F479038

General Info

Members Datasets Scaffolds Average Seq Length
750 391 710 328

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10033959|Ga0099794_100339592
Length 378
Sequence MKKPNGAGHVVRALFHCSEGCALMLVALFVTQSANVSSNVLNPNEEKFMQQRQLGKNGPLVSALGLGCMGMSFAYGPADETESLRVLRRYLELGGNFLDTAEVYGPYTNEELLGRFLRDVPRDSVVIATKFGFRFNPDGTRGLDSSPENVRRACDASLKRLGIETIDLFYQHRVDPKVPIEDTVGAMAELVSAGKVRALGLSEAGPQTLRRAAKVHPIAALQSEYSLWSRDVETNGVLAACRELRITFVPYSPLGRGFLTGAIQKLEDLDASDWRRTNPRFGEKALQANLKLLETVKDLAGKKGSTPAQLALAWVLAQGNDLIPIPGTKRVRYLEENMGALNVKLTASDLKEINARFAQIEVFGERYAPDMMALVNHA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
4 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
5 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
6 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
7 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
8 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
9 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
10 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
11 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
12 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
13 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
14 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
15 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
16 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
17 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
18 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
19 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
20 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
21 2831426010 Nostoc sp. 106C Isolate Unclassified
22 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
23 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
24 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
25 2855730933 Achromobacter sp. HZ28 Isolate Nodule
26 2855767633 Achromobacter sp. HZ34 Isolate Nodule
27 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
28 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
29 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
30 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
31 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
32 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
33 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
34 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
35 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
36 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
37 2969141011 Bacillus velezensis MH25 Isolate Unclassified
38 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
39 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
40 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
43 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
379 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
380 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
387 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
388 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
389 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
390 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
391 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0
Isolates 5.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0.4
Rhizoplane 3.2
Rhizosphere 86
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_699357 2162886006 Unclassified 2599
2 SwRhRL3b_contig_806853 2162886006 Bacteria 3179
3 SwRhRL2b_contig_273078 2162886007 Bacteria 2113
4 SwRhRL2b_contig_454664 2162886007 Bacteria 4475
5 JGI24739J22299_10000155 3300001989 Bacteria 22101
6 JGI24737J22298_10000087 3300001990 Bacteria 27343
7 JGI24737J22298_10005388 3300001990 Bacteria 4418
8 JGI24735J21928_10000192 3300002067 Bacteria 21729
9 JGI24738J21930_10001254 3300002075 Bacteria 7132
10 JGI25151J46595_10000249 3300003187 Bacteria 62907
11 rootH2_10031165 3300003320 Bacteria 16235
12 Ga0055542_1001795 3300003762 Bacteria 8898
13 Ga0055536_1000301 3300003781 Bacteria 37078
14 Ga0055536_1016823 3300003781 Bacteria 2425
15 Ga0065704_10070425 3300005289 Bacteria 25271
16 Ga0065707_10003564 3300005295 Bacteria 5436
17 Ga0065707_10082025 3300005295 Bacteria 24254
18 Ga0065707_10096761 3300005295 Bacteria 3236
19 Ga0070658_10047333 3300005327 Bacteria 3480
20 Ga0070676_10040769 3300005328 Bacteria 2690
21 Ga0070676_10103436 3300005328 Bacteria 1763
22 Ga0070683_100162012 3300005329 Bacteria 2122
23 Ga0070683_100355989 3300005329 Bacteria 1394
24 Ga0070690_100089660 3300005330 Bacteria 2023
25 Ga0070670_100030601 3300005331 Bacteria 4635
26 Ga0070670_100090283 3300005331 Bacteria 2633
27 Ga0070677_10000001 3300005333 Bacteria 118426
28 Ga0068869_100129883 3300005334 Bacteria 1935
29 Ga0070666_10005910 3300005335 Bacteria 7516
30 Ga0070682_100299748 3300005337 Bacteria 1179
31 Ga0068868_100100153 3300005338 Bacteria 2344
32 Ga0068868_100107131 3300005338 Bacteria 2268
33 Ga0068868_100224085 3300005338 Bacteria 1575
34 Ga0070660_100009652 3300005339 Bacteria 6797
35 Ga0070689_100146124 3300005340 Bacteria 1905
36 Ga0070675_100126231 3300005354 Bacteria 2177
37 Ga0070674_100246201 3300005356 Bacteria 1402
38 Ga0070674_100389741 3300005356 Bacteria 1135
39 Ga0070688_100005952 3300005365 Bacteria 6462
40 Ga0070659_100064137 3300005366 Bacteria 2907
41 Ga0070667_100074723 3300005367 Bacteria 2892
42 Ga0070709_10018076 3300005434 Bacteria 4053
43 Ga0070714_100107549 3300005435 Bacteria 2465
44 Ga0070714_100544019 3300005435 Bacteria 1111
45 Ga0070713_100448866 3300005436 Bacteria 1211
46 Ga0070710_10106441 3300005437 Bacteria 1678
47 Ga0070711_100004985 3300005439 Bacteria 7885
48 Ga0070711_100070249 3300005439 Bacteria 2465
49 Ga0070711_100074501 3300005439 Bacteria 2401
50 Ga0070711_100243992 3300005439 Bacteria 1406
51 Ga0070711_100329020 3300005439 Bacteria 1223
52 Ga0070705_100085042 3300005440 Bacteria 1954
53 Ga0070705_100179691 3300005440 Bacteria 1432
54 Ga0070708_100012539 3300005445 Bacteria 6919
55 Ga0070708_100014454 3300005445 Bacteria 6495
56 Ga0070708_100063643 3300005445 Bacteria 3302
57 Ga0070678_100001647 3300005456 Bacteria 11963
58 Ga0070662_100008544 3300005457 Bacteria 6678
59 Ga0070681_10021716 3300005458 Bacteria 6437
60 Ga0070681_10090440 3300005458 Bacteria 3011
61 Ga0070681_10146375 3300005458 Bacteria 2291
62 Ga0070681_10202976 3300005458 Bacteria 1900
63 Ga0070707_100024799 3300005468 Bacteria 5685
64 Ga0070707_100026575 3300005468 Bacteria 5498
65 Ga0070707_100032329 3300005468 Bacteria 4984
66 Ga0070698_100019533 3300005471 Bacteria 7112
67 Ga0070698_100027381 3300005471 Bacteria 5928
68 Ga0070698_100037911 3300005471 Bacteria 4969
69 Ga0070698_100081236 3300005471 Bacteria 3236
70 Ga0070699_100002783 3300005518 Bacteria 15599
71 Ga0070679_100130070 3300005530 Bacteria 2499
72 Ga0070697_100151406 3300005536 Bacteria 1955
73 Ga0070697_100175967 3300005536 Bacteria 1813
74 Ga0068853_100148597 3300005539 Bacteria 2108
75 Ga0070672_100061477 3300005543 Bacteria 2961
76 Ga0070686_100075235 3300005544 Bacteria 2221
77 Ga0070686_100303990 3300005544 Bacteria 1184
78 Ga0070665_100001237 3300005548 Bacteria 31017
79 Ga0070704_100436208 3300005549 Bacteria 1125
80 Ga0068855_100009909 3300005563 Bacteria 11491
81 Ga0068855_100055255 3300005563 Bacteria 4664
82 Ga0068855_100127745 3300005563 Bacteria 2905
83 Ga0068855_100242648 3300005563 Bacteria 2012
84 Ga0070664_100200715 3300005564 Bacteria 1780
85 Ga0068857_100025731 3300005577 Bacteria 5181
86 Ga0068857_100434249 3300005577 Bacteria 1226
87 Ga0068856_100103141 3300005614 Bacteria 2846
88 Ga0068852_100103350 3300005616 Bacteria 2577
89 Ga0068852_100144141 3300005616 Bacteria 2207
90 Ga0068859_100106799 3300005617 Bacteria 2859
91 Ga0068859_100245892 3300005617 Bacteria 1878
92 Ga0068864_100169005 3300005618 Bacteria 1993
93 Ga0068863_100012703 3300005841 Bacteria 8121
94 Ga0068858_100037956 3300005842 Bacteria 4468
95 Ga0068858_100064239 3300005842 Bacteria 3397
96 Ga0068858_100203928 3300005842 Bacteria 1871
97 Ga0068860_100082228 3300005843 Bacteria 3063
98 Ga0068860_100268190 3300005843 Bacteria 1665
99 Ga0068860_100564791 3300005843 Bacteria 1141
100 Ga0081455_10020686 3300005937 Bacteria 6188
101 Ga0081540_1025305 3300005983 Bacteria 3419
102 Ga0070717_10004583 3300006028 Bacteria 10007
103 Ga0075365_10000319 3300006038 Bacteria 16990
104 Ga0075365_10005282 3300006038 Bacteria 6947
105 Ga0070715_10155786 3300006163 Bacteria 1124
106 Ga0070716_100001520 3300006173 Bacteria 10384
107 Ga0070716_100005798 3300006173 Bacteria 5998
108 Ga0070712_100014072 3300006175 Bacteria 5130
109 Ga0070712_100034086 3300006175 Bacteria 3449
110 Ga0070712_100053422 3300006175 Bacteria 2821
111 Ga0097621_100002270 3300006237 Bacteria 13158
112 Ga0097621_100040681 3300006237 Bacteria 3738
113 Ga0097621_100056162 3300006237 Bacteria 3216
114 Ga0097621_100060596 3300006237 Bacteria 3103
115 Ga0068871_100004133 3300006358 Bacteria 10041
116 Ga0068871_100029721 3300006358 Bacteria 4295
117 Ga0068871_100061939 3300006358 Bacteria 3057
118 Ga0075428_100043590 3300006844 Bacteria 4933
119 Ga0075431_100000239 3300006847 Bacteria 41273
120 Ga0075431_100004271 3300006847 Bacteria 13992
121 Ga0075431_100407760 3300006847 Bacteria 1359
122 Ga0075433_10042903 3300006852 Bacteria 3925
123 Ga0075434_100013850 3300006871 Bacteria 7692
124 Ga0075434_100101644 3300006871 Bacteria 2882
125 Ga0075434_100143455 3300006871 Bacteria 2408
126 Ga0075434_100162715 3300006871 Bacteria 2251
127 Ga0075434_100181432 3300006871 Bacteria 2125
128 Ga0075434_100214628 3300006871 Bacteria 1944
129 Ga0068865_100066129 3300006881 Bacteria 2550
130 Ga0075436_100012017 3300006914 Bacteria 5938
131 Ga0075436_100066930 3300006914 Bacteria 2483
132 Ga0075436_100182085 3300006914 Bacteria 1485
133 Ga0097620_100106798 3300006931 Bacteria 2859
134 Ga0097620_100128418 3300006931 Bacteria 2606
135 Ga0097620_100245904 3300006931 Bacteria 1878
136 Ga0075435_100007769 3300007076 Bacteria 7665
137 Ga0075435_100011913 3300007076 Bacteria 6422
138 Ga0099794_10028232 3300007265 Bacteria 2609
139 Ga0099794_10033959 3300007265 Bacteria 2400
140 Ga0099795_10007353 3300007788 Bacteria 3069
141 Ga0105244_10058935 3300009036 Bacteria 1936
142 Ga0105240_10000779 3300009093 Bacteria 57657
143 Ga0105240_10297267 3300009093 Bacteria 1848
144 Ga0111539_10022378 3300009094 Bacteria 7767
145 Ga0105245_10025506 3300009098 Bacteria 5199
146 Ga0105245_10031829 3300009098 Bacteria 4670
147 Ga0105245_10108052 3300009098 Bacteria 2584
148 Ga0105245_10120239 3300009098 Bacteria 2453
149 Ga0114129_10035833 3300009147 Bacteria 7007
150 Ga0114129_10048471 3300009147 Bacteria 5969
151 Ga0114129_10081000 3300009147 Bacteria 4513
