300025931 Bacteria 14708
205 Ga0207690_10000165 3300025932 Bacteria 51537
206 Ga0207690_10017348 3300025932 Bacteria 4393
207 Ga0207690_10018062 3300025932 Bacteria 4320
208 Ga0207706_10000018 3300025933 Bacteria 168729
209 Ga0207706_10028676 3300025933 Bacteria 4969
210 Ga0207686_10026568 3300025934 Bacteria 3379
211 Ga0207669_10000032 3300025937 Bacteria 82757
212 Ga0207711_10014493 3300025941 Bacteria 6551
213 Ga0207711_10040773 3300025941 Bacteria 3951
214 Ga0207689_10054979 3300025942 Bacteria 3277
215 Ga0207661_10183741 3300025944 Bacteria 1828
216 Ga0207667_10072768 3300025949 Bacteria 3572
217 Ga0207667_10083431 3300025949 Bacteria 3309
218 Ga0207712_10000067 3300025961 Bacteria 130079
219 Ga0207712_10003883 3300025961 Bacteria 9443
220 Ga0207712_10023398 3300025961 Bacteria 4076
221 Ga0207712_10160793 3300025961 Bacteria 1745
222 Ga0207668_10000053 3300025972 Bacteria 97131
223 Ga0207668_10000363 3300025972 Bacteria 28976
224 Ga0207668_10009658 3300025972 Bacteria 5792
225 Ga0207668_10026971 3300025972 Bacteria 3737
226 Ga0207668_10030190 3300025972 Bacteria 3560
227 Ga0207668_10104670 3300025972 Bacteria 2110
228 Ga0207668_10177067 3300025972 Bacteria 1678
229 Ga0207677_10000046 3300026023 Bacteria 105382
230 Ga0207703_10001133 3300026035 Bacteria 25156
231 Ga0207703_10003008 3300026035 Bacteria 14283
232 Ga0207703_10004569 3300026035 Bacteria 11349
233 Ga0207703_10005760 3300026035 Bacteria 9928
234 Ga0207703_10013988 3300026035 Bacteria 6256
235 Ga0207639_10152110 3300026041 Bacteria 1939
236 Ga0207639_10283391 3300026041 Bacteria 1458
237 Ga0207708_10038392 3300026075 Bacteria 3648
238 Ga0207702_10046770 3300026078 Bacteria 3644
239 Ga0207702_10113611 3300026078 Bacteria 2412
240 Ga0207641_10003614 3300026088 Bacteria 13647
241 Ga0207641_10006154 3300026088 Bacteria 10154
242 Ga0207641_10013745 3300026088 Bacteria 6640
243 Ga0207641_10255831 3300026088 Bacteria 1637
244 Ga0207648_10202363 3300026089 Bacteria 1761
245 Ga0207648_10230801 3300026089 Bacteria 1646
246 Ga0207676_10001597 3300026095 Bacteria 16695
247 Ga0207674_10074477 3300026116 Bacteria 3407
248 Ga0207675_100094820 3300026118 Bacteria 2807
249 Ga0207675_100246744 3300026118 Bacteria 1727
250 Ga0207683_10083220 3300026121 Bacteria 2843
251 Ga0207683_10141203 3300026121 Bacteria 2170
252 Ga0207698_10027561 3300026142 Bacteria 4035
253 Ga0209970_1009394 3300027614 Bacteria 1597
254 Ga0209813_10000406 3300027866 Bacteria 10561
255 Ga0209813_10001907 3300027866 Bacteria 4705
256 Ga0207428_10051901 3300027907 Bacteria 3276
257 Ga0265355_1000561 3300028036 Bacteria 2014
258 Ga0268266_10000012 3300028379 Bacteria 734912
259 Ga0268266_10000029 3300028379 Bacteria 424015
260 Ga0268266_10000311 3300028379 Bacteria 77262
261 Ga0268266_10000321 3300028379 Bacteria 75565
262 Ga0268266_10003345 3300028379 Bacteria 16054
263 Ga0268266_10016661 3300028379 Bacteria 6279
264 Ga0268266_10034769 3300028379 Bacteria 4287
265 Ga0268266_10362777 3300028379 Bacteria 1363
266 Ga0268265_10004022 3300028380 Bacteria 10354
267 Ga0268265_10011012 3300028380 Bacteria 6108
268 Ga0268264_10005167 3300028381 Bacteria 11062
269 Ga0268264_10057405 3300028381 Bacteria 3256
270 Ga0268264_10108360 3300028381 Bacteria 2428
271 Ga0268264_10440456 3300028381 Bacteria 1260
272 Ga0265337_1000032 3300028556 Bacteria 61342
273 Ga0265337_1009999 3300028556 Bacteria 3348
274 Ga0265326_10000040 3300028558 Bacteria 85624
275 Ga0265326_10000082 3300028558 Bacteria 51208
276 Ga0265319_1000006 3300028563 Bacteria 228868
277 Ga0265319_1000357 3300028563 Bacteria 33082
278 Ga0265319_1000863 3300028563 Bacteria 19261
279 Ga0265319_1005558 3300028563 Bacteria 6010
280 Ga0265334_10000050 3300028573 Bacteria 88877
281 Ga0265318_10000275 3300028577 Bacteria 43186
282 Ga0265318_10002149 3300028577 Bacteria 10711
283 Ga0265318_10063568 3300028577 Bacteria 1374
284 Ga0265322_10000012 3300028654 Bacteria 152373
285 Ga0265336_10000043 3300028666 Bacteria 132135
286 Ga0265336_10001438 3300028666 Bacteria 10856
287 Ga0307517_10067581 3300028786 Bacteria 3269
288 Ga0307517_10076016 3300028786 Bacteria 2938
289 Ga0307515_10042841 3300028794 Bacteria 7062
290 Ga0265338_10000142 3300028800 Bacteria 132135
291 Ga0265338_10013959 3300028800 Bacteria 9009
292 Ga0265338_10020173 3300028800 Bacteria 7026
293 Ga0265338_10024739 3300028800 Bacteria 6122
294 Ga0265338_10029298 3300028800 Bacteria 5459
295 Ga0265338_10040390 3300028800 Bacteria 4383
296 Ga0265338_10100462 3300028800 Bacteria 2359
297 Ga0265338_10246384 3300028800 Bacteria 1320
298 Ga0265324_10000620 3300029957 Bacteria 24187
299 Ga0265324_10002295 3300029957 Bacteria 9946
300 Ga0307511_10029704 3300030521 Bacteria 4926
301 Ga0265766_1000600 3300030863 Bacteria 1602
302 Ga0265330_10081402 3300031235 Bacteria 1395
303 Ga0265328_10002011 3300031239 Bacteria 9212
304 Ga0265320_10000001 3300031240 Bacteria 847191
305 Ga0265320_10012505 3300031240 Bacteria 4935
306 Ga0265320_10040194 3300031240 Bacteria 2334
307 Ga0265325_10018226 3300031241 Bacteria 3892
308 Ga0265325_10051778 3300031241 Bacteria 2110
309 Ga0265329_10000919 3300031242 Bacteria 14805
310 Ga0265340_10000006 3300031247 Bacteria 132135
311 Ga0265340_10001769 3300031247 Bacteria 12330
312 Ga0265340_10035745 3300031247 Bacteria 2466
313 Ga0265331_10001467 3300031250 Bacteria 17360
314 Ga0265327_10000003 3300031251 Bacteria 852750
315 Ga0265327_10031343 3300031251 Bacteria 2988
316 Ga0265327_10036074 3300031251 Bacteria 2723
317 Ga0265316_10003472 3300031344 Bacteria 15930
318 Ga0265316_10010215 3300031344 Bacteria 8571
319 Ga0265316_10029887 3300031344 Bacteria 4474
320 Ga0265316_10052032 3300031344 Bacteria 3214
321 Ga0265316_10086271 3300031344 Bacteria 2400
322 Ga0265316_10168291 3300031344 Bacteria 1636
323 Ga0307513_10016219 3300031456 Bacteria 8997
324 Ga0307513_10080274 3300031456 Bacteria 3366
325 Ga0307513_10236790 3300031456 Bacteria 1634
326 Ga0307408_100094204 3300031548 Bacteria 2267
327 Ga0265313_10000031 3300031595 Bacteria 128981
328 Ga0265313_10045234 3300031595 Bacteria 2144
329 Ga0265313_10079460 3300031595 Bacteria 1493
330 Ga0265314_10000178 3300031711 Bacteria 94070
331 Ga0265314_10029221 3300031711 Bacteria 4100
332 Ga0265342_10008958 3300031712 Bacteria 7108
333 Ga0316578_10084977 3300031728 Bacteria 1886
334 Ga0307516_10033588 3300031730 Bacteria 5163
335 Ga0307405_10125927 3300031731 Bacteria 1761
336 Ga0307410_10021164 3300031852 Bacteria 3996
337 Ga0307410_10100030 3300031852 Bacteria 2076
338 Ga0307410_10281831 3300031852 Bacteria 1304
339 Ga0307406_10046283 3300031901 Bacteria 2736
340 Ga0307406_10077001 3300031901 Bacteria 2205
341 Ga0307412_10065817 3300031911 Bacteria 2454
342 Ga0307409_100052255 3300031995 Bacteria 3131
343 Ga0307414_10085018 3300032004 Bacteria 2329
344 Ga0307415_100193066 3300032126 Bacteria 1608
345 Ga0316593_10034316 3300032168 Bacteria 1664
346 Ga0307507_10180226 3300033179 Bacteria 1512
347 Ga0307510_10015365 3300033180 Bacteria 9050
348 Ga0307510_10184849 3300033180 Bacteria 1641
349 Ga0316587_1013100 3300033529 Bacteria 1355
350 Ga0316596_1003203 3300033541 Bacteria 3566
351 Ga0373923_0021631 3300035111 Bacteria 2513
352 Ga0373936_0009150 3300035113 Bacteria 3733
353 Ga0373955_0013248 3300035172 Bacteria 3982
354 Ga0373955_0145740 3300035172 Bacteria 1391
355 Ga0316574_0018664 3300035398 Bacteria 4081
356 Ga0316574_0096095 3300035398 Bacteria 1893
357 Ga0373935_0027604 3300035692 Bacteria 3510
358 Ga0373927_0004885 3300035695 Bacteria 9316
359 Ga0373933_0005630 3300035724 Bacteria 6826
360 Ga0373933_0061472 3300035724 Bacteria 2266
361 Ga0373947_0084463 3300035725 Bacteria 1970
362 Ga0373937_0016661 3300036401 Bacteria 6529
363 Ga0373937_0076699 3300036401 Bacteria 3087
364 Ga0373937_0088030 3300036401 Bacteria 2875
365 Ga0316582_0127044 3300036647 Bacteria 1710
366 Ga0373925_0000023 3300037068 Bacteria 158881
367 Ga0395899_0025038 3300037312 Bacteria 4506
368 Ga0395899_0214213 3300037312 Bacteria 1337
369 Ga0395900_0227298 3300037418 Bacteria 1878
370 Ga0395900_0422772 3300037418 Bacteria 1293
371 Ga0395898_0088428 3300037466 Bacteria 2982
372 Ga0395898_0211604 3300037466 Bacteria 1849
373 Ga0395898_0257402 3300037466 Bacteria 1664
374 Ga0395905_0022710 3300037471 Bacteria 5931
375 Ga0395905_0169582 3300037471 Bacteria 2050
376 Ga0436364_0542964 3300037853 Bacteria 3053
377 Ga0436364_0586950 3300037853 Bacteria 42624
378 Ga0395901_0120715 3300038443 Bacteria 2754
379 Ga0395901_0135008 3300038443 Bacteria 2593
380 Ga0395901_0165610 3300038443 Bacteria 2321
381 Ga0400486_00962 3300038742 Bacteria 3359
382 Ga0436365_0319180 3300039437 Bacteria 20648
383 Ga0436365_1318630 3300039437 Bacteria 2263
384 Ga0436361_0413994 3300039447 Bacteria 12077
385 Ga0436362_0179942 3300039453 Bacteria 1466
386 Ga0439431_0013009 3300041997 Bacteria 1917
387 Ga0439457_011885 3300042014 Bacteria 1968
388 Ga0439434_0017551 3300042435 Bacteria 2141
389 Ga0439435_0002970 3300042436 Bacteria 3454
390 Ga0450901_001704 3300042533 Bacteria 2476
391 Ga0451577_0347129 3300042876 Bacteria 1346
392 Ga0466969_0001105 3300044656 Bacteria 14550
393 Ga0466966_0003817 3300044684 Bacteria 9943
394 Ga0466961_0000659 3300044693 Bacteria 21720
395 Ga0466961_0058761 3300044693 Bacteria 2446
396 Ga0466961_0071708 3300044693 Bacteria 2198
397 Ga0466963_0000325 3300044694 Bacteria 21618
398 Ga0466963_0087179 3300044694 Bacteria 2122
399 Ga0466971_0037640 3300044719 Bacteria 2169
400 Ga0466970_0042626 3300044765 Bacteria 2414
401 Ga0466970_0050555 3300044765 Bacteria 2217
402 Ga0466957_0016259 3300044842 Bacteria 4351
403 Ga0466957_0162610 3300044842 Bacteria 1450
404 Ga0466960_0001761 3300044901 Bacteria 7943
405 Ga0466959_0022573 3300045049 Bacteria 4653
406 Ga0466959_0078843 3300045049 Bacteria 2375
407 Ga0451576_0000023 3300045051 Bacteria 477965
408 Ga0451576_0000063 3300045051 Bacteria 278985
409 Ga0451576_0027584 3300045051 Bacteria 6097
410 Ga0451576_0039758 3300045051 Bacteria 4979
411 Ga0466958_0047302 3300045836 Bacteria 2597
412 Ga0466967_0023322 3300045976 Bacteria 5068
413 Ga0495627_001425 3300046453 Bacteria 14069
414 Ga0495592_0180516 3300046454 Bacteria 1438
415 Ga0495603_0000323 3300046455 Bacteria 25798
416 Ga0495603_0000641 3300046455 Bacteria 19699
417 Ga0495603_0058507 3300046455 Bacteria 2279
418 Ga0495590_0001017 3300046457 Bacteria 12347
419 Ga0495638_0013903 3300046460 Bacteria 5459
420 Ga0495641_0000400 3300046461 Bacteria 36235
421 Ga0495641_0029068 3300046461 Bacteria 2667
422 Ga0495641_0042340 3300046461 Bacteria 2111
423 Ga0495653_0004713 3300046463 Bacteria 11039
424 Ga0495653_0014903 3300046463 Bacteria 6341
425 Ga0495653_0046609 3300046463 Bacteria 3356
426 Ga0495653_0077384 3300046463 Bacteria 2470
427 Ga0495650_0000121 3300046471 Bacteria 183055
428 Ga0495582_0000006 3300046473 Bacteria 140434
429 Ga0495662_0000236 3300046476 Bacteria 23206
430 Ga0495664_0000007 3300046477 Bacteria 386710
431 Ga0495607_0124900 3300046501 Bacteria 1346
432 Ga0495583_0021508 3300046506 Bacteria 3317
433 Ga0495608_0022894 3300046511 Bacteria 4286
434 Ga0495610_0000924 3300046512 Bacteria 27260
435 Ga0495618_0000035 3300046514 Bacteria 102739
436 Ga0495618_0000037 3300046514 Bacteria 99735
437 Ga0495620_0000668 3300046515 Bacteria 21158
438 Ga0495620_0036764 3300046515 Bacteria 2187
439 Ga0495630_0012465 3300046517 Bacteria 6173
440 Ga0495630_0102334 3300046517 Bacteria 2167
441 Ga0495637_0017338 3300046520 Bacteria 3357
442 Ga0495648_0001203 3300046524 Bacteria 25919
443 Ga0495642_0022905 3300046528 Bacteria 2463
444 Ga0495652_0049476 3300046529 Bacteria 3598
445 Ga0495640_0025030 3300046533 Bacteria 4335
446 Ga0495621_0004561 3300046539 Bacteria 3909
447 Ga0495597_0005196 3300046542 Bacteria 6928
448 Ga0495645_0000033 3300046543 Bacteria 105930
449 Ga0495645_0000159 3300046543 Bacteria 46648
450 Ga0495645_0167715 3300046543 Bacteria 1513
451 Ga0495633_0005367 3300046558 Bacteria 7861
452 Ga0495667_0000067 3300046559 Bacteria 81751
453 Ga0495667_0004534 3300046559 Bacteria 9376
454 Ga0495656_0000412 3300046615 Bacteria 14129
455 Ga0495656_0079938 3300046615 Bacteria 1473
456 Ga0495668_0005284 3300046616 Bacteria 8830
457 Ga0495611_0026790 3300046648 Bacteria 2516
458 Ga0495625_0131776 3300046660 Bacteria 1693
459 Ga0495635_0000006 3300046663 Bacteria 301820
460 Ga0495588_0037138 3300046674 Bacteria 2474
461 Ga0495657_0000027 3300046675 Bacteria 131421
462 Ga0495657_0001760 3300046675 Bacteria 18520
463 Ga0495657_0050118 3300046675 Bacteria 2808
464 Ga0495599_0014944 3300046678 Bacteria 4811
