F479038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 750 | 391 | 710 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10033959|Ga0099794_100339592 |
| Length | 378 |
| Sequence | MKKPNGAGHVVRALFHCSEGCALMLVALFVTQSANVSSNVLNPNEEKFMQQRQLGKNGPLVSALGLGCMGMSFAYGPADETESLRVLRRYLELGGNFLDTAEVYGPYTNEELLGRFLRDVPRDSVVIATKFGFRFNPDGTRGLDSSPENVRRACDASLKRLGIETIDLFYQHRVDPKVPIEDTVGAMAELVSAGKVRALGLSEAGPQTLRRAAKVHPIAALQSEYSLWSRDVETNGVLAACRELRITFVPYSPLGRGFLTGAIQKLEDLDASDWRRTNPRFGEKALQANLKLLETVKDLAGKKGSTPAQLALAWVLAQGNDLIPIPGTKRVRYLEENMGALNVKLTASDLKEINARFAQIEVFGERYAPDMMALVNHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 4 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 5 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 6 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 7 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 8 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 9 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 10 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 11 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 12 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 13 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 14 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 15 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 16 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 17 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 18 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 19 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 20 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 21 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 22 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 23 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 24 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 25 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 26 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 27 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 28 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 29 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 30 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 31 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 32 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 33 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 34 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 35 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 36 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 37 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 38 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 39 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 40 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 41 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 42 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 43 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 46 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 57 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 60 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 145 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 208 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 235 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 236 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 237 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 367 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 380 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 388 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 389 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 390 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 391 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.67 |
| Metatranscriptomes | 0 |
| Isolates | 5.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.67 |
| Nodule | 0.4 |
| Rhizoplane | 3.2 |
| Rhizosphere | 86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_699357 | 2162886006 | Unclassified | 2599 |
| 2 | SwRhRL3b_contig_806853 | 2162886006 | Bacteria | 3179 |
| 3 | SwRhRL2b_contig_273078 | 2162886007 | Bacteria | 2113 |
| 4 | SwRhRL2b_contig_454664 | 2162886007 | Bacteria | 4475 |
| 5 | JGI24739J22299_10000155 | 3300001989 | Bacteria | 22101 |
| 6 | JGI24737J22298_10000087 | 3300001990 | Bacteria | 27343 |
| 7 | JGI24737J22298_10005388 | 3300001990 | Bacteria | 4418 |
| 8 | JGI24735J21928_10000192 | 3300002067 | Bacteria | 21729 |
| 9 | JGI24738J21930_10001254 | 3300002075 | Bacteria | 7132 |
| 10 | JGI25151J46595_10000249 | 3300003187 | Bacteria | 62907 |
| 11 | rootH2_10031165 | 3300003320 | Bacteria | 16235 |
| 12 | Ga0055542_1001795 | 3300003762 | Bacteria | 8898 |
| 13 | Ga0055536_1000301 | 3300003781 | Bacteria | 37078 |
| 14 | Ga0055536_1016823 | 3300003781 | Bacteria | 2425 |
| 15 | Ga0065704_10070425 | 3300005289 | Bacteria | 25271 |
| 16 | Ga0065707_10003564 | 3300005295 | Bacteria | 5436 |
| 17 | Ga0065707_10082025 | 3300005295 | Bacteria | 24254 |
| 18 | Ga0065707_10096761 | 3300005295 | Bacteria | 3236 |
| 19 | Ga0070658_10047333 | 3300005327 | Bacteria | 3480 |
| 20 | Ga0070676_10040769 | 3300005328 | Bacteria | 2690 |
| 21 | Ga0070676_10103436 | 3300005328 | Bacteria | 1763 |
| 22 | Ga0070683_100162012 | 3300005329 | Bacteria | 2122 |
| 23 | Ga0070683_100355989 | 3300005329 | Bacteria | 1394 |
| 24 | Ga0070690_100089660 | 3300005330 | Bacteria | 2023 |
| 25 | Ga0070670_100030601 | 3300005331 | Bacteria | 4635 |
| 26 | Ga0070670_100090283 | 3300005331 | Bacteria | 2633 |
| 27 | Ga0070677_10000001 | 3300005333 | Bacteria | 118426 |
| 28 | Ga0068869_100129883 | 3300005334 | Bacteria | 1935 |
| 29 | Ga0070666_10005910 | 3300005335 | Bacteria | 7516 |
| 30 | Ga0070682_100299748 | 3300005337 | Bacteria | 1179 |
| 31 | Ga0068868_100100153 | 3300005338 | Bacteria | 2344 |
| 32 | Ga0068868_100107131 | 3300005338 | Bacteria | 2268 |
| 33 | Ga0068868_100224085 | 3300005338 | Bacteria | 1575 |
| 34 | Ga0070660_100009652 | 3300005339 | Bacteria | 6797 |
| 35 | Ga0070689_100146124 | 3300005340 | Bacteria | 1905 |
| 36 | Ga0070675_100126231 | 3300005354 | Bacteria | 2177 |
| 37 | Ga0070674_100246201 | 3300005356 | Bacteria | 1402 |
| 38 | Ga0070674_100389741 | 3300005356 | Bacteria | 1135 |
| 39 | Ga0070688_100005952 | 3300005365 | Bacteria | 6462 |
| 40 | Ga0070659_100064137 | 3300005366 | Bacteria | 2907 |
| 41 | Ga0070667_100074723 | 3300005367 | Bacteria | 2892 |
| 42 | Ga0070709_10018076 | 3300005434 | Bacteria | 4053 |
| 43 | Ga0070714_100107549 | 3300005435 | Bacteria | 2465 |
| 44 | Ga0070714_100544019 | 3300005435 | Bacteria | 1111 |
| 45 | Ga0070713_100448866 | 3300005436 | Bacteria | 1211 |
| 46 | Ga0070710_10106441 | 3300005437 | Bacteria | 1678 |
| 47 | Ga0070711_100004985 | 3300005439 | Bacteria | 7885 |
| 48 | Ga0070711_100070249 | 3300005439 | Bacteria | 2465 |
| 49 | Ga0070711_100074501 | 3300005439 | Bacteria | 2401 |
| 50 | Ga0070711_100243992 | 3300005439 | Bacteria | 1406 |
| 51 | Ga0070711_100329020 | 3300005439 | Bacteria | 1223 |
| 52 | Ga0070705_100085042 | 3300005440 | Bacteria | 1954 |
| 53 | Ga0070705_100179691 | 3300005440 | Bacteria | 1432 |
| 54 | Ga0070708_100012539 | 3300005445 | Bacteria | 6919 |
| 55 | Ga0070708_100014454 | 3300005445 | Bacteria | 6495 |
| 56 | Ga0070708_100063643 | 3300005445 | Bacteria | 3302 |
| 57 | Ga0070678_100001647 | 3300005456 | Bacteria | 11963 |
| 58 | Ga0070662_100008544 | 3300005457 | Bacteria | 6678 |
| 59 | Ga0070681_10021716 | 3300005458 | Bacteria | 6437 |
| 60 | Ga0070681_10090440 | 3300005458 | Bacteria | 3011 |
| 61 | Ga0070681_10146375 | 3300005458 | Bacteria | 2291 |
| 62 | Ga0070681_10202976 | 3300005458 | Bacteria | 1900 |
| 63 | Ga0070707_100024799 | 3300005468 | Bacteria | 5685 |
| 64 | Ga0070707_100026575 | 3300005468 | Bacteria | 5498 |
| 65 | Ga0070707_100032329 | 3300005468 | Bacteria | 4984 |
| 66 | Ga0070698_100019533 | 3300005471 | Bacteria | 7112 |
| 67 | Ga0070698_100027381 | 3300005471 | Bacteria | 5928 |
| 68 | Ga0070698_100037911 | 3300005471 | Bacteria | 4969 |
| 69 | Ga0070698_100081236 | 3300005471 | Bacteria | 3236 |
| 70 | Ga0070699_100002783 | 3300005518 | Bacteria | 15599 |
| 71 | Ga0070679_100130070 | 3300005530 | Bacteria | 2499 |
| 72 | Ga0070697_100151406 | 3300005536 | Bacteria | 1955 |
| 73 | Ga0070697_100175967 | 3300005536 | Bacteria | 1813 |
| 74 | Ga0068853_100148597 | 3300005539 | Bacteria | 2108 |
| 75 | Ga0070672_100061477 | 3300005543 | Bacteria | 2961 |
| 76 | Ga0070686_100075235 | 3300005544 | Bacteria | 2221 |
| 77 | Ga0070686_100303990 | 3300005544 | Bacteria | 1184 |
| 78 | Ga0070665_100001237 | 3300005548 | Bacteria | 31017 |
| 79 | Ga0070704_100436208 | 3300005549 | Bacteria | 1125 |
| 80 | Ga0068855_100009909 | 3300005563 | Bacteria | 11491 |
| 81 | Ga0068855_100055255 | 3300005563 | Bacteria | 4664 |
| 82 | Ga0068855_100127745 | 3300005563 | Bacteria | 2905 |
| 83 | Ga0068855_100242648 | 3300005563 | Bacteria | 2012 |
| 84 | Ga0070664_100200715 | 3300005564 | Bacteria | 1780 |
| 85 | Ga0068857_100025731 | 3300005577 | Bacteria | 5181 |
| 86 | Ga0068857_100434249 | 3300005577 | Bacteria | 1226 |
| 87 | Ga0068856_100103141 | 3300005614 | Bacteria | 2846 |
| 88 | Ga0068852_100103350 | 3300005616 | Bacteria | 2577 |
| 89 | Ga0068852_100144141 | 3300005616 | Bacteria | 2207 |
| 90 | Ga0068859_100106799 | 3300005617 | Bacteria | 2859 |
| 91 | Ga0068859_100245892 | 3300005617 | Bacteria | 1878 |
| 92 | Ga0068864_100169005 | 3300005618 | Bacteria | 1993 |
| 93 | Ga0068863_100012703 | 3300005841 | Bacteria | 8121 |
| 94 | Ga0068858_100037956 | 3300005842 | Bacteria | 4468 |
| 95 | Ga0068858_100064239 | 3300005842 | Bacteria | 3397 |