152 Ga0105241_10000033 3300009174 Bacteria 118315
153 Ga0105241_10085593 3300009174 Bacteria 2477
154 Ga0105241_10128315 3300009174 Bacteria 2050
155 Ga0105241_10496495 3300009174 Bacteria 1087
156 Ga0105242_10019574 3300009176 Bacteria 5306
157 Ga0105242_10033980 3300009176 Bacteria 4087
158 Ga0105242_10078677 3300009176 Bacteria 2753
159 Ga0105242_10449645 3300009176 Bacteria 1214
160 Ga0105248_10018035 3300009177 Bacteria 7791
161 Ga0105248_10206465 3300009177 Bacteria 2213
162 Ga0105237_10024447 3300009545 Bacteria 6179
163 Ga0105237_10035885 3300009545 Bacteria 5015
164 Ga0105238_10032776 3300009551 Bacteria 5287
165 Ga0105249_10000074 3300009553 Bacteria 145235
166 Ga0105249_10069414 3300009553 Bacteria 3252
167 Ga0105239_10040629 3300010375 Bacteria 5097
168 Ga0105239_10065083 3300010375 Bacteria 4003
169 Ga0105239_10147102 3300010375 Bacteria 2629
170 Ga0105239_10374212 3300010375 Bacteria 1610
171 Ga0105246_10171245 3300011119 Bacteria 1663
172 Ga0105246_10202605 3300011119 Bacteria 1544
173 Ga0105246_10209967 3300011119 Bacteria 1519
174 Ga0157370_10017710 3300013104 Bacteria 7182
175 Ga0157369_10005309 3300013105 Bacteria 15018
176 Ga0157369_10133926 3300013105 Bacteria 2624
177 Ga0157369_10167800 3300013105 Bacteria 2314
178 Ga0157374_10037930 3300013296 Bacteria 4427
179 Ga0157374_10396699 3300013296 Bacteria 1376
180 Ga0157378_10001980 3300013297 Bacteria 18324
181 Ga0157378_10033649 3300013297 Bacteria 4533
182 Ga0157378_10138402 3300013297 Bacteria 2259
183 Ga0157378_10848004 3300013297 Bacteria 942
184 Ga0163162_10015187 3300013306 Bacteria 7522
185 Ga0163162_10060031 3300013306 Bacteria 3836
186 Ga0163162_10071493 3300013306 Bacteria 3523
187 Ga0157372_10063926 3300013307 Bacteria 4128
188 Ga0157372_10121144 3300013307 Bacteria 3005
189 Ga0157375_10041011 3300013308 Bacteria 4467
190 Ga0157375_10086391 3300013308 Bacteria 3187
191 Ga0157375_10102645 3300013308 Bacteria 2945
192 Ga0157375_10138616 3300013308 Bacteria 2558
193 Ga0157375_10619332 3300013308 Bacteria 1240
194 Ga0163163_10012585 3300014325 Bacteria 7716
195 Ga0163163_10049839 3300014325 Bacteria 4122
196 Ga0163163_10233626 3300014325 Bacteria 1888
197 Ga0157379_10119673 3300014968 Bacteria 2368
198 Ga0157379_10174617 3300014968 Bacteria 1940
199 Ga0157376_10000008 3300014969 Bacteria 351192
200 Ga0157376_10002432 3300014969 Bacteria 12594
201 Ga0157376_10003459 3300014969 Bacteria 10880
202 Ga0157376_10092052 3300014969 Bacteria 2628
203 Ga0157376_10388691 3300014969 Bacteria 1346
204 Ga0213873_10000002 3300021358 Bacteria 1164195
205 Ga0213873_10030802 3300021358 Bacteria 1330
206 Ga0213872_10000700 3300021361 Bacteria 25208
207 Ga0213872_10029132 3300021361 Bacteria 2532
208 Ga0213872_10108812 3300021361 Bacteria 1232
209 Ga0213874_10010712 3300021377 Bacteria 2303
210 Ga0213876_10000001 3300021384 Bacteria 1186326
211 Ga0213876_10001370 3300021384 Bacteria 15256
212 Ga0213875_10005331 3300021388 Bacteria 6916
213 Ga0213871_10031656 3300021441 Bacteria 1383
214 Ga0209148_1000146 3300025254 Bacteria 160734
215 Ga0209025_1000003 3300025294 Bacteria 1366495
216 Ga0209050_1000093 3300025298 Bacteria 250654
217 Ga0209257_1004775 3300025304 Bacteria 10104
218 Ga0207653_10036352 3300025885 Bacteria 1604
219 Ga0207653_10039119 3300025885 Bacteria 1552
220 Ga0207692_10095471 3300025898 Bacteria 1621
221 Ga0207688_10092746 3300025901 Bacteria 1736
222 Ga0207680_10039239 3300025903 Bacteria 2746
223 Ga0207647_10000604 3300025904 Bacteria 27991
224 Ga0207685_10032511 3300025905 Bacteria 1877
225 Ga0207685_10097221 3300025905 Bacteria 1252
226 Ga0207645_10088850 3300025907 Bacteria 1987
227 Ga0207705_10044109 3300025909 Bacteria 3205
228 Ga0207705_10185540 3300025909 Bacteria 1571
229 Ga0207684_10025533 3300025910 Bacteria 5036
230 Ga0207654_10024547 3300025911 Bacteria 3243
231 Ga0207654_10059788 3300025911 Bacteria 2224
232 Ga0207707_10030855 3300025912 Bacteria 4689
233 Ga0207707_10271427 3300025912 Bacteria 1470
234 Ga0207695_10018336 3300025913 Bacteria 8097
235 Ga0207695_10025883 3300025913 Bacteria 6557
236 Ga0207695_10154906 3300025913 Bacteria 2227
237 Ga0207693_10004813 3300025915 Bacteria 11356
238 Ga0207693_10059170 3300025915 Bacteria 3001
239 Ga0207693_10072293 3300025915 Bacteria 2701
240 Ga0207663_10029782 3300025916 Bacteria 3211
241 Ga0207657_10008390 3300025919 Bacteria 10489
242 Ga0207657_10015485 3300025919 Bacteria 7387
243 Ga0207652_10227369 3300025921 Bacteria 1682
244 Ga0207646_10051556 3300025922 Bacteria 3682
245 Ga0207646_10178785 3300025922 Bacteria 1916
246 Ga0207646_10383139 3300025922 Bacteria 1270
247 Ga0207694_10005191 3300025924 Bacteria 10056
248 Ga0207687_10025307 3300025927 Bacteria 3971
249 Ga0207687_10028506 3300025927 Bacteria 3751
250 Ga0207687_10142627 3300025927 Bacteria 1819
251 Ga0207700_10029682 3300025928 Bacteria 3862
252 Ga0207664_10174493 3300025929 Bacteria 1842
253 Ga0207706_10001626 3300025933 Bacteria 22272
254 Ga0207706_10094327 3300025933 Bacteria 2632
255 Ga0207686_10034213 3300025934 Bacteria 3040
256 Ga0207686_10043497 3300025934 Bacteria 2752
257 Ga0207686_10125546 3300025934 Bacteria 1753
258 Ga0207686_10209194 3300025934 Bacteria 1401
259 Ga0207709_10055772 3300025935 Bacteria 2443
260 Ga0207665_10000024 3300025939 Bacteria 101596
261 Ga0207665_10088635 3300025939 Bacteria 2141
262 Ga0207665_10129051 3300025939 Bacteria 1793
263 Ga0207665_10191315 3300025939 Bacteria 1487
264 Ga0207665_10318408 3300025939 Bacteria 1166
265 Ga0207691_10044156 3300025940 Bacteria 4104
266 Ga0207691_10071568 3300025940 Bacteria 3129
267 Ga0207711_10016461 3300025941 Bacteria 6144
268 Ga0207711_10083240 3300025941 Bacteria 2798
269 Ga0207689_10026741 3300025942 Bacteria 4832
270 Ga0207679_10009581 3300025945 Bacteria 6208
271 Ga0207679_10078307 3300025945 Bacteria 2518
272 Ga0207667_10014901 3300025949 Bacteria 8840
273 Ga0207667_10028927 3300025949 Bacteria 6016
274 Ga0207667_10055661 3300025949 Bacteria 4158
275 Ga0207667_10261652 3300025949 Bacteria 1769
276 Ga0207712_10000007 3300025961 Bacteria 539589
277 Ga0207668_10097389 3300025972 Bacteria 2177
278 Ga0207668_10235369 3300025972 Bacteria 1479
279 Ga0207658_10081068 3300025986 Bacteria 2487
280 Ga0207677_10003509 3300026023 Bacteria 8309
281 Ga0207703_10008898 3300026035 Bacteria 7910
282 Ga0207703_10108414 3300026035 Bacteria 2365
283 Ga0207703_10118569 3300026035 Bacteria 2269
284 Ga0207708_10096368 3300026075 Bacteria 2286
285 Ga0207702_10480132 3300026078 Bacteria 1209
286 Ga0207641_10002979 3300026088 Bacteria 15326
287 Ga0207648_10035805 3300026089 Bacteria 4373
288 Ga0207676_10047138 3300026095 Bacteria 3338
289 Ga0207674_10021605 3300026116 Bacteria 6928
290 Ga0207674_10069771 3300026116 Bacteria 3534
291 Ga0207675_100110943 3300026118 Bacteria 2588
292 Ga0207683_10026048 3300026121 Bacteria 5050
293 Ga0207698_10025155 3300026142 Bacteria 4189
294 Ga0207698_10070924 3300026142 Bacteria 2763
295 Ga0207698_10077620 3300026142 Bacteria 2664
296 Ga0209588_1001362 3300027671 Bacteria 6366
297 Ga0209588_1016141 3300027671 Bacteria 2302
298 Ga0209588_1020632 3300027671 Bacteria 2064
299 Ga0207428_10000044 3300027907 Bacteria 198046
300 Ga0268266_10000112 3300028379 Bacteria 168186
301 Ga0268266_10057684 3300028379 Bacteria 3342
302 Ga0268264_10391036 3300028381 Bacteria 1334
303 Ga0265319_1001296 3300028563 Bacteria 15126
304 Ga0265338_10016932 3300028800 Bacteria 7888
305 Ga0265338_10070724 3300028800 Bacteria 2989
306 Ga0307511_10004267 3300030521 Bacteria 14596
307 Ga0265330_10000497 3300031235 Bacteria 26301
308 Ga0265332_10040108 3300031238 Bacteria 2027
309 Ga0265320_10015580 3300031240 Bacteria 4292
310 Ga0265320_10072255 3300031240 Bacteria 1624
311 Ga0265329_10012429 3300031242 Bacteria 3060
312 Ga0265339_10024868 3300031249 Bacteria 3445
313 Ga0265327_10003259 3300031251 Bacteria 15737
314 Ga0265327_10027392 3300031251 Bacteria 3281
315 Ga0265316_10002313 3300031344 Bacteria 19915
316 Ga0265316_10002370 3300031344 Bacteria 19611
317 Ga0265316_10061012 3300031344 Bacteria 2930
318 Ga0316575_10009325 3300031665 Bacteria 3593
319 Ga0316579_10032351 3300031691 Bacteria 2398
320 Ga0265314_10000001 3300031711 Bacteria 3792860
321 Ga0265314_10002144 3300031711 Bacteria 20676
322 Ga0265314_10003041 3300031711 Bacteria 16561
323 Ga0265314_10018535 3300031711 Bacteria 5425
324 Ga0265342_10026697 3300031712 Bacteria 3616
325 Ga0307412_10014348 3300031911 Bacteria 4670
326 Ga0307414_10000024 3300032004 Bacteria 205727
327 Ga0307414_10019066 3300032004 Bacteria 4243
328 Ga0307414_10191158 3300032004 Bacteria 1656
329 Ga0307415_100239747 3300032126 Bacteria 1466
330 Ga0373939_0059944 3300035114 Bacteria 1208
331 Ga0373954_0143235 3300035118 Bacteria 1166
332 Ga0373943_0001085 3300035170 Bacteria 12115
333 Ga0373946_0006506 3300035171 Bacteria 4237
334 Ga0373931_0151276 3300035691 Bacteria 1353
335 Ga0373931_0196782 3300035691 Bacteria 1202
336 Ga0373935_0037596 3300035692 Bacteria 3030
337 Ga0373935_0243697 3300035692 Bacteria 1256
338 Ga0373927_0063745 3300035695 Bacteria 2384
339 Ga0373947_0003233 3300035725 Bacteria 9668
340 Ga0316584_0192299 3300036712 Bacteria 1508
341 Ga0373925_0187750 3300037068 Bacteria 1639
342 Ga0395899_0007423 3300037312 Bacteria 8471
343 Ga0395899_0037220 3300037312 Bacteria 3648
344 Ga0395899_0071794 3300037312 Bacteria 2533
345 Ga0395899_0078820 3300037312 Bacteria 2400
346 Ga0395900_0002198 3300037418 Bacteria 21786
347 Ga0395900_0006564 3300037418 Bacteria 12121
348 Ga0395900_0010142 3300037418 Bacteria 9634
349 Ga0395900_0114500 3300037418 Bacteria 2767
350 Ga0395898_0009879 3300037466 Bacteria 10004
351 Ga0395898_0012790 3300037466 Bacteria 8664
352 Ga0395898_0016549 3300037466 Bacteria 7541
353 Ga0395898_0033533 3300037466 Bacteria 5123
354 Ga0395905_0056934 3300037471 Bacteria 3656
355 Ga0395905_0153168 3300037471 Bacteria 2168
356 Ga0395905_0213405 3300037471 Bacteria 1808
357 Ga0436364_0159653 3300037853 Bacteria 1633
358 Ga0436364_0534877 3300037853 Bacteria 1388
359 Ga0436364_0643307 3300037853 Bacteria 2175
360 Ga0436364_0669554 3300037853 Bacteria 8539
361 Ga0436364_0892362 3300037853 Bacteria 4399
362 Ga0436364_1341086 3300037853 Bacteria 25667
363 Ga0436364_1554448 3300037853 Bacteria 11409
364 Ga0395901_0000089 3300038443 Bacteria 124305
365 Ga0395901_0015898 3300038443 Bacteria 7668
366 Ga0395901_0027387 3300038443 Bacteria 5856
367 Ga0395901_0060228 3300038443 Bacteria 3950
368 Ga0395901_0140620 3300038443 Bacteria 2537
369 Ga0395901_0354303 3300038443 Bacteria 1514
370 Ga0395901_0386637 3300038443 Bacteria 1439
371 Ga0436365_0172644 3300039437 Bacteria 2334