465 Ga0495623_0031396 3300046679 Bacteria 3415
466 Ga0495647_0000010 3300046681 Bacteria 94696
467 Ga0495658_0000094 3300046683 Bacteria 46061
468 Ga0495658_0104120 3300046683 Bacteria 1698
469 Ga0495669_0000371 3300046684 Bacteria 22866
470 Ga0495669_0001857 3300046684 Bacteria 8658
471 Ga0495613_0000947 3300046689 Bacteria 22179
472 Ga0495613_0035802 3300046689 Bacteria 3682
473 Ga0495624_0000767 3300046690 Bacteria 25280
474 Ga0495670_0001585 3300046691 Bacteria 11108
475 Ga0495671_0094827 3300046692 Bacteria 1460
476 Ga0495649_0004615 3300046694 Bacteria 8960
477 Ga0495600_0016896 3300046809 Bacteria 4639
478 Ga0495600_0041791 3300046809 Bacteria 2988
479 Ga0495600_0091954 3300046809 Bacteria 1979
480 Ga0495660_0019866 3300046810 Bacteria 3854
481 Ga0495604_0000218 3300047317 Bacteria 52385
482 Ga0495604_0036561 3300047317 Bacteria 3871
483 Ga0495672_0001458 3300047320 Bacteria 23198
484 Ga0495676_0001315 3300047321 Bacteria 21280
485 Ga0495680_0001684 3300047322 Bacteria 23470
486 Ga0495680_0001951 3300047322 Bacteria 21721
487 Ga0495680_0028739 3300047322 Bacteria 4557
488 Ga0495687_020629 3300047443 Bacteria 3208
489 Ga0495677_0011211 3300047445 Bacteria 3281
490 Ga0495677_0021265 3300047445 Bacteria 2351
491 Ga0495679_005798 3300047446 Bacteria 5435
492 Ga0495673_0002746 3300047469 Bacteria 12052
493 Ga0495673_0007304 3300047469 Bacteria 6373
494 Ga0495681_0055771 3300047470 Bacteria 1841
495 Ga0495684_0001725 3300047471 Bacteria 17594
496 Ga0495684_0055386 3300047471 Bacteria 3024
497 Ga0495593_0059744 3300047673 Bacteria 1997
498 Ga0496100_0000004 3300048903 Bacteria 321778
499 Ga0496101_0000007 3300048904 Bacteria 321778
500 Ga0496101_0008458 3300048904 Bacteria 6723
501 Ga0496101_0099463 3300048904 Bacteria 2174
502 Ga0496101_0130560 3300048904 Bacteria 1908
503 Ga0496102_0000002 3300048905 Bacteria 814588
504 Ga0496103_0000017 3300048906 Bacteria 244768
505 Ga0496104_0000001 3300048907 Bacteria 711867
506 Ga0496104_0000008 3300048907 Bacteria 516976
507 Ga0496104_0000307 3300048907 Bacteria 43626
508 Ga0496104_0033810 3300048907 Bacteria 4765
509 Ga0496104_0298145 3300048907 Bacteria 1524
510 Ga0496105_0000003 3300048908 Bacteria 713251
511 Ga0496105_0000070 3300048908 Bacteria 80117
512 Ga0496105_0217838 3300048908 Bacteria 1554
513 Ga0496106_0000004 3300048909 Bacteria 279896
514 Ga0496106_0004033 3300048909 Bacteria 10970
515 Ga0496106_0093786 3300048909 Bacteria 2320
516 Ga0496106_0193822 3300048909 Bacteria 1616
517 Ga0496107_0000001 3300048910 Bacteria 321778
518 Ga0496107_0001409 3300048910 Bacteria 14833
519 Ga0496107_0142562 3300048910 Bacteria 1771
520 Ga0496107_0229461 3300048910 Bacteria 1381
521 Ga0496108_0000004 3300048911 Bacteria 545055
522 Ga0496108_0036957 3300048911 Bacteria 4065
523 Ga0496108_0045232 3300048911 Bacteria 3676
524 Ga0496108_0054744 3300048911 Bacteria 3348
525 Ga0496108_0196490 3300048911 Bacteria 1749
526 Ga0496109_0000036 3300048912 Bacteria 153972
527 Ga0496109_0000550 3300048912 Bacteria 31748
528 Ga0496109_0002231 3300048912 Bacteria 16078
529 Ga0496109_0004801 3300048912 Bacteria 11284
530 Ga0496109_0023777 3300048912 Bacteria 5439
531 Ga0496109_0167197 3300048912 Bacteria 2062
532 Ga0496110_0000152 3300048913 Bacteria 41561
533 Ga0496110_0013101 3300048913 Bacteria 6844
534 Ga0496110_0032992 3300048913 Bacteria 4476
535 Ga0496110_0053927 3300048913 Bacteria 3536
536 Ga0496110_0123328 3300048913 Bacteria 2336
537 Ga0496111_0000123 3300048914 Bacteria 33765
538 Ga0496111_0112895 3300048914 Bacteria 2002
539 Ga0496112_0000002 3300048915 Bacteria 782039
540 Ga0496112_0001057 3300048915 Bacteria 20325
541 Ga0496112_0001810 3300048915 Bacteria 16828
542 Ga0496112_0018998 3300048915 Bacteria 6477
543 Ga0496112_0020121 3300048915 Bacteria 6318
544 Ga0496113_0029106 3300048916 Bacteria 3984
545 Ga0496113_0079171 3300048916 Bacteria 2515
546 Ga0496114_0000097 3300048917 Bacteria 63410
547 Ga0496114_0003529 3300048917 Bacteria 12000
548 Ga0496115_0000005 3300048918 Bacteria 290756
549 Ga0496115_0000151 3300048918 Bacteria 64493
550 Ga0496115_0020265 3300048918 Bacteria 5128
551 Ga0496115_0055983 3300048918 Bacteria 3169
552 Ga0496115_0059763 3300048918 Bacteria 3070
553 Ga0496115_0140761 3300048918 Bacteria 1990
554 Ga0496115_0288564 3300048918 Bacteria 1346
555 Ga0496116_0052644 3300048919 Bacteria 2695
556 Ga0496117_0010944 3300048920 Bacteria 8176
557 Ga0496118_0006934 3300048921 Bacteria 12251
558 Ga0496119_0019080 3300048922 Bacteria 5070
559 Ga0496121_0000485 3300048924 Bacteria 76992
560 Ga0496121_0000946 3300048924 Bacteria 52586
561 Ga0496121_0027878 3300048924 Bacteria 5274
562 Ga0496123_0001481 3300048926 Bacteria 32597
563 Ga0496124_0040664 3300048927 Bacteria 4020
564 Ga0496125_0000815 3300048928 Bacteria 50702
565 Ga0496125_0090667 3300048928 Bacteria 2293
566 Ga0496125_0190625 3300048928 Bacteria 1354
567 Ga0496126_0183070 3300048929 Bacteria 1778
568 Ga0501311_002271 3300049527 Bacteria 1817
569 Ga0501314_000335 3300049530 Bacteria 2808
570 Ga0501031_0009868 3300049568 Bacteria 6215
571 Ga0501031_0027816 3300049568 Bacteria 3686
572 Ga0501032_0001419 3300049569 Bacteria 19025
573 Ga0501032_0067379 3300049569 Bacteria 2391
574 Ga0501033_0004084 3300049570 Bacteria 11779
575 Ga0501033_0218198 3300049570 Bacteria 1358
576 Ga0501034_0004173 3300049571 Bacteria 16144
577 Ga0501034_0118404 3300049571 Bacteria 2635
578 Ga0501034_0128649 3300049571 Bacteria 2516
579 Ga0501034_0157828 3300049571 Bacteria 2241
580 Ga0501034_0165468 3300049571 Bacteria 2180
581 Ga0501034_0187645 3300049571 Bacteria 2030
582 Ga0501034_0254468 3300049571 Bacteria 1700
583 Ga0501036_0014888 3300049572 Bacteria 6489
584 Ga0501036_0020928 3300049572 Bacteria 5493
585 Ga0501036_0076823 3300049572 Bacteria 2825
586 Ga0501036_0085139 3300049572 Bacteria 2672
587 Ga0501037_0001774 3300049573 Bacteria 15668
588 Ga0501038_0029168 3300049574 Bacteria 4892
589 Ga0501038_0107566 3300049574 Bacteria 2313
590 Ga0501039_0009138 3300049575 Bacteria 7550
591 Ga0501039_0108356 3300049575 Bacteria 2171
592 Ga0501040_0200740 3300049576 Bacteria 1416
593 Ga0501040_0264088 3300049576 Bacteria 1228
594 Ga0501042_0004502 3300049578 Bacteria 8892
595 Ga0501042_0008906 3300049578 Bacteria 6657
596 Ga0501042_0099949 3300049578 Bacteria 2085
597 Ga0501042_0130740 3300049578 Bacteria 1809
598 Ga0501042_0259000 3300049578 Bacteria 1256
599 Ga0501043_0017287 3300049579 Bacteria 5657
600 Ga0501043_0109183 3300049579 Bacteria 2173
601 Ga0501046_0014582 3300049580 Bacteria 6623
602 Ga0501046_0192802 3300049580 Bacteria 1519
603 Ga0501047_0014422 3300049581 Bacteria 7514
604 Ga0501047_0021902 3300049581 Bacteria 6136
605 Ga0501047_0023718 3300049581 Bacteria 5890
606 Ga0501047_0084394 3300049581 Bacteria 3052
607 Ga0501047_0144623 3300049581 Bacteria 2255
608 Ga0501047_0177307 3300049581 Bacteria 1998
609 Ga0501047_0195623 3300049581 Bacteria 1884
610 Ga0501048_0006374 3300049582 Bacteria 8968
611 Ga0501048_0040346 3300049582 Bacteria 3346
612 Ga0501048_0081658 3300049582 Bacteria 2280
613 Ga0501067_0009878 3300049583 Bacteria 5284
614 Ga0501067_0036584 3300049583 Bacteria 2725
615 Ga0501067_0050205 3300049583 Bacteria 2312
616 Ga0501068_0011636 3300049584 Bacteria 4971
617 Ga0501068_0066433 3300049584 Bacteria 2196
618 Ga0501069_0001887 3300049585 Bacteria 10466
619 Ga0501069_0004122 3300049585 Bacteria 7502
620 Ga0501070_0012789 3300049586 Bacteria 7074
621 Ga0501070_0119182 3300049586 Bacteria 2181
622 Ga0501070_0136837 3300049586 Bacteria 2022
623 Ga0501071_0050472 3300049587 Bacteria 2997
624 Ga0501071_0096370 3300049587 Bacteria 2177
625 Ga0501071_0180049 3300049587 Bacteria 1583
626 Ga0501071_0240661 3300049587 Bacteria 1364
627 Ga0501072_0016795 3300049588 Bacteria 5621
628 Ga0501072_0124884 3300049588 Bacteria 2050
629 Ga0501072_0222472 3300049588 Bacteria 1504
630 Ga0501073_0005503 3300049589 Bacteria 9487
631 Ga0501073_0014497 3300049589 Bacteria 5727
632 Ga0501073_0018783 3300049589 Bacteria 4997
633 Ga0501073_0243105 3300049589 Bacteria 1243
634 Ga0501074_0021775 3300049590 Bacteria 4653
635 Ga0501074_0050003 3300049590 Bacteria 3017
636 Ga0501074_0054280 3300049590 Bacteria 2890
637 Ga0501075_0006663 3300049591 Bacteria 7962
638 Ga0501238_000151 3300049671 Bacteria 10786
639 Ga0501257_000588 3300049686 Bacteria 7187
640 Ga0501080_0010572 3300049742 Bacteria 8449
641 Ga0501080_0035304 3300049742 Bacteria 4666
642 Ga0501081_0118209 3300049743 Bacteria 1886
643 Ga0501083_0059882 3300049744 Bacteria 2546
644 Ga0501083_0184562 3300049744 Bacteria 1361
645 Ga0501035_0004680 3300049822 Bacteria 12986
646 Ga0501035_0166314 3300049822 Bacteria 1907
647 Ga0501044_0041168 3300049823 Bacteria 4810
648 Ga0501044_0046900 3300049823 Bacteria 4471
649 Ga0501044_0115439 3300049823 Bacteria 2690
650 Ga0501044_0204239 3300049823 Bacteria 1933
651 Ga0501045_0064286 3300049824 Bacteria 2693
652 nmdc:mga03n38_29987_c1 3300050490 Bacteria 2283
653 nmdc:mga03n38_57892_c1 3300050490 Bacteria 1754
654 nmdc:mga06z11_11573_c1 3300050494 Bacteria 3810
655 nmdc:mga04h51_2557_c1 3300050495 Bacteria 4330
656 nmdc:mga0qj67_70565_c1 3300050509 Bacteria 2787
657 nmdc:mga06r32_278056_c1 3300050510 Bacteria 1661
658 nmdc:mga08y16_3153_c1 3300050511 Bacteria 17078
659 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
660 nmdc:mga0a205_253389_c1 3300050515 Bacteria 1639
661 nmdc:mga0sz30_8411_c1 3300050516 Bacteria 3897
662 Ga0495601_0061038 3300053077 Bacteria 2393
663 Ga0495612_0000369 3300053078 Bacteria 18070
664 Ga0495612_0002269 3300053078 Bacteria 7914
665 Ga0500635_0000151 3300053080 Bacteria 38898
666 Ga0495595_0002820 3300053084 Bacteria 6837
667 Ga0495619_0000036 3300053085 Bacteria 125188
668 Ga0495619_0005952 3300053085 Bacteria 7725
669 Ga0495619_0077095 3300053085 Bacteria 2238
670 Ga0500578_0002408 3300053086 Bacteria 15729
671 Ga0500578_0071208 3300053086 Bacteria 2216
672 Ga0500643_034824 3300053087 Bacteria 1514
673 Ga0500644_0004248 3300053088 Bacteria 3579
674 Ga0500566_0047254 3300053094 Bacteria 2471
675 Ga0500641_0000563 3300053096 Bacteria 13434
676 Ga0500641_0021040 3300053096 Bacteria 2481
677 Ga0500555_003161 3300053103 Bacteria 4693
678 Ga0500555_027784 3300053103 Bacteria 1613
679 Ga0500556_0000849 3300053104 Bacteria 17422
680 Ga0500556_0013092 3300053104 Bacteria 2498
681 Ga0500562_004351 3300053108 Bacteria 3585
682 Ga0500562_015604 3300053108 Bacteria 1949
683 Ga0500569_001151 3300053109 Bacteria 4877
684 Ga0500594_0000315 3300053118 Bacteria 10818
685 Ga0500608_000165 3300053122 Bacteria 27378
686 Ga0500608_000752 3300053122 Bacteria 11826
687 Ga0500608_010288 3300053122 Bacteria 4010
688 Ga0500614_001566 3300053123 Bacteria 5413
689 Ga0500658_0082928 3300053134 Bacteria 1374
690 Ga0500564_000306 3300053138 Bacteria 13745
691 Ga0500568_0069987 3300053139 Bacteria 1344
692 Ga0500616_0000008 3300053153 Bacteria 785239
693 Ga0500616_0006301 3300053153 Bacteria 7797
694 Ga0500616_0006551 3300053153 Bacteria 7601
695 Ga0500622_0003641 3300053156 Bacteria 10132
696 Ga0500622_0008207 3300053156 Bacteria 5864
697 Ga0500622_0064052 3300053156 Bacteria 1870
698 Ga0500624_001098 3300053157 Bacteria 5109
699 Ga0500634_0000031 3300053161 Bacteria 75547
700 Ga0500638_049699 3300053162 Bacteria 2028
701 Ga0500639_067780 3300053163 Bacteria 1825
702 Ga0500645_000199 3300053730 Bacteria 46484
703 Ga0500645_003346 3300053730 Bacteria 6570
704 Ga0501084_0030403 3300054114 Bacteria 4516
705 Ga0501084_0116876 3300054114 Bacteria 2242
706 Ga0587093_001189 3300059478 Bacteria 2125
707 Ga0587070_001606 3300059491 Bacteria 2378
708 Ga0587070_002325 3300059491 Bacteria 2139
709 Ga0587070_004991 3300059491 Bacteria 1714
710 Ga0587077_000881 3300059493 Bacteria 2953
711 Ga0587080_001568 3300059503 Bacteria 2513
712 Ga0587083_0002187 3300059505 Bacteria 2388
713 Ga0587085_002368 3300059506 Bacteria 1911
714 Ga0587088_002143 3300059508 Bacteria 2191
715 Ga0587092_003651 3300059512 Bacteria 1769
716 Ga0587094_001362 3300059513 Bacteria 2286
717 Ga0587095_000405 3300059514 Bacteria 2180
718 Ga0587099_001045 3300059622 Bacteria 1871
719 Ga0587101_001895 3300059623 Bacteria 1898
720 Ga0587117_000969 3300059627 Bacteria 2257
721 Ga0587078_001097 3300059646 Bacteria 2308
722 Ga0587102_000527 3300059649 Bacteria 2232
723 Ga0587107_000363 3300059652 Bacteria 2842
724 Ga0587071_003361 3300060344 Bacteria 2286
725 Ga0587111_0003802 3300060346 Bacteria 2186
726 Ga0501082_0004513 3300060353 Bacteria 12157
727 Ga0501082_0039877 3300060353 Bacteria 4051
728 Ga0501082_0468111 3300060353 Bacteria 1101