| 96 | Ga0068858_100203928 | 3300005842 | Bacteria | 1871 |
| 97 | Ga0068860_100082228 | 3300005843 | Bacteria | 3063 |
| 98 | Ga0068860_100268190 | 3300005843 | Bacteria | 1665 |
| 99 | Ga0068860_100564791 | 3300005843 | Bacteria | 1141 |
| 100 | Ga0081455_10020686 | 3300005937 | Bacteria | 6188 |
| 101 | Ga0081540_1025305 | 3300005983 | Bacteria | 3419 |
| 102 | Ga0070717_10004583 | 3300006028 | Bacteria | 10007 |
| 103 | Ga0075365_10000319 | 3300006038 | Bacteria | 16990 |
| 104 | Ga0075365_10005282 | 3300006038 | Bacteria | 6947 |
| 105 | Ga0070715_10155786 | 3300006163 | Bacteria | 1124 |
| 106 | Ga0070716_100001520 | 3300006173 | Bacteria | 10384 |
| 107 | Ga0070716_100005798 | 3300006173 | Bacteria | 5998 |
| 108 | Ga0070712_100014072 | 3300006175 | Bacteria | 5130 |
| 109 | Ga0070712_100034086 | 3300006175 | Bacteria | 3449 |
| 110 | Ga0070712_100053422 | 3300006175 | Bacteria | 2821 |
| 111 | Ga0097621_100002270 | 3300006237 | Bacteria | 13158 |
| 112 | Ga0097621_100040681 | 3300006237 | Bacteria | 3738 |
| 113 | Ga0097621_100056162 | 3300006237 | Bacteria | 3216 |
| 114 | Ga0097621_100060596 | 3300006237 | Bacteria | 3103 |
| 115 | Ga0068871_100004133 | 3300006358 | Bacteria | 10041 |
| 116 | Ga0068871_100029721 | 3300006358 | Bacteria | 4295 |
| 117 | Ga0068871_100061939 | 3300006358 | Bacteria | 3057 |
| 118 | Ga0075428_100043590 | 3300006844 | Bacteria | 4933 |
| 119 | Ga0075431_100000239 | 3300006847 | Bacteria | 41273 |
| 120 | Ga0075431_100004271 | 3300006847 | Bacteria | 13992 |
| 121 | Ga0075431_100407760 | 3300006847 | Bacteria | 1359 |
| 122 | Ga0075433_10042903 | 3300006852 | Bacteria | 3925 |
| 123 | Ga0075434_100013850 | 3300006871 | Bacteria | 7692 |
| 124 | Ga0075434_100101644 | 3300006871 | Bacteria | 2882 |
| 125 | Ga0075434_100143455 | 3300006871 | Bacteria | 2408 |
| 126 | Ga0075434_100162715 | 3300006871 | Bacteria | 2251 |
| 127 | Ga0075434_100181432 | 3300006871 | Bacteria | 2125 |
| 128 | Ga0075434_100214628 | 3300006871 | Bacteria | 1944 |
| 129 | Ga0068865_100066129 | 3300006881 | Bacteria | 2550 |
| 130 | Ga0075436_100012017 | 3300006914 | Bacteria | 5938 |
| 131 | Ga0075436_100066930 | 3300006914 | Bacteria | 2483 |
| 132 | Ga0075436_100182085 | 3300006914 | Bacteria | 1485 |
| 133 | Ga0097620_100106798 | 3300006931 | Bacteria | 2859 |
| 134 | Ga0097620_100128418 | 3300006931 | Bacteria | 2606 |
| 135 | Ga0097620_100245904 | 3300006931 | Bacteria | 1878 |
| 136 | Ga0075435_100007769 | 3300007076 | Bacteria | 7665 |
| 137 | Ga0075435_100011913 | 3300007076 | Bacteria | 6422 |
| 138 | Ga0099794_10028232 | 3300007265 | Bacteria | 2609 |
| 139 | Ga0099794_10033959 | 3300007265 | Bacteria | 2400 |
| 140 | Ga0099795_10007353 | 3300007788 | Bacteria | 3069 |
| 141 | Ga0105244_10058935 | 3300009036 | Bacteria | 1936 |
| 142 | Ga0105240_10000779 | 3300009093 | Bacteria | 57657 |
| 143 | Ga0105240_10297267 | 3300009093 | Bacteria | 1848 |
| 144 | Ga0111539_10022378 | 3300009094 | Bacteria | 7767 |
| 145 | Ga0105245_10025506 | 3300009098 | Bacteria | 5199 |
| 146 | Ga0105245_10031829 | 3300009098 | Bacteria | 4670 |
| 147 | Ga0105245_10108052 | 3300009098 | Bacteria | 2584 |
| 148 | Ga0105245_10120239 | 3300009098 | Bacteria | 2453 |
| 149 | Ga0114129_10035833 | 3300009147 | Bacteria | 7007 |
| 150 | Ga0114129_10048471 | 3300009147 | Bacteria | 5969 |
| 151 | Ga0114129_10081000 | 3300009147 | Bacteria | 4513 |
| 152 | Ga0105241_10000033 | 3300009174 | Bacteria | 118315 |
| 153 | Ga0105241_10085593 | 3300009174 | Bacteria | 2477 |
| 154 | Ga0105241_10128315 | 3300009174 | Bacteria | 2050 |
| 155 | Ga0105241_10496495 | 3300009174 | Bacteria | 1087 |
| 156 | Ga0105242_10019574 | 3300009176 | Bacteria | 5306 |
| 157 | Ga0105242_10033980 | 3300009176 | Bacteria | 4087 |
| 158 | Ga0105242_10078677 | 3300009176 | Bacteria | 2753 |
| 159 | Ga0105242_10449645 | 3300009176 | Bacteria | 1214 |
| 160 | Ga0105248_10018035 | 3300009177 | Bacteria | 7791 |
| 161 | Ga0105248_10206465 | 3300009177 | Bacteria | 2213 |
| 162 | Ga0105237_10024447 | 3300009545 | Bacteria | 6179 |
| 163 | Ga0105237_10035885 | 3300009545 | Bacteria | 5015 |
| 164 | Ga0105238_10032776 | 3300009551 | Bacteria | 5287 |
| 165 | Ga0105249_10000074 | 3300009553 | Bacteria | 145235 |
| 166 | Ga0105249_10069414 | 3300009553 | Bacteria | 3252 |
| 167 | Ga0105239_10040629 | 3300010375 | Bacteria | 5097 |
| 168 | Ga0105239_10065083 | 3300010375 | Bacteria | 4003 |
| 169 | Ga0105239_10147102 | 3300010375 | Bacteria | 2629 |
| 170 | Ga0105239_10374212 | 3300010375 | Bacteria | 1610 |
| 171 | Ga0105246_10171245 | 3300011119 | Bacteria | 1663 |
| 172 | Ga0105246_10202605 | 3300011119 | Bacteria | 1544 |
| 173 | Ga0105246_10209967 | 3300011119 | Bacteria | 1519 |
| 174 | Ga0157370_10017710 | 3300013104 | Bacteria | 7182 |
| 175 | Ga0157369_10005309 | 3300013105 | Bacteria | 15018 |
| 176 | Ga0157369_10133926 | 3300013105 | Bacteria | 2624 |
| 177 | Ga0157369_10167800 | 3300013105 | Bacteria | 2314 |
| 178 | Ga0157374_10037930 | 3300013296 | Bacteria | 4427 |
| 179 | Ga0157374_10396699 | 3300013296 | Bacteria | 1376 |
| 180 | Ga0157378_10001980 | 3300013297 | Bacteria | 18324 |
| 181 | Ga0157378_10033649 | 3300013297 | Bacteria | 4533 |
| 182 | Ga0157378_10138402 | 3300013297 | Bacteria | 2259 |
| 183 | Ga0157378_10848004 | 3300013297 | Bacteria | 942 |
| 184 | Ga0163162_10015187 | 3300013306 | Bacteria | 7522 |
| 185 | Ga0163162_10060031 | 3300013306 | Bacteria | 3836 |
| 186 | Ga0163162_10071493 | 3300013306 | Bacteria | 3523 |
| 187 | Ga0157372_10063926 | 3300013307 | Bacteria | 4128 |
| 188 | Ga0157372_10121144 | 3300013307 | Bacteria | 3005 |
| 189 | Ga0157375_10041011 | 3300013308 | Bacteria | 4467 |
| 190 | Ga0157375_10086391 | 3300013308 | Bacteria | 3187 |
| 191 | Ga0157375_10102645 | 3300013308 | Bacteria | 2945 |
| 192 | Ga0157375_10138616 | 3300013308 | Bacteria | 2558 |
| 193 | Ga0157375_10619332 | 3300013308 | Bacteria | 1240 |
| 194 | Ga0163163_10012585 | 3300014325 | Bacteria | 7716 |
| 195 | Ga0163163_10049839 | 3300014325 | Bacteria | 4122 |
| 196 | Ga0163163_10233626 | 3300014325 | Bacteria | 1888 |
| 197 | Ga0157379_10119673 | 3300014968 | Bacteria | 2368 |
| 198 | Ga0157379_10174617 | 3300014968 | Bacteria | 1940 |
| 199 | Ga0157376_10000008 | 3300014969 | Bacteria | 351192 |
| 200 | Ga0157376_10002432 | 3300014969 | Bacteria | 12594 |
| 201 | Ga0157376_10003459 | 3300014969 | Bacteria | 10880 |
| 202 | Ga0157376_10092052 | 3300014969 | Bacteria | 2628 |
| 203 | Ga0157376_10388691 | 3300014969 | Bacteria | 1346 |
| 204 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 205 | Ga0213873_10030802 | 3300021358 | Bacteria | 1330 |
| 206 | Ga0213872_10000700 | 3300021361 | Bacteria | 25208 |
| 207 | Ga0213872_10029132 | 3300021361 | Bacteria | 2532 |
| 208 | Ga0213872_10108812 | 3300021361 | Bacteria | 1232 |
| 209 | Ga0213874_10010712 | 3300021377 | Bacteria | 2303 |
| 210 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 211 | Ga0213876_10001370 | 3300021384 | Bacteria | 15256 |
| 212 | Ga0213875_10005331 | 3300021388 | Bacteria | 6916 |
| 213 | Ga0213871_10031656 | 3300021441 | Bacteria | 1383 |
| 214 | Ga0209148_1000146 | 3300025254 | Bacteria | 160734 |
| 215 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 216 | Ga0209050_1000093 | 3300025298 | Bacteria | 250654 |
| 217 | Ga0209257_1004775 | 3300025304 | Bacteria | 10104 |
| 218 | Ga0207653_10036352 | 3300025885 | Bacteria | 1604 |
| 219 | Ga0207653_10039119 | 3300025885 | Bacteria | 1552 |
| 220 | Ga0207692_10095471 | 3300025898 | Bacteria | 1621 |
| 221 | Ga0207688_10092746 | 3300025901 | Bacteria | 1736 |
| 222 | Ga0207680_10039239 | 3300025903 | Bacteria | 2746 |
| 223 | Ga0207647_10000604 | 3300025904 | Bacteria | 27991 |
| 224 | Ga0207685_10032511 | 3300025905 | Bacteria | 1877 |
| 225 | Ga0207685_10097221 | 3300025905 | Bacteria | 1252 |
| 226 | Ga0207645_10088850 | 3300025907 | Bacteria | 1987 |
| 227 | Ga0207705_10044109 | 3300025909 | Bacteria | 3205 |
| 228 | Ga0207705_10185540 | 3300025909 | Bacteria | 1571 |
| 229 | Ga0207684_10025533 | 3300025910 | Bacteria | 5036 |
| 230 | Ga0207654_10024547 | 3300025911 | Bacteria | 3243 |
| 231 | Ga0207654_10059788 | 3300025911 | Bacteria | 2224 |
| 232 | Ga0207707_10030855 | 3300025912 | Bacteria | 4689 |
| 233 | Ga0207707_10271427 | 3300025912 | Bacteria | 1470 |
| 234 | Ga0207695_10018336 | 3300025913 | Bacteria | 8097 |
| 235 | Ga0207695_10025883 | 3300025913 | Bacteria | 6557 |
| 236 | Ga0207695_10154906 | 3300025913 | Bacteria | 2227 |
| 237 | Ga0207693_10004813 | 3300025915 | Bacteria | 11356 |
| 238 | Ga0207693_10059170 | 3300025915 | Bacteria | 3001 |
| 239 | Ga0207693_10072293 | 3300025915 | Bacteria | 2701 |
| 240 | Ga0207663_10029782 | 3300025916 | Bacteria | 3211 |
| 241 | Ga0207657_10008390 | 3300025919 | Bacteria | 10489 |
| 242 | Ga0207657_10015485 | 3300025919 | Bacteria | 7387 |
| 243 | Ga0207652_10227369 | 3300025921 | Bacteria | 1682 |
| 244 | Ga0207646_10051556 | 3300025922 | Bacteria | 3682 |
| 245 | Ga0207646_10178785 | 3300025922 | Bacteria | 1916 |
| 246 | Ga0207646_10383139 | 3300025922 | Bacteria | 1270 |
| 247 | Ga0207694_10005191 | 3300025924 | Bacteria | 10056 |
| 248 | Ga0207687_10025307 | 3300025927 | Bacteria | 3971 |
| 249 | Ga0207687_10028506 | 3300025927 | Bacteria | 3751 |
| 250 | Ga0207687_10142627 | 3300025927 | Bacteria | 1819 |
| 251 | Ga0207700_10029682 | 3300025928 | Bacteria | 3862 |
| 252 | Ga0207664_10174493 | 3300025929 | Bacteria | 1842 |
| 253 | Ga0207706_10001626 | 3300025933 | Bacteria | 22272 |
| 254 | Ga0207706_10094327 | 3300025933 | Bacteria | 2632 |