372 Ga0436365_0243957 3300039437 Bacteria 1942
373 Ga0436365_0364010 3300039437 Bacteria 49544
374 Ga0436365_0447799 3300039437 Bacteria 61454
375 Ga0436365_0909013 3300039437 Bacteria 3174
376 Ga0436365_1154184 3300039437 Bacteria 2354
377 Ga0436365_1290487 3300039437 Bacteria 2233
378 Ga0436360_0245961 3300039438 Bacteria 1423
379 Ga0436360_0281448 3300039438 Bacteria 6062
380 Ga0436360_0743755 3300039438 Bacteria 1242
381 Ga0436361_0073268 3300039447 Bacteria 7070
382 Ga0436361_0313172 3300039447 Bacteria 5777
383 Ga0436361_0833078 3300039447 Bacteria 31749
384 Ga0436361_0897890 3300039447 Bacteria 2033
385 Ga0436361_1013109 3300039447 Bacteria 3488
386 Ga0436363_0428108 3300039450 Bacteria 4533
387 Ga0436363_1147568 3300039450 Bacteria 2699
388 Ga0436362_0660519 3300039453 Bacteria 832172
389 Ga0436362_1138586 3300039453 Bacteria 1789
390 Ga0451791_0545886 3300041451 Bacteria 1723
391 Ga0439448_0028863 3300042005 Bacteria 1754
392 Ga0439458_0008978 3300042157 Bacteria 2230
393 Ga0439458_0013455 3300042157 Bacteria 1840
394 Ga0439458_0024318 3300042157 Bacteria 1416
395 Ga0451577_0121858 3300042876 Bacteria 2336
396 Ga0466969_0145401 3300044656 Bacteria 1094
397 Ga0466965_0190516 3300044683 Bacteria 1084
398 Ga0466966_0004926 3300044684 Bacteria 8780
399 Ga0466966_0044790 3300044684 Bacteria 2831
400 Ga0466966_0054719 3300044684 Bacteria 2528
401 Ga0466966_0125074 3300044684 Bacteria 1577
402 Ga0466961_0017907 3300044693 Bacteria 4554
403 Ga0466961_0032921 3300044693 Bacteria 3330
404 Ga0466963_0000019 3300044694 Bacteria 56949
405 Ga0466963_0015612 3300044694 Bacteria 4708
406 Ga0466964_0001574 3300044706 Bacteria 7855
407 Ga0466964_0004696 3300044706 Bacteria 5050
408 Ga0453684_0000185 3300044712 Bacteria 274418
409 Ga0453684_0024229 3300044712 Bacteria 8881
410 Ga0453684_0027086 3300044712 Bacteria 8238
411 Ga0453684_0057979 3300044712 Bacteria 5005
412 Ga0453684_0302925 3300044712 Bacteria 1816
413 Ga0466971_0005825 3300044719 Bacteria 5364
414 Ga0466971_0012399 3300044719 Bacteria 3735
415 Ga0466957_0000053 3300044842 Bacteria 42517
416 Ga0466957_0006783 3300044842 Bacteria 6471
417 Ga0466957_0020032 3300044842 Bacteria 3937
418 Ga0466957_0108639 3300044842 Bacteria 1757
419 Ga0466957_0285728 3300044842 Bacteria 1105
420 Ga0466959_0000870 3300045049 Bacteria 17824
421 Ga0466959_0009302 3300045049 Bacteria 6982
422 Ga0466959_0107831 3300045049 Bacteria 1990
423 Ga0466958_0007414 3300045836 Bacteria 6033
424 Ga0466958_0041095 3300045836 Bacteria 2781
425 Ga0466958_0055271 3300045836 Bacteria 2409
426 Ga0466967_0004114 3300045976 Bacteria 9719
427 Ga0466967_0008826 3300045976 Bacteria 7430
428 Ga0495603_0008347 3300046455 Bacteria 6262
429 Ga0495603_0109838 3300046455 Bacteria 1609
430 Ga0495629_0000259 3300046459 Bacteria 46161
431 Ga0495638_0000187 3300046460 Bacteria 94516
432 Ga0495638_0033155 3300046460 Bacteria 3304
433 Ga0495641_0000362 3300046461 Bacteria 37539
434 Ga0495641_0033399 3300046461 Bacteria 2442
435 Ga0495641_0094915 3300046461 Bacteria 1332
436 Ga0495653_0017476 3300046463 Bacteria 5833
437 Ga0495580_0024637 3300046472 Bacteria 4402
438 Ga0495580_0131972 3300046472 Bacteria 1732
439 Ga0495582_0001127 3300046473 Bacteria 15031
440 Ga0495582_0034734 3300046473 Bacteria 2771
441 Ga0495605_0000018 3300046474 Bacteria 270187
442 Ga0495605_0005663 3300046474 Bacteria 7263
443 Ga0495639_0010305 3300046475 Bacteria 4022
444 Ga0495662_0000661 3300046476 Bacteria 16220
445 Ga0495664_0103854 3300046477 Bacteria 1713
446 Ga0495584_0020006 3300046491 Bacteria 3400
447 Ga0495596_0045928 3300046500 Bacteria 1716
448 Ga0495607_0000400 3300046501 Bacteria 44002
449 Ga0495607_0004295 3300046501 Bacteria 10518
450 Ga0495583_0000552 3300046506 Bacteria 52374
451 Ga0495616_0002532 3300046513 Bacteria 12075
452 Ga0495630_0015000 3300046517 Bacteria 5653
453 Ga0495630_0223265 3300046517 Bacteria 1438
454 Ga0495632_0018477 3300046519 Bacteria 3826
455 Ga0495632_0041470 3300046519 Bacteria 2313
456 Ga0495643_0002120 3300046522 Bacteria 16364
457 Ga0495643_0028882 3300046522 Bacteria 3106
458 Ga0495644_0019544 3300046523 Bacteria 2586
459 Ga0495654_0001175 3300046530 Bacteria 18635
460 Ga0495665_0006418 3300046531 Bacteria 6349
461 Ga0495640_0013393 3300046533 Bacteria 6230
462 Ga0495609_0000001 3300046538 Bacteria 1060094
463 Ga0495633_0132015 3300046558 Bacteria 1155
464 Ga0495656_0011809 3300046615 Bacteria 3210
465 Ga0495668_0002529 3300046616 Bacteria 14911
466 Ga0495668_0002869 3300046616 Bacteria 13666
467 Ga0495668_0032029 3300046616 Bacteria 2960
468 Ga0495634_0023543 3300046642 Bacteria 4327
469 Ga0495634_0081620 3300046642 Bacteria 2114
470 Ga0495611_0008043 3300046648 Bacteria 4479
471 Ga0495625_0001610 3300046660 Bacteria 26640
472 Ga0495661_0000023 3300046665 Bacteria 189053
473 Ga0495647_0009997 3300046681 Bacteria 3224
474 Ga0495647_0031329 3300046681 Bacteria 1977
475 Ga0495658_0000467 3300046683 Bacteria 22368
476 Ga0495658_0041905 3300046683 Bacteria 2554
477 Ga0495613_0019003 3300046689 Bacteria 5120
478 Ga0495613_0139559 3300046689 Bacteria 1732
479 Ga0495624_0001840 3300046690 Bacteria 16179
480 Ga0495624_0039187 3300046690 Bacteria 3039
481 Ga0495649_0008508 3300046694 Bacteria 6168
482 Ga0495589_0000027 3300046794 Bacteria 181084
483 Ga0495589_0014244 3300046794 Bacteria 4098
484 Ga0495589_0059403 3300046794 Bacteria 1879
485 Ga0495600_0026369 3300046809 Bacteria 3751
486 Ga0495600_0288990 3300046809 Bacteria 1036
487 Ga0495660_0002222 3300046810 Bacteria 12495
488 Ga0495581_0000327 3300047315 Bacteria 23532
489 Ga0495581_0021689 3300047315 Bacteria 3721
490 Ga0495581_0132613 3300047315 Bacteria 1452
491 Ga0495636_0017133 3300047318 Bacteria 2899
492 Ga0495674_0027735 3300047319 Bacteria 5171
493 Ga0495674_0033545 3300047319 Bacteria 4648
494 Ga0495674_0042277 3300047319 Bacteria 4066
495 Ga0495672_0019772 3300047320 Bacteria 4434
496 Ga0495676_0000925 3300047321 Bacteria 24604
497 Ga0495676_0002537 3300047321 Bacteria 16242
498 Ga0495680_0008081 3300047322 Bacteria 9593
499 Ga0495680_0016990 3300047322 Bacteria 6230
500 Ga0495683_0011736 3300047323 Bacteria 4608
501 Ga0495687_000019 3300047443 Bacteria 341756
502 Ga0495687_020394 3300047443 Bacteria 3230
503 Ga0495677_0000055 3300047445 Bacteria 64238
504 Ga0495677_0000388 3300047445 Bacteria 18849
505 Ga0495679_003096 3300047446 Bacteria 8150
506 Ga0495681_0014480 3300047470 Bacteria 4516
507 Ga0495684_0005134 3300047471 Bacteria 10213
508 Ga0495684_0010148 3300047471 Bacteria 7283
509 Ga0495686_0000159 3300047472 Bacteria 129374
510 Ga0495686_0011299 3300047472 Bacteria 6295
511 Ga0495602_0181880 3300048088 Bacteria 1620
512 Ga0495614_0059895 3300048089 Bacteria 1636
513 Ga0495626_0000417 3300048091 Bacteria 43590
514 Ga0495626_0015783 3300048091 Bacteria 3856
515 Ga0496100_0013957 3300048903 Bacteria 4651
516 Ga0496101_0004100 3300048904 Bacteria 9115
517 Ga0496101_0115790 3300048904 Bacteria 2022
518 Ga0496102_0000376 3300048905 Bacteria 53516
519 Ga0496102_0013767 3300048905 Bacteria 7016
520 Ga0496102_0528567 3300048905 Bacteria 1102
521 Ga0496103_0000293 3300048906 Bacteria 46560
522 Ga0496104_0098182 3300048907 Bacteria 2803
523 Ga0496105_0042362 3300048908 Bacteria 3753
524 Ga0496105_0303759 3300048908 Bacteria 1282
525 Ga0496106_0000189 3300048909 Bacteria 43320
526 Ga0496106_0263914 3300048909 Bacteria 1378
527 Ga0496107_0003423 3300048910 Bacteria 10606
528 Ga0496107_0081256 3300048910 Bacteria 2363
529 Ga0496107_0286584 3300048910 Bacteria 1226
530 Ga0496108_0000001 3300048911 Bacteria 919044
531 Ga0496109_0000006 3300048912 Bacteria 325513
532 Ga0496111_0220729 3300048914 Bacteria 1408
533 Ga0496112_0321485 3300048915 Bacteria 1492
534 Ga0496113_0067195 3300048916 Bacteria 2717
535 Ga0496114_0002109 3300048917 Bacteria 15104
536 Ga0496115_0000070 3300048918 Bacteria 91981
537 Ga0496115_0000243 3300048918 Bacteria 49388
538 Ga0496116_0001007 3300048919 Bacteria 34381
539 Ga0496117_0000695 3300048920 Bacteria 53545
540 Ga0496117_0073746 3300048920 Bacteria 2275
541 Ga0496118_0014898 3300048921 Bacteria 7242
542 Ga0496118_0024957 3300048921 Bacteria 5143
543 Ga0496119_0020700 3300048922 Bacteria 4784
544 Ga0496120_0007039 3300048923 Bacteria 8446
545 Ga0496121_0003572 3300048924 Bacteria 21983
546 Ga0496121_0084550 3300048924 Bacteria 2501
547 Ga0496122_0005591 3300048925 Bacteria 14879
548 Ga0496122_0086143 3300048925 Bacteria 2164
549 Ga0496122_0087405 3300048925 Bacteria 2142
550 Ga0496122_0120295 3300048925 Bacteria 1695
551 Ga0496123_0016109 3300048926 Bacteria 6090
552 Ga0496124_0000735 3300048927 Bacteria 53555
553 Ga0496124_0018078 3300048927 Bacteria 6618
554 Ga0496125_0003511 3300048928 Bacteria 18932
555 Ga0496126_0005341 3300048929 Bacteria 14699
556 Ga0496126_0011226 3300048929 Bacteria 9294
557 Ga0496126_0049500 3300048929 Bacteria 3836
558 Ga0495678_014818 3300049459 Bacteria 3612
559 Ga0495678_043008 3300049459 Bacteria 1797
560 Ga0501031_0000328 3300049568 Bacteria 27375
561 Ga0501031_0124766 3300049568 Bacteria 1682
562 Ga0501031_0143052 3300049568 Bacteria 1563
563 Ga0501032_0001065 3300049569 Bacteria 21928
564 Ga0501032_0053973 3300049569 Bacteria 2706
565 Ga0501032_0059812 3300049569 Bacteria 2556
566 Ga0501033_0000194 3300049570 Bacteria 58635
567 Ga0501033_0013182 3300049570 Bacteria 6297
568 Ga0501033_0108379 3300049570 Bacteria 2023
569 Ga0501033_0268882 3300049570 Bacteria 1205
570 Ga0501034_0196361 3300049571 Bacteria 1977
571 Ga0501036_0000186 3300049572 Bacteria 41220
572 Ga0501036_0031698 3300049572 Bacteria 4467
573 Ga0501036_0056758 3300049572 Bacteria 3317
574 Ga0501036_0363866 3300049572 Bacteria 1207
575 Ga0501037_0000348 3300049573 Bacteria 38976
576 Ga0501037_0046700 3300049573 Bacteria 3176
577 Ga0501037_0064110 3300049573 Bacteria 2678
578 Ga0501038_0000412 3300049574 Bacteria 37074
579 Ga0501038_0041072 3300049574 Bacteria 4035
580 Ga0501038_0062820 3300049574 Bacteria 3172
581 Ga0501038_0379302 3300049574 Bacteria 1097
582 Ga0501039_0000100 3300049575 Bacteria 60151
583 Ga0501039_0002789 3300049575 Bacteria 13051
584 Ga0501039_0019384 3300049575 Bacteria 5214
585 Ga0501039_0101927 3300049575 Bacteria 2240
586 Ga0501039_0332924 3300049575 Bacteria 1193
587 Ga0501040_0000151 3300049576 Bacteria 38289
588 Ga0501040_0006712 3300049576 Bacteria 7466
589 Ga0501041_0011135 3300049577 Bacteria 5311
590 Ga0501041_0087643 3300049577 Bacteria 1921
591 Ga0501041_0214490 3300049577 Bacteria 1207
592 Ga0501042_0000021 3300049578 Bacteria 50302
593 Ga0501042_0012665 3300049578 Bacteria 5722
594 Ga0501043_0000992 3300049579 Bacteria 25034
595 Ga0501043_0050455 3300049579 Bacteria 3270