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0222472 Ga0501072_0222472_32_1096 353
2 3300049589 Ga0501073_0243105 Ga0501073_0243105_163_1227 353
3 3300060353 Ga0501082_0468111 Ga0501082_0468111_13_1077 353
4 iso_pu_bacteria 2841911363 2841913362 363
5 iso_pu_bacteria 2841911363 2841913377 363
6 iso_pu_bacteria 2841917233 2841919109 363
7 iso_pu_bacteria 2841917233 2841919124 363
8 3300048913 Ga0496110_0013101 Ga0496110_0013101_24_1127 366
9 3300049576 Ga0501040_0264088 Ga0501040_0264088_16_1146 374
10 3300046615 Ga0495656_0079938 Ga0495656_0079938_61_1194 376
11 iso_pu_bacteria 2643221574 2643884694 378
12 3300005617 Ga0068859_100044984 Ga0068859_1000449848 380
13 3300006931 Ga0097620_100044985 Ga0097620_1000449858 380
14 3300025942 Ga0207689_10054979 Ga0207689_100549795 380
15 3300026089 Ga0207648_10230801 Ga0207648_102308012 380
16 3300028381 Ga0268264_10108360 Ga0268264_101083606 380
17 3300005335 Ga0070666_10079916 Ga0070666_100799162 381
18 3300006237 Ga0097621_100216228 Ga0097621_1002162282 381
19 3300009177 Ga0105248_10088373 Ga0105248_100883734 381
20 3300025933 Ga0207706_10028676 Ga0207706_100286765 381
21 3300028786 Ga0307517_10067581 Ga0307517_100675814 381
22 3300028786 Ga0307517_10076016 Ga0307517_100760161 381
23 3300031456 Ga0307513_10016219 Ga0307513_1001621911 381
24 3300031456 Ga0307513_10080274 Ga0307513_100802742 381
25 3300033180 Ga0307510_10015365 Ga0307510_100153659 381
26 3300046648 Ga0495611_0026790 Ga0495611_0026790_562_1752 381
27 3300048904 Ga0496101_0099463 Ga0496101_0099463_241_1431 381
28 3300048910 Ga0496107_0142562 Ga0496107_0142562_244_1434 381
29 3300048911 Ga0496108_0054744 Ga0496108_0054744_428_1618 381
30 3300048916 Ga0496113_0079171 Ga0496113_0079171_579_1769 381
31 3300015262 Ga0182007_10032563 Ga0182007_100325632 382
32 3300028794 Ga0307515_10042841 Ga0307515_100428412 382
33 3300033529 Ga0316587_1013100 Ga0316587_10131001 382
34 3300037853 Ga0436364_0586950 Ga0436364_0586950_34743_35897 382
35 3300046457 Ga0495590_0001017 Ga0495590_0001017_3745_4935 382
36 3300046520 Ga0495637_0017338 Ga0495637_0017338_1105_2295 382
37 3300046524 Ga0495648_0001203 Ga0495648_0001203_4694_5884 382
38 3300046692 Ga0495671_0094827 Ga0495671_0094827_190_1344 382
39 3300047469 Ga0495673_0002746 Ga0495673_0002746_809_1999 382
40 3300053086 Ga0500578_0002408 Ga0500578_0002408_14472_15662 382
41 3300053118 Ga0500594_0000315 Ga0500594_0000315_7297_8487 382
42 3300053138 Ga0500564_000306 Ga0500564_000306_12399_13589 382
43 iso_pu_bacteria 2643221691 2644508361 382
44 3300049579 Ga0501043_0109183 Ga0501043_0109183_837_2048 383
45 3300049823 Ga0501044_0041168 Ga0501044_0041168_486_1697 383
46 3300001979 JGI24740J21852_10004417 JGI24740J21852_100044173 384
47 3300031852 Ga0307410_10281831 Ga0307410_102818311 384
48 iso_pu_bacteria 2643221640 2644224135 384
49 iso_pu_bacteria 2643221642 2644234918 384
50 iso_pu_bacteria 2671180139 2671694510 385
51 iso_pu_bacteria 2671180139 2671694524 385
52 iso_pu_bacteria 2891048133 2891050816 385
53 iso_pu_bacteria 2891048133 2891052030 385
54 3300005981 Ga0081538_10004242 Ga0081538_100042429 387
55 iso_pu_bacteria 2643221661 2644342236 387
56 3300035398 Ga0316574_0096095 Ga0316574_0096095_522_1697 389
57 3300042436 Ga0439435_0002970 Ga0439435_0002970_899_2074 389
58 3300049571 Ga0501034_0157828 Ga0501034_0157828_736_1911 389
59 3300049581 Ga0501047_0023718 Ga0501047_0023718_3907_5082 389
60 3300048909 Ga0496106_0193822 Ga0496106_0193822_253_1431 390
61 iso_pu_bacteria 2510917020 2511125119 390
62 iso_pu_bacteria 2582581280 2585151781 390
63 iso_pu_bacteria 2582581280 2585154534 390
64 iso_pu_bacteria 2582581280 2585155436 390
65 iso_pu_bacteria 2582581280 2585155676 390
66 iso_pu_bacteria 2643221545 2643748407 390
67 iso_pu_bacteria 2643221580 2643911578 390
68 iso_pu_bacteria 2643221583 2643924190 390
69 iso_pu_bacteria 2643221591 2643963622 390
70 iso_pu_bacteria 2643221663 2644352463 390
71 iso_pu_bacteria 2643221674 2644410370 390
72 iso_pu_bacteria 2739367756 2739792092 390
73 iso_pu_bacteria 2843744320 2843746970 390
74 iso_pu_bacteria 2843744320 2843749243 390
75 iso_pu_bacteria 2849560528 2849562782 390
76 iso_pu_bacteria 2849573788 2849574447 390
77 iso_pu_bacteria 2851153111 2851157042 390
78 iso_pu_bacteria 2857504554 2857509622 390
79 iso_pu_bacteria 2885427238 2885427568 390
80 iso_pu_bacteria 2898329390 2898332255 390
81 iso_pu_bacteria 2928972540 2928975614 390
82 iso_pu_bacteria 2932401849 2932403060 390
83 iso_pu_bacteria 2939669807 2939671411 390
84 iso_pu_bacteria 2941485952 2941486882 390
85 iso_pu_bacteria 2941485952 2941486929 390
86 iso_pu_bacteria 2977240413 2977241637 390
87 iso_pu_bacteria 2977240413 2977242317 390
88 iso_pu_bacteria 646564506 646814833 390
89 iso_pu_bacteria 8057529695 8057530443 390
90 iso_pu_bacteria 8057529695 8057530466 390
91 3300025261 Ga0209233_1004407 Ga0209233_10044076 391
92 3300037312 Ga0395899_0214213 Ga0395899_0214213_78_1277 391
93 3300003373 JGI25407J50210_10000001 JGI25407J50210_1000000124 393
94 3300005338 Ga0068868_100112874 Ga0068868_1001128741 393
95 3300005549 Ga0070704_100012434 Ga0070704_1000124343 393
96 3300005617 Ga0068859_100314217 Ga0068859_1003142171 393
97 3300005842 Ga0068858_100117388 Ga0068858_1001173882 393
98 3300005844 Ga0068862_100071259 Ga0068862_1000712593 393
99 3300006048 Ga0075363_100093713 Ga0075363_1000937131 393
100 3300006051 Ga0075364_10143435 Ga0075364_101434351 393
101 3300006353 Ga0075370_10111186 Ga0075370_101111862 393
102 3300006846 Ga0075430_100205507 Ga0075430_1002055072 393
103 3300006881 Ga0068865_100007443 Ga0068865_1000074432 393
104 3300006931 Ga0097620_100314216 Ga0097620_1003142162 393
105 3300014497 Ga0182008_10007915 Ga0182008_100079154 393
106 3300025907 Ga0207645_10040174 Ga0207645_100401742 393
107 3300025961 Ga0207712_10023398 Ga0207712_100233987 393
108 3300026075 Ga0207708_10038392 Ga0207708_100383925 393
109 3300026118 Ga0207675_100094820 Ga0207675_1000948201 393
110 3300026121 Ga0207683_10083220 Ga0207683_100832204 393
111 3300027614 Ga0209970_1009394 Ga0209970_10093943 393
112 3300028379 Ga0268266_10362777 Ga0268266_103627772 393
113 3300028381 Ga0268264_10440456 Ga0268264_104404561 393
114 3300031241 Ga0265325_10018226 Ga0265325_100182263 393
115 3300031344 Ga0265316_10003472 Ga0265316_1000347221 393
116 3300031852 Ga0307410_10021164 Ga0307410_100211642 393
117 3300041997 Ga0439431_0013009 Ga0439431_0013009_344_1528 393
118 3300042435 Ga0439434_0017551 Ga0439434_0017551_784_1968 393
119 3300042876 Ga0451577_0347129 Ga0451577_0347129_87_1274 393
120 3300045051 Ga0451576_0039758 Ga0451576_0039758_2779_3966 393
121 3300046455 Ga0495603_0058507 Ga0495603_0058507_576_1760 393
122 3300046461 Ga0495641_0029068 Ga0495641_0029068_798_1982 393
123 3300048908 Ga0496105_0217838 Ga0496105_0217838_324_1508 393
124 3300048911 Ga0496108_0196490 Ga0496108_0196490_51_1235 393
125 3300048912 Ga0496109_0023777 Ga0496109_0023777_2409_3593 393
126 3300048913 Ga0496110_0123328 Ga0496110_0123328_842_2026 393
127 3300048917 Ga0496114_0003529 Ga0496114_0003529_3978_5162 393
128 3300048918 Ga0496115_0288564 Ga0496115_0288564_18_1202 393
129 3300049572 Ga0501036_0014888 Ga0501036_0014888_2324_3508 393
130 3300049572 Ga0501036_0076823 Ga0501036_0076823_649_1833 393
131 3300049576 Ga0501040_0200740 Ga0501040_0200740_200_1384 393
132 3300049578 Ga0501042_0099949 Ga0501042_0099949_67_1251 393
133 3300049582 Ga0501048_0081658 Ga0501048_0081658_366_1550 393
134 3300049587 Ga0501071_0096370 Ga0501071_0096370_95_1279 393
135 3300049587 Ga0501071_0240661 Ga0501071_0240661_35_1219 393
136 3300049588 Ga0501072_0016795 Ga0501072_0016795_859_2043 393
137 3300049590 Ga0501074_0054280 Ga0501074_0054280_1229_2413 393
138 3300049591 Ga0501075_0006663 Ga0501075_0006663_4743_5927 393
139 3300049824 Ga0501045_0064286 Ga0501045_0064286_522_1706 393
140 3300050510 nmdc:mga06r32_278056_c1 nmdc:mga06r32_278056_c1_421_1605 393
141 3300050515 nmdc:mga0a205_253389_c1 nmdc:mga0a205_253389_c1_96_1283 393
142 3300053139 Ga0500568_0069987 Ga0500568_0069987_97_1281 393
143 3300053153 Ga0500616_0000008 Ga0500616_0000008_290024_291211 393
144 3300054114 Ga0501084_0116876 Ga0501084_0116876_480_1664 393
145 3300059622 Ga0587099_001045 Ga0587099_001045_84_1271 393
146 3300000546 LJNas_1002379 LJNas_10023792 394
147 3300001977 JGI24746J21847_1000007 JGI24746J21847_10000073 394
148 3300002074 JGI24748J21848_1000332 JGI24748J21848_10003322 394
149 3300002239 JGI24034J26672_10000068 JGI24034J26672_1000006829 394
150 3300002244 JGI24742J22300_10000389 JGI24742J22300_100003891 394
151 3300003214 JGI25165J46597_1000961 JGI25165J46597_100096130 394
152 3300003215 JGI25153J46596_10019154 JGI25153J46596_100191542 394
153 3300003773 Ga0055537_1003463 Ga0055537_10034632 394
154 3300003773 Ga0055537_1005190 Ga0055537_10051904 394
155 3300003784 Ga0055534_1011560 Ga0055534_10115601 394
156 3300003784 Ga0055534_1015199 Ga0055534_10151991 394
157 3300003794 Ga0055531_10005224 Ga0055531_100052249 394
158 3300004799 Ga0058863_10019511 Ga0058863_100195111 394
159 3300004803 Ga0058862_10006495 Ga0058862_100064951 394
160 3300004803 Ga0058862_10084521 Ga0058862_100845211 394
161 3300005329 Ga0070683_100002370 Ga0070683_10000237017 394
162 3300005329 Ga0070683_100293863 Ga0070683_1002938631 394
163 3300005331 Ga0070670_100003031 Ga0070670_10000303112 394
164 3300005333 Ga0070677_10000017 Ga0070677_1000001713 394
165 3300005335 Ga0070666_10059071 Ga0070666_100590712 394