| 255 | Ga0207686_10034213 | 3300025934 | Bacteria | 3040 |
| 256 | Ga0207686_10043497 | 3300025934 | Bacteria | 2752 |
| 257 | Ga0207686_10125546 | 3300025934 | Bacteria | 1753 |
| 258 | Ga0207686_10209194 | 3300025934 | Bacteria | 1401 |
| 259 | Ga0207709_10055772 | 3300025935 | Bacteria | 2443 |
| 260 | Ga0207665_10000024 | 3300025939 | Bacteria | 101596 |
| 261 | Ga0207665_10088635 | 3300025939 | Bacteria | 2141 |
| 262 | Ga0207665_10129051 | 3300025939 | Bacteria | 1793 |
| 263 | Ga0207665_10191315 | 3300025939 | Bacteria | 1487 |
| 264 | Ga0207665_10318408 | 3300025939 | Bacteria | 1166 |
| 265 | Ga0207691_10044156 | 3300025940 | Bacteria | 4104 |
| 266 | Ga0207691_10071568 | 3300025940 | Bacteria | 3129 |
| 267 | Ga0207711_10016461 | 3300025941 | Bacteria | 6144 |
| 268 | Ga0207711_10083240 | 3300025941 | Bacteria | 2798 |
| 269 | Ga0207689_10026741 | 3300025942 | Bacteria | 4832 |
| 270 | Ga0207679_10009581 | 3300025945 | Bacteria | 6208 |
| 271 | Ga0207679_10078307 | 3300025945 | Bacteria | 2518 |
| 272 | Ga0207667_10014901 | 3300025949 | Bacteria | 8840 |
| 273 | Ga0207667_10028927 | 3300025949 | Bacteria | 6016 |
| 274 | Ga0207667_10055661 | 3300025949 | Bacteria | 4158 |
| 275 | Ga0207667_10261652 | 3300025949 | Bacteria | 1769 |
| 276 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 277 | Ga0207668_10097389 | 3300025972 | Bacteria | 2177 |
| 278 | Ga0207668_10235369 | 3300025972 | Bacteria | 1479 |
| 279 | Ga0207658_10081068 | 3300025986 | Bacteria | 2487 |
| 280 | Ga0207677_10003509 | 3300026023 | Bacteria | 8309 |
| 281 | Ga0207703_10008898 | 3300026035 | Bacteria | 7910 |
| 282 | Ga0207703_10108414 | 3300026035 | Bacteria | 2365 |
| 283 | Ga0207703_10118569 | 3300026035 | Bacteria | 2269 |
| 284 | Ga0207708_10096368 | 3300026075 | Bacteria | 2286 |
| 285 | Ga0207702_10480132 | 3300026078 | Bacteria | 1209 |
| 286 | Ga0207641_10002979 | 3300026088 | Bacteria | 15326 |
| 287 | Ga0207648_10035805 | 3300026089 | Bacteria | 4373 |
| 288 | Ga0207676_10047138 | 3300026095 | Bacteria | 3338 |
| 289 | Ga0207674_10021605 | 3300026116 | Bacteria | 6928 |
| 290 | Ga0207674_10069771 | 3300026116 | Bacteria | 3534 |
| 291 | Ga0207675_100110943 | 3300026118 | Bacteria | 2588 |
| 292 | Ga0207683_10026048 | 3300026121 | Bacteria | 5050 |
| 293 | Ga0207698_10025155 | 3300026142 | Bacteria | 4189 |
| 294 | Ga0207698_10070924 | 3300026142 | Bacteria | 2763 |
| 295 | Ga0207698_10077620 | 3300026142 | Bacteria | 2664 |
| 296 | Ga0209588_1001362 | 3300027671 | Bacteria | 6366 |
| 297 | Ga0209588_1016141 | 3300027671 | Bacteria | 2302 |
| 298 | Ga0209588_1020632 | 3300027671 | Bacteria | 2064 |
| 299 | Ga0207428_10000044 | 3300027907 | Bacteria | 198046 |
| 300 | Ga0268266_10000112 | 3300028379 | Bacteria | 168186 |
| 301 | Ga0268266_10057684 | 3300028379 | Bacteria | 3342 |
| 302 | Ga0268264_10391036 | 3300028381 | Bacteria | 1334 |
| 303 | Ga0265319_1001296 | 3300028563 | Bacteria | 15126 |
| 304 | Ga0265338_10016932 | 3300028800 | Bacteria | 7888 |
| 305 | Ga0265338_10070724 | 3300028800 | Bacteria | 2989 |
| 306 | Ga0307511_10004267 | 3300030521 | Bacteria | 14596 |
| 307 | Ga0265330_10000497 | 3300031235 | Bacteria | 26301 |
| 308 | Ga0265332_10040108 | 3300031238 | Bacteria | 2027 |
| 309 | Ga0265320_10015580 | 3300031240 | Bacteria | 4292 |
| 310 | Ga0265320_10072255 | 3300031240 | Bacteria | 1624 |
| 311 | Ga0265329_10012429 | 3300031242 | Bacteria | 3060 |
| 312 | Ga0265339_10024868 | 3300031249 | Bacteria | 3445 |
| 313 | Ga0265327_10003259 | 3300031251 | Bacteria | 15737 |
| 314 | Ga0265327_10027392 | 3300031251 | Bacteria | 3281 |
| 315 | Ga0265316_10002313 | 3300031344 | Bacteria | 19915 |
| 316 | Ga0265316_10002370 | 3300031344 | Bacteria | 19611 |
| 317 | Ga0265316_10061012 | 3300031344 | Bacteria | 2930 |
| 318 | Ga0316575_10009325 | 3300031665 | Bacteria | 3593 |
| 319 | Ga0316579_10032351 | 3300031691 | Bacteria | 2398 |
| 320 | Ga0265314_10000001 | 3300031711 | Bacteria | 3792860 |
| 321 | Ga0265314_10002144 | 3300031711 | Bacteria | 20676 |
| 322 | Ga0265314_10003041 | 3300031711 | Bacteria | 16561 |
| 323 | Ga0265314_10018535 | 3300031711 | Bacteria | 5425 |
| 324 | Ga0265342_10026697 | 3300031712 | Bacteria | 3616 |
| 325 | Ga0307412_10014348 | 3300031911 | Bacteria | 4670 |
| 326 | Ga0307414_10000024 | 3300032004 | Bacteria | 205727 |
| 327 | Ga0307414_10019066 | 3300032004 | Bacteria | 4243 |
| 328 | Ga0307414_10191158 | 3300032004 | Bacteria | 1656 |
| 329 | Ga0307415_100239747 | 3300032126 | Bacteria | 1466 |
| 330 | Ga0373939_0059944 | 3300035114 | Bacteria | 1208 |
| 331 | Ga0373954_0143235 | 3300035118 | Bacteria | 1166 |
| 332 | Ga0373943_0001085 | 3300035170 | Bacteria | 12115 |
| 333 | Ga0373946_0006506 | 3300035171 | Bacteria | 4237 |
| 334 | Ga0373931_0151276 | 3300035691 | Bacteria | 1353 |
| 335 | Ga0373931_0196782 | 3300035691 | Bacteria | 1202 |
| 336 | Ga0373935_0037596 | 3300035692 | Bacteria | 3030 |
| 337 | Ga0373935_0243697 | 3300035692 | Bacteria | 1256 |
| 338 | Ga0373927_0063745 | 3300035695 | Bacteria | 2384 |
| 339 | Ga0373947_0003233 | 3300035725 | Bacteria | 9668 |
| 340 | Ga0316584_0192299 | 3300036712 | Bacteria | 1508 |
| 341 | Ga0373925_0187750 | 3300037068 | Bacteria | 1639 |
| 342 | Ga0395899_0007423 | 3300037312 | Bacteria | 8471 |
| 343 | Ga0395899_0037220 | 3300037312 | Bacteria | 3648 |
| 344 | Ga0395899_0071794 | 3300037312 | Bacteria | 2533 |
| 345 | Ga0395899_0078820 | 3300037312 | Bacteria | 2400 |
| 346 | Ga0395900_0002198 | 3300037418 | Bacteria | 21786 |
| 347 | Ga0395900_0006564 | 3300037418 | Bacteria | 12121 |
| 348 | Ga0395900_0010142 | 3300037418 | Bacteria | 9634 |
| 349 | Ga0395900_0114500 | 3300037418 | Bacteria | 2767 |
| 350 | Ga0395898_0009879 | 3300037466 | Bacteria | 10004 |
| 351 | Ga0395898_0012790 | 3300037466 | Bacteria | 8664 |
| 352 | Ga0395898_0016549 | 3300037466 | Bacteria | 7541 |
| 353 | Ga0395898_0033533 | 3300037466 | Bacteria | 5123 |
| 354 | Ga0395905_0056934 | 3300037471 | Bacteria | 3656 |
| 355 | Ga0395905_0153168 | 3300037471 | Bacteria | 2168 |
| 356 | Ga0395905_0213405 | 3300037471 | Bacteria | 1808 |
| 357 | Ga0436364_0159653 | 3300037853 | Bacteria | 1633 |
| 358 | Ga0436364_0534877 | 3300037853 | Bacteria | 1388 |
| 359 | Ga0436364_0643307 | 3300037853 | Bacteria | 2175 |
| 360 | Ga0436364_0669554 | 3300037853 | Bacteria | 8539 |
| 361 | Ga0436364_0892362 | 3300037853 | Bacteria | 4399 |
| 362 | Ga0436364_1341086 | 3300037853 | Bacteria | 25667 |
| 363 | Ga0436364_1554448 | 3300037853 | Bacteria | 11409 |
| 364 | Ga0395901_0000089 | 3300038443 | Bacteria | 124305 |
| 365 | Ga0395901_0015898 | 3300038443 | Bacteria | 7668 |
| 366 | Ga0395901_0027387 | 3300038443 | Bacteria | 5856 |
| 367 | Ga0395901_0060228 | 3300038443 | Bacteria | 3950 |
| 368 | Ga0395901_0140620 | 3300038443 | Bacteria | 2537 |
| 369 | Ga0395901_0354303 | 3300038443 | Bacteria | 1514 |
| 370 | Ga0395901_0386637 | 3300038443 | Bacteria | 1439 |
| 371 | Ga0436365_0172644 | 3300039437 | Bacteria | 2334 |
| 372 | Ga0436365_0243957 | 3300039437 | Bacteria | 1942 |
| 373 | Ga0436365_0364010 | 3300039437 | Bacteria | 49544 |
| 374 | Ga0436365_0447799 | 3300039437 | Bacteria | 61454 |
| 375 | Ga0436365_0909013 | 3300039437 | Bacteria | 3174 |
| 376 | Ga0436365_1154184 | 3300039437 | Bacteria | 2354 |
| 377 | Ga0436365_1290487 | 3300039437 | Bacteria | 2233 |
| 378 | Ga0436360_0245961 | 3300039438 | Bacteria | 1423 |
| 379 | Ga0436360_0281448 | 3300039438 | Bacteria | 6062 |
| 380 | Ga0436360_0743755 | 3300039438 | Bacteria | 1242 |
| 381 | Ga0436361_0073268 | 3300039447 | Bacteria | 7070 |
| 382 | Ga0436361_0313172 | 3300039447 | Bacteria | 5777 |
| 383 | Ga0436361_0833078 | 3300039447 | Bacteria | 31749 |
| 384 | Ga0436361_0897890 | 3300039447 | Bacteria | 2033 |
| 385 | Ga0436361_1013109 | 3300039447 | Bacteria | 3488 |
| 386 | Ga0436363_0428108 | 3300039450 | Bacteria | 4533 |
| 387 | Ga0436363_1147568 | 3300039450 | Bacteria | 2699 |
| 388 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 389 | Ga0436362_1138586 | 3300039453 | Bacteria | 1789 |
| 390 | Ga0451791_0545886 | 3300041451 | Bacteria | 1723 |
| 391 | Ga0439448_0028863 | 3300042005 | Bacteria | 1754 |
| 392 | Ga0439458_0008978 | 3300042157 | Bacteria | 2230 |
| 393 | Ga0439458_0013455 | 3300042157 | Bacteria | 1840 |
| 394 | Ga0439458_0024318 | 3300042157 | Bacteria | 1416 |
| 395 | Ga0451577_0121858 | 3300042876 | Bacteria | 2336 |
| 396 | Ga0466969_0145401 | 3300044656 | Bacteria | 1094 |
| 397 | Ga0466965_0190516 | 3300044683 | Bacteria | 1084 |
| 398 | Ga0466966_0004926 | 3300044684 | Bacteria | 8780 |
| 399 | Ga0466966_0044790 | 3300044684 | Bacteria | 2831 |
| 400 | Ga0466966_0054719 | 3300044684 | Bacteria | 2528 |
| 401 | Ga0466966_0125074 | 3300044684 | Bacteria | 1577 |
| 402 | Ga0466961_0017907 | 3300044693 | Bacteria | 4554 |
| 403 | Ga0466961_0032921 | 3300044693 | Bacteria | 3330 |
| 404 | Ga0466963_0000019 | 3300044694 | Bacteria | 56949 |
| 405 | Ga0466963_0015612 | 3300044694 | Bacteria | 4708 |
| 406 | Ga0466964_0001574 | 3300044706 | Bacteria | 7855 |
| 407 | Ga0466964_0004696 | 3300044706 | Bacteria | 5050 |
| 408 | Ga0453684_0000185 | 3300044712 | Bacteria | 274418 |
| 409 | Ga0453684_0024229 | 3300044712 | Bacteria | 8881 |
| 410 | Ga0453684_0027086 | 3300044712 | Bacteria | 8238 |
| 411 | Ga0453684_0057979 | 3300044712 | Bacteria | 5005 |
| 412 | Ga0453684_0302925 | 3300044712 | Bacteria | 1816 |
| 413 | Ga0466971_0005825 | 3300044719 | Bacteria | 5364 |
| 414 | Ga0466971_0012399 | 3300044719 | Bacteria | 3735 |
| 415 | Ga0466957_0000053 | 3300044842 | Bacteria | 42517 |