596 Ga0501043_0094318 3300049579 Bacteria 2353
597 Ga0501046_0000425 3300049580 Bacteria 42189
598 Ga0501046_0035586 3300049580 Bacteria 4012
599 Ga0501046_0036135 3300049580 Bacteria 3977
600 Ga0501047_0000723 3300049581 Bacteria 34341
601 Ga0501047_0042493 3300049581 Bacteria 4392
602 Ga0501047_0153723 3300049581 Bacteria 2175
603 Ga0501048_0000086 3300049582 Bacteria 48595
604 Ga0501048_0032327 3300049582 Bacteria 3781
605 Ga0501048_0063856 3300049582 Bacteria 2603
606 Ga0501048_0127225 3300049582 Bacteria 1801
607 Ga0501048_0174320 3300049582 Bacteria 1524
608 Ga0501048_0281806 3300049582 Bacteria 1182
609 Ga0501068_0001822 3300049584 Bacteria 11313
610 Ga0501069_0000938 3300049585 Bacteria 13905
611 Ga0501069_0004899 3300049585 Bacteria 6933
612 Ga0501069_0198588 3300049585 Bacteria 1162
613 Ga0501070_0000379 3300049586 Bacteria 40548
614 Ga0501070_0030012 3300049586 Bacteria 4555
615 Ga0501071_0000014 3300049587 Bacteria 60053
616 Ga0501071_0013315 3300049587 Bacteria 5604
617 Ga0501071_0021983 3300049587 Bacteria 4445
618 Ga0501071_0067981 3300049587 Bacteria 2592
619 Ga0501072_0000351 3300049588 Bacteria 32834
620 Ga0501072_0002443 3300049588 Bacteria 13913
621 Ga0501072_0030540 3300049588 Bacteria 4216
622 Ga0501072_0153320 3300049588 Bacteria 1837
623 Ga0501072_0340976 3300049588 Bacteria 1190
624 Ga0501073_0012548 3300049589 Bacteria 6185
625 Ga0501073_0039061 3300049589 Bacteria 3364
626 Ga0501073_0043028 3300049589 Bacteria 3185
627 Ga0501074_0000458 3300049590 Bacteria 24552
628 Ga0501074_0012020 3300049590 Bacteria 6292
629 Ga0501075_0000159 3300049591 Bacteria 34415
630 Ga0501075_0009989 3300049591 Bacteria 6655
631 Ga0501075_0097481 3300049591 Bacteria 2231
632 Ga0501076_0000240 3300049592 Bacteria 33579
633 Ga0501076_0014187 3300049592 Bacteria 5995
634 Ga0501076_0014605 3300049592 Bacteria 5920
635 Ga0501076_0392905 3300049592 Bacteria 1140
636 Ga0501077_0000107 3300049593 Bacteria 43983
637 Ga0501077_0011737 3300049593 Bacteria 5477
638 Ga0501077_0099883 3300049593 Bacteria 1839
639 Ga0501224_007719 3300049664 Unclassified 1567
640 Ga0501079_0009383 3300049741 Bacteria 7415
641 Ga0501079_0013898 3300049741 Bacteria 6142
642 Ga0501079_0024967 3300049741 Bacteria 4584
643 Ga0501079_0112969 3300049741 Bacteria 2111
644 Ga0501080_0000155 3300049742 Bacteria 49054
645 Ga0501080_0061803 3300049742 Bacteria 3486
646 Ga0501080_0089447 3300049742 Bacteria 2860
647 Ga0501080_0126770 3300049742 Bacteria 2364
648 Ga0501081_0000009 3300049743 Bacteria 70386
649 Ga0501081_0020721 3300049743 Bacteria 4385
650 Ga0501083_0000077 3300049744 Bacteria 65581
651 Ga0501083_0075038 3300049744 Bacteria 2246
652 Ga0501083_0144369 3300049744 Bacteria 1558
653 Ga0501035_0032085 3300049822 Bacteria 4781
654 Ga0501035_0080513 3300049822 Bacteria 2875
655 Ga0501035_0157232 3300049822 Bacteria 1970
656 Ga0501044_0004990 3300049823 Bacteria 14828
657 Ga0501044_0027955 3300049823 Bacteria 5952
658 Ga0501044_0087430 3300049823 Bacteria 3148
659 Ga0501044_0121041 3300049823 Bacteria 2618
660 Ga0501044_0239686 3300049823 Bacteria 1758
661 Ga0501045_0000190 3300049824 Bacteria 34526
662 Ga0501045_0022632 3300049824 Bacteria 4501
663 nmdc:mga0k408_55665_c2 3300050493 Bacteria 1193
664 nmdc:mga06z11_68268_c1 3300050494 Bacteria 1873
665 nmdc:mga05p37_234445_c1 3300050507 Bacteria 2210
666 nmdc:mga05p37_739220_c1 3300050507 Bacteria 1086
667 nmdc:mga09592_52083_c1 3300050508 Bacteria 3454
668 nmdc:mga0qj67_268773_c1 3300050509 Bacteria 1383
669 nmdc:mga06r32_283751_c1 3300050510 Bacteria 1643
670 nmdc:mga06r32_3111_c1 3300050510 Bacteria 14857
671 nmdc:mga08y16_39925_c1 3300050511 Bacteria 4923
672 nmdc:mga0n895_129709_c1 3300050512 Bacteria 2546
673 nmdc:mga0n895_171744_c1 3300050512 Bacteria 2200
674 nmdc:mga0n895_180784_c1 3300050512 Bacteria 2140
675 nmdc:mga0n895_182738_c1 3300050512 Bacteria 2129
676 nmdc:mga0n895_24134_c1 3300050512 Bacteria 5727
677 nmdc:mga0n895_30093_c1 3300050512 Bacteria 5185
678 nmdc:mga0rr50_191496_c1 3300050513 Bacteria 1676
679 nmdc:mga0rr50_20898_c1 3300050513 Bacteria 4457
680 nmdc:mga0rr50_522954_c1 3300050513 Bacteria 1009
681 nmdc:mga0rr50_79322_c1 3300050513 Bacteria 2528
682 nmdc:mga08x19_107874_c1 3300050514 Bacteria 1854
683 nmdc:mga08x19_135455_c1 3300050514 Bacteria 1660
684 nmdc:mga08x19_161052_c1 3300050514 Bacteria 1524
685 nmdc:mga08x19_57670_c1 3300050514 Bacteria 2510
686 nmdc:mga0a205_454451_c1 3300050515 Bacteria 1141
687 Ga0495619_0110536 3300053085 Bacteria 1878
688 Ga0495619_0237917 3300053085 Bacteria 1262
689 Ga0500643_000004 3300053087 Bacteria 857484
690 Ga0500592_000277 3300053116 Bacteria 9076
691 Ga0500592_015485 3300053116 Bacteria 1224
692 Ga0500658_0048722 3300053134 Bacteria 1723
693 Ga0500568_0015288 3300053139 Bacteria 3438
694 Ga0500573_0010374 3300053140 Bacteria 5199
695 Ga0500616_0015346 3300053153 Bacteria 4383
696 Ga0500627_0001588 3300053158 Bacteria 6405
697 Ga0501084_0000378 3300054114 Bacteria 34200
698 Ga0501084_0011572 3300054114 Bacteria 7304
699 Ga0501084_0013470 3300054114 Bacteria 6767
700 Ga0501082_0005870 3300060353 Bacteria 10657
701 Ga0501082_0021882 3300060353 Bacteria 5512
702 Ga0501082_0066665 3300060353 Bacteria 3100
703 Ga0501082_0091098 3300060353 Bacteria 2632
704 Ga0501082_0121870 3300060353 Bacteria 2260
705 Ga0501082_0608370 3300060353 Bacteria 956
706 Ga0466962_0014220 3300061719 Bacteria 3834
707 Ga0530510_0000256 3300061734 Bacteria 33416
708 Ga0530510_0059211 3300061734 Bacteria 2770
709 Ga0530510_0119447 3300061734 Bacteria 1934
710 Ga0530510_0125865 3300061734 Bacteria 1883

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025885 Ga0207653_10036352 Ga0207653_100363522 268
2 3300013297 Ga0157378_10848004 Ga0157378_108480041 269
3 3300048909 Ga0496106_0263914 Ga0496106_0263914_353_1210 276
4 3300005843 Ga0068860_100082228 Ga0068860_1000822283 288
5 3300060353 Ga0501082_0608370 Ga0501082_0608370_13_936 288
6 3300048926 Ga0496123_0016109 Ga0496123_0016109_23_904 289
7 3300048915 Ga0496112_0321485 Ga0496112_0321485_545_1453 290
8 3300048925 Ga0496122_0120295 Ga0496122_0120295_22_903 290
9 3300053087 Ga0500643_000004 Ga0500643_000004_259496_260404 290
10 iso_pu_bacteria 2891554331 2891560683 294
11 3300035691 Ga0373931_0151276 Ga0373931_0151276_42_953 297
12 3300050494 nmdc:mga06z11_68268_c1 nmdc:mga06z11_68268_c1_29_970 298
13 3300044656 Ga0466969_0145401 Ga0466969_0145401_105_1034 299
14 3300045049 Ga0466959_0009302 Ga0466959_0009302_1136_2065 299
15 3300050513 nmdc:mga0rr50_522954_c1 nmdc:mga0rr50_522954_c1_67_984 299
16 3300025939 Ga0207665_10129051 Ga0207665_101290512 300
17 3300044693 Ga0466961_0032921 Ga0466961_0032921_38_967 300
18 3300044719 Ga0466971_0005825 Ga0466971_0005825_1483_2412 300
19 3300044842 Ga0466957_0285728 Ga0466957_0285728_128_1057 300
20 3300049570 Ga0501033_0108379 Ga0501033_0108379_663_1592 300
21 3300049575 Ga0501039_0332924 Ga0501039_0332924_231_1160 300
22 3300054114 Ga0501084_0011572 Ga0501084_0011572_5503_6432 300
23 3300061719 Ga0466962_0014220 Ga0466962_0014220_2833_3762 300
24 3300061734 Ga0530510_0119447 Ga0530510_0119447_977_1906 300
25 3300005329 Ga0070683_100355989 Ga0070683_1003559892 301
26 3300005436 Ga0070713_100448866 Ga0070713_1004488662 301
27 3300005458 Ga0070681_10090440 Ga0070681_100904403 301
28 3300005563 Ga0068855_100009909 Ga0068855_1000099094 301
29 3300025913 Ga0207695_10025883 Ga0207695_100258835 301
30 3300025949 Ga0207667_10055661 Ga0207667_100556611 301
31 3300035118 Ga0373954_0143235 Ga0373954_0143235_43_966 301
32 3300014969 Ga0157376_10003459 Ga0157376_1000345913 302
33 3300037853 Ga0436364_0669554 Ga0436364_0669554_4474_5397 302
34 3300039437 Ga0436365_1290487 Ga0436365_1290487_1278_2213 302
35 3300042157 Ga0439458_0024318 Ga0439458_0024318_151_1077 302
36 3300044706 Ga0466964_0004696 Ga0466964_0004696_3389_4315 302
37 3300044842 Ga0466957_0020032 Ga0466957_0020032_1053_1979 302
38 3300046461 Ga0495641_0033399 Ga0495641_0033399_562_1497 302
39 3300046809 Ga0495600_0288990 Ga0495600_0288990_68_1003 302
40 3300048905 Ga0496102_0528567 Ga0496102_0528567_45_980 302
41 3300049568 Ga0501031_0000328 Ga0501031_0000328_19591_20526 302
42 3300049569 Ga0501032_0001065 Ga0501032_0001065_19052_19987 302
43 3300049570 Ga0501033_0000194 Ga0501033_0000194_54741_55676 302
44 3300049572 Ga0501036_0000186 Ga0501036_0000186_39151_40086 302
45 3300049573 Ga0501037_0000348 Ga0501037_0000348_13141_14076 302
46 3300049574 Ga0501038_0000412 Ga0501038_0000412_33153_34088 302
47 3300049575 Ga0501039_0000100 Ga0501039_0000100_39648_40583 302
48 3300049576 Ga0501040_0000151 Ga0501040_0000151_30001_30936 302
49 3300049578 Ga0501042_0000021 Ga0501042_0000021_39520_40455 302
50 3300049579 Ga0501043_0000992 Ga0501043_0000992_1977_2912 302
51 3300049580 Ga0501046_0000425 Ga0501046_0000425_39148_40083 302
52 3300049581 Ga0501047_0000723 Ga0501047_0000723_30024_30959 302
53 3300049582 Ga0501048_0000086 Ga0501048_0000086_14481_15416 302
54 3300049582 Ga0501048_0174320 Ga0501048_0174320_151_1086 302
55 3300049584 Ga0501068_0001822 Ga0501068_0001822_9689_10624 302
56 3300049585 Ga0501069_0000938 Ga0501069_0000938_6638_7573 302
57 3300049585 Ga0501069_0198588 Ga0501069_0198588_54_989 302
58 3300049586 Ga0501070_0000379 Ga0501070_0000379_17465_18400 302
59 3300049587 Ga0501071_0000014 Ga0501071_0000014_39645_40580 302
60 3300049587 Ga0501071_0067981 Ga0501071_0067981_1272_2207 302
61 3300049588 Ga0501072_0000351 Ga0501072_0000351_1923_2858 302
62 3300049589 Ga0501073_0012548 Ga0501073_0012548_1973_2908 302
63 3300049590 Ga0501074_0000458 Ga0501074_0000458_1948_2883 302
64 3300049591 Ga0501075_0000159 Ga0501075_0000159_3480_4415 302
65 3300049592 Ga0501076_0000240 Ga0501076_0000240_30001_30936 302
66 3300049593 Ga0501077_0000107 Ga0501077_0000107_41451_42386 302
67 3300049741 Ga0501079_0024967 Ga0501079_0024967_2960_3895 302
68 3300049742 Ga0501080_0000155 Ga0501080_0000155_31683_32618 302
69 3300049742 Ga0501080_0126770 Ga0501080_0126770_1004_1939 302
70 3300049743 Ga0501081_0000009 Ga0501081_0000009_37230_38165 302
71 3300049744 Ga0501083_0000077 Ga0501083_0000077_44993_45928 302
72 3300049744 Ga0501083_0144369 Ga0501083_0144369_12_947 302
73 3300049822 Ga0501035_0032085 Ga0501035_0032085_3483_4418 302
74 3300049823 Ga0501044_0004990 Ga0501044_0004990_1999_2934 302
75 3300049824 Ga0501045_0000190 Ga0501045_0000190_2345_3280 302
76 3300050512 nmdc:mga0n895_180784_c1 nmdc:mga0n895_180784_c1_1166_2101 302
77 3300054114 Ga0501084_0000378 Ga0501084_0000378_2000_2935 302
78 3300060353 Ga0501082_0091098 Ga0501082_0091098_690_1625 302
79 3300061734 Ga0530510_0000256 Ga0530510_0000256_2481_3416 302