166 3300005336 Ga0070680_100083838 Ga0070680_1000838382 394
167 3300005337 Ga0070682_100000009 Ga0070682_100000009300 394
168 3300005338 Ga0068868_100003492 Ga0068868_10000349220 394
169 3300005347 Ga0070668_100041840 Ga0070668_1000418406 394
170 3300005353 Ga0070669_100109408 Ga0070669_1001094083 394
171 3300005355 Ga0070671_100001396 Ga0070671_1000013969 394
172 3300005356 Ga0070674_100000021 Ga0070674_10000002191 394
173 3300005356 Ga0070674_100000047 Ga0070674_1000000479 394
174 3300005366 Ga0070659_100000160 Ga0070659_10000016051 394
175 3300005366 Ga0070659_100041891 Ga0070659_1000418914 394
176 3300005367 Ga0070667_100033809 Ga0070667_1000338092 394
177 3300005367 Ga0070667_100129510 Ga0070667_1001295101 394
178 3300005436 Ga0070713_100061429 Ga0070713_1000614292 394
179 3300005437 Ga0070710_10000005 Ga0070710_1000000586 394
180 3300005439 Ga0070711_100001729 Ga0070711_1000017292 394
181 3300005439 Ga0070711_100124810 Ga0070711_1001248101 394
182 3300005440 Ga0070705_100004488 Ga0070705_1000044889 394
183 3300005455 Ga0070663_100079574 Ga0070663_1000795744 394
184 3300005457 Ga0070662_100000007 Ga0070662_10000000724 394
185 3300005458 Ga0070681_10035006 Ga0070681_100350062 394
186 3300005530 Ga0070679_100067285 Ga0070679_1000672854 394
187 3300005535 Ga0070684_100016808 Ga0070684_1000168082 394
188 3300005547 Ga0070693_100001510 Ga0070693_10000151015 394
189 3300005547 Ga0070693_100103499 Ga0070693_1001034991 394
190 3300005548 Ga0070665_100000005 Ga0070665_100000005365 394
191 3300005548 Ga0070665_100000022 Ga0070665_100000022408 394
192 3300005548 Ga0070665_100044175 Ga0070665_1000441752 394
193 3300005548 Ga0070665_100049555 Ga0070665_1000495555 394
194 3300005548 Ga0070665_100052636 Ga0070665_1000526364 394
195 3300005563 Ga0068855_100099763 Ga0068855_1000997634 394
196 3300005563 Ga0068855_100390135 Ga0068855_1003901353 394
197 3300005564 Ga0070664_100173116 Ga0070664_1001731162 394
198 3300005614 Ga0068856_100069110 Ga0068856_1000691102 394
199 3300005614 Ga0068856_100328330 Ga0068856_1003283301 394
200 3300005616 Ga0068852_100007244 Ga0068852_10000724410 394
201 3300005617 Ga0068859_100009443 Ga0068859_1000094431 394
202 3300005617 Ga0068859_100009530 Ga0068859_1000095308 394
203 3300005617 Ga0068859_100165595 Ga0068859_1001655952 394
204 3300005617 Ga0068859_100217799 Ga0068859_1002177992 394
205 3300005618 Ga0068864_100016896 Ga0068864_1000168961 394
206 3300005718 Ga0068866_10000007 Ga0068866_1000000711 394
207 3300005718 Ga0068866_10000274 Ga0068866_1000027431 394
208 3300005841 Ga0068863_100008077 Ga0068863_10000807710 394
209 3300005841 Ga0068863_100195270 Ga0068863_1001952702 394
210 3300005842 Ga0068858_100000150 Ga0068858_1000001509 394
211 3300005843 Ga0068860_100039842 Ga0068860_1000398424 394
212 3300005844 Ga0068862_100062233 Ga0068862_1000622333 394
213 3300005844 Ga0068862_100066022 Ga0068862_1000660224 394
214 3300005937 Ga0081455_10035476 Ga0081455_100354762 394
215 3300005983 Ga0081540_1037311 Ga0081540_10373113 394
216 3300005983 Ga0081540_1073811 Ga0081540_10738111 394
217 3300005985 Ga0081539_10003958 Ga0081539_1000395814 394
218 3300006028 Ga0070717_10000069 Ga0070717_1000006983 394
219 3300006028 Ga0070717_10024370 Ga0070717_100243703 394
220 3300006028 Ga0070717_10157967 Ga0070717_101579672 394
221 3300006028 Ga0070717_10161271 Ga0070717_101612712 394
222 3300006038 Ga0075365_10054607 Ga0075365_100546072 394
223 3300006042 Ga0075368_10005365 Ga0075368_100053652 394
224 3300006058 Ga0075432_10000042 Ga0075432_1000004234 394
225 3300006163 Ga0070715_10000003 Ga0070715_10000003237 394
226 3300006175 Ga0070712_100000350 Ga0070712_10000035035 394
227 3300006846 Ga0075430_100036366 Ga0075430_1000363666 394
228 3300006847 Ga0075431_100154252 Ga0075431_1001542522 394
229 3300006852 Ga0075433_10001498 Ga0075433_1000149810 394
230 3300006931 Ga0097620_100009444 Ga0097620_10000944413 394
231 3300006931 Ga0097620_100009531 Ga0097620_1000095315 394
232 3300006931 Ga0097620_100165595 Ga0097620_1001655952 394
233 3300006931 Ga0097620_100217802 Ga0097620_1002178022 394
234 3300006946 Ga0079104_1011968 Ga0079104_10119682 394
235 3300009011 Ga0105251_10074873 Ga0105251_100748731 394
236 3300009093 Ga0105240_10006736 Ga0105240_1000673628 394
237 3300009093 Ga0105240_10011097 Ga0105240_100110979 394
238 3300009093 Ga0105240_10122585 Ga0105240_101225854 394
239 3300009098 Ga0105245_10000022 Ga0105245_10000022191 394
240 3300009101 Ga0105247_10000064 Ga0105247_10000064133 394
241 3300009101 Ga0105247_10029622 Ga0105247_100296225 394
242 3300009177 Ga0105248_10090574 Ga0105248_100905742 394
243 3300009545 Ga0105237_10000795 Ga0105237_1000079510 394
244 3300009551 Ga0105238_10000014 Ga0105238_10000014168 394
245 3300009551 Ga0105238_10269312 Ga0105238_102693122 394
246 3300009553 Ga0105249_10018050 Ga0105249_100180502 394
247 3300013307 Ga0157372_10091383 Ga0157372_100913832 394
248 3300013308 Ga0157375_10000126 Ga0157375_100001262 394
249 3300013308 Ga0157375_10008331 Ga0157375_100083312 394
250 3300013308 Ga0157375_10173955 Ga0157375_101739552 394
251 3300014325 Ga0163163_10098331 Ga0163163_100983313 394
252 3300014325 Ga0163163_10181092 Ga0163163_101810921 394
253 3300014326 Ga0157380_10000560 Ga0157380_1000056024 394
254 3300014326 Ga0157380_10038641 Ga0157380_100386414 394
255 3300014497 Ga0182008_10027906 Ga0182008_100279063 394
256 3300014968 Ga0157379_10026179 Ga0157379_100261794 394
257 3300014968 Ga0157379_10061801 Ga0157379_100618011 394
258 3300017792 Ga0163161_10000013 Ga0163161_10000013177 394
259 3300020069 Ga0197907_10106601 Ga0197907_101066012 394
260 3300020070 Ga0206356_11626451 Ga0206356_116264512 394
261 3300020075 Ga0206349_1658903 Ga0206349_16589031 394
262 3300020078 Ga0206352_10123011 Ga0206352_101230111 394
263 3300020080 Ga0206350_11565878 Ga0206350_115658782 394
264 3300021361 Ga0213872_10018990 Ga0213872_100189902 394
265 3300021384 Ga0213876_10001317 Ga0213876_1000131718 394
266 3300021384 Ga0213876_10016428 Ga0213876_100164284 394
267 3300021388 Ga0213875_10000154 Ga0213875_1000015451 394
268 3300022467 Ga0224712_10028045 Ga0224712_100280452 394
269 3300022467 Ga0224712_10029260 Ga0224712_100292602 394
270 3300025231 Ga0207427_101449 Ga0207427_1014492 394
271 3300025250 Ga0209026_1004620 Ga0209026_10046203 394
272 3300025250 Ga0209026_1004741 Ga0209026_10047414 394
273 3300025261 Ga0209233_1000293 Ga0209233_100029338 394
274 3300025261 Ga0209233_1016401 Ga0209233_10164011 394
275 3300025272 Ga0209455_1015467 Ga0209455_10154672 394
276 3300025291 Ga0209675_1010141 Ga0209675_10101412 394
277 3300025292 Ga0209676_1001296 Ga0209676_100129611 394
278 3300025297 Ga0209758_1001435 Ga0209758_10014357 394
279 3300025297 Ga0209758_1013790 Ga0209758_10137902 394
280 3300025298 Ga0209050_1000161 Ga0209050_100016156 394
281 3300025298 Ga0209050_1000161 Ga0209050_100016183 394
282 3300025298 Ga0209050_1015450 Ga0209050_10154503 394
283 3300025303 Ga0209051_1000877 Ga0209051_100087735 394
284 3300025304 Ga0209257_1000252 Ga0209257_100025292 394
285 3300025304 Ga0209257_1000409 Ga0209257_10004094 394
286 3300025304 Ga0209257_1000552 Ga0209257_100055220 394
287 3300025304 Ga0209257_1003348 Ga0209257_10033489 394
288 3300025315 Ga0207697_10015765 Ga0207697_100157654 394
289 3300025315 Ga0207697_10083476 Ga0207697_100834761 394
290 3300025893 Ga0207682_10000008 Ga0207682_1000000828 394
291 3300025898 Ga0207692_10000003 Ga0207692_10000003357 394
292 3300025899 Ga0207642_10000008 Ga0207642_1000000820 394
293 3300025899 Ga0207642_10000979 Ga0207642_100009793 394
294 3300025900 Ga0207710_10000220 Ga0207710_1000022027 394
295 3300025900 Ga0207710_10088046 Ga0207710_100880461 394
296 3300025904 Ga0207647_10153064 Ga0207647_101530641 394
297 3300025905 Ga0207685_10000003 Ga0207685_10000003234 394
298 3300025909 Ga0207705_10128982 Ga0207705_101289822 394
299 3300025912 Ga0207707_10007402 Ga0207707_100074022 394
300 3300025912 Ga0207707_10113656 Ga0207707_101136562 394
301 3300025912 Ga0207707_10123548 Ga0207707_101235484 394
302 3300025913 Ga0207695_10016319 Ga0207695_100163192 394
303 3300025913 Ga0207695_10041220 Ga0207695_100412208 394
304 3300025913 Ga0207695_10084973 Ga0207695_100849732 394
305 3300025913 Ga0207695_10178435 Ga0207695_101784352 394
306 3300025913 Ga0207695_10200353 Ga0207695_102003533 394
307 3300025913 Ga0207695_10243997 Ga0207695_102439972 394
308 3300025914 Ga0207671_10001074 Ga0207671_1000107437 394
309 3300025914 Ga0207671_10005921 Ga0207671_1000592110 394
310 3300025915 Ga0207693_10000138 Ga0207693_1000013880 394
311 3300025916 Ga0207663_10174851 Ga0207663_101748512 394
312 3300025917 Ga0207660_10052069 Ga0207660_100520692 394
313 3300025917 Ga0207660_10106414 Ga0207660_101064143 394
314 3300025919 Ga0207657_10092245 Ga0207657_100922452 394
315 3300025919 Ga0207657_10213381 Ga0207657_102133812 394
316 3300025921 Ga0207652_10000242 Ga0207652_100002422 394
317 3300025921 Ga0207652_10116411 Ga0207652_101164112 394
318 3300025923 Ga0207681_10036263 Ga0207681_100362635 394
319 3300025924 Ga0207694_10000008 Ga0207694_1000000870 394
320 3300025924 Ga0207694_10015447 Ga0207694_100154475 394
321 3300025927 Ga0207687_10000039 Ga0207687_1000003943 394
322 3300025927 Ga0207687_10000132 Ga0207687_1000013255 394
323 3300025928 Ga0207700_10104123 Ga0207700_101041233 394
324 3300025929 Ga0207664_10040931 Ga0207664_100409312 394
325 3300025929 Ga0207664_10052171 Ga0207664_100521712 394