| 416 | Ga0466957_0006783 | 3300044842 | Bacteria | 6471 |
| 417 | Ga0466957_0020032 | 3300044842 | Bacteria | 3937 |
| 418 | Ga0466957_0108639 | 3300044842 | Bacteria | 1757 |
| 419 | Ga0466957_0285728 | 3300044842 | Bacteria | 1105 |
| 420 | Ga0466959_0000870 | 3300045049 | Bacteria | 17824 |
| 421 | Ga0466959_0009302 | 3300045049 | Bacteria | 6982 |
| 422 | Ga0466959_0107831 | 3300045049 | Bacteria | 1990 |
| 423 | Ga0466958_0007414 | 3300045836 | Bacteria | 6033 |
| 424 | Ga0466958_0041095 | 3300045836 | Bacteria | 2781 |
| 425 | Ga0466958_0055271 | 3300045836 | Bacteria | 2409 |
| 426 | Ga0466967_0004114 | 3300045976 | Bacteria | 9719 |
| 427 | Ga0466967_0008826 | 3300045976 | Bacteria | 7430 |
| 428 | Ga0495603_0008347 | 3300046455 | Bacteria | 6262 |
| 429 | Ga0495603_0109838 | 3300046455 | Bacteria | 1609 |
| 430 | Ga0495629_0000259 | 3300046459 | Bacteria | 46161 |
| 431 | Ga0495638_0000187 | 3300046460 | Bacteria | 94516 |
| 432 | Ga0495638_0033155 | 3300046460 | Bacteria | 3304 |
| 433 | Ga0495641_0000362 | 3300046461 | Bacteria | 37539 |
| 434 | Ga0495641_0033399 | 3300046461 | Bacteria | 2442 |
| 435 | Ga0495641_0094915 | 3300046461 | Bacteria | 1332 |
| 436 | Ga0495653_0017476 | 3300046463 | Bacteria | 5833 |
| 437 | Ga0495580_0024637 | 3300046472 | Bacteria | 4402 |
| 438 | Ga0495580_0131972 | 3300046472 | Bacteria | 1732 |
| 439 | Ga0495582_0001127 | 3300046473 | Bacteria | 15031 |
| 440 | Ga0495582_0034734 | 3300046473 | Bacteria | 2771 |
| 441 | Ga0495605_0000018 | 3300046474 | Bacteria | 270187 |
| 442 | Ga0495605_0005663 | 3300046474 | Bacteria | 7263 |
| 443 | Ga0495639_0010305 | 3300046475 | Bacteria | 4022 |
| 444 | Ga0495662_0000661 | 3300046476 | Bacteria | 16220 |
| 445 | Ga0495664_0103854 | 3300046477 | Bacteria | 1713 |
| 446 | Ga0495584_0020006 | 3300046491 | Bacteria | 3400 |
| 447 | Ga0495596_0045928 | 3300046500 | Bacteria | 1716 |
| 448 | Ga0495607_0000400 | 3300046501 | Bacteria | 44002 |
| 449 | Ga0495607_0004295 | 3300046501 | Bacteria | 10518 |
| 450 | Ga0495583_0000552 | 3300046506 | Bacteria | 52374 |
| 451 | Ga0495616_0002532 | 3300046513 | Bacteria | 12075 |
| 452 | Ga0495630_0015000 | 3300046517 | Bacteria | 5653 |
| 453 | Ga0495630_0223265 | 3300046517 | Bacteria | 1438 |
| 454 | Ga0495632_0018477 | 3300046519 | Bacteria | 3826 |
| 455 | Ga0495632_0041470 | 3300046519 | Bacteria | 2313 |
| 456 | Ga0495643_0002120 | 3300046522 | Bacteria | 16364 |
| 457 | Ga0495643_0028882 | 3300046522 | Bacteria | 3106 |
| 458 | Ga0495644_0019544 | 3300046523 | Bacteria | 2586 |
| 459 | Ga0495654_0001175 | 3300046530 | Bacteria | 18635 |
| 460 | Ga0495665_0006418 | 3300046531 | Bacteria | 6349 |
| 461 | Ga0495640_0013393 | 3300046533 | Bacteria | 6230 |
| 462 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 463 | Ga0495633_0132015 | 3300046558 | Bacteria | 1155 |
| 464 | Ga0495656_0011809 | 3300046615 | Bacteria | 3210 |
| 465 | Ga0495668_0002529 | 3300046616 | Bacteria | 14911 |
| 466 | Ga0495668_0002869 | 3300046616 | Bacteria | 13666 |
| 467 | Ga0495668_0032029 | 3300046616 | Bacteria | 2960 |
| 468 | Ga0495634_0023543 | 3300046642 | Bacteria | 4327 |
| 469 | Ga0495634_0081620 | 3300046642 | Bacteria | 2114 |
| 470 | Ga0495611_0008043 | 3300046648 | Bacteria | 4479 |
| 471 | Ga0495625_0001610 | 3300046660 | Bacteria | 26640 |
| 472 | Ga0495661_0000023 | 3300046665 | Bacteria | 189053 |
| 473 | Ga0495647_0009997 | 3300046681 | Bacteria | 3224 |
| 474 | Ga0495647_0031329 | 3300046681 | Bacteria | 1977 |
| 475 | Ga0495658_0000467 | 3300046683 | Bacteria | 22368 |
| 476 | Ga0495658_0041905 | 3300046683 | Bacteria | 2554 |
| 477 | Ga0495613_0019003 | 3300046689 | Bacteria | 5120 |
| 478 | Ga0495613_0139559 | 3300046689 | Bacteria | 1732 |
| 479 | Ga0495624_0001840 | 3300046690 | Bacteria | 16179 |
| 480 | Ga0495624_0039187 | 3300046690 | Bacteria | 3039 |
| 481 | Ga0495649_0008508 | 3300046694 | Bacteria | 6168 |
| 482 | Ga0495589_0000027 | 3300046794 | Bacteria | 181084 |
| 483 | Ga0495589_0014244 | 3300046794 | Bacteria | 4098 |
| 484 | Ga0495589_0059403 | 3300046794 | Bacteria | 1879 |
| 485 | Ga0495600_0026369 | 3300046809 | Bacteria | 3751 |
| 486 | Ga0495600_0288990 | 3300046809 | Bacteria | 1036 |
| 487 | Ga0495660_0002222 | 3300046810 | Bacteria | 12495 |
| 488 | Ga0495581_0000327 | 3300047315 | Bacteria | 23532 |
| 489 | Ga0495581_0021689 | 3300047315 | Bacteria | 3721 |
| 490 | Ga0495581_0132613 | 3300047315 | Bacteria | 1452 |
| 491 | Ga0495636_0017133 | 3300047318 | Bacteria | 2899 |
| 492 | Ga0495674_0027735 | 3300047319 | Bacteria | 5171 |
| 493 | Ga0495674_0033545 | 3300047319 | Bacteria | 4648 |
| 494 | Ga0495674_0042277 | 3300047319 | Bacteria | 4066 |
| 495 | Ga0495672_0019772 | 3300047320 | Bacteria | 4434 |
| 496 | Ga0495676_0000925 | 3300047321 | Bacteria | 24604 |
| 497 | Ga0495676_0002537 | 3300047321 | Bacteria | 16242 |
| 498 | Ga0495680_0008081 | 3300047322 | Bacteria | 9593 |
| 499 | Ga0495680_0016990 | 3300047322 | Bacteria | 6230 |
| 500 | Ga0495683_0011736 | 3300047323 | Bacteria | 4608 |
| 501 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 502 | Ga0495687_020394 | 3300047443 | Bacteria | 3230 |
| 503 | Ga0495677_0000055 | 3300047445 | Bacteria | 64238 |
| 504 | Ga0495677_0000388 | 3300047445 | Bacteria | 18849 |
| 505 | Ga0495679_003096 | 3300047446 | Bacteria | 8150 |
| 506 | Ga0495681_0014480 | 3300047470 | Bacteria | 4516 |
| 507 | Ga0495684_0005134 | 3300047471 | Bacteria | 10213 |
| 508 | Ga0495684_0010148 | 3300047471 | Bacteria | 7283 |
| 509 | Ga0495686_0000159 | 3300047472 | Bacteria | 129374 |
| 510 | Ga0495686_0011299 | 3300047472 | Bacteria | 6295 |
| 511 | Ga0495602_0181880 | 3300048088 | Bacteria | 1620 |
| 512 | Ga0495614_0059895 | 3300048089 | Bacteria | 1636 |
| 513 | Ga0495626_0000417 | 3300048091 | Bacteria | 43590 |
| 514 | Ga0495626_0015783 | 3300048091 | Bacteria | 3856 |
| 515 | Ga0496100_0013957 | 3300048903 | Bacteria | 4651 |
| 516 | Ga0496101_0004100 | 3300048904 | Bacteria | 9115 |
| 517 | Ga0496101_0115790 | 3300048904 | Bacteria | 2022 |
| 518 | Ga0496102_0000376 | 3300048905 | Bacteria | 53516 |
| 519 | Ga0496102_0013767 | 3300048905 | Bacteria | 7016 |
| 520 | Ga0496102_0528567 | 3300048905 | Bacteria | 1102 |
| 521 | Ga0496103_0000293 | 3300048906 | Bacteria | 46560 |
| 522 | Ga0496104_0098182 | 3300048907 | Bacteria | 2803 |
| 523 | Ga0496105_0042362 | 3300048908 | Bacteria | 3753 |
| 524 | Ga0496105_0303759 | 3300048908 | Bacteria | 1282 |
| 525 | Ga0496106_0000189 | 3300048909 | Bacteria | 43320 |
| 526 | Ga0496106_0263914 | 3300048909 | Bacteria | 1378 |
| 527 | Ga0496107_0003423 | 3300048910 | Bacteria | 10606 |
| 528 | Ga0496107_0081256 | 3300048910 | Bacteria | 2363 |
| 529 | Ga0496107_0286584 | 3300048910 | Bacteria | 1226 |
| 530 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 531 | Ga0496109_0000006 | 3300048912 | Bacteria | 325513 |
| 532 | Ga0496111_0220729 | 3300048914 | Bacteria | 1408 |
| 533 | Ga0496112_0321485 | 3300048915 | Bacteria | 1492 |
| 534 | Ga0496113_0067195 | 3300048916 | Bacteria | 2717 |
| 535 | Ga0496114_0002109 | 3300048917 | Bacteria | 15104 |
| 536 | Ga0496115_0000070 | 3300048918 | Bacteria | 91981 |
| 537 | Ga0496115_0000243 | 3300048918 | Bacteria | 49388 |
| 538 | Ga0496116_0001007 | 3300048919 | Bacteria | 34381 |
| 539 | Ga0496117_0000695 | 3300048920 | Bacteria | 53545 |
| 540 | Ga0496117_0073746 | 3300048920 | Bacteria | 2275 |
| 541 | Ga0496118_0014898 | 3300048921 | Bacteria | 7242 |
| 542 | Ga0496118_0024957 | 3300048921 | Bacteria | 5143 |
| 543 | Ga0496119_0020700 | 3300048922 | Bacteria | 4784 |
| 544 | Ga0496120_0007039 | 3300048923 | Bacteria | 8446 |
| 545 | Ga0496121_0003572 | 3300048924 | Bacteria | 21983 |
| 546 | Ga0496121_0084550 | 3300048924 | Bacteria | 2501 |
| 547 | Ga0496122_0005591 | 3300048925 | Bacteria | 14879 |
| 548 | Ga0496122_0086143 | 3300048925 | Bacteria | 2164 |
| 549 | Ga0496122_0087405 | 3300048925 | Bacteria | 2142 |
| 550 | Ga0496122_0120295 | 3300048925 | Bacteria | 1695 |
| 551 | Ga0496123_0016109 | 3300048926 | Bacteria | 6090 |
| 552 | Ga0496124_0000735 | 3300048927 | Bacteria | 53555 |
| 553 | Ga0496124_0018078 | 3300048927 | Bacteria | 6618 |
| 554 | Ga0496125_0003511 | 3300048928 | Bacteria | 18932 |
| 555 | Ga0496126_0005341 | 3300048929 | Bacteria | 14699 |
| 556 | Ga0496126_0011226 | 3300048929 | Bacteria | 9294 |
| 557 | Ga0496126_0049500 | 3300048929 | Bacteria | 3836 |
| 558 | Ga0495678_014818 | 3300049459 | Bacteria | 3612 |
| 559 | Ga0495678_043008 | 3300049459 | Bacteria | 1797 |
| 560 | Ga0501031_0000328 | 3300049568 | Bacteria | 27375 |
| 561 | Ga0501031_0124766 | 3300049568 | Bacteria | 1682 |
| 562 | Ga0501031_0143052 | 3300049568 | Bacteria | 1563 |
| 563 | Ga0501032_0001065 | 3300049569 | Bacteria | 21928 |
| 564 | Ga0501032_0053973 | 3300049569 | Bacteria | 2706 |
| 565 | Ga0501032_0059812 | 3300049569 | Bacteria | 2556 |
| 566 | Ga0501033_0000194 | 3300049570 | Bacteria | 58635 |
| 567 | Ga0501033_0013182 | 3300049570 | Bacteria | 6297 |
| 568 | Ga0501033_0108379 | 3300049570 | Bacteria | 2023 |
| 569 | Ga0501033_0268882 | 3300049570 | Bacteria | 1205 |
| 570 | Ga0501034_0196361 | 3300049571 | Bacteria | 1977 |
| 571 | Ga0501036_0000186 | 3300049572 | Bacteria | 41220 |
| 572 | Ga0501036_0031698 | 3300049572 | Bacteria | 4467 |
| 573 | Ga0501036_0056758 | 3300049572 | Bacteria | 3317 |
| 574 | Ga0501036_0363866 | 3300049572 | Bacteria | 1207 |
| 575 | Ga0501037_0000348 | 3300049573 | Bacteria | 38976 |
| 576 | Ga0501037_0046700 | 3300049573 | Bacteria | 3176 |