80 3300003187 JGI25151J46595_10000249 JGI25151J46595_100002497 303
81 3300005843 Ga0068860_100268190 Ga0068860_1002681902 303
82 3300021361 Ga0213872_10108812 Ga0213872_101088121 303
83 3300025294 Ga0209025_1000003 Ga0209025_10000031140 303
84 3300025941 Ga0207711_10083240 Ga0207711_100832403 303
85 3300026035 Ga0207703_10108414 Ga0207703_101084141 303
86 3300046683 Ga0495658_0041905 Ga0495658_0041905_343_1278 303
87 2162886007 SwRhRL2b_contig_273078 SwRhRL2b_0870.00006850 304
88 3300007265 Ga0099794_10028232 Ga0099794_100282322 304
89 3300007788 Ga0099795_10007353 Ga0099795_100073535 304
90 3300039437 Ga0436365_0909013 Ga0436365_0909013_1844_2773 304
91 3300039450 Ga0436363_0428108 Ga0436363_0428108_49_978 304
92 3300046474 Ga0495605_0000018 Ga0495605_0000018_138102_139079 304
93 3300009147 Ga0114129_10081000 Ga0114129_100810002 305
94 3300030521 Ga0307511_10004267 Ga0307511_100042674 305
95 3300042876 Ga0451577_0121858 Ga0451577_0121858_1143_2084 305
96 3300044712 Ga0453684_0000185 Ga0453684_0000185_191701_192642 305
97 3300046491 Ga0495584_0020006 Ga0495584_0020006_1952_2887 305
98 3300046506 Ga0495583_0000552 Ga0495583_0000552_23401_24336 305
99 3300046519 Ga0495632_0041470 Ga0495632_0041470_181_1113 305
100 3300046558 Ga0495633_0132015 Ga0495633_0132015_157_1092 305
101 3300046616 Ga0495668_0002869 Ga0495668_0002869_6618_7553 305
102 3300046794 Ga0495589_0059403 Ga0495589_0059403_316_1251 305
103 3300047443 Ga0495687_020394 Ga0495687_020394_1938_2870 305
104 3300049459 Ga0495678_043008 Ga0495678_043008_68_1003 305
105 3300050509 nmdc:mga0qj67_268773_c1 nmdc:mga0qj67_268773_c1_148_1083 305
106 3300050510 nmdc:mga06r32_283751_c1 nmdc:mga06r32_283751_c1_272_1207 305
107 3300053116 Ga0500592_000277 Ga0500592_000277_3813_4748 305
108 3300006038 Ga0075365_10000319 Ga0075365_100003194 306
109 3300039450 Ga0436363_1147568 Ga0436363_1147568_769_1788 307
110 3300049459 Ga0495678_014818 Ga0495678_014818_1380_2363 307
111 3300009174 Ga0105241_10128315 Ga0105241_101283152 308
112 3300025905 Ga0207685_10032511 Ga0207685_100325112 309
113 3300025928 Ga0207700_10029682 Ga0207700_100296822 309
114 3300026118 Ga0207675_100110943 Ga0207675_1001109432 309
115 3300049577 Ga0501041_0087643 Ga0501041_0087643_89_1078 309
116 3300060353 Ga0501082_0066665 Ga0501082_0066665_308_1297 309
117 3300049572 Ga0501036_0056758 Ga0501036_0056758_121_1110 310
118 3300049573 Ga0501037_0046700 Ga0501037_0046700_1228_2217 310
119 3300049575 Ga0501039_0101927 Ga0501039_0101927_838_1827 310
120 3300049589 Ga0501073_0039061 Ga0501073_0039061_1339_2328 310
121 3300049742 Ga0501080_0089447 Ga0501080_0089447_1041_2030 310
122 3300049744 Ga0501083_0075038 Ga0501083_0075038_1091_2080 310
123 3300049823 Ga0501044_0087430 Ga0501044_0087430_1339_2328 310
124 3300005435 Ga0070714_100544019 Ga0070714_1005440191 311
125 3300005439 Ga0070711_100004985 Ga0070711_1000049856 311
126 3300025929 Ga0207664_10174493 Ga0207664_101744932 311
127 3300049592 Ga0501076_0014605 Ga0501076_0014605_2525_3514 311
128 3300037853 Ga0436364_0159653 Ga0436364_0159653_345_1313 312
129 3300044684 Ga0466966_0054719 Ga0466966_0054719_718_1677 313
130 3300045049 Ga0466959_0107831 Ga0466959_0107831_452_1411 313
131 3300005329 Ga0070683_100162012 Ga0070683_1001620123 315
132 3300036712 Ga0316584_0192299 Ga0316584_0192299_500_1471 315
133 3300005843 Ga0068860_100564791 Ga0068860_1005647912 316
134 3300025972 Ga0207668_10097389 Ga0207668_100973891 316
135 3300048903 Ga0496100_0013957 Ga0496100_0013957_2392_3375 316
136 3300048904 Ga0496101_0004100 Ga0496101_0004100_5408_6391 316
137 3300048905 Ga0496102_0013767 Ga0496102_0013767_405_1388 316
138 3300048908 Ga0496105_0042362 Ga0496105_0042362_2218_3201 316
139 3300048909 Ga0496106_0000189 Ga0496106_0000189_17943_18926 316
140 3300048910 Ga0496107_0003423 Ga0496107_0003423_7155_8138 316
141 3300048917 Ga0496114_0002109 Ga0496114_0002109_2862_3845 316
142 3300049568 Ga0501031_0124766 Ga0501031_0124766_642_1619 316
143 3300049574 Ga0501038_0379302 Ga0501038_0379302_51_1028 316
144 3300049588 Ga0501072_0153320 Ga0501072_0153320_696_1673 316
145 3300049593 Ga0501077_0099883 Ga0501077_0099883_567_1544 316
146 iso_pu_bacteria 2619619299 2621299944 316
147 iso_pu_bacteria 2738541265 2738669941 316
148 iso_pu_bacteria 2738541282 2738748334 316
149 iso_pu_bacteria 2738541303 2738857376 316
150 iso_pu_bacteria 2816332298 2817491238 316
151 iso_pu_bacteria 2855730933 2855733816 316
152 iso_pu_bacteria 2855767633 2855769406 316
153 3300013297 Ga0157378_10001980 Ga0157378_100019803 317
154 3300031240 Ga0265320_10072255 Ga0265320_100722552 317
155 3300032126 Ga0307415_100239747 Ga0307415_1002397471 317
156 3300035692 Ga0373935_0243697 Ga0373935_0243697_172_1143 317
157 3300035695 Ga0373927_0063745 Ga0373927_0063745_860_1831 317
158 3300037068 Ga0373925_0187750 Ga0373925_0187750_188_1159 317
159 3300039453 Ga0436362_1138586 Ga0436362_1138586_26_994 317
160 3300046530 Ga0495654_0001175 Ga0495654_0001175_16203_17198 317
161 3300046616 Ga0495668_0002529 Ga0495668_0002529_9448_10443 317
162 3300046794 Ga0495589_0014244 Ga0495589_0014244_1659_2654 317
163 3300048088 Ga0495602_0181880 Ga0495602_0181880_191_1162 317
164 3300048907 Ga0496104_0098182 Ga0496104_0098182_1825_2793 317
165 3300048929 Ga0496126_0049500 Ga0496126_0049500_1835_2815 317
166 3300053158 Ga0500627_0001588 Ga0500627_0001588_985_1980 317
167 iso_pu_bacteria 2852680915 2852681830 317
168 iso_pu_bacteria 2881412998 2881413877 317
169 3300005367 Ga0070667_100074723 Ga0070667_1000747232 318
170 3300025909 Ga0207705_10185540 Ga0207705_101855401 318
171 3300053140 Ga0500573_0010374 Ga0500573_0010374_2000_2977 318
172 3300031238 Ga0265332_10040108 Ga0265332_100401082 319
173 3300031249 Ga0265339_10024868 Ga0265339_100248682 319
174 3300031344 Ga0265316_10002370 Ga0265316_1000237011 319
175 3300031711 Ga0265314_10000001 Ga0265314_10000001866 319
176 3300049570 Ga0501033_0268882 Ga0501033_0268882_19_1005 319
177 iso_pu_bacteria 2511231119 2511701705 319
178 iso_pu_bacteria 2545555800 2545557556 319
179 iso_pu_bacteria 2576861599 2578931943 319
180 iso_pu_bacteria 2648501850 2651531314 319
181 iso_pu_bacteria 2671180844 2674421339 319
182 iso_pu_bacteria 2695420354 2695629672 319
183 iso_pu_bacteria 2716884898 2717914633 319
184 iso_pu_bacteria 2831426010 2831433613 319
185 iso_pu_bacteria 2848694841 2848702406 319
186 iso_pu_bacteria 2877768649 2877772605 319
187 iso_pu_bacteria 2880169592 2880173451 319
188 iso_pu_bacteria 2897109615 2897113733 319
189 iso_pu_bacteria 2904560550 2904563330 319
190 iso_pu_bacteria 2921250672 2921256092 319
191 iso_pu_bacteria 2969141011 2969145180 319
192 iso_pu_bacteria 2971893375 2971897307 319
193 iso_pu_bacteria 2996706504 2996710563 319
194 iso_pu_bacteria 8022630665 8022632822 319
195 iso_pu_bacteria 8051952484 8051953782 319
196 iso_pu_bacteria 8052174270 8052178018 319
197 3300005295 Ga0065707_10096761 Ga0065707_100967612 320
198 3300005337 Ga0070682_100299748 Ga0070682_1002997481 320
199 3300005338 Ga0068868_100224085 Ga0068868_1002240852 320
200 3300005437 Ga0070710_10106441 Ga0070710_101064412 320
201 3300005439 Ga0070711_100074501 Ga0070711_1000745012 320
202 3300005440 Ga0070705_100085042 Ga0070705_1000850422 320
203 3300005471 Ga0070698_100027381 Ga0070698_1000273816 320
204 3300005536 Ga0070697_100151406 Ga0070697_1001514061 320
205 3300005544 Ga0070686_100075235 Ga0070686_1000752352 320
206 3300005544 Ga0070686_100303990 Ga0070686_1003039901 320
207 3300005549 Ga0070704_100436208 Ga0070704_1004362081 320
208 3300005983 Ga0081540_1025305 Ga0081540_10253054 320
209 3300006038 Ga0075365_10005282 Ga0075365_100052825 320
210 3300006175 Ga0070712_100014072 Ga0070712_1000140723 320
211 3300006175 Ga0070712_100034086 Ga0070712_1000340862 320
212 3300006844 Ga0075428_100043590 Ga0075428_1000435902 320
213 3300006847 Ga0075431_100004271 Ga0075431_1000042715 320
214 3300006847 Ga0075431_100407760 Ga0075431_1004077601 320
215 3300006852 Ga0075433_10042903 Ga0075433_100429032 320
216 3300006871 Ga0075434_100013850 Ga0075434_1000138509 320
217 3300006871 Ga0075434_100143455 Ga0075434_1001434552 320
218 3300006871 Ga0075434_100162715 Ga0075434_1001627153 320
219 3300006871 Ga0075434_100214628 Ga0075434_1002146282 320
220 3300006914 Ga0075436_100012017 Ga0075436_1000120176 320
221 3300007076 Ga0075435_100007769 Ga0075435_1000077694 320
222 3300007076 Ga0075435_100011913 Ga0075435_1000119132 320
223 3300009094 Ga0111539_10022378 Ga0111539_100223785 320
224 3300009098 Ga0105245_10025506 Ga0105245_100255063 320
225 3300009147 Ga0114129_10035833 Ga0114129_100358339 320
226 3300009147 Ga0114129_10048471 Ga0114129_100484713 320
227 3300009553 Ga0105249_10069414 Ga0105249_100694143 320
228 3300011119 Ga0105246_10202605 Ga0105246_102026052 320
229 3300013105 Ga0157369_10005309 Ga0157369_1000530919 320
230 3300013307 Ga0157372_10121144 Ga0157372_101211444 320
231 3300013308 Ga0157375_10041011 Ga0157375_100410113 320
232 3300021358 Ga0213873_10000002 Ga0213873_10000002422 320
233 3300021384 Ga0213876_10000001 Ga0213876_10000001505 320
234 3300025898 Ga0207692_10095471 Ga0207692_100954712 320
235 3300025901 Ga0207688_10092746 Ga0207688_100927463 320
236 3300025915 Ga0207693_10004813 Ga0207693_100048134 320
237 3300025915 Ga0207693_10059170 Ga0207693_100591703 320
238 3300025915 Ga0207693_10072293 Ga0207693_100722933 320
239 3300025939 Ga0207665_10191315 Ga0207665_101913152 320
240 3300025945 Ga0207679_10009581 Ga0207679_100095813 320
241 3300026075 Ga0207708_10096368 Ga0207708_100963683 320
242 3300026121 Ga0207683_10026048 Ga0207683_100260483 320
243 3300028800 Ga0265338_10070724 Ga0265338_100707242 320
244 3300031242 Ga0265329_10012429 Ga0265329_100124293 320
245 3300031251 Ga0265327_10027392 Ga0265327_100273923 320
246 3300031344 Ga0265316_10061012 Ga0265316_100610123 320
247 3300031711 Ga0265314_10003041 Ga0265314_100030417 320
248 3300031712 Ga0265342_10026697 Ga0265342_100266973 320
249 3300032004 Ga0307414_10000024 Ga0307414_10000024119 320
250 3300032004 Ga0307414_10019066 Ga0307414_100190662 320
251 3300032004 Ga0307414_10191158 Ga0307414_101911582 320
252 3300035170 Ga0373943_0001085 Ga0373943_0001085_1654_2643 320
253 3300035171 Ga0373946_0006506 Ga0373946_0006506_2079_3068 320
254 3300035691 Ga0373931_0196782 Ga0373931_0196782_154_1140 320
255 3300035692 Ga0373935_0037596 Ga0373935_0037596_293_1282 320
256 3300035725 Ga0373947_0003233 Ga0373947_0003233_2644_3633 320
257 3300037466 Ga0395898_0012790 Ga0395898_0012790_1283_2272 320
258 3300037466 Ga0395898_0033533 Ga0395898_0033533_1547_2536 320
259 3300037471 Ga0395905_0056934 Ga0395905_0056934_2407_3396 320