326 3300025929 Ga0207664_10052775 Ga0207664_100527755 394
327 3300025931 Ga0207644_10001581 Ga0207644_100015813 394
328 3300025932 Ga0207690_10000165 Ga0207690_1000016512 394
329 3300025932 Ga0207690_10017348 Ga0207690_100173484 394
330 3300025932 Ga0207690_10018062 Ga0207690_100180624 394
331 3300025933 Ga0207706_10000018 Ga0207706_10000018161 394
332 3300025934 Ga0207686_10026568 Ga0207686_100265683 394
333 3300025937 Ga0207669_10000032 Ga0207669_1000003291 394
334 3300025941 Ga0207711_10014493 Ga0207711_100144935 394
335 3300025941 Ga0207711_10040773 Ga0207711_100407733 394
336 3300025944 Ga0207661_10183741 Ga0207661_101837411 394
337 3300025949 Ga0207667_10072768 Ga0207667_100727682 394
338 3300025949 Ga0207667_10083431 Ga0207667_100834312 394
339 3300025961 Ga0207712_10000067 Ga0207712_1000006749 394
340 3300025961 Ga0207712_10003883 Ga0207712_100038836 394
341 3300025961 Ga0207712_10160793 Ga0207712_101607932 394
342 3300025972 Ga0207668_10000053 Ga0207668_1000005317 394
343 3300025972 Ga0207668_10000363 Ga0207668_1000036336 394
344 3300025972 Ga0207668_10009658 Ga0207668_100096586 394
345 3300025972 Ga0207668_10026971 Ga0207668_100269712 394
346 3300025972 Ga0207668_10030190 Ga0207668_100301906 394
347 3300025972 Ga0207668_10104670 Ga0207668_101046702 394
348 3300025972 Ga0207668_10177067 Ga0207668_101770672 394
349 3300026023 Ga0207677_10000046 Ga0207677_10000046105 394
350 3300026035 Ga0207703_10001133 Ga0207703_100011339 394
351 3300026035 Ga0207703_10003008 Ga0207703_100030087 394
352 3300026035 Ga0207703_10004569 Ga0207703_100045694 394
353 3300026035 Ga0207703_10005760 Ga0207703_1000576010 394
354 3300026035 Ga0207703_10013988 Ga0207703_100139887 394
355 3300026041 Ga0207639_10152110 Ga0207639_101521101 394
356 3300026041 Ga0207639_10283391 Ga0207639_102833912 394
357 3300026078 Ga0207702_10046770 Ga0207702_100467701 394
358 3300026078 Ga0207702_10113611 Ga0207702_101136112 394
359 3300026088 Ga0207641_10003614 Ga0207641_1000361410 394
360 3300026088 Ga0207641_10006154 Ga0207641_1000615410 394
361 3300026088 Ga0207641_10013745 Ga0207641_100137452 394
362 3300026088 Ga0207641_10255831 Ga0207641_102558312 394
363 3300026089 Ga0207648_10202363 Ga0207648_102023632 394
364 3300026095 Ga0207676_10001597 Ga0207676_100015976 394
365 3300026116 Ga0207674_10074477 Ga0207674_100744772 394
366 3300026118 Ga0207675_100246744 Ga0207675_1002467442 394
367 3300026121 Ga0207683_10141203 Ga0207683_101412032 394
368 3300026142 Ga0207698_10027561 Ga0207698_100275612 394
369 3300027866 Ga0209813_10000406 Ga0209813_1000040621 394
370 3300027866 Ga0209813_10001907 Ga0209813_100019072 394
371 3300027907 Ga0207428_10051901 Ga0207428_100519015 394
372 3300028036 Ga0265355_1000561 Ga0265355_10005613 394
373 3300028379 Ga0268266_10000012 Ga0268266_10000012287 394
374 3300028379 Ga0268266_10000029 Ga0268266_1000002947 394
375 3300028379 Ga0268266_10000311 Ga0268266_1000031166 394
376 3300028379 Ga0268266_10000321 Ga0268266_100003218 394
377 3300028379 Ga0268266_10003345 Ga0268266_1000334524 394
378 3300028379 Ga0268266_10016661 Ga0268266_100166616 394
379 3300028379 Ga0268266_10034769 Ga0268266_100347691 394
380 3300028380 Ga0268265_10004022 Ga0268265_1000402215 394
381 3300028380 Ga0268265_10011012 Ga0268265_100110123 394
382 3300028381 Ga0268264_10005167 Ga0268264_100051671 394
383 3300028381 Ga0268264_10057405 Ga0268264_100574054 394
384 3300028556 Ga0265337_1000032 Ga0265337_100003238 394
385 3300028556 Ga0265337_1009999 Ga0265337_10099992 394
386 3300028558 Ga0265326_10000040 Ga0265326_100000403 394
387 3300028558 Ga0265326_10000082 Ga0265326_1000008216 394
388 3300028563 Ga0265319_1000006 Ga0265319_1000006193 394
389 3300028563 Ga0265319_1000357 Ga0265319_100035739 394
390 3300028563 Ga0265319_1000863 Ga0265319_10008632 394
391 3300028563 Ga0265319_1005558 Ga0265319_10055584 394
392 3300028573 Ga0265334_10000050 Ga0265334_1000005054 394
393 3300028577 Ga0265318_10000275 Ga0265318_100002758 394
394 3300028577 Ga0265318_10002149 Ga0265318_100021495 394
395 3300028577 Ga0265318_10063568 Ga0265318_100635681 394
396 3300028654 Ga0265322_10000012 Ga0265322_1000001226 394
397 3300028666 Ga0265336_10000043 Ga0265336_1000004399 394
398 3300028666 Ga0265336_10001438 Ga0265336_100014383 394
399 3300028800 Ga0265338_10000142 Ga0265338_1000014250 394
400 3300028800 Ga0265338_10013959 Ga0265338_100139595 394
401 3300028800 Ga0265338_10020173 Ga0265338_100201735 394
402 3300028800 Ga0265338_10024739 Ga0265338_100247392 394
403 3300028800 Ga0265338_10029298 Ga0265338_100292984 394
404 3300028800 Ga0265338_10040390 Ga0265338_100403904 394
405 3300028800 Ga0265338_10100462 Ga0265338_101004622 394
406 3300028800 Ga0265338_10246384 Ga0265338_102463841 394
407 3300029957 Ga0265324_10000620 Ga0265324_1000062011 394
408 3300029957 Ga0265324_10002295 Ga0265324_100022959 394
409 3300030521 Ga0307511_10029704 Ga0307511_100297043 394
410 3300030863 Ga0265766_1000600 Ga0265766_10006001 394
411 3300031235 Ga0265330_10081402 Ga0265330_100814021 394
412 3300031239 Ga0265328_10002011 Ga0265328_100020119 394
413 3300031240 Ga0265320_10000001 Ga0265320_10000001726 394
414 3300031240 Ga0265320_10012505 Ga0265320_100125052 394
415 3300031240 Ga0265320_10040194 Ga0265320_100401942 394
416 3300031241 Ga0265325_10051778 Ga0265325_100517782 394
417 3300031242 Ga0265329_10000919 Ga0265329_100009192 394
418 3300031247 Ga0265340_10000006 Ga0265340_1000000699 394
419 3300031247 Ga0265340_10001769 Ga0265340_100017696 394
420 3300031247 Ga0265340_10035745 Ga0265340_100357452 394
421 3300031250 Ga0265331_10001467 Ga0265331_100014672 394
422 3300031251 Ga0265327_10000003 Ga0265327_10000003726 394
423 3300031251 Ga0265327_10031343 Ga0265327_100313432 394
424 3300031251 Ga0265327_10036074 Ga0265327_100360744 394
425 3300031344 Ga0265316_10010215 Ga0265316_100102152 394
426 3300031344 Ga0265316_10029887 Ga0265316_100298876 394
427 3300031344 Ga0265316_10052032 Ga0265316_100520323 394
428 3300031344 Ga0265316_10086271 Ga0265316_100862713 394
429 3300031344 Ga0265316_10168291 Ga0265316_101682912 394
430 3300031456 Ga0307513_10236790 Ga0307513_102367903 394
431 3300031548 Ga0307408_100094204 Ga0307408_1000942042 394
432 3300031595 Ga0265313_10000031 Ga0265313_1000003177 394
433 3300031595 Ga0265313_10045234 Ga0265313_100452345 394
434 3300031595 Ga0265313_10079460 Ga0265313_100794602 394
435 3300031711 Ga0265314_10000178 Ga0265314_1000017865 394
436 3300031711 Ga0265314_10029221 Ga0265314_100292212 394
437 3300031712 Ga0265342_10008958 Ga0265342_100089583 394
438 3300031728 Ga0316578_10084977 Ga0316578_100849771 394
439 3300031730 Ga0307516_10033588 Ga0307516_100335885 394
440 3300031731 Ga0307405_10125927 Ga0307405_101259272 394
441 3300031852 Ga0307410_10100030 Ga0307410_101000303 394
442 3300031901 Ga0307406_10046283 Ga0307406_100462831 394
443 3300031901 Ga0307406_10077001 Ga0307406_100770012 394
444 3300031911 Ga0307412_10065817 Ga0307412_100658173 394
445 3300031995 Ga0307409_100052255 Ga0307409_1000522552 394
446 3300032004 Ga0307414_10085018 Ga0307414_100850182 394
447 3300032126 Ga0307415_100193066 Ga0307415_1001930662 394
448 3300032168 Ga0316593_10034316 Ga0316593_100343163 394
449 3300033179 Ga0307507_10180226 Ga0307507_101802262 394
450 3300033180 Ga0307510_10184849 Ga0307510_101848492 394
451 3300033541 Ga0316596_1003203 Ga0316596_10032033 394
452 3300035111 Ga0373923_0021631 Ga0373923_0021631_185_1372 394
453 3300035113 Ga0373936_0009150 Ga0373936_0009150_2335_3525 394
454 3300035172 Ga0373955_0013248 Ga0373955_0013248_528_1718 394
455 3300035172 Ga0373955_0145740 Ga0373955_0145740_23_1213 394
456 3300035398 Ga0316574_0018664 Ga0316574_0018664_28_1212 394
457 3300035692 Ga0373935_0027604 Ga0373935_0027604_525_1715 394
458 3300035695 Ga0373927_0004885 Ga0373927_0004885_1188_2378 394
459 3300035724 Ga0373933_0005630 Ga0373933_0005630_5281_6471 394
460 3300035724 Ga0373933_0061472 Ga0373933_0061472_612_1802 394
461 3300035725 Ga0373947_0084463 Ga0373947_0084463_270_1460 394
462 3300036401 Ga0373937_0016661 Ga0373937_0016661_1802_2989 394
463 3300036401 Ga0373937_0076699 Ga0373937_0076699_1284_2474 394
464 3300036401 Ga0373937_0088030 Ga0373937_0088030_1073_2257 394
465 3300036647 Ga0316582_0127044 Ga0316582_0127044_415_1608 394
466 3300037068 Ga0373925_0000023 Ga0373925_0000023_17888_19078 394
467 3300037312 Ga0395899_0025038 Ga0395899_0025038_195_1385 394
468 3300037418 Ga0395900_0227298 Ga0395900_0227298_393_1577 394
469 3300037418 Ga0395900_0422772 Ga0395900_0422772_69_1259 394
470 3300037466 Ga0395898_0088428 Ga0395898_0088428_614_1798 394
471 3300037466 Ga0395898_0211604 Ga0395898_0211604_220_1410 394
472 3300037466 Ga0395898_0257402 Ga0395898_0257402_321_1505 394
473 3300037471 Ga0395905_0022710 Ga0395905_0022710_3069_4259 394
474 3300037471 Ga0395905_0169582 Ga0395905_0169582_766_1956 394
475 3300037853 Ga0436364_0542964 Ga0436364_0542964_39_1229 394
476 3300038443 Ga0395901_0120715 Ga0395901_0120715_1228_2412 394
477 3300038443 Ga0395901_0135008 Ga0395901_0135008_350_1534 394
478 3300038443 Ga0395901_0165610 Ga0395901_0165610_274_1464 394
479 3300038742 Ga0400486_00962 Ga0400486_00962_85_1293 394
480 3300039437 Ga0436365_0319180 Ga0436365_0319180_19194_20384 394
481 3300039437 Ga0436365_1318630 Ga0436365_1318630_528_1718 394
482 3300039447 Ga0436361_0413994 Ga0436361_0413994_3107_4297 394
483 3300039453 Ga0436362_0179942 Ga0436362_0179942_49_1239 394
484 3300042014 Ga0439457_011885 Ga0439457_011885_180_1370 394