| 577 | Ga0501037_0064110 | 3300049573 | Bacteria | 2678 |
| 578 | Ga0501038_0000412 | 3300049574 | Bacteria | 37074 |
| 579 | Ga0501038_0041072 | 3300049574 | Bacteria | 4035 |
| 580 | Ga0501038_0062820 | 3300049574 | Bacteria | 3172 |
| 581 | Ga0501038_0379302 | 3300049574 | Bacteria | 1097 |
| 582 | Ga0501039_0000100 | 3300049575 | Bacteria | 60151 |
| 583 | Ga0501039_0002789 | 3300049575 | Bacteria | 13051 |
| 584 | Ga0501039_0019384 | 3300049575 | Bacteria | 5214 |
| 585 | Ga0501039_0101927 | 3300049575 | Bacteria | 2240 |
| 586 | Ga0501039_0332924 | 3300049575 | Bacteria | 1193 |
| 587 | Ga0501040_0000151 | 3300049576 | Bacteria | 38289 |
| 588 | Ga0501040_0006712 | 3300049576 | Bacteria | 7466 |
| 589 | Ga0501041_0011135 | 3300049577 | Bacteria | 5311 |
| 590 | Ga0501041_0087643 | 3300049577 | Bacteria | 1921 |
| 591 | Ga0501041_0214490 | 3300049577 | Bacteria | 1207 |
| 592 | Ga0501042_0000021 | 3300049578 | Bacteria | 50302 |
| 593 | Ga0501042_0012665 | 3300049578 | Bacteria | 5722 |
| 594 | Ga0501043_0000992 | 3300049579 | Bacteria | 25034 |
| 595 | Ga0501043_0050455 | 3300049579 | Bacteria | 3270 |
| 596 | Ga0501043_0094318 | 3300049579 | Bacteria | 2353 |
| 597 | Ga0501046_0000425 | 3300049580 | Bacteria | 42189 |
| 598 | Ga0501046_0035586 | 3300049580 | Bacteria | 4012 |
| 599 | Ga0501046_0036135 | 3300049580 | Bacteria | 3977 |
| 600 | Ga0501047_0000723 | 3300049581 | Bacteria | 34341 |
| 601 | Ga0501047_0042493 | 3300049581 | Bacteria | 4392 |
| 602 | Ga0501047_0153723 | 3300049581 | Bacteria | 2175 |
| 603 | Ga0501048_0000086 | 3300049582 | Bacteria | 48595 |
| 604 | Ga0501048_0032327 | 3300049582 | Bacteria | 3781 |
| 605 | Ga0501048_0063856 | 3300049582 | Bacteria | 2603 |
| 606 | Ga0501048_0127225 | 3300049582 | Bacteria | 1801 |
| 607 | Ga0501048_0174320 | 3300049582 | Bacteria | 1524 |
| 608 | Ga0501048_0281806 | 3300049582 | Bacteria | 1182 |
| 609 | Ga0501068_0001822 | 3300049584 | Bacteria | 11313 |
| 610 | Ga0501069_0000938 | 3300049585 | Bacteria | 13905 |
| 611 | Ga0501069_0004899 | 3300049585 | Bacteria | 6933 |
| 612 | Ga0501069_0198588 | 3300049585 | Bacteria | 1162 |
| 613 | Ga0501070_0000379 | 3300049586 | Bacteria | 40548 |
| 614 | Ga0501070_0030012 | 3300049586 | Bacteria | 4555 |
| 615 | Ga0501071_0000014 | 3300049587 | Bacteria | 60053 |
| 616 | Ga0501071_0013315 | 3300049587 | Bacteria | 5604 |
| 617 | Ga0501071_0021983 | 3300049587 | Bacteria | 4445 |
| 618 | Ga0501071_0067981 | 3300049587 | Bacteria | 2592 |
| 619 | Ga0501072_0000351 | 3300049588 | Bacteria | 32834 |
| 620 | Ga0501072_0002443 | 3300049588 | Bacteria | 13913 |
| 621 | Ga0501072_0030540 | 3300049588 | Bacteria | 4216 |
| 622 | Ga0501072_0153320 | 3300049588 | Bacteria | 1837 |
| 623 | Ga0501072_0340976 | 3300049588 | Bacteria | 1190 |
| 624 | Ga0501073_0012548 | 3300049589 | Bacteria | 6185 |
| 625 | Ga0501073_0039061 | 3300049589 | Bacteria | 3364 |
| 626 | Ga0501073_0043028 | 3300049589 | Bacteria | 3185 |
| 627 | Ga0501074_0000458 | 3300049590 | Bacteria | 24552 |
| 628 | Ga0501074_0012020 | 3300049590 | Bacteria | 6292 |
| 629 | Ga0501075_0000159 | 3300049591 | Bacteria | 34415 |
| 630 | Ga0501075_0009989 | 3300049591 | Bacteria | 6655 |
| 631 | Ga0501075_0097481 | 3300049591 | Bacteria | 2231 |
| 632 | Ga0501076_0000240 | 3300049592 | Bacteria | 33579 |
| 633 | Ga0501076_0014187 | 3300049592 | Bacteria | 5995 |
| 634 | Ga0501076_0014605 | 3300049592 | Bacteria | 5920 |
| 635 | Ga0501076_0392905 | 3300049592 | Bacteria | 1140 |
| 636 | Ga0501077_0000107 | 3300049593 | Bacteria | 43983 |
| 637 | Ga0501077_0011737 | 3300049593 | Bacteria | 5477 |
| 638 | Ga0501077_0099883 | 3300049593 | Bacteria | 1839 |
| 639 | Ga0501224_007719 | 3300049664 | Unclassified | 1567 |
| 640 | Ga0501079_0009383 | 3300049741 | Bacteria | 7415 |
| 641 | Ga0501079_0013898 | 3300049741 | Bacteria | 6142 |
| 642 | Ga0501079_0024967 | 3300049741 | Bacteria | 4584 |
| 643 | Ga0501079_0112969 | 3300049741 | Bacteria | 2111 |
| 644 | Ga0501080_0000155 | 3300049742 | Bacteria | 49054 |
| 645 | Ga0501080_0061803 | 3300049742 | Bacteria | 3486 |
| 646 | Ga0501080_0089447 | 3300049742 | Bacteria | 2860 |
| 647 | Ga0501080_0126770 | 3300049742 | Bacteria | 2364 |
| 648 | Ga0501081_0000009 | 3300049743 | Bacteria | 70386 |
| 649 | Ga0501081_0020721 | 3300049743 | Bacteria | 4385 |
| 650 | Ga0501083_0000077 | 3300049744 | Bacteria | 65581 |
| 651 | Ga0501083_0075038 | 3300049744 | Bacteria | 2246 |
| 652 | Ga0501083_0144369 | 3300049744 | Bacteria | 1558 |
| 653 | Ga0501035_0032085 | 3300049822 | Bacteria | 4781 |
| 654 | Ga0501035_0080513 | 3300049822 | Bacteria | 2875 |
| 655 | Ga0501035_0157232 | 3300049822 | Bacteria | 1970 |
| 656 | Ga0501044_0004990 | 3300049823 | Bacteria | 14828 |
| 657 | Ga0501044_0027955 | 3300049823 | Bacteria | 5952 |
| 658 | Ga0501044_0087430 | 3300049823 | Bacteria | 3148 |
| 659 | Ga0501044_0121041 | 3300049823 | Bacteria | 2618 |
| 660 | Ga0501044_0239686 | 3300049823 | Bacteria | 1758 |
| 661 | Ga0501045_0000190 | 3300049824 | Bacteria | 34526 |
| 662 | Ga0501045_0022632 | 3300049824 | Bacteria | 4501 |
| 663 | nmdc:mga0k408_55665_c2 | 3300050493 | Bacteria | 1193 |
| 664 | nmdc:mga06z11_68268_c1 | 3300050494 | Bacteria | 1873 |
| 665 | nmdc:mga05p37_234445_c1 | 3300050507 | Bacteria | 2210 |
| 666 | nmdc:mga05p37_739220_c1 | 3300050507 | Bacteria | 1086 |
| 667 | nmdc:mga09592_52083_c1 | 3300050508 | Bacteria | 3454 |
| 668 | nmdc:mga0qj67_268773_c1 | 3300050509 | Bacteria | 1383 |
| 669 | nmdc:mga06r32_283751_c1 | 3300050510 | Bacteria | 1643 |
| 670 | nmdc:mga06r32_3111_c1 | 3300050510 | Bacteria | 14857 |
| 671 | nmdc:mga08y16_39925_c1 | 3300050511 | Bacteria | 4923 |
| 672 | nmdc:mga0n895_129709_c1 | 3300050512 | Bacteria | 2546 |
| 673 | nmdc:mga0n895_171744_c1 | 3300050512 | Bacteria | 2200 |
| 674 | nmdc:mga0n895_180784_c1 | 3300050512 | Bacteria | 2140 |
| 675 | nmdc:mga0n895_182738_c1 | 3300050512 | Bacteria | 2129 |
| 676 | nmdc:mga0n895_24134_c1 | 3300050512 | Bacteria | 5727 |
| 677 | nmdc:mga0n895_30093_c1 | 3300050512 | Bacteria | 5185 |
| 678 | nmdc:mga0rr50_191496_c1 | 3300050513 | Bacteria | 1676 |
| 679 | nmdc:mga0rr50_20898_c1 | 3300050513 | Bacteria | 4457 |
| 680 | nmdc:mga0rr50_522954_c1 | 3300050513 | Bacteria | 1009 |
| 681 | nmdc:mga0rr50_79322_c1 | 3300050513 | Bacteria | 2528 |
| 682 | nmdc:mga08x19_107874_c1 | 3300050514 | Bacteria | 1854 |
| 683 | nmdc:mga08x19_135455_c1 | 3300050514 | Bacteria | 1660 |
| 684 | nmdc:mga08x19_161052_c1 | 3300050514 | Bacteria | 1524 |
| 685 | nmdc:mga08x19_57670_c1 | 3300050514 | Bacteria | 2510 |
| 686 | nmdc:mga0a205_454451_c1 | 3300050515 | Bacteria | 1141 |
| 687 | Ga0495619_0110536 | 3300053085 | Bacteria | 1878 |
| 688 | Ga0495619_0237917 | 3300053085 | Bacteria | 1262 |
| 689 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 690 | Ga0500592_000277 | 3300053116 | Bacteria | 9076 |
| 691 | Ga0500592_015485 | 3300053116 | Bacteria | 1224 |
| 692 | Ga0500658_0048722 | 3300053134 | Bacteria | 1723 |
| 693 | Ga0500568_0015288 | 3300053139 | Bacteria | 3438 |
| 694 | Ga0500573_0010374 | 3300053140 | Bacteria | 5199 |
| 695 | Ga0500616_0015346 | 3300053153 | Bacteria | 4383 |
| 696 | Ga0500627_0001588 | 3300053158 | Bacteria | 6405 |
| 697 | Ga0501084_0000378 | 3300054114 | Bacteria | 34200 |
| 698 | Ga0501084_0011572 | 3300054114 | Bacteria | 7304 |
| 699 | Ga0501084_0013470 | 3300054114 | Bacteria | 6767 |
| 700 | Ga0501082_0005870 | 3300060353 | Bacteria | 10657 |
| 701 | Ga0501082_0021882 | 3300060353 | Bacteria | 5512 |
| 702 | Ga0501082_0066665 | 3300060353 | Bacteria | 3100 |
| 703 | Ga0501082_0091098 | 3300060353 | Bacteria | 2632 |
| 704 | Ga0501082_0121870 | 3300060353 | Bacteria | 2260 |
| 705 | Ga0501082_0608370 | 3300060353 | Bacteria | 956 |
| 706 | Ga0466962_0014220 | 3300061719 | Bacteria | 3834 |
| 707 | Ga0530510_0000256 | 3300061734 | Bacteria | 33416 |
| 708 | Ga0530510_0059211 | 3300061734 | Bacteria | 2770 |
| 709 | Ga0530510_0119447 | 3300061734 | Bacteria | 1934 |
| 710 | Ga0530510_0125865 | 3300061734 | Bacteria | 1883 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025885 | Ga0207653_10036352 | Ga0207653_100363522 | 268 |
| 2 | 3300013297 | Ga0157378_10848004 | Ga0157378_108480041 | 269 |
| 3 | 3300048909 | Ga0496106_0263914 | Ga0496106_0263914_353_1210 | 276 |
| 4 | 3300005843 | Ga0068860_100082228 | Ga0068860_1000822283 | 288 |
| 5 | 3300060353 | Ga0501082_0608370 | Ga0501082_0608370_13_936 | 288 |
| 6 | 3300048926 | Ga0496123_0016109 | Ga0496123_0016109_23_904 | 289 |
| 7 | 3300048915 | Ga0496112_0321485 | Ga0496112_0321485_545_1453 | 290 |
| 8 | 3300048925 | Ga0496122_0120295 | Ga0496122_0120295_22_903 | 290 |
| 9 | 3300053087 | Ga0500643_000004 | Ga0500643_000004_259496_260404 | 290 |
| 10 | iso_pu_bacteria | 2891554331 | 2891560683 | 294 |
| 11 | 3300035691 | Ga0373931_0151276 | Ga0373931_0151276_42_953 | 297 |
| 12 | 3300050494 | nmdc:mga06z11_68268_c1 | nmdc:mga06z11_68268_c1_29_970 | 298 |
| 13 | 3300044656 | Ga0466969_0145401 | Ga0466969_0145401_105_1034 | 299 |
| 14 | 3300045049 | Ga0466959_0009302 | Ga0466959_0009302_1136_2065 | 299 |
| 15 | 3300050513 | nmdc:mga0rr50_522954_c1 | nmdc:mga0rr50_522954_c1_67_984 | 299 |
| 16 | 3300025939 | Ga0207665_10129051 | Ga0207665_101290512 | 300 |
| 17 | 3300044693 | Ga0466961_0032921 | Ga0466961_0032921_38_967 | 300 |
| 18 | 3300044719 | Ga0466971_0005825 | Ga0466971_0005825_1483_2412 | 300 |
| 19 | 3300044842 | Ga0466957_0285728 | Ga0466957_0285728_128_1057 | 300 |
| 20 | 3300049570 | Ga0501033_0108379 | Ga0501033_0108379_663_1592 | 300 |
| 21 | 3300049575 | Ga0501039_0332924 | Ga0501039_0332924_231_1160 | 300 |