260 3300037853 Ga0436364_1341086 Ga0436364_1341086_15511_16500 320
261 3300038443 Ga0395901_0015898 Ga0395901_0015898_3721_4710 320
262 3300038443 Ga0395901_0060228 Ga0395901_0060228_329_1318 320
263 3300039437 Ga0436365_0447799 Ga0436365_0447799_22087_23064 320
264 3300039437 Ga0436365_1154184 Ga0436365_1154184_1021_2046 320
265 3300039453 Ga0436362_0660519 Ga0436362_0660519_504582_505559 320
266 3300044683 Ga0466965_0190516 Ga0466965_0190516_68_1057 320
267 3300044684 Ga0466966_0044790 Ga0466966_0044790_880_1869 320
268 3300044693 Ga0466961_0017907 Ga0466961_0017907_3119_4108 320
269 3300044694 Ga0466963_0015612 Ga0466963_0015612_2317_3306 320
270 3300044712 Ga0453684_0024229 Ga0453684_0024229_2172_3302 320
271 3300044719 Ga0466971_0012399 Ga0466971_0012399_766_1758 320
272 3300044842 Ga0466957_0006783 Ga0466957_0006783_911_1903 320
273 3300045049 Ga0466959_0000870 Ga0466959_0000870_2752_3741 320
274 3300045836 Ga0466958_0007414 Ga0466958_0007414_2529_3518 320
275 3300045836 Ga0466958_0041095 Ga0466958_0041095_38_1030 320
276 3300046455 Ga0495603_0109838 Ga0495603_0109838_597_1586 320
277 3300046459 Ga0495629_0000259 Ga0495629_0000259_39137_40126 320
278 3300046461 Ga0495641_0000362 Ga0495641_0000362_19873_20862 320
279 3300046463 Ga0495653_0017476 Ga0495653_0017476_1707_2696 320
280 3300046473 Ga0495582_0001127 Ga0495582_0001127_5503_6492 320
281 3300046475 Ga0495639_0010305 Ga0495639_0010305_420_1409 320
282 3300046476 Ga0495662_0000661 Ga0495662_0000661_9258_10247 320
283 3300046517 Ga0495630_0015000 Ga0495630_0015000_1526_2515 320
284 3300046531 Ga0495665_0006418 Ga0495665_0006418_479_1468 320
285 3300046533 Ga0495640_0013393 Ga0495640_0013393_3033_4022 320
286 3300046642 Ga0495634_0023543 Ga0495634_0023543_1046_2035 320
287 3300046681 Ga0495647_0031329 Ga0495647_0031329_867_1856 320
288 3300046683 Ga0495658_0000467 Ga0495658_0000467_3016_4005 320
289 3300046689 Ga0495613_0019003 Ga0495613_0019003_494_1483 320
290 3300046690 Ga0495624_0001840 Ga0495624_0001840_12396_13385 320
291 3300046809 Ga0495600_0026369 Ga0495600_0026369_2160_3149 320
292 3300047315 Ga0495581_0000327 Ga0495581_0000327_11291_12280 320
293 3300047319 Ga0495674_0033545 Ga0495674_0033545_1940_2929 320
294 3300047321 Ga0495676_0000925 Ga0495676_0000925_19336_20325 320
295 3300047322 Ga0495680_0016990 Ga0495680_0016990_4748_5737 320
296 3300047471 Ga0495684_0005134 Ga0495684_0005134_8803_9792 320
297 3300048904 Ga0496101_0115790 Ga0496101_0115790_481_1470 320
298 3300048910 Ga0496107_0081256 Ga0496107_0081256_499_1488 320
299 3300048910 Ga0496107_0286584 Ga0496107_0286584_200_1189 320
300 3300048914 Ga0496111_0220729 Ga0496111_0220729_116_1105 320
301 3300048916 Ga0496113_0067195 Ga0496113_0067195_1081_2070 320
302 3300048918 Ga0496115_0000070 Ga0496115_0000070_68757_69791 320
303 3300048918 Ga0496115_0000243 Ga0496115_0000243_26229_27218 320
304 3300048929 Ga0496126_0011226 Ga0496126_0011226_7104_8099 320
305 3300049568 Ga0501031_0143052 Ga0501031_0143052_22_1011 320
306 3300049569 Ga0501032_0053973 Ga0501032_0053973_1582_2571 320
307 3300049571 Ga0501034_0196361 Ga0501034_0196361_47_1036 320
308 3300049572 Ga0501036_0031698 Ga0501036_0031698_1075_2064 320
309 3300049572 Ga0501036_0363866 Ga0501036_0363866_21_1010 320
310 3300049573 Ga0501037_0064110 Ga0501037_0064110_21_1010 320
311 3300049574 Ga0501038_0041072 Ga0501038_0041072_345_1334 320
312 3300049574 Ga0501038_0062820 Ga0501038_0062820_1617_2606 320
313 3300049575 Ga0501039_0002789 Ga0501039_0002789_1283_2272 320
314 3300049576 Ga0501040_0006712 Ga0501040_0006712_2765_3754 320
315 3300049577 Ga0501041_0011135 Ga0501041_0011135_3496_4485 320
316 3300049577 Ga0501041_0214490 Ga0501041_0214490_21_1010 320
317 3300049578 Ga0501042_0012665 Ga0501042_0012665_3745_4734 320
318 3300049579 Ga0501043_0050455 Ga0501043_0050455_1997_2986 320
319 3300049579 Ga0501043_0094318 Ga0501043_0094318_384_1373 320
320 3300049580 Ga0501046_0035586 Ga0501046_0035586_1255_2244 320
321 3300049580 Ga0501046_0036135 Ga0501046_0036135_2968_3957 320
322 3300049581 Ga0501047_0042493 Ga0501047_0042493_2450_3439 320
323 3300049582 Ga0501048_0032327 Ga0501048_0032327_1862_2851 320
324 3300049582 Ga0501048_0063856 Ga0501048_0063856_1476_2465 320
325 3300049582 Ga0501048_0127225 Ga0501048_0127225_213_1202 320
326 3300049585 Ga0501069_0004899 Ga0501069_0004899_3716_4705 320
327 3300049586 Ga0501070_0030012 Ga0501070_0030012_2967_3956 320
328 3300049587 Ga0501071_0013315 Ga0501071_0013315_253_1242 320
329 3300049587 Ga0501071_0021983 Ga0501071_0021983_2525_3514 320
330 3300049588 Ga0501072_0002443 Ga0501072_0002443_4801_5790 320
331 3300049588 Ga0501072_0030540 Ga0501072_0030540_1024_2013 320
332 3300049588 Ga0501072_0340976 Ga0501072_0340976_84_1073 320
333 3300049589 Ga0501073_0043028 Ga0501073_0043028_499_1488 320
334 3300049590 Ga0501074_0012020 Ga0501074_0012020_3838_4827 320
335 3300049591 Ga0501075_0009989 Ga0501075_0009989_5013_6002 320
336 3300049591 Ga0501075_0097481 Ga0501075_0097481_235_1224 320
337 3300049592 Ga0501076_0014187 Ga0501076_0014187_2477_3466 320
338 3300049592 Ga0501076_0392905 Ga0501076_0392905_26_1015 320
339 3300049593 Ga0501077_0011737 Ga0501077_0011737_1299_2288 320
340 3300049741 Ga0501079_0009383 Ga0501079_0009383_15_1004 320
341 3300049741 Ga0501079_0013898 Ga0501079_0013898_2092_3081 320
342 3300049741 Ga0501079_0112969 Ga0501079_0112969_15_1037 320
343 3300049742 Ga0501080_0061803 Ga0501080_0061803_2478_3467 320
344 3300049743 Ga0501081_0020721 Ga0501081_0020721_797_1786 320
345 3300049823 Ga0501044_0239686 Ga0501044_0239686_273_1262 320
346 3300049824 Ga0501045_0022632 Ga0501045_0022632_1115_2104 320
347 3300050507 nmdc:mga05p37_234445_c1 nmdc:mga05p37_234445_c1_778_1767 320
348 3300050507 nmdc:mga05p37_739220_c1 nmdc:mga05p37_739220_c1_44_1033 320
349 3300050510 nmdc:mga06r32_3111_c1 nmdc:mga06r32_3111_c1_9700_10689 320
350 3300050511 nmdc:mga08y16_39925_c1 nmdc:mga08y16_39925_c1_1135_2127 320
351 3300050512 nmdc:mga0n895_129709_c1 nmdc:mga0n895_129709_c1_548_1537 320
352 3300050512 nmdc:mga0n895_182738_c1 nmdc:mga0n895_182738_c1_294_1286 320
353 3300050513 nmdc:mga0rr50_191496_c1 nmdc:mga0rr50_191496_c1_426_1415 320
354 3300050514 nmdc:mga08x19_107874_c1 nmdc:mga08x19_107874_c1_93_1088 320
355 3300050514 nmdc:mga08x19_135455_c1 nmdc:mga08x19_135455_c1_418_1410 320
356 3300053085 Ga0495619_0237917 Ga0495619_0237917_133_1122 320
357 3300054114 Ga0501084_0013470 Ga0501084_0013470_3838_4827 320
358 3300060353 Ga0501082_0005870 Ga0501082_0005870_3665_4654 320
359 3300060353 Ga0501082_0021882 Ga0501082_0021882_3606_4595 320
360 3300060353 Ga0501082_0121870 Ga0501082_0121870_1074_2063 320
361 3300061734 Ga0530510_0059211 Ga0530510_0059211_1438_2427 320
362 3300061734 Ga0530510_0125865 Ga0530510_0125865_738_1727 320
363 iso_pu_bacteria 2728369359 2730139888 320
364 iso_pu_bacteria 2808606384 2808972334 320
365 iso_pu_bacteria 2808606390 2809007163 320
366 iso_pu_bacteria 2808606391 2809014301 320
367 iso_pu_bacteria 2821111986 2821113081 320
368 iso_pu_bacteria 2885526491 2885529521 320
369 iso_pu_bacteria 2889276214 2889280157 320
370 3300003781 Ga0055536_1000301 Ga0055536_100030113 321
371 3300003781 Ga0055536_1016823 Ga0055536_10168232 321
372 3300005333 Ga0070677_10000001 Ga0070677_10000001114 321
373 3300005439 Ga0070711_100329020 Ga0070711_1003290201 321
374 3300009553 Ga0105249_10000074 Ga0105249_1000007422 321
375 3300025304 Ga0209257_1004775 Ga0209257_100477510 321
376 3300025961 Ga0207712_10000007 Ga0207712_1000000724 321
377 3300027907 Ga0207428_10000044 Ga0207428_1000004428 321
378 3300031235 Ga0265330_10000497 Ga0265330_1000049711 321
379 3300031344 Ga0265316_10002313 Ga0265316_1000231312 321
380 3300031911 Ga0307412_10014348 Ga0307412_100143483 321
381 3300044694 Ga0466963_0000019 Ga0466963_0000019_13466_14446 321
382 3300046472 Ga0495580_0131972 Ga0495580_0131972_422_1438 321
383 3300046522 Ga0495643_0002120 Ga0495643_0002120_13675_14658 321
384 3300047321 Ga0495676_0002537 Ga0495676_0002537_8168_9178 321
385 3300048905 Ga0496102_0000376 Ga0496102_0000376_51208_52338 321
386 3300048906 Ga0496103_0000293 Ga0496103_0000293_1157_2287 321
387 3300048911 Ga0496108_0000001 Ga0496108_0000001_299129_300109 321
388 3300048912 Ga0496109_0000006 Ga0496109_0000006_299129_300109 321
389 3300048919 Ga0496116_0001007 Ga0496116_0001007_3731_4861 321
390 3300048920 Ga0496117_0000695 Ga0496117_0000695_51237_52367 321
391 3300048921 Ga0496118_0014898 Ga0496118_0014898_1179_2309 321
392 3300048922 Ga0496119_0020700 Ga0496119_0020700_2489_3619 321
393 3300048927 Ga0496124_0000735 Ga0496124_0000735_1179_2309 321
394 3300049569 Ga0501032_0059812 Ga0501032_0059812_1379_2374 321
395 3300049570 Ga0501033_0013182 Ga0501033_0013182_4223_5218 321
396 3300049575 Ga0501039_0019384 Ga0501039_0019384_1085_2080 321
397 3300049581 Ga0501047_0153723 Ga0501047_0153723_1085_2080 321
398 3300049582 Ga0501048_0281806 Ga0501048_0281806_49_1044 321
399 3300049822 Ga0501035_0080513 Ga0501035_0080513_519_1514 321
400 3300049823 Ga0501044_0027955 Ga0501044_0027955_2368_3363 321
401 3300049823 Ga0501044_0121041 Ga0501044_0121041_983_1978 321
402 3300053139 Ga0500568_0015288 Ga0500568_0015288_1463_2458 321
403 iso_pu_bacteria 2721755693 2723604177 321
404 iso_pu_bacteria 2904162308 2904164799 321
405 3300001990 JGI24737J22298_10005388 JGI24737J22298_100053884 322
406 3300005328 Ga0070676_10040769 Ga0070676_100407691 322
407 3300005328 Ga0070676_10103436 Ga0070676_101034361 322
408 3300005366 Ga0070659_100064137 Ga0070659_1000641374 322
409 3300005468 Ga0070707_100024799 Ga0070707_1000247992 322
410 3300005563 Ga0068855_100055255 Ga0068855_1000552551 322
411 3300005937 Ga0081455_10020686 Ga0081455_100206864 322
412 3300006847 Ga0075431_100000239 Ga0075431_10000023920 322
413 3300009036 Ga0105244_10058935 Ga0105244_100589352 322
414 3300009174 Ga0105241_10085593 Ga0105241_100855934 322
415 3300009174 Ga0105241_10496495 Ga0105241_104964951 322
416 3300010375 Ga0105239_10040629 Ga0105239_100406292 322
417 3300013296 Ga0157374_10396699 Ga0157374_103966991 322
418 3300025298 Ga0209050_1000093 Ga0209050_1000093184 322
419 3300025907 Ga0207645_10088850 Ga0207645_100888502 322
420 3300025911 Ga0207654_10024547 Ga0207654_100245475 322
421 3300025919 Ga0207657_10008390 Ga0207657_100083908 322
422 3300025933 Ga0207706_10094327 Ga0207706_100943272 322
423 3300025934 Ga0207686_10034213 Ga0207686_100342132 322
424 3300025935 Ga0207709_10055772 Ga0207709_100557723 322
425 3300025939 Ga0207665_10088635 Ga0207665_100886352 322
426 3300025949 Ga0207667_10014901 Ga0207667_100149013 322