485 3300042533 Ga0450901_001704 Ga0450901_001704_463_1653 394
486 3300044656 Ga0466969_0001105 Ga0466969_0001105_4796_5986 394
487 3300044684 Ga0466966_0003817 Ga0466966_0003817_8667_9857 394
488 3300044693 Ga0466961_0000659 Ga0466961_0000659_2253_3443 394
489 3300044693 Ga0466961_0058761 Ga0466961_0058761_1220_2410 394
490 3300044693 Ga0466961_0071708 Ga0466961_0071708_98_1288 394
491 3300044694 Ga0466963_0000325 Ga0466963_0000325_13254_14441 394
492 3300044694 Ga0466963_0087179 Ga0466963_0087179_902_2089 394
493 3300044719 Ga0466971_0037640 Ga0466971_0037640_783_1970 394
494 3300044765 Ga0466970_0042626 Ga0466970_0042626_736_1926 394
495 3300044765 Ga0466970_0050555 Ga0466970_0050555_245_1429 394
496 3300044842 Ga0466957_0016259 Ga0466957_0016259_439_1629 394
497 3300044842 Ga0466957_0162610 Ga0466957_0162610_191_1381 394
498 3300044901 Ga0466960_0001761 Ga0466960_0001761_3309_4493 394
499 3300045049 Ga0466959_0022573 Ga0466959_0022573_57_1244 394
500 3300045049 Ga0466959_0078843 Ga0466959_0078843_880_2112 394
501 3300045051 Ga0451576_0000023 Ga0451576_0000023_322408_323598 394
502 3300045051 Ga0451576_0000063 Ga0451576_0000063_261712_262902 394
503 3300045051 Ga0451576_0027584 Ga0451576_0027584_95_1285 394
504 3300045836 Ga0466958_0047302 Ga0466958_0047302_65_1252 394
505 3300045976 Ga0466967_0023322 Ga0466967_0023322_1125_2315 394
506 3300046453 Ga0495627_001425 Ga0495627_001425_129_1319 394
507 3300046454 Ga0495592_0180516 Ga0495592_0180516_217_1404 394
508 3300046455 Ga0495603_0000323 Ga0495603_0000323_17282_18466 394
509 3300046455 Ga0495603_0000641 Ga0495603_0000641_9392_10576 394
510 3300046460 Ga0495638_0013903 Ga0495638_0013903_378_1568 394
511 3300046461 Ga0495641_0000400 Ga0495641_0000400_13362_14546 394
512 3300046461 Ga0495641_0042340 Ga0495641_0042340_507_1691 394
513 3300046463 Ga0495653_0004713 Ga0495653_0004713_4913_6097 394
514 3300046463 Ga0495653_0014903 Ga0495653_0014903_2775_3959 394
515 3300046463 Ga0495653_0046609 Ga0495653_0046609_428_1612 394
516 3300046463 Ga0495653_0077384 Ga0495653_0077384_889_2076 394
517 3300046471 Ga0495650_0000121 Ga0495650_0000121_82455_83639 394
518 3300046473 Ga0495582_0000006 Ga0495582_0000006_29708_30892 394
519 3300046476 Ga0495662_0000236 Ga0495662_0000236_15746_16930 394
520 3300046477 Ga0495664_0000007 Ga0495664_0000007_121246_122430 394
521 3300046501 Ga0495607_0124900 Ga0495607_0124900_77_1267 394
522 3300046506 Ga0495583_0021508 Ga0495583_0021508_469_1659 394
523 3300046511 Ga0495608_0022894 Ga0495608_0022894_1332_2519 394
524 3300046512 Ga0495610_0000924 Ga0495610_0000924_20229_21419 394
525 3300046514 Ga0495618_0000035 Ga0495618_0000035_82601_83785 394
526 3300046514 Ga0495618_0000037 Ga0495618_0000037_27098_28282 394
527 3300046515 Ga0495620_0000668 Ga0495620_0000668_13028_14212 394
528 3300046515 Ga0495620_0036764 Ga0495620_0036764_14_1204 394
529 3300046517 Ga0495630_0012465 Ga0495630_0012465_2846_4030 394
530 3300046517 Ga0495630_0102334 Ga0495630_0102334_911_2095 394
531 3300046528 Ga0495642_0022905 Ga0495642_0022905_595_1785 394
532 3300046529 Ga0495652_0049476 Ga0495652_0049476_1542_2732 394
533 3300046533 Ga0495640_0025030 Ga0495640_0025030_1609_2796 394
534 3300046539 Ga0495621_0004561 Ga0495621_0004561_2051_3241 394
535 3300046542 Ga0495597_0005196 Ga0495597_0005196_3104_4294 394
536 3300046543 Ga0495645_0000033 Ga0495645_0000033_19562_20746 394
537 3300046543 Ga0495645_0000159 Ga0495645_0000159_12386_13570 394
538 3300046543 Ga0495645_0167715 Ga0495645_0167715_244_1434 394
539 3300046558 Ga0495633_0005367 Ga0495633_0005367_5579_6769 394
540 3300046559 Ga0495667_0000067 Ga0495667_0000067_54419_55603 394
541 3300046559 Ga0495667_0004534 Ga0495667_0004534_6495_7682 394
542 3300046615 Ga0495656_0000412 Ga0495656_0000412_3466_4650 394
543 3300046616 Ga0495668_0005284 Ga0495668_0005284_7349_8539 394
544 3300046660 Ga0495625_0131776 Ga0495625_0131776_488_1678 394
545 3300046663 Ga0495635_0000006 Ga0495635_0000006_83865_85049 394
546 3300046674 Ga0495588_0037138 Ga0495588_0037138_1146_2336 394
547 3300046675 Ga0495657_0000027 Ga0495657_0000027_109729_110913 394
548 3300046675 Ga0495657_0001760 Ga0495657_0001760_15615_16799 394
549 3300046675 Ga0495657_0050118 Ga0495657_0050118_476_1663 394
550 3300046678 Ga0495599_0014944 Ga0495599_0014944_57_1244 394
551 3300046679 Ga0495623_0031396 Ga0495623_0031396_1464_2651 394
552 3300046681 Ga0495647_0000010 Ga0495647_0000010_77828_79012 394
553 3300046683 Ga0495658_0000094 Ga0495658_0000094_15846_17030 394
554 3300046683 Ga0495658_0104120 Ga0495658_0104120_243_1433 394
555 3300046684 Ga0495669_0000371 Ga0495669_0000371_9487_10677 394
556 3300046684 Ga0495669_0001857 Ga0495669_0001857_7358_8542 394
557 3300046689 Ga0495613_0000947 Ga0495613_0000947_4723_5907 394
558 3300046689 Ga0495613_0035802 Ga0495613_0035802_706_1896 394
559 3300046690 Ga0495624_0000767 Ga0495624_0000767_8545_9729 394
560 3300046691 Ga0495670_0001585 Ga0495670_0001585_8627_9811 394
561 3300046694 Ga0495649_0004615 Ga0495649_0004615_4596_5780 394
562 3300046809 Ga0495600_0016896 Ga0495600_0016896_1049_2236 394
563 3300046809 Ga0495600_0041791 Ga0495600_0041791_1434_2618 394
564 3300046809 Ga0495600_0091954 Ga0495600_0091954_389_1579 394
565 3300046810 Ga0495660_0019866 Ga0495660_0019866_2341_3531 394
566 3300047317 Ga0495604_0000218 Ga0495604_0000218_49136_50320 394
567 3300047317 Ga0495604_0036561 Ga0495604_0036561_983_2170 394
568 3300047320 Ga0495672_0001458 Ga0495672_0001458_10474_11664 394
569 3300047321 Ga0495676_0001315 Ga0495676_0001315_13109_14293 394
570 3300047322 Ga0495680_0001684 Ga0495680_0001684_15683_16867 394
571 3300047322 Ga0495680_0001951 Ga0495680_0001951_12939_14123 394
572 3300047322 Ga0495680_0028739 Ga0495680_0028739_2286_3473 394
573 3300047443 Ga0495687_020629 Ga0495687_020629_982_2172 394
574 3300047445 Ga0495677_0011211 Ga0495677_0011211_671_1861 394
575 3300047445 Ga0495677_0021265 Ga0495677_0021265_710_1900 394
576 3300047446 Ga0495679_005798 Ga0495679_005798_173_1363 394
577 3300047469 Ga0495673_0007304 Ga0495673_0007304_4710_5900 394
578 3300047470 Ga0495681_0055771 Ga0495681_0055771_452_1642 394
579 3300047471 Ga0495684_0001725 Ga0495684_0001725_10528_11712 394
580 3300047471 Ga0495684_0055386 Ga0495684_0055386_959_2146 394
581 3300047673 Ga0495593_0059744 Ga0495593_0059744_786_1970 394
582 3300048903 Ga0496100_0000004 Ga0496100_0000004_304105_305289 394
583 3300048904 Ga0496101_0000007 Ga0496101_0000007_304105_305289 394
584 3300048904 Ga0496101_0008458 Ga0496101_0008458_4534_5718 394
585 3300048904 Ga0496101_0130560 Ga0496101_0130560_439_1629 394
586 3300048905 Ga0496102_0000002 Ga0496102_0000002_649254_650438 394
587 3300048906 Ga0496103_0000017 Ga0496103_0000017_242471_243655 394
588 3300048907 Ga0496104_0000001 Ga0496104_0000001_318026_319210 394
589 3300048907 Ga0496104_0000008 Ga0496104_0000008_492768_493952 394
590 3300048907 Ga0496104_0000307 Ga0496104_0000307_40845_42029 394
591 3300048907 Ga0496104_0033810 Ga0496104_0033810_15_1202 394
592 3300048907 Ga0496104_0298145 Ga0496104_0298145_57_1247 394
593 3300048908 Ga0496105_0000003 Ga0496105_0000003_492768_493952 394
594 3300048908 Ga0496105_0000070 Ga0496105_0000070_52473_53657 394
595 3300048909 Ga0496106_0000004 Ga0496106_0000004_265519_266703 394
596 3300048909 Ga0496106_0004033 Ga0496106_0004033_536_1726 394
597 3300048909 Ga0496106_0093786 Ga0496106_0093786_541_1731 394
598 3300048910 Ga0496107_0000001 Ga0496107_0000001_304105_305289 394
599 3300048910 Ga0496107_0001409 Ga0496107_0001409_12713_13900 394
600 3300048910 Ga0496107_0229461 Ga0496107_0229461_16_1206 394
601 3300048911 Ga0496108_0000004 Ga0496108_0000004_63695_64879 394
602 3300048911 Ga0496108_0036957 Ga0496108_0036957_1894_3078 394
603 3300048911 Ga0496108_0045232 Ga0496108_0045232_291_1475 394
604 3300048912 Ga0496109_0000036 Ga0496109_0000036_89094_90278 394
605 3300048912 Ga0496109_0000550 Ga0496109_0000550_8202_9386 394
606 3300048912 Ga0496109_0002231 Ga0496109_0002231_12759_13943 394
607 3300048912 Ga0496109_0004801 Ga0496109_0004801_5253_6443 394
608 3300048912 Ga0496109_0167197 Ga0496109_0167197_630_1814 394
609 3300048913 Ga0496110_0000152 Ga0496110_0000152_17865_19049 394
610 3300048913 Ga0496110_0032992 Ga0496110_0032992_752_1936 394
611 3300048913 Ga0496110_0053927 Ga0496110_0053927_2330_3517 394
612 3300048914 Ga0496111_0000123 Ga0496111_0000123_19626_20810 394
613 3300048914 Ga0496111_0112895 Ga0496111_0112895_616_1806 394
614 3300048915 Ga0496112_0000002 Ga0496112_0000002_235018_236202 394
615 3300048915 Ga0496112_0001057 Ga0496112_0001057_3971_5155 394
616 3300048915 Ga0496112_0001810 Ga0496112_0001810_3627_4811 394
617 3300048915 Ga0496112_0018998 Ga0496112_0018998_4927_6111 394
618 3300048915 Ga0496112_0020121 Ga0496112_0020121_903_2090 394
619 3300048916 Ga0496113_0029106 Ga0496113_0029106_904_2091 394
620 3300048917 Ga0496114_0000097 Ga0496114_0000097_20860_22044 394
621 3300048918 Ga0496115_0000005 Ga0496115_0000005_137000_138184 394
622 3300048918 Ga0496115_0000151 Ga0496115_0000151_21962_23146 394
623 3300048918 Ga0496115_0020265 Ga0496115_0020265_3134_4318 394
624 3300048918 Ga0496115_0055983 Ga0496115_0055983_1369_2559 394
625 3300048918 Ga0496115_0059763 Ga0496115_0059763_1263_2453 394
626 3300048918 Ga0496115_0140761 Ga0496115_0140761_24_1214 394
627 3300048919 Ga0496116_0052644 Ga0496116_0052644_312_1502 394
628 3300048920 Ga0496117_0010944 Ga0496117_0010944_2915_4105 394