| 22 | 3300054114 | Ga0501084_0011572 | Ga0501084_0011572_5503_6432 | 300 |
| 23 | 3300061719 | Ga0466962_0014220 | Ga0466962_0014220_2833_3762 | 300 |
| 24 | 3300061734 | Ga0530510_0119447 | Ga0530510_0119447_977_1906 | 300 |
| 25 | 3300005329 | Ga0070683_100355989 | Ga0070683_1003559892 | 301 |
| 26 | 3300005436 | Ga0070713_100448866 | Ga0070713_1004488662 | 301 |
| 27 | 3300005458 | Ga0070681_10090440 | Ga0070681_100904403 | 301 |
| 28 | 3300005563 | Ga0068855_100009909 | Ga0068855_1000099094 | 301 |
| 29 | 3300025913 | Ga0207695_10025883 | Ga0207695_100258835 | 301 |
| 30 | 3300025949 | Ga0207667_10055661 | Ga0207667_100556611 | 301 |
| 31 | 3300035118 | Ga0373954_0143235 | Ga0373954_0143235_43_966 | 301 |
| 32 | 3300014969 | Ga0157376_10003459 | Ga0157376_1000345913 | 302 |
| 33 | 3300037853 | Ga0436364_0669554 | Ga0436364_0669554_4474_5397 | 302 |
| 34 | 3300039437 | Ga0436365_1290487 | Ga0436365_1290487_1278_2213 | 302 |
| 35 | 3300042157 | Ga0439458_0024318 | Ga0439458_0024318_151_1077 | 302 |
| 36 | 3300044706 | Ga0466964_0004696 | Ga0466964_0004696_3389_4315 | 302 |
| 37 | 3300044842 | Ga0466957_0020032 | Ga0466957_0020032_1053_1979 | 302 |
| 38 | 3300046461 | Ga0495641_0033399 | Ga0495641_0033399_562_1497 | 302 |
| 39 | 3300046809 | Ga0495600_0288990 | Ga0495600_0288990_68_1003 | 302 |
| 40 | 3300048905 | Ga0496102_0528567 | Ga0496102_0528567_45_980 | 302 |
| 41 | 3300049568 | Ga0501031_0000328 | Ga0501031_0000328_19591_20526 | 302 |
| 42 | 3300049569 | Ga0501032_0001065 | Ga0501032_0001065_19052_19987 | 302 |
| 43 | 3300049570 | Ga0501033_0000194 | Ga0501033_0000194_54741_55676 | 302 |
| 44 | 3300049572 | Ga0501036_0000186 | Ga0501036_0000186_39151_40086 | 302 |
| 45 | 3300049573 | Ga0501037_0000348 | Ga0501037_0000348_13141_14076 | 302 |
| 46 | 3300049574 | Ga0501038_0000412 | Ga0501038_0000412_33153_34088 | 302 |
| 47 | 3300049575 | Ga0501039_0000100 | Ga0501039_0000100_39648_40583 | 302 |
| 48 | 3300049576 | Ga0501040_0000151 | Ga0501040_0000151_30001_30936 | 302 |
| 49 | 3300049578 | Ga0501042_0000021 | Ga0501042_0000021_39520_40455 | 302 |
| 50 | 3300049579 | Ga0501043_0000992 | Ga0501043_0000992_1977_2912 | 302 |
| 51 | 3300049580 | Ga0501046_0000425 | Ga0501046_0000425_39148_40083 | 302 |
| 52 | 3300049581 | Ga0501047_0000723 | Ga0501047_0000723_30024_30959 | 302 |
| 53 | 3300049582 | Ga0501048_0000086 | Ga0501048_0000086_14481_15416 | 302 |
| 54 | 3300049582 | Ga0501048_0174320 | Ga0501048_0174320_151_1086 | 302 |
| 55 | 3300049584 | Ga0501068_0001822 | Ga0501068_0001822_9689_10624 | 302 |
| 56 | 3300049585 | Ga0501069_0000938 | Ga0501069_0000938_6638_7573 | 302 |
| 57 | 3300049585 | Ga0501069_0198588 | Ga0501069_0198588_54_989 | 302 |
| 58 | 3300049586 | Ga0501070_0000379 | Ga0501070_0000379_17465_18400 | 302 |
| 59 | 3300049587 | Ga0501071_0000014 | Ga0501071_0000014_39645_40580 | 302 |
| 60 | 3300049587 | Ga0501071_0067981 | Ga0501071_0067981_1272_2207 | 302 |
| 61 | 3300049588 | Ga0501072_0000351 | Ga0501072_0000351_1923_2858 | 302 |
| 62 | 3300049589 | Ga0501073_0012548 | Ga0501073_0012548_1973_2908 | 302 |
| 63 | 3300049590 | Ga0501074_0000458 | Ga0501074_0000458_1948_2883 | 302 |
| 64 | 3300049591 | Ga0501075_0000159 | Ga0501075_0000159_3480_4415 | 302 |
| 65 | 3300049592 | Ga0501076_0000240 | Ga0501076_0000240_30001_30936 | 302 |
| 66 | 3300049593 | Ga0501077_0000107 | Ga0501077_0000107_41451_42386 | 302 |
| 67 | 3300049741 | Ga0501079_0024967 | Ga0501079_0024967_2960_3895 | 302 |
| 68 | 3300049742 | Ga0501080_0000155 | Ga0501080_0000155_31683_32618 | 302 |
| 69 | 3300049742 | Ga0501080_0126770 | Ga0501080_0126770_1004_1939 | 302 |
| 70 | 3300049743 | Ga0501081_0000009 | Ga0501081_0000009_37230_38165 | 302 |
| 71 | 3300049744 | Ga0501083_0000077 | Ga0501083_0000077_44993_45928 | 302 |
| 72 | 3300049744 | Ga0501083_0144369 | Ga0501083_0144369_12_947 | 302 |
| 73 | 3300049822 | Ga0501035_0032085 | Ga0501035_0032085_3483_4418 | 302 |
| 74 | 3300049823 | Ga0501044_0004990 | Ga0501044_0004990_1999_2934 | 302 |
| 75 | 3300049824 | Ga0501045_0000190 | Ga0501045_0000190_2345_3280 | 302 |
| 76 | 3300050512 | nmdc:mga0n895_180784_c1 | nmdc:mga0n895_180784_c1_1166_2101 | 302 |
| 77 | 3300054114 | Ga0501084_0000378 | Ga0501084_0000378_2000_2935 | 302 |
| 78 | 3300060353 | Ga0501082_0091098 | Ga0501082_0091098_690_1625 | 302 |
| 79 | 3300061734 | Ga0530510_0000256 | Ga0530510_0000256_2481_3416 | 302 |
| 80 | 3300003187 | JGI25151J46595_10000249 | JGI25151J46595_100002497 | 303 |
| 81 | 3300005843 | Ga0068860_100268190 | Ga0068860_1002681902 | 303 |
| 82 | 3300021361 | Ga0213872_10108812 | Ga0213872_101088121 | 303 |
| 83 | 3300025294 | Ga0209025_1000003 | Ga0209025_10000031140 | 303 |
| 84 | 3300025941 | Ga0207711_10083240 | Ga0207711_100832403 | 303 |
| 85 | 3300026035 | Ga0207703_10108414 | Ga0207703_101084141 | 303 |
| 86 | 3300046683 | Ga0495658_0041905 | Ga0495658_0041905_343_1278 | 303 |
| 87 | 2162886007 | SwRhRL2b_contig_273078 | SwRhRL2b_0870.00006850 | 304 |
| 88 | 3300007265 | Ga0099794_10028232 | Ga0099794_100282322 | 304 |
| 89 | 3300007788 | Ga0099795_10007353 | Ga0099795_100073535 | 304 |
| 90 | 3300039437 | Ga0436365_0909013 | Ga0436365_0909013_1844_2773 | 304 |
| 91 | 3300039450 | Ga0436363_0428108 | Ga0436363_0428108_49_978 | 304 |
| 92 | 3300046474 | Ga0495605_0000018 | Ga0495605_0000018_138102_139079 | 304 |
| 93 | 3300009147 | Ga0114129_10081000 | Ga0114129_100810002 | 305 |
| 94 | 3300030521 | Ga0307511_10004267 | Ga0307511_100042674 | 305 |
| 95 | 3300042876 | Ga0451577_0121858 | Ga0451577_0121858_1143_2084 | 305 |
| 96 | 3300044712 | Ga0453684_0000185 | Ga0453684_0000185_191701_192642 | 305 |
| 97 | 3300046491 | Ga0495584_0020006 | Ga0495584_0020006_1952_2887 | 305 |
| 98 | 3300046506 | Ga0495583_0000552 | Ga0495583_0000552_23401_24336 | 305 |
| 99 | 3300046519 | Ga0495632_0041470 | Ga0495632_0041470_181_1113 | 305 |
| 100 | 3300046558 | Ga0495633_0132015 | Ga0495633_0132015_157_1092 | 305 |
| 101 | 3300046616 | Ga0495668_0002869 | Ga0495668_0002869_6618_7553 | 305 |
| 102 | 3300046794 | Ga0495589_0059403 | Ga0495589_0059403_316_1251 | 305 |
| 103 | 3300047443 | Ga0495687_020394 | Ga0495687_020394_1938_2870 | 305 |
| 104 | 3300049459 | Ga0495678_043008 | Ga0495678_043008_68_1003 | 305 |
| 105 | 3300050509 | nmdc:mga0qj67_268773_c1 | nmdc:mga0qj67_268773_c1_148_1083 | 305 |
| 106 | 3300050510 | nmdc:mga06r32_283751_c1 | nmdc:mga06r32_283751_c1_272_1207 | 305 |
| 107 | 3300053116 | Ga0500592_000277 | Ga0500592_000277_3813_4748 | 305 |
| 108 | 3300006038 | Ga0075365_10000319 | Ga0075365_100003194 | 306 |
| 109 | 3300039450 | Ga0436363_1147568 | Ga0436363_1147568_769_1788 | 307 |
| 110 | 3300049459 | Ga0495678_014818 | Ga0495678_014818_1380_2363 | 307 |
| 111 | 3300009174 | Ga0105241_10128315 | Ga0105241_101283152 | 308 |
| 112 | 3300025905 | Ga0207685_10032511 | Ga0207685_100325112 | 309 |
| 113 | 3300025928 | Ga0207700_10029682 | Ga0207700_100296822 | 309 |
| 114 | 3300026118 | Ga0207675_100110943 | Ga0207675_1001109432 | 309 |
| 115 | 3300049577 | Ga0501041_0087643 | Ga0501041_0087643_89_1078 | 309 |
| 116 | 3300060353 | Ga0501082_0066665 | Ga0501082_0066665_308_1297 | 309 |
| 117 | 3300049572 | Ga0501036_0056758 | Ga0501036_0056758_121_1110 | 310 |
| 118 | 3300049573 | Ga0501037_0046700 | Ga0501037_0046700_1228_2217 | 310 |
| 119 | 3300049575 | Ga0501039_0101927 | Ga0501039_0101927_838_1827 | 310 |
| 120 | 3300049589 | Ga0501073_0039061 | Ga0501073_0039061_1339_2328 | 310 |
| 121 | 3300049742 | Ga0501080_0089447 | Ga0501080_0089447_1041_2030 | 310 |
| 122 | 3300049744 | Ga0501083_0075038 | Ga0501083_0075038_1091_2080 | 310 |
| 123 | 3300049823 | Ga0501044_0087430 | Ga0501044_0087430_1339_2328 | 310 |
| 124 | 3300005435 | Ga0070714_100544019 | Ga0070714_1005440191 | 311 |
| 125 | 3300005439 | Ga0070711_100004985 | Ga0070711_1000049856 | 311 |
| 126 | 3300025929 | Ga0207664_10174493 | Ga0207664_101744932 | 311 |
| 127 | 3300049592 | Ga0501076_0014605 | Ga0501076_0014605_2525_3514 | 311 |
| 128 | 3300037853 | Ga0436364_0159653 | Ga0436364_0159653_345_1313 | 312 |
| 129 | 3300044684 | Ga0466966_0054719 | Ga0466966_0054719_718_1677 | 313 |
| 130 | 3300045049 | Ga0466959_0107831 | Ga0466959_0107831_452_1411 | 313 |
| 131 | 3300005329 | Ga0070683_100162012 | Ga0070683_1001620123 | 315 |
| 132 | 3300036712 | Ga0316584_0192299 | Ga0316584_0192299_500_1471 | 315 |
| 133 | 3300005843 | Ga0068860_100564791 | Ga0068860_1005647912 | 316 |
| 134 | 3300025972 | Ga0207668_10097389 | Ga0207668_100973891 | 316 |
| 135 | 3300048903 | Ga0496100_0013957 | Ga0496100_0013957_2392_3375 | 316 |
| 136 | 3300048904 | Ga0496101_0004100 | Ga0496101_0004100_5408_6391 | 316 |
| 137 | 3300048905 | Ga0496102_0013767 | Ga0496102_0013767_405_1388 | 316 |
| 138 | 3300048908 | Ga0496105_0042362 | Ga0496105_0042362_2218_3201 | 316 |
| 139 | 3300048909 | Ga0496106_0000189 | Ga0496106_0000189_17943_18926 | 316 |
| 140 | 3300048910 | Ga0496107_0003423 | Ga0496107_0003423_7155_8138 | 316 |
| 141 | 3300048917 | Ga0496114_0002109 | Ga0496114_0002109_2862_3845 | 316 |
| 142 | 3300049568 | Ga0501031_0124766 | Ga0501031_0124766_642_1619 | 316 |
| 143 | 3300049574 | Ga0501038_0379302 | Ga0501038_0379302_51_1028 | 316 |
| 144 | 3300049588 | Ga0501072_0153320 | Ga0501072_0153320_696_1673 | 316 |
| 145 | 3300049593 | Ga0501077_0099883 | Ga0501077_0099883_567_1544 | 316 |
| 146 | iso_pu_bacteria | 2619619299 | 2621299944 | 316 |
| 147 | iso_pu_bacteria | 2738541265 | 2738669941 | 316 |
| 148 | iso_pu_bacteria | 2738541282 | 2738748334 | 316 |
| 149 | iso_pu_bacteria | 2738541303 | 2738857376 | 316 |