427 3300025972 Ga0207668_10235369 Ga0207668_102353692 322
428 3300028800 Ga0265338_10016932 Ga0265338_100169329 322
429 3300031665 Ga0316575_10009325 Ga0316575_100093252 322
430 3300031691 Ga0316579_10032351 Ga0316579_100323512 322
431 3300037312 Ga0395899_0007423 Ga0395899_0007423_3764_4855 322
432 3300037312 Ga0395899_0037220 Ga0395899_0037220_2481_3470 322
433 3300037312 Ga0395899_0071794 Ga0395899_0071794_1366_2355 322
434 3300037312 Ga0395899_0078820 Ga0395899_0078820_801_1790 322
435 3300037418 Ga0395900_0002198 Ga0395900_0002198_7913_8902 322
436 3300037418 Ga0395900_0006564 Ga0395900_0006564_160_1149 322
437 3300037418 Ga0395900_0010142 Ga0395900_0010142_5198_6187 322
438 3300037418 Ga0395900_0114500 Ga0395900_0114500_1556_2545 322
439 3300037466 Ga0395898_0009879 Ga0395898_0009879_7895_8884 322
440 3300037466 Ga0395898_0016549 Ga0395898_0016549_4713_5702 322
441 3300037471 Ga0395905_0153168 Ga0395905_0153168_741_1730 322
442 3300038443 Ga0395901_0000089 Ga0395901_0000089_50708_51799 322
443 3300038443 Ga0395901_0027387 Ga0395901_0027387_314_1303 322
444 3300038443 Ga0395901_0140620 Ga0395901_0140620_212_1303 322
445 3300038443 Ga0395901_0354303 Ga0395901_0354303_496_1497 322
446 3300038443 Ga0395901_0386637 Ga0395901_0386637_350_1339 322
447 3300039437 Ga0436365_0243957 Ga0436365_0243957_725_1738 322
448 3300042005 Ga0439448_0028863 Ga0439448_0028863_523_1512 322
449 3300042157 Ga0439458_0008978 Ga0439458_0008978_738_1727 322
450 3300042157 Ga0439458_0013455 Ga0439458_0013455_311_1402 322
451 3300044684 Ga0466966_0125074 Ga0466966_0125074_489_1478 322
452 3300044706 Ga0466964_0001574 Ga0466964_0001574_4322_5413 322
453 3300044842 Ga0466957_0000053 Ga0466957_0000053_25316_26305 322
454 3300044842 Ga0466957_0108639 Ga0466957_0108639_122_1111 322
455 3300045836 Ga0466958_0055271 Ga0466958_0055271_681_1670 322
456 3300045976 Ga0466967_0004114 Ga0466967_0004114_2012_3007 322
457 3300045976 Ga0466967_0008826 Ga0466967_0008826_4469_5560 322
458 3300046474 Ga0495605_0005663 Ga0495605_0005663_5759_6847 322
459 3300046501 Ga0495607_0000400 Ga0495607_0000400_3693_4781 322
460 3300046513 Ga0495616_0002532 Ga0495616_0002532_2271_3359 322
461 3300046522 Ga0495643_0028882 Ga0495643_0028882_1103_2191 322
462 3300046538 Ga0495609_0000001 Ga0495609_0000001_288883_289971 322
463 3300046615 Ga0495656_0011809 Ga0495656_0011809_57_1145 322
464 3300046616 Ga0495668_0032029 Ga0495668_0032029_430_1416 322
465 3300046665 Ga0495661_0000023 Ga0495661_0000023_11002_12090 322
466 3300046794 Ga0495589_0000027 Ga0495589_0000027_46154_47242 322
467 3300047319 Ga0495674_0027735 Ga0495674_0027735_1880_2866 322
468 3300047443 Ga0495687_000019 Ga0495687_000019_288883_289971 322
469 3300047445 Ga0495677_0000055 Ga0495677_0000055_51775_52863 322
470 3300048091 Ga0495626_0000417 Ga0495626_0000417_31046_32134 322
471 3300048908 Ga0496105_0303759 Ga0496105_0303759_136_1125 322
472 3300048925 Ga0496122_0005591 Ga0496122_0005591_8779_9762 322
473 3300048927 Ga0496124_0018078 Ga0496124_0018078_617_1708 322
474 iso_pu_bacteria 2848297114 2848300223 322
475 3300003762 Ga0055542_1001795 Ga0055542_10017958 323
476 3300005327 Ga0070658_10047333 Ga0070658_100473332 323
477 3300005330 Ga0070690_100089660 Ga0070690_1000896602 323
478 3300005331 Ga0070670_100030601 Ga0070670_1000306013 323
479 3300005335 Ga0070666_10005910 Ga0070666_100059102 323
480 3300005338 Ga0068868_100100153 Ga0068868_1001001534 323
481 3300005339 Ga0070660_100009652 Ga0070660_1000096527 323
482 3300005354 Ga0070675_100126231 Ga0070675_1001262312 323
483 3300005456 Ga0070678_100001647 Ga0070678_10000164710 323
484 3300005458 Ga0070681_10146375 Ga0070681_101463752 323
485 3300005458 Ga0070681_10202976 Ga0070681_102029762 323
486 3300005530 Ga0070679_100130070 Ga0070679_1001300703 323
487 3300005563 Ga0068855_100127745 Ga0068855_1001277453 323
488 3300005563 Ga0068855_100242648 Ga0068855_1002426483 323
489 3300005564 Ga0070664_100200715 Ga0070664_1002007151 323
490 3300005577 Ga0068857_100025731 Ga0068857_1000257313 323
491 3300005614 Ga0068856_100103141 Ga0068856_1001031414 323
492 3300005616 Ga0068852_100144141 Ga0068852_1001441412 323
493 3300005617 Ga0068859_100106799 Ga0068859_1001067994 323
494 3300005618 Ga0068864_100169005 Ga0068864_1001690052 323
495 3300005842 Ga0068858_100037956 Ga0068858_1000379562 323
496 3300006237 Ga0097621_100040681 Ga0097621_1000406814 323
497 3300006237 Ga0097621_100056162 Ga0097621_1000561622 323
498 3300006358 Ga0068871_100004133 Ga0068871_10000413311 323
499 3300006358 Ga0068871_100061939 Ga0068871_1000619393 323
500 3300006881 Ga0068865_100066129 Ga0068865_1000661294 323
501 3300006931 Ga0097620_100106798 Ga0097620_1001067983 323
502 3300006931 Ga0097620_100128418 Ga0097620_1001284183 323
503 3300009093 Ga0105240_10000779 Ga0105240_100007794 323
504 3300009093 Ga0105240_10297267 Ga0105240_102972672 323
505 3300009098 Ga0105245_10031829 Ga0105245_100318296 323
506 3300009098 Ga0105245_10108052 Ga0105245_101080522 323
507 3300009098 Ga0105245_10120239 Ga0105245_101202393 323
508 3300009176 Ga0105242_10033980 Ga0105242_100339803 323
509 3300009176 Ga0105242_10078677 Ga0105242_100786772 323
510 3300009176 Ga0105242_10449645 Ga0105242_104496451 323
511 3300009177 Ga0105248_10018035 Ga0105248_100180357 323
512 3300009545 Ga0105237_10035885 Ga0105237_100358852 323
513 3300009551 Ga0105238_10032776 Ga0105238_100327762 323
514 3300010375 Ga0105239_10065083 Ga0105239_100650833 323
515 3300010375 Ga0105239_10147102 Ga0105239_101471023 323
516 3300011119 Ga0105246_10171245 Ga0105246_101712452 323
517 3300013104 Ga0157370_10017710 Ga0157370_100177103 323
518 3300013105 Ga0157369_10133926 Ga0157369_101339263 323
519 3300013105 Ga0157369_10167800 Ga0157369_101678001 323
520 3300013296 Ga0157374_10037930 Ga0157374_100379305 323
521 3300013297 Ga0157378_10138402 Ga0157378_101384023 323
522 3300013306 Ga0163162_10060031 Ga0163162_100600315 323
523 3300013306 Ga0163162_10071493 Ga0163162_100714933 323
524 3300013307 Ga0157372_10063926 Ga0157372_100639262 323
525 3300013308 Ga0157375_10102645 Ga0157375_101026453 323
526 3300013308 Ga0157375_10138616 Ga0157375_101386163 323
527 3300014325 Ga0163163_10012585 Ga0163163_100125858 323
528 3300014325 Ga0163163_10049839 Ga0163163_100498395 323
529 3300014325 Ga0163163_10233626 Ga0163163_102336262 323
530 3300014968 Ga0157379_10119673 Ga0157379_101196733 323
531 3300014969 Ga0157376_10388691 Ga0157376_103886912 323
532 3300025254 Ga0209148_1000146 Ga0209148_100014627 323
533 3300025885 Ga0207653_10039119 Ga0207653_100391191 323
534 3300025903 Ga0207680_10039239 Ga0207680_100392392 323
535 3300025909 Ga0207705_10044109 Ga0207705_100441092 323
536 3300025911 Ga0207654_10059788 Ga0207654_100597884 323
537 3300025912 Ga0207707_10030855 Ga0207707_100308553 323
538 3300025912 Ga0207707_10271427 Ga0207707_102714272 323
539 3300025913 Ga0207695_10018336 Ga0207695_100183363 323
540 3300025913 Ga0207695_10154906 Ga0207695_101549063 323
541 3300025919 Ga0207657_10015485 Ga0207657_100154858 323
542 3300025921 Ga0207652_10227369 Ga0207652_102273692 323
543 3300025924 Ga0207694_10005191 Ga0207694_100051914 323
544 3300025927 Ga0207687_10025307 Ga0207687_100253073 323
545 3300025927 Ga0207687_10028506 Ga0207687_100285066 323
546 3300025927 Ga0207687_10142627 Ga0207687_101426272 323
547 3300025934 Ga0207686_10043497 Ga0207686_100434973 323
548 3300025934 Ga0207686_10209194 Ga0207686_102091942 323
549 3300025940 Ga0207691_10071568 Ga0207691_100715683 323
550 3300025941 Ga0207711_10016461 Ga0207711_100164616 323
551 3300025945 Ga0207679_10078307 Ga0207679_100783072 323
552 3300025949 Ga0207667_10028927 Ga0207667_100289273 323
553 3300025949 Ga0207667_10261652 Ga0207667_102616522 323
554 3300025986 Ga0207658_10081068 Ga0207658_100810682 323
555 3300026023 Ga0207677_10003509 Ga0207677_1000350910 323
556 3300026035 Ga0207703_10008898 Ga0207703_100088982 323
557 3300026089 Ga0207648_10035805 Ga0207648_100358052 323
558 3300026095 Ga0207676_10047138 Ga0207676_100471385 323
559 3300026116 Ga0207674_10021605 Ga0207674_100216052 323
560 3300026116 Ga0207674_10069771 Ga0207674_100697713 323
561 3300028379 Ga0268266_10057684 Ga0268266_100576843 323
562 3300028563 Ga0265319_1001296 Ga0265319_100129616 323
563 3300031240 Ga0265320_10015580 Ga0265320_100155803 323
564 3300031251 Ga0265327_10003259 Ga0265327_1000325912 323
565 3300031711 Ga0265314_10002144 Ga0265314_1000214410 323
566 3300031711 Ga0265314_10018535 Ga0265314_100185352 323
567 3300046460 Ga0495638_0000187 Ga0495638_0000187_34318_35307 323
568 3300046660 Ga0495625_0001610 Ga0495625_0001610_1848_2834 323
569 3300046694 Ga0495649_0008508 Ga0495649_0008508_412_1401 323
570 3300047472 Ga0495686_0000159 Ga0495686_0000159_30384_31376 323
571 3300047472 Ga0495686_0011299 Ga0495686_0011299_3459_4448 323
572 3300049822 Ga0501035_0157232 Ga0501035_0157232_75_1061 323
573 3300053134 Ga0500658_0048722 Ga0500658_0048722_675_1664 323
574 3300053153 Ga0500616_0015346 Ga0500616_0015346_385_1443 323
575 3300001989 JGI24739J22299_10000155 JGI24739J22299_1000015516 324
576 3300001990 JGI24737J22298_10000087 JGI24737J22298_1000008723 324
577 3300002067 JGI24735J21928_10000192 JGI24735J21928_1000019213 324
578 3300002075 JGI24738J21930_10001254 JGI24738J21930_100012542 324
579 3300005439 Ga0070711_100070249 Ga0070711_1000702491 324
580 3300005439 Ga0070711_100243992 Ga0070711_1002439922 324
581 3300005445 Ga0070708_100012539 Ga0070708_1000125396 324
582 3300005445 Ga0070708_100014454 Ga0070708_1000144542 324
583 3300005445 Ga0070708_100063643 Ga0070708_1000636432 324
584 3300005457 Ga0070662_100008544 Ga0070662_1000085443 324
585 3300005458 Ga0070681_10021716 Ga0070681_100217162 324
586 3300005468 Ga0070707_100026575 Ga0070707_1000265753 324
587 3300005468 Ga0070707_100032329 Ga0070707_1000323292 324
588 3300005471 Ga0070698_100019533 Ga0070698_1000195332 324
589 3300005471 Ga0070698_100037911 Ga0070698_1000379113 324
590 3300005471 Ga0070698_100081236 Ga0070698_1000812362 324
591 3300005518 Ga0070699_100002783 Ga0070699_1000027833 324
592 3300005536 Ga0070697_100175967 Ga0070697_1001759671 324
593 3300006028 Ga0070717_10004583 Ga0070717_100045837 324
594 3300006163 Ga0070715_10155786 Ga0070715_101557861 324
595 3300006173 Ga0070716_100001520 Ga0070716_1000015207 324
596 3300006173 Ga0070716_100005798 Ga0070716_1000057986 324
597 3300006871 Ga0075434_100181432 Ga0075434_1001814322 324
598 3300006914 Ga0075436_100066930 Ga0075436_1000669303 324
599 3300007265 Ga0099794_10033959 Ga0099794_100339592 324
600 3300021377 Ga0213874_10010712 Ga0213874_100107124 324
601 3300021441 Ga0213871_10031656 Ga0213871_100316561 324