629 3300048921 Ga0496118_0006934 Ga0496118_0006934_7303_8493 394
630 3300048922 Ga0496119_0019080 Ga0496119_0019080_2964_4154 394
631 3300048924 Ga0496121_0000485 Ga0496121_0000485_74028_75218 394
632 3300048924 Ga0496121_0000946 Ga0496121_0000946_33403_34593 394
633 3300048924 Ga0496121_0027878 Ga0496121_0027878_1756_2940 394
634 3300048926 Ga0496123_0001481 Ga0496123_0001481_15673_16863 394
635 3300048927 Ga0496124_0040664 Ga0496124_0040664_20_1210 394
636 3300048928 Ga0496125_0000815 Ga0496125_0000815_38787_39977 394
637 3300048928 Ga0496125_0090667 Ga0496125_0090667_808_1998 394
638 3300048928 Ga0496125_0190625 Ga0496125_0190625_10_1200 394
639 3300048929 Ga0496126_0183070 Ga0496126_0183070_319_1509 394
640 3300049527 Ga0501311_002271 Ga0501311_002271_20_1210 394
641 3300049530 Ga0501314_000335 Ga0501314_000335_740_1930 394
642 3300049568 Ga0501031_0009868 Ga0501031_0009868_3503_4687 394
643 3300049568 Ga0501031_0027816 Ga0501031_0027816_2125_3318 394
644 3300049569 Ga0501032_0001419 Ga0501032_0001419_450_1634 394
645 3300049569 Ga0501032_0067379 Ga0501032_0067379_842_2032 394
646 3300049570 Ga0501033_0004084 Ga0501033_0004084_1123_2307 394
647 3300049570 Ga0501033_0218198 Ga0501033_0218198_36_1226 394
648 3300049571 Ga0501034_0004173 Ga0501034_0004173_11227_12417 394
649 3300049571 Ga0501034_0118404 Ga0501034_0118404_1357_2541 394
650 3300049571 Ga0501034_0128649 Ga0501034_0128649_502_1692 394
651 3300049571 Ga0501034_0165468 Ga0501034_0165468_25_1215 394
652 3300049571 Ga0501034_0187645 Ga0501034_0187645_287_1477 394
653 3300049571 Ga0501034_0254468 Ga0501034_0254468_373_1563 394
654 3300049572 Ga0501036_0020928 Ga0501036_0020928_730_1914 394
655 3300049572 Ga0501036_0085139 Ga0501036_0085139_972_2162 394
656 3300049573 Ga0501037_0001774 Ga0501037_0001774_10571_11755 394
657 3300049574 Ga0501038_0029168 Ga0501038_0029168_3411_4595 394
658 3300049574 Ga0501038_0107566 Ga0501038_0107566_992_2182 394
659 3300049575 Ga0501039_0009138 Ga0501039_0009138_3740_4924 394
660 3300049575 Ga0501039_0108356 Ga0501039_0108356_691_1881 394
661 3300049578 Ga0501042_0004502 Ga0501042_0004502_7460_8650 394
662 3300049578 Ga0501042_0008906 Ga0501042_0008906_3411_4595 394
663 3300049578 Ga0501042_0130740 Ga0501042_0130740_348_1532 394
664 3300049578 Ga0501042_0259000 Ga0501042_0259000_29_1216 394
665 3300049579 Ga0501043_0017287 Ga0501043_0017287_530_1714 394
666 3300049580 Ga0501046_0014582 Ga0501046_0014582_3412_4596 394
667 3300049580 Ga0501046_0192802 Ga0501046_0192802_148_1338 394
668 3300049581 Ga0501047_0014422 Ga0501047_0014422_3010_4194 394
669 3300049581 Ga0501047_0021902 Ga0501047_0021902_4160_5350 394
670 3300049581 Ga0501047_0084394 Ga0501047_0084394_1453_2643 394
671 3300049581 Ga0501047_0144623 Ga0501047_0144623_1044_2234 394
672 3300049581 Ga0501047_0177307 Ga0501047_0177307_783_1973 394
673 3300049581 Ga0501047_0195623 Ga0501047_0195623_68_1258 394
674 3300049582 Ga0501048_0006374 Ga0501048_0006374_4265_5449 394
675 3300049582 Ga0501048_0040346 Ga0501048_0040346_1991_3181 394
676 3300049583 Ga0501067_0009878 Ga0501067_0009878_3190_4380 394
677 3300049583 Ga0501067_0036584 Ga0501067_0036584_1388_2578 394
678 3300049583 Ga0501067_0050205 Ga0501067_0050205_281_1471 394
679 3300049584 Ga0501068_0011636 Ga0501068_0011636_3486_4670 394
680 3300049584 Ga0501068_0066433 Ga0501068_0066433_431_1618 394
681 3300049585 Ga0501069_0001887 Ga0501069_0001887_1154_2338 394
682 3300049585 Ga0501069_0004122 Ga0501069_0004122_1005_2195 394
683 3300049586 Ga0501070_0012789 Ga0501070_0012789_5638_6822 394
684 3300049586 Ga0501070_0119182 Ga0501070_0119182_320_1510 394
685 3300049586 Ga0501070_0136837 Ga0501070_0136837_121_1311 394
686 3300049587 Ga0501071_0050472 Ga0501071_0050472_1627_2811 394
687 3300049587 Ga0501071_0180049 Ga0501071_0180049_144_1331 394
688 3300049588 Ga0501072_0124884 Ga0501072_0124884_23_1213 394
689 3300049589 Ga0501073_0005503 Ga0501073_0005503_1722_2909 394
690 3300049589 Ga0501073_0014497 Ga0501073_0014497_3364_4548 394
691 3300049589 Ga0501073_0018783 Ga0501073_0018783_855_2045 394
692 3300049590 Ga0501074_0021775 Ga0501074_0021775_619_1806 394
693 3300049590 Ga0501074_0050003 Ga0501074_0050003_1599_2789 394
694 3300049671 Ga0501238_000151 Ga0501238_000151_329_1519 394
695 3300049686 Ga0501257_000588 Ga0501257_000588_565_1755 394
696 3300049742 Ga0501080_0010572 Ga0501080_0010572_3655_4842 394
697 3300049742 Ga0501080_0035304 Ga0501080_0035304_3032_4216 394
698 3300049743 Ga0501081_0118209 Ga0501081_0118209_135_1349 394
699 3300049744 Ga0501083_0059882 Ga0501083_0059882_1000_2187 394
700 3300049744 Ga0501083_0184562 Ga0501083_0184562_19_1209 394
701 3300049822 Ga0501035_0004680 Ga0501035_0004680_7525_8709 394
702 3300049822 Ga0501035_0166314 Ga0501035_0166314_450_1640 394
703 3300049823 Ga0501044_0046900 Ga0501044_0046900_2902_4086 394
704 3300049823 Ga0501044_0115439 Ga0501044_0115439_374_1564 394
705 3300049823 Ga0501044_0204239 Ga0501044_0204239_365_1555 394
706 3300050490 nmdc:mga03n38_29987_c1 nmdc:mga03n38_29987_c1_1066_2256 394
707 3300050490 nmdc:mga03n38_57892_c1 nmdc:mga03n38_57892_c1_263_1450 394
708 3300050494 nmdc:mga06z11_11573_c1 nmdc:mga06z11_11573_c1_2591_3781 394
709 3300050495 nmdc:mga04h51_2557_c1 nmdc:mga04h51_2557_c1_2992_4182 394
710 3300050509 nmdc:mga0qj67_70565_c1 nmdc:mga0qj67_70565_c1_998_2182 394
711 3300050511 nmdc:mga08y16_3153_c1 nmdc:mga08y16_3153_c1_8795_10006 394
712 3300050515 nmdc:mga0a205_15_c2 nmdc:mga0a205_15_c2_29167_30351 394
713 3300050516 nmdc:mga0sz30_8411_c1 nmdc:mga0sz30_8411_c1_190_1380 394
714 3300053077 Ga0495601_0061038 Ga0495601_0061038_791_1978 394
715 3300053078 Ga0495612_0000369 Ga0495612_0000369_12817_14001 394
716 3300053078 Ga0495612_0002269 Ga0495612_0002269_2153_3337 394
717 3300053080 Ga0500635_0000151 Ga0500635_0000151_15791_16981 394
718 3300053084 Ga0495595_0002820 Ga0495595_0002820_3160_4347 394
719 3300053085 Ga0495619_0000036 Ga0495619_0000036_79175_80359 394
720 3300053085 Ga0495619_0005952 Ga0495619_0005952_6093_7277 394
721 3300053085 Ga0495619_0077095 Ga0495619_0077095_555_1742 394
722 3300053086 Ga0500578_0071208 Ga0500578_0071208_856_2046 394
723 3300053087 Ga0500643_034824 Ga0500643_034824_291_1481 394
724 3300053088 Ga0500644_0004248 Ga0500644_0004248_1595_2785 394
725 3300053094 Ga0500566_0047254 Ga0500566_0047254_1103_2293 394
726 3300053096 Ga0500641_0000563 Ga0500641_0000563_12214_13404 394
727 3300053096 Ga0500641_0021040 Ga0500641_0021040_422_1612 394
728 3300053103 Ga0500555_003161 Ga0500555_003161_1222_2412 394
729 3300053103 Ga0500555_027784 Ga0500555_027784_127_1317 394
730 3300053104 Ga0500556_0000849 Ga0500556_0000849_11707_12891 394
731 3300053104 Ga0500556_0013092 Ga0500556_0013092_584_1774 394
732 3300053108 Ga0500562_004351 Ga0500562_004351_410_1600 394
733 3300053108 Ga0500562_015604 Ga0500562_015604_274_1464 394
734 3300053109 Ga0500569_001151 Ga0500569_001151_3603_4793 394
735 3300053122 Ga0500608_000165 Ga0500608_000165_12310_13500 394
736 3300053122 Ga0500608_000752 Ga0500608_000752_7817_9007 394
737 3300053122 Ga0500608_010288 Ga0500608_010288_1180_2370 394
738 3300053123 Ga0500614_001566 Ga0500614_001566_3697_4881 394
739 3300053134 Ga0500658_0082928 Ga0500658_0082928_51_1241 394
740 3300053153 Ga0500616_0006301 Ga0500616_0006301_4633_5817 394
741 3300053153 Ga0500616_0006551 Ga0500616_0006551_1908_3092 394
742 3300053156 Ga0500622_0003641 Ga0500622_0003641_3900_5090 394
743 3300053156 Ga0500622_0008207 Ga0500622_0008207_4239_5429 394
744 3300053156 Ga0500622_0064052 Ga0500622_0064052_62_1252 394
745 3300053157 Ga0500624_001098 Ga0500624_001098_3570_4760 394
746 3300053161 Ga0500634_0000031 Ga0500634_0000031_1649_2839 394
747 3300053162 Ga0500638_049699 Ga0500638_049699_672_1862 394
748 3300053163 Ga0500639_067780 Ga0500639_067780_269_1459 394
749 3300053730 Ga0500645_000199 Ga0500645_000199_8515_9705 394
750 3300053730 Ga0500645_003346 Ga0500645_003346_3113_4303 394
751 3300054114 Ga0501084_0030403 Ga0501084_0030403_1410_2600 394
752 3300059478 Ga0587093_001189 Ga0587093_001189_442_1626 394
753 3300059491 Ga0587070_001606 Ga0587070_001606_549_1733 394
754 3300059491 Ga0587070_002325 Ga0587070_002325_385_1572 394
755 3300059491 Ga0587070_004991 Ga0587070_004991_475_1665 394
756 3300059493 Ga0587077_000881 Ga0587077_000881_1188_2372 394
757 3300059503 Ga0587080_001568 Ga0587080_001568_625_1809 394
758 3300059505 Ga0587083_0002187 Ga0587083_0002187_589_1773 394
759 3300059506 Ga0587085_002368 Ga0587085_002368_577_1761 394
760 3300059508 Ga0587088_002143 Ga0587088_002143_438_1622 394
761 3300059512 Ga0587092_003651 Ga0587092_003651_337_1521 394
762 3300059513 Ga0587094_001362 Ga0587094_001362_533_1717 394
763 3300059514 Ga0587095_000405 Ga0587095_000405_363_1547 394
764 3300059623 Ga0587101_001895 Ga0587101_001895_502_1686 394
765 3300059627 Ga0587117_000969 Ga0587117_000969_563_1747 394
766 3300059646 Ga0587078_001097 Ga0587078_001097_932_2116 394
767 3300059649 Ga0587102_000527 Ga0587102_000527_361_1545 394
768 3300059652 Ga0587107_000363 Ga0587107_000363_486_1670 394
769 3300060344 Ga0587071_003361 Ga0587071_003361_533_1717 394
770 3300060346 Ga0587111_0003802 Ga0587111_0003802_614_1798 394
771 3300060353 Ga0501082_0004513 Ga0501082_0004513_7525_8709 394
772 3300060353 Ga0501082_0039877 Ga0501082_0039877_1662_2852 394
773 iso_pu_bacteria 2997451912 2997456927 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03143