| 150 | iso_pu_bacteria | 2816332298 | 2817491238 | 316 |
| 151 | iso_pu_bacteria | 2855730933 | 2855733816 | 316 |
| 152 | iso_pu_bacteria | 2855767633 | 2855769406 | 316 |
| 153 | 3300013297 | Ga0157378_10001980 | Ga0157378_100019803 | 317 |
| 154 | 3300031240 | Ga0265320_10072255 | Ga0265320_100722552 | 317 |
| 155 | 3300032126 | Ga0307415_100239747 | Ga0307415_1002397471 | 317 |
| 156 | 3300035692 | Ga0373935_0243697 | Ga0373935_0243697_172_1143 | 317 |
| 157 | 3300035695 | Ga0373927_0063745 | Ga0373927_0063745_860_1831 | 317 |
| 158 | 3300037068 | Ga0373925_0187750 | Ga0373925_0187750_188_1159 | 317 |
| 159 | 3300039453 | Ga0436362_1138586 | Ga0436362_1138586_26_994 | 317 |
| 160 | 3300046530 | Ga0495654_0001175 | Ga0495654_0001175_16203_17198 | 317 |
| 161 | 3300046616 | Ga0495668_0002529 | Ga0495668_0002529_9448_10443 | 317 |
| 162 | 3300046794 | Ga0495589_0014244 | Ga0495589_0014244_1659_2654 | 317 |
| 163 | 3300048088 | Ga0495602_0181880 | Ga0495602_0181880_191_1162 | 317 |
| 164 | 3300048907 | Ga0496104_0098182 | Ga0496104_0098182_1825_2793 | 317 |
| 165 | 3300048929 | Ga0496126_0049500 | Ga0496126_0049500_1835_2815 | 317 |
| 166 | 3300053158 | Ga0500627_0001588 | Ga0500627_0001588_985_1980 | 317 |
| 167 | iso_pu_bacteria | 2852680915 | 2852681830 | 317 |
| 168 | iso_pu_bacteria | 2881412998 | 2881413877 | 317 |
| 169 | 3300005367 | Ga0070667_100074723 | Ga0070667_1000747232 | 318 |
| 170 | 3300025909 | Ga0207705_10185540 | Ga0207705_101855401 | 318 |
| 171 | 3300053140 | Ga0500573_0010374 | Ga0500573_0010374_2000_2977 | 318 |
| 172 | 3300031238 | Ga0265332_10040108 | Ga0265332_100401082 | 319 |
| 173 | 3300031249 | Ga0265339_10024868 | Ga0265339_100248682 | 319 |
| 174 | 3300031344 | Ga0265316_10002370 | Ga0265316_1000237011 | 319 |
| 175 | 3300031711 | Ga0265314_10000001 | Ga0265314_10000001866 | 319 |
| 176 | 3300049570 | Ga0501033_0268882 | Ga0501033_0268882_19_1005 | 319 |
| 177 | iso_pu_bacteria | 2511231119 | 2511701705 | 319 |
| 178 | iso_pu_bacteria | 2545555800 | 2545557556 | 319 |
| 179 | iso_pu_bacteria | 2576861599 | 2578931943 | 319 |
| 180 | iso_pu_bacteria | 2648501850 | 2651531314 | 319 |
| 181 | iso_pu_bacteria | 2671180844 | 2674421339 | 319 |
| 182 | iso_pu_bacteria | 2695420354 | 2695629672 | 319 |
| 183 | iso_pu_bacteria | 2716884898 | 2717914633 | 319 |
| 184 | iso_pu_bacteria | 2831426010 | 2831433613 | 319 |
| 185 | iso_pu_bacteria | 2848694841 | 2848702406 | 319 |
| 186 | iso_pu_bacteria | 2877768649 | 2877772605 | 319 |
| 187 | iso_pu_bacteria | 2880169592 | 2880173451 | 319 |
| 188 | iso_pu_bacteria | 2897109615 | 2897113733 | 319 |
| 189 | iso_pu_bacteria | 2904560550 | 2904563330 | 319 |
| 190 | iso_pu_bacteria | 2921250672 | 2921256092 | 319 |
| 191 | iso_pu_bacteria | 2969141011 | 2969145180 | 319 |
| 192 | iso_pu_bacteria | 2971893375 | 2971897307 | 319 |
| 193 | iso_pu_bacteria | 2996706504 | 2996710563 | 319 |
| 194 | iso_pu_bacteria | 8022630665 | 8022632822 | 319 |
| 195 | iso_pu_bacteria | 8051952484 | 8051953782 | 319 |
| 196 | iso_pu_bacteria | 8052174270 | 8052178018 | 319 |
| 197 | 3300005295 | Ga0065707_10096761 | Ga0065707_100967612 | 320 |
| 198 | 3300005337 | Ga0070682_100299748 | Ga0070682_1002997481 | 320 |
| 199 | 3300005338 | Ga0068868_100224085 | Ga0068868_1002240852 | 320 |
| 200 | 3300005437 | Ga0070710_10106441 | Ga0070710_101064412 | 320 |
| 201 | 3300005439 | Ga0070711_100074501 | Ga0070711_1000745012 | 320 |
| 202 | 3300005440 | Ga0070705_100085042 | Ga0070705_1000850422 | 320 |
| 203 | 3300005471 | Ga0070698_100027381 | Ga0070698_1000273816 | 320 |
| 204 | 3300005536 | Ga0070697_100151406 | Ga0070697_1001514061 | 320 |
| 205 | 3300005544 | Ga0070686_100075235 | Ga0070686_1000752352 | 320 |
| 206 | 3300005544 | Ga0070686_100303990 | Ga0070686_1003039901 | 320 |
| 207 | 3300005549 | Ga0070704_100436208 | Ga0070704_1004362081 | 320 |
| 208 | 3300005983 | Ga0081540_1025305 | Ga0081540_10253054 | 320 |
| 209 | 3300006038 | Ga0075365_10005282 | Ga0075365_100052825 | 320 |
| 210 | 3300006175 | Ga0070712_100014072 | Ga0070712_1000140723 | 320 |
| 211 | 3300006175 | Ga0070712_100034086 | Ga0070712_1000340862 | 320 |
| 212 | 3300006844 | Ga0075428_100043590 | Ga0075428_1000435902 | 320 |
| 213 | 3300006847 | Ga0075431_100004271 | Ga0075431_1000042715 | 320 |
| 214 | 3300006847 | Ga0075431_100407760 | Ga0075431_1004077601 | 320 |
| 215 | 3300006852 | Ga0075433_10042903 | Ga0075433_100429032 | 320 |
| 216 | 3300006871 | Ga0075434_100013850 | Ga0075434_1000138509 | 320 |
| 217 | 3300006871 | Ga0075434_100143455 | Ga0075434_1001434552 | 320 |
| 218 | 3300006871 | Ga0075434_100162715 | Ga0075434_1001627153 | 320 |
| 219 | 3300006871 | Ga0075434_100214628 | Ga0075434_1002146282 | 320 |
| 220 | 3300006914 | Ga0075436_100012017 | Ga0075436_1000120176 | 320 |
| 221 | 3300007076 | Ga0075435_100007769 | Ga0075435_1000077694 | 320 |
| 222 | 3300007076 | Ga0075435_100011913 | Ga0075435_1000119132 | 320 |
| 223 | 3300009094 | Ga0111539_10022378 | Ga0111539_100223785 | 320 |
| 224 | 3300009098 | Ga0105245_10025506 | Ga0105245_100255063 | 320 |
| 225 | 3300009147 | Ga0114129_10035833 | Ga0114129_100358339 | 320 |
| 226 | 3300009147 | Ga0114129_10048471 | Ga0114129_100484713 | 320 |
| 227 | 3300009553 | Ga0105249_10069414 | Ga0105249_100694143 | 320 |
| 228 | 3300011119 | Ga0105246_10202605 | Ga0105246_102026052 | 320 |
| 229 | 3300013105 | Ga0157369_10005309 | Ga0157369_1000530919 | 320 |
| 230 | 3300013307 | Ga0157372_10121144 | Ga0157372_101211444 | 320 |
| 231 | 3300013308 | Ga0157375_10041011 | Ga0157375_100410113 | 320 |
| 232 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002422 | 320 |
| 233 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001505 | 320 |
| 234 | 3300025898 | Ga0207692_10095471 | Ga0207692_100954712 | 320 |
| 235 | 3300025901 | Ga0207688_10092746 | Ga0207688_100927463 | 320 |
| 236 | 3300025915 | Ga0207693_10004813 | Ga0207693_100048134 | 320 |
| 237 | 3300025915 | Ga0207693_10059170 | Ga0207693_100591703 | 320 |
| 238 | 3300025915 | Ga0207693_10072293 | Ga0207693_100722933 | 320 |
| 239 | 3300025939 | Ga0207665_10191315 | Ga0207665_101913152 | 320 |
| 240 | 3300025945 | Ga0207679_10009581 | Ga0207679_100095813 | 320 |
| 241 | 3300026075 | Ga0207708_10096368 | Ga0207708_100963683 | 320 |
| 242 | 3300026121 | Ga0207683_10026048 | Ga0207683_100260483 | 320 |
| 243 | 3300028800 | Ga0265338_10070724 | Ga0265338_100707242 | 320 |
| 244 | 3300031242 | Ga0265329_10012429 | Ga0265329_100124293 | 320 |
| 245 | 3300031251 | Ga0265327_10027392 | Ga0265327_100273923 | 320 |
| 246 | 3300031344 | Ga0265316_10061012 | Ga0265316_100610123 | 320 |
| 247 | 3300031711 | Ga0265314_10003041 | Ga0265314_100030417 | 320 |
| 248 | 3300031712 | Ga0265342_10026697 | Ga0265342_100266973 | 320 |
| 249 | 3300032004 | Ga0307414_10000024 | Ga0307414_10000024119 | 320 |
| 250 | 3300032004 | Ga0307414_10019066 | Ga0307414_100190662 | 320 |
| 251 | 3300032004 | Ga0307414_10191158 | Ga0307414_101911582 | 320 |
| 252 | 3300035170 | Ga0373943_0001085 | Ga0373943_0001085_1654_2643 | 320 |
| 253 | 3300035171 | Ga0373946_0006506 | Ga0373946_0006506_2079_3068 | 320 |
| 254 | 3300035691 | Ga0373931_0196782 | Ga0373931_0196782_154_1140 | 320 |
| 255 | 3300035692 | Ga0373935_0037596 | Ga0373935_0037596_293_1282 | 320 |
| 256 | 3300035725 | Ga0373947_0003233 | Ga0373947_0003233_2644_3633 | 320 |
| 257 | 3300037466 | Ga0395898_0012790 | Ga0395898_0012790_1283_2272 | 320 |
| 258 | 3300037466 | Ga0395898_0033533 | Ga0395898_0033533_1547_2536 | 320 |
| 259 | 3300037471 | Ga0395905_0056934 | Ga0395905_0056934_2407_3396 | 320 |
| 260 | 3300037853 | Ga0436364_1341086 | Ga0436364_1341086_15511_16500 | 320 |
| 261 | 3300038443 | Ga0395901_0015898 | Ga0395901_0015898_3721_4710 | 320 |
| 262 | 3300038443 | Ga0395901_0060228 | Ga0395901_0060228_329_1318 | 320 |
| 263 | 3300039437 | Ga0436365_0447799 | Ga0436365_0447799_22087_23064 | 320 |
| 264 | 3300039437 | Ga0436365_1154184 | Ga0436365_1154184_1021_2046 | 320 |
| 265 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_504582_505559 | 320 |
| 266 | 3300044683 | Ga0466965_0190516 | Ga0466965_0190516_68_1057 | 320 |
| 267 | 3300044684 | Ga0466966_0044790 | Ga0466966_0044790_880_1869 | 320 |
| 268 | 3300044693 | Ga0466961_0017907 | Ga0466961_0017907_3119_4108 | 320 |
| 269 | 3300044694 | Ga0466963_0015612 | Ga0466963_0015612_2317_3306 | 320 |
| 270 | 3300044712 | Ga0453684_0024229 | Ga0453684_0024229_2172_3302 | 320 |
| 271 | 3300044719 | Ga0466971_0012399 | Ga0466971_0012399_766_1758 | 320 |
| 272 | 3300044842 | Ga0466957_0006783 | Ga0466957_0006783_911_1903 | 320 |
| 273 | 3300045049 | Ga0466959_0000870 | Ga0466959_0000870_2752_3741 | 320 |
| 274 | 3300045836 | Ga0466958_0007414 | Ga0466958_0007414_2529_3518 | 320 |
| 275 | 3300045836 | Ga0466958_0041095 | Ga0466958_0041095_38_1030 | 320 |
| 276 | 3300046455 | Ga0495603_0109838 | Ga0495603_0109838_597_1586 | 320 |
| 277 | 3300046459 | Ga0495629_0000259 | Ga0495629_0000259_39137_40126 | 320 |
| 278 | 3300046461 | Ga0495641_0000362 | Ga0495641_0000362_19873_20862 | 320 |
| 279 | 3300046463 | Ga0495653_0017476 | Ga0495653_0017476_1707_2696 | 320 |
| 280 | 3300046473 | Ga0495582_0001127 | Ga0495582_0001127_5503_6492 | 320 |
| 281 | 3300046475 | Ga0495639_0010305 | Ga0495639_0010305_420_1409 | 320 |
| 282 | 3300046476 | Ga0495662_0000661 | Ga0495662_0000661_9258_10247 | 320 |
| 283 | 3300046517 | Ga0495630_0015000 | Ga0495630_0015000_1526_2515 | 320 |
| 284 | 3300046531 | Ga0495665_0006418 | Ga0495665_0006418_479_1468 | 320 |
| 285 | 3300046533 | Ga0495640_0013393 | Ga0495640_0013393_3033_4022 | 320 |