602 3300025904 Ga0207647_10000604 Ga0207647_100006047 324
603 3300025905 Ga0207685_10097221 Ga0207685_100972211 324
604 3300025910 Ga0207684_10025533 Ga0207684_100255334 324
605 3300025916 Ga0207663_10029782 Ga0207663_100297822 324
606 3300025922 Ga0207646_10051556 Ga0207646_100515563 324
607 3300025922 Ga0207646_10178785 Ga0207646_101787852 324
608 3300025922 Ga0207646_10383139 Ga0207646_103831391 324
609 3300025933 Ga0207706_10001626 Ga0207706_100016265 324
610 3300025939 Ga0207665_10000024 Ga0207665_100000243 324
611 3300025939 Ga0207665_10318408 Ga0207665_103184082 324
612 3300026142 Ga0207698_10025155 Ga0207698_100251552 324
613 3300026142 Ga0207698_10077620 Ga0207698_100776202 324
614 3300027671 Ga0209588_1001362 Ga0209588_10013622 324
615 3300027671 Ga0209588_1016141 Ga0209588_10161412 324
616 3300027671 Ga0209588_1020632 Ga0209588_10206322 324
617 3300037471 Ga0395905_0213405 Ga0395905_0213405_36_1067 324
618 3300037853 Ga0436364_0643307 Ga0436364_0643307_468_1478 324
619 3300037853 Ga0436364_0892362 Ga0436364_0892362_847_1875 324
620 3300039438 Ga0436360_0245961 Ga0436360_0245961_35_1039 324
621 3300044684 Ga0466966_0004926 Ga0466966_0004926_5477_6481 324
622 3300044712 Ga0453684_0027086 Ga0453684_0027086_5951_6934 324
623 3300048920 Ga0496117_0073746 Ga0496117_0073746_1270_2259 324
624 3300048921 Ga0496118_0024957 Ga0496118_0024957_514_1503 324
625 3300048923 Ga0496120_0007039 Ga0496120_0007039_4486_5475 324
626 3300048924 Ga0496121_0003572 Ga0496121_0003572_10959_11948 324
627 3300048924 Ga0496121_0084550 Ga0496121_0084550_239_1228 324
628 3300048925 Ga0496122_0086143 Ga0496122_0086143_1082_2071 324
629 3300048925 Ga0496122_0087405 Ga0496122_0087405_117_1106 324
630 3300048928 Ga0496125_0003511 Ga0496125_0003511_3720_4709 324
631 3300048929 Ga0496126_0005341 Ga0496126_0005341_6653_7642 324
632 3300050513 nmdc:mga0rr50_79322_c1 nmdc:mga0rr50_79322_c1_1417_2409 324
633 3300050514 nmdc:mga08x19_57670_c1 nmdc:mga08x19_57670_c1_480_1472 324
634 3300005356 Ga0070674_100246201 Ga0070674_1002462011 325
635 3300005365 Ga0070688_100005952 Ga0070688_1000059523 325
636 3300005434 Ga0070709_10018076 Ga0070709_100180763 325
637 3300005435 Ga0070714_100107549 Ga0070714_1001075492 325
638 3300005440 Ga0070705_100179691 Ga0070705_1001796912 325
639 3300005548 Ga0070665_100001237 Ga0070665_1000012374 325
640 3300005577 Ga0068857_100434249 Ga0068857_1004342492 325
641 3300005617 Ga0068859_100245892 Ga0068859_1002458922 325
642 3300005841 Ga0068863_100012703 Ga0068863_1000127034 325
643 3300005842 Ga0068858_100064239 Ga0068858_1000642393 325
644 3300005842 Ga0068858_100203928 Ga0068858_1002039282 325
645 3300006175 Ga0070712_100053422 Ga0070712_1000534222 325
646 3300006237 Ga0097621_100002270 Ga0097621_1000022702 325
647 3300006358 Ga0068871_100029721 Ga0068871_1000297213 325
648 3300006871 Ga0075434_100101644 Ga0075434_1001016442 325
649 3300006914 Ga0075436_100182085 Ga0075436_1001820851 325
650 3300006931 Ga0097620_100245904 Ga0097620_1002459042 325
651 3300009174 Ga0105241_10000033 Ga0105241_1000003320 325
652 3300009176 Ga0105242_10019574 Ga0105242_100195744 325
653 3300009177 Ga0105248_10206465 Ga0105248_102064652 325
654 3300009545 Ga0105237_10024447 Ga0105237_100244473 325
655 3300010375 Ga0105239_10374212 Ga0105239_103742121 325
656 3300013297 Ga0157378_10033649 Ga0157378_100336492 325
657 3300013308 Ga0157375_10619332 Ga0157375_106193321 325
658 3300014968 Ga0157379_10174617 Ga0157379_101746172 325
659 3300014969 Ga0157376_10000008 Ga0157376_10000008139 325
660 3300014969 Ga0157376_10002432 Ga0157376_100024328 325
661 3300021358 Ga0213873_10030802 Ga0213873_100308022 325
662 3300021361 Ga0213872_10000700 Ga0213872_1000070012 325
663 3300021361 Ga0213872_10029132 Ga0213872_100291322 325
664 3300021384 Ga0213876_10001370 Ga0213876_100013702 325
665 3300021388 Ga0213875_10005331 Ga0213875_100053315 325
666 3300025934 Ga0207686_10125546 Ga0207686_101255462 325
667 3300026035 Ga0207703_10118569 Ga0207703_101185692 325
668 3300026078 Ga0207702_10480132 Ga0207702_104801322 325
669 3300026088 Ga0207641_10002979 Ga0207641_1000297912 325
670 3300028379 Ga0268266_10000112 Ga0268266_10000112104 325
671 3300028381 Ga0268264_10391036 Ga0268264_103910362 325
672 3300035114 Ga0373939_0059944 Ga0373939_0059944_187_1176 325
673 3300037853 Ga0436364_0534877 Ga0436364_0534877_364_1359 325
674 3300037853 Ga0436364_1554448 Ga0436364_1554448_1982_2977 325
675 3300039437 Ga0436365_0172644 Ga0436365_0172644_1218_2213 325
676 3300039437 Ga0436365_0364010 Ga0436365_0364010_37966_38964 325
677 3300039438 Ga0436360_0281448 Ga0436360_0281448_365_1363 325
678 3300039447 Ga0436361_0073268 Ga0436361_0073268_4528_5526 325
679 3300039447 Ga0436361_0833078 Ga0436361_0833078_17709_18704 325
680 3300039447 Ga0436361_0897890 Ga0436361_0897890_305_1303 325
681 3300039447 Ga0436361_1013109 Ga0436361_1013109_1103_2101 325
682 3300041451 Ga0451791_0545886 Ga0451791_0545886_244_1236 325
683 3300044712 Ga0453684_0057979 Ga0453684_0057979_2837_3829 325
684 3300044712 Ga0453684_0302925 Ga0453684_0302925_621_1613 325
685 3300046455 Ga0495603_0008347 Ga0495603_0008347_3573_4571 325
686 3300046460 Ga0495638_0033155 Ga0495638_0033155_2283_3278 325
687 3300046461 Ga0495641_0094915 Ga0495641_0094915_288_1286 325
688 3300046472 Ga0495580_0024637 Ga0495580_0024637_2575_3573 325
689 3300046473 Ga0495582_0034734 Ga0495582_0034734_388_1386 325
690 3300046477 Ga0495664_0103854 Ga0495664_0103854_30_1025 325
691 3300046500 Ga0495596_0045928 Ga0495596_0045928_490_1485 325
692 3300046501 Ga0495607_0004295 Ga0495607_0004295_8485_9480 325
693 3300046517 Ga0495630_0223265 Ga0495630_0223265_409_1407 325
694 3300046519 Ga0495632_0018477 Ga0495632_0018477_526_1521 325
695 3300046523 Ga0495644_0019544 Ga0495644_0019544_459_1454 325
696 3300046642 Ga0495634_0081620 Ga0495634_0081620_99_1097 325
697 3300046648 Ga0495611_0008043 Ga0495611_0008043_2020_3015 325
698 3300046681 Ga0495647_0009997 Ga0495647_0009997_1113_2111 325
699 3300046689 Ga0495613_0139559 Ga0495613_0139559_433_1431 325
700 3300046690 Ga0495624_0039187 Ga0495624_0039187_829_1824 325
701 3300046810 Ga0495660_0002222 Ga0495660_0002222_5613_6608 325
702 3300047315 Ga0495581_0021689 Ga0495581_0021689_1549_2547 325
703 3300047315 Ga0495581_0132613 Ga0495581_0132613_323_1318 325
704 3300047318 Ga0495636_0017133 Ga0495636_0017133_1100_2095 325
705 3300047319 Ga0495674_0042277 Ga0495674_0042277_421_1419 325
706 3300047320 Ga0495672_0019772 Ga0495672_0019772_647_1642 325
707 3300047322 Ga0495680_0008081 Ga0495680_0008081_4646_5644 325
708 3300047323 Ga0495683_0011736 Ga0495683_0011736_2273_3268 325
709 3300047445 Ga0495677_0000388 Ga0495677_0000388_7128_8123 325
710 3300047446 Ga0495679_003096 Ga0495679_003096_4768_5763 325
711 3300047470 Ga0495681_0014480 Ga0495681_0014480_1721_2716 325
712 3300047471 Ga0495684_0010148 Ga0495684_0010148_4765_5763 325
713 3300048089 Ga0495614_0059895 Ga0495614_0059895_324_1322 325
714 3300048091 Ga0495626_0015783 Ga0495626_0015783_2337_3332 325
715 3300049664 Ga0501224_007719 Ga0501224_007719_83_1153 325
716 3300050493 nmdc:mga0k408_55665_c2 nmdc:mga0k408_55665_c2_10_1008 325
717 3300050512 nmdc:mga0n895_171744_c1 nmdc:mga0n895_171744_c1_687_1685 325
718 3300050512 nmdc:mga0n895_24134_c1 nmdc:mga0n895_24134_c1_4561_5571 325
719 3300050512 nmdc:mga0n895_30093_c1 nmdc:mga0n895_30093_c1_2508_3506 325
720 3300050513 nmdc:mga0rr50_20898_c1 nmdc:mga0rr50_20898_c1_1737_2753 325
721 3300050514 nmdc:mga08x19_161052_c1 nmdc:mga08x19_161052_c1_430_1428 325
722 3300050515 nmdc:mga0a205_454451_c1 nmdc:mga0a205_454451_c1_80_1078 325
723 3300053085 Ga0495619_0110536 Ga0495619_0110536_12_1010 325
724 3300053116 Ga0500592_015485 Ga0500592_015485_53_1048 325
725 3300039438 Ga0436360_0743755 Ga0436360_0743755_196_1197 326
726 3300039447 Ga0436361_0313172 Ga0436361_0313172_168_1169 326
727 2162886006 SwRhRL3b_contig_699357 SwRhRL3b_0890.00000530 329
728 2162886006 SwRhRL3b_contig_806853 SwRhRL3b_0271.00001060 329
729 2162886007 SwRhRL2b_contig_454664 SwRhRL2b_0472.00000640 329
730 3300003320 rootH2_10031165 rootH2_100311658 329
731 3300005289 Ga0065704_10070425 Ga0065704_1007042521 329
732 3300005295 Ga0065707_10003564 Ga0065707_100035642 329
733 3300005295 Ga0065707_10082025 Ga0065707_1008202521 329
734 3300005331 Ga0070670_100090283 Ga0070670_1000902834 329
735 3300005334 Ga0068869_100129883 Ga0068869_1001298832 329
736 3300005338 Ga0068868_100107131 Ga0068868_1001071312 329
737 3300005340 Ga0070689_100146124 Ga0070689_1001461242 329
738 3300005356 Ga0070674_100389741 Ga0070674_1003897411 329
739 3300005539 Ga0068853_100148597 Ga0068853_1001485972 329
740 3300005543 Ga0070672_100061477 Ga0070672_1000614772 329
741 3300005616 Ga0068852_100103350 Ga0068852_1001033502 329
742 3300006237 Ga0097621_100060596 Ga0097621_1000605962 329
743 3300011119 Ga0105246_10209967 Ga0105246_102099672 329
744 3300013306 Ga0163162_10015187 Ga0163162_100151874 329
745 3300013308 Ga0157375_10086391 Ga0157375_100863912 329
746 3300014969 Ga0157376_10092052 Ga0157376_100920521 329
747 3300025940 Ga0207691_10044156 Ga0207691_100441562 329
748 3300025942 Ga0207689_10026741 Ga0207689_100267414 329
749 3300026142 Ga0207698_10070924 Ga0207698_100709242 329
750 3300050508 nmdc:mga09592_52083_c1 nmdc:mga09592_52083_c1_1307_2302 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

63

356

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9244 1 317
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9222 1 317
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9095 1 317
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9046 1 317
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9 3 305
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9568 1 321 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9487 3 255 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9458 73 327 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9379 4 329 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.934 1 222 3.20.20.100
ID Description Score Start End GO Terms
AF-Q0JE28-F1-model_v4 Os04g0338100 protein 0.99 108 192
AF-A0A7J8U949-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9879 97 207 GO:0004033
GO:0005737
GO:0016020
AF-A0A317LPZ2-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.987 1 329 GO:0004033
GO:0005737
AF-A0A1J5PSL3-F1-model_v4 General stress protein 69 (EC 1.1.1.-) 0.9829 138 329 GO:0004033
GO:0005737
AF-A0A317LPZ2-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9809 1 329 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
94.76 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map