GTP_EFTU_D3

Elongation factor Tu C-terminal domain

359

454

0.98

PF03144

GTP_EFTU_D2

Elongation factor Tu domain 2

286

355

0.98

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

74

263

0.94

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

6

77

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i4q-assembly1.cif.gz_C-2 contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.9746 209 394
5i4q-assembly1.cif.gz_C-2 contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.9695 209 394
6wd9-assembly1.cif.gz_8 cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) 0.9608 10 393
6wd9-assembly1.cif.gz_8 cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) 0.9581 10 393
6wd4-assembly1.cif.gz_8 cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure ii-b2) 0.9578 2 393
ID Description Score Start End Superfamily
af_B4FVB2_262_392_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9875 206 334 2.40.30.10
2y12Z02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9875 206 296 2.40.30.10
af_G5ECM6_248_343_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.983 206 297 2.40.30.10
5w7qA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9822 206 300 2.40.30.10
4h9gA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9817 300 393 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A2P7P1A2-F1-model_v4 deleted 0.9998 214 297
AF-A0A3S0V9N4-F1-model_v4 Elongation factor Tu 0.9992 288 394 GO:0003746
GO:0005525
AF-A0A3D0F3T6-F1-model_v4 Elongation factor Tu (EC 3.6.5.3) 0.9992 302 394 GO:0003746
GO:0005525
GO:0005829
GO:0016787
AF-A0A352F424-F1-model_v4 Elongation factor Tu (EC 3.6.5.3) 0.9989 302 394 GO:0003746
GO:0005525
GO:0005829
GO:0016787
AF-A0A1V5ZE31-F1-model_v4 Elongation factor Tu 0.9984 312 394 GO:0003746
GO:0005525

Feature Viewer

pLDDT pTM Quality
86.86 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map