| 286 | 3300046642 | Ga0495634_0023543 | Ga0495634_0023543_1046_2035 | 320 |
| 287 | 3300046681 | Ga0495647_0031329 | Ga0495647_0031329_867_1856 | 320 |
| 288 | 3300046683 | Ga0495658_0000467 | Ga0495658_0000467_3016_4005 | 320 |
| 289 | 3300046689 | Ga0495613_0019003 | Ga0495613_0019003_494_1483 | 320 |
| 290 | 3300046690 | Ga0495624_0001840 | Ga0495624_0001840_12396_13385 | 320 |
| 291 | 3300046809 | Ga0495600_0026369 | Ga0495600_0026369_2160_3149 | 320 |
| 292 | 3300047315 | Ga0495581_0000327 | Ga0495581_0000327_11291_12280 | 320 |
| 293 | 3300047319 | Ga0495674_0033545 | Ga0495674_0033545_1940_2929 | 320 |
| 294 | 3300047321 | Ga0495676_0000925 | Ga0495676_0000925_19336_20325 | 320 |
| 295 | 3300047322 | Ga0495680_0016990 | Ga0495680_0016990_4748_5737 | 320 |
| 296 | 3300047471 | Ga0495684_0005134 | Ga0495684_0005134_8803_9792 | 320 |
| 297 | 3300048904 | Ga0496101_0115790 | Ga0496101_0115790_481_1470 | 320 |
| 298 | 3300048910 | Ga0496107_0081256 | Ga0496107_0081256_499_1488 | 320 |
| 299 | 3300048910 | Ga0496107_0286584 | Ga0496107_0286584_200_1189 | 320 |
| 300 | 3300048914 | Ga0496111_0220729 | Ga0496111_0220729_116_1105 | 320 |
| 301 | 3300048916 | Ga0496113_0067195 | Ga0496113_0067195_1081_2070 | 320 |
| 302 | 3300048918 | Ga0496115_0000070 | Ga0496115_0000070_68757_69791 | 320 |
| 303 | 3300048918 | Ga0496115_0000243 | Ga0496115_0000243_26229_27218 | 320 |
| 304 | 3300048929 | Ga0496126_0011226 | Ga0496126_0011226_7104_8099 | 320 |
| 305 | 3300049568 | Ga0501031_0143052 | Ga0501031_0143052_22_1011 | 320 |
| 306 | 3300049569 | Ga0501032_0053973 | Ga0501032_0053973_1582_2571 | 320 |
| 307 | 3300049571 | Ga0501034_0196361 | Ga0501034_0196361_47_1036 | 320 |
| 308 | 3300049572 | Ga0501036_0031698 | Ga0501036_0031698_1075_2064 | 320 |
| 309 | 3300049572 | Ga0501036_0363866 | Ga0501036_0363866_21_1010 | 320 |
| 310 | 3300049573 | Ga0501037_0064110 | Ga0501037_0064110_21_1010 | 320 |
| 311 | 3300049574 | Ga0501038_0041072 | Ga0501038_0041072_345_1334 | 320 |
| 312 | 3300049574 | Ga0501038_0062820 | Ga0501038_0062820_1617_2606 | 320 |
| 313 | 3300049575 | Ga0501039_0002789 | Ga0501039_0002789_1283_2272 | 320 |
| 314 | 3300049576 | Ga0501040_0006712 | Ga0501040_0006712_2765_3754 | 320 |
| 315 | 3300049577 | Ga0501041_0011135 | Ga0501041_0011135_3496_4485 | 320 |
| 316 | 3300049577 | Ga0501041_0214490 | Ga0501041_0214490_21_1010 | 320 |
| 317 | 3300049578 | Ga0501042_0012665 | Ga0501042_0012665_3745_4734 | 320 |
| 318 | 3300049579 | Ga0501043_0050455 | Ga0501043_0050455_1997_2986 | 320 |
| 319 | 3300049579 | Ga0501043_0094318 | Ga0501043_0094318_384_1373 | 320 |
| 320 | 3300049580 | Ga0501046_0035586 | Ga0501046_0035586_1255_2244 | 320 |
| 321 | 3300049580 | Ga0501046_0036135 | Ga0501046_0036135_2968_3957 | 320 |
| 322 | 3300049581 | Ga0501047_0042493 | Ga0501047_0042493_2450_3439 | 320 |
| 323 | 3300049582 | Ga0501048_0032327 | Ga0501048_0032327_1862_2851 | 320 |
| 324 | 3300049582 | Ga0501048_0063856 | Ga0501048_0063856_1476_2465 | 320 |
| 325 | 3300049582 | Ga0501048_0127225 | Ga0501048_0127225_213_1202 | 320 |
| 326 | 3300049585 | Ga0501069_0004899 | Ga0501069_0004899_3716_4705 | 320 |
| 327 | 3300049586 | Ga0501070_0030012 | Ga0501070_0030012_2967_3956 | 320 |
| 328 | 3300049587 | Ga0501071_0013315 | Ga0501071_0013315_253_1242 | 320 |
| 329 | 3300049587 | Ga0501071_0021983 | Ga0501071_0021983_2525_3514 | 320 |
| 330 | 3300049588 | Ga0501072_0002443 | Ga0501072_0002443_4801_5790 | 320 |
| 331 | 3300049588 | Ga0501072_0030540 | Ga0501072_0030540_1024_2013 | 320 |
| 332 | 3300049588 | Ga0501072_0340976 | Ga0501072_0340976_84_1073 | 320 |
| 333 | 3300049589 | Ga0501073_0043028 | Ga0501073_0043028_499_1488 | 320 |
| 334 | 3300049590 | Ga0501074_0012020 | Ga0501074_0012020_3838_4827 | 320 |
| 335 | 3300049591 | Ga0501075_0009989 | Ga0501075_0009989_5013_6002 | 320 |
| 336 | 3300049591 | Ga0501075_0097481 | Ga0501075_0097481_235_1224 | 320 |
| 337 | 3300049592 | Ga0501076_0014187 | Ga0501076_0014187_2477_3466 | 320 |
| 338 | 3300049592 | Ga0501076_0392905 | Ga0501076_0392905_26_1015 | 320 |
| 339 | 3300049593 | Ga0501077_0011737 | Ga0501077_0011737_1299_2288 | 320 |
| 340 | 3300049741 | Ga0501079_0009383 | Ga0501079_0009383_15_1004 | 320 |
| 341 | 3300049741 | Ga0501079_0013898 | Ga0501079_0013898_2092_3081 | 320 |
| 342 | 3300049741 | Ga0501079_0112969 | Ga0501079_0112969_15_1037 | 320 |
| 343 | 3300049742 | Ga0501080_0061803 | Ga0501080_0061803_2478_3467 | 320 |
| 344 | 3300049743 | Ga0501081_0020721 | Ga0501081_0020721_797_1786 | 320 |
| 345 | 3300049823 | Ga0501044_0239686 | Ga0501044_0239686_273_1262 | 320 |
| 346 | 3300049824 | Ga0501045_0022632 | Ga0501045_0022632_1115_2104 | 320 |
| 347 | 3300050507 | nmdc:mga05p37_234445_c1 | nmdc:mga05p37_234445_c1_778_1767 | 320 |
| 348 | 3300050507 | nmdc:mga05p37_739220_c1 | nmdc:mga05p37_739220_c1_44_1033 | 320 |
| 349 | 3300050510 | nmdc:mga06r32_3111_c1 | nmdc:mga06r32_3111_c1_9700_10689 | 320 |
| 350 | 3300050511 | nmdc:mga08y16_39925_c1 | nmdc:mga08y16_39925_c1_1135_2127 | 320 |
| 351 | 3300050512 | nmdc:mga0n895_129709_c1 | nmdc:mga0n895_129709_c1_548_1537 | 320 |
| 352 | 3300050512 | nmdc:mga0n895_182738_c1 | nmdc:mga0n895_182738_c1_294_1286 | 320 |
| 353 | 3300050513 | nmdc:mga0rr50_191496_c1 | nmdc:mga0rr50_191496_c1_426_1415 | 320 |
| 354 | 3300050514 | nmdc:mga08x19_107874_c1 | nmdc:mga08x19_107874_c1_93_1088 | 320 |
| 355 | 3300050514 | nmdc:mga08x19_135455_c1 | nmdc:mga08x19_135455_c1_418_1410 | 320 |
| 356 | 3300053085 | Ga0495619_0237917 | Ga0495619_0237917_133_1122 | 320 |
| 357 | 3300054114 | Ga0501084_0013470 | Ga0501084_0013470_3838_4827 | 320 |
| 358 | 3300060353 | Ga0501082_0005870 | Ga0501082_0005870_3665_4654 | 320 |
| 359 | 3300060353 | Ga0501082_0021882 | Ga0501082_0021882_3606_4595 | 320 |
| 360 | 3300060353 | Ga0501082_0121870 | Ga0501082_0121870_1074_2063 | 320 |
| 361 | 3300061734 | Ga0530510_0059211 | Ga0530510_0059211_1438_2427 | 320 |
| 362 | 3300061734 | Ga0530510_0125865 | Ga0530510_0125865_738_1727 | 320 |
| 363 | iso_pu_bacteria | 2728369359 | 2730139888 | 320 |
| 364 | iso_pu_bacteria | 2808606384 | 2808972334 | 320 |
| 365 | iso_pu_bacteria | 2808606390 | 2809007163 | 320 |
| 366 | iso_pu_bacteria | 2808606391 | 2809014301 | 320 |
| 367 | iso_pu_bacteria | 2821111986 | 2821113081 | 320 |
| 368 | iso_pu_bacteria | 2885526491 | 2885529521 | 320 |
| 369 | iso_pu_bacteria | 2889276214 | 2889280157 | 320 |
| 370 | 3300003781 | Ga0055536_1000301 | Ga0055536_100030113 | 321 |
| 371 | 3300003781 | Ga0055536_1016823 | Ga0055536_10168232 | 321 |
| 372 | 3300005333 | Ga0070677_10000001 | Ga0070677_10000001114 | 321 |
| 373 | 3300005439 | Ga0070711_100329020 | Ga0070711_1003290201 | 321 |
| 374 | 3300009553 | Ga0105249_10000074 | Ga0105249_1000007422 | 321 |
| 375 | 3300025304 | Ga0209257_1004775 | Ga0209257_100477510 | 321 |
| 376 | 3300025961 | Ga0207712_10000007 | Ga0207712_1000000724 | 321 |
| 377 | 3300027907 | Ga0207428_10000044 | Ga0207428_1000004428 | 321 |
| 378 | 3300031235 | Ga0265330_10000497 | Ga0265330_1000049711 | 321 |
| 379 | 3300031344 | Ga0265316_10002313 | Ga0265316_1000231312 | 321 |
| 380 | 3300031911 | Ga0307412_10014348 | Ga0307412_100143483 | 321 |
| 381 | 3300044694 | Ga0466963_0000019 | Ga0466963_0000019_13466_14446 | 321 |
| 382 | 3300046472 | Ga0495580_0131972 | Ga0495580_0131972_422_1438 | 321 |
| 383 | 3300046522 | Ga0495643_0002120 | Ga0495643_0002120_13675_14658 | 321 |
| 384 | 3300047321 | Ga0495676_0002537 | Ga0495676_0002537_8168_9178 | 321 |
| 385 | 3300048905 | Ga0496102_0000376 | Ga0496102_0000376_51208_52338 | 321 |
| 386 | 3300048906 | Ga0496103_0000293 | Ga0496103_0000293_1157_2287 | 321 |
| 387 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_299129_300109 | 321 |
| 388 | 3300048912 | Ga0496109_0000006 | Ga0496109_0000006_299129_300109 | 321 |
| 389 | 3300048919 | Ga0496116_0001007 | Ga0496116_0001007_3731_4861 | 321 |
| 390 | 3300048920 | Ga0496117_0000695 | Ga0496117_0000695_51237_52367 | 321 |
| 391 | 3300048921 | Ga0496118_0014898 | Ga0496118_0014898_1179_2309 | 321 |
| 392 | 3300048922 | Ga0496119_0020700 | Ga0496119_0020700_2489_3619 | 321 |
| 393 | 3300048927 | Ga0496124_0000735 | Ga0496124_0000735_1179_2309 | 321 |
| 394 | 3300049569 | Ga0501032_0059812 | Ga0501032_0059812_1379_2374 | 321 |
| 395 | 3300049570 | Ga0501033_0013182 | Ga0501033_0013182_4223_5218 | 321 |
| 396 | 3300049575 | Ga0501039_0019384 | Ga0501039_0019384_1085_2080 | 321 |
| 397 | 3300049581 | Ga0501047_0153723 | Ga0501047_0153723_1085_2080 | 321 |
| 398 | 3300049582 | Ga0501048_0281806 | Ga0501048_0281806_49_1044 | 321 |
| 399 | 3300049822 | Ga0501035_0080513 | Ga0501035_0080513_519_1514 | 321 |
| 400 | 3300049823 | Ga0501044_0027955 | Ga0501044_0027955_2368_3363 | 321 |
| 401 | 3300049823 | Ga0501044_0121041 | Ga0501044_0121041_983_1978 | 321 |
| 402 | 3300053139 | Ga0500568_0015288 | Ga0500568_0015288_1463_2458 | 321 |
| 403 | iso_pu_bacteria | 2721755693 | 2723604177 | 321 |
| 404 | iso_pu_bacteria | 2904162308 | 2904164799 | 321 |
| 405 | 3300001990 | JGI24737J22298_10005388 | JGI24737J22298_100053884 | 322 |
| 406 | 3300005328 | Ga0070676_10040769 | Ga0070676_100407691 | 322 |
| 407 | 3300005328 | Ga0070676_10103436 | Ga0070676_101034361 | 322 |
| 408 | 3300005366 | Ga0070659_100064137 | Ga0070659_1000641374 | 322 |
| 409 | 3300005468 | Ga0070707_100024799 | Ga0070707_1000247992 | 322 |
| 410 | 3300005563 | Ga0068855_100055255 | Ga0068855_1000552551 | 322 |
| 411 | 3300005937 | Ga0081455_10020686 | Ga0081455_100206864 | 322 |
| 412 | 3300006847 | Ga0075431_100000239 | Ga0075431_10000023920 | 322 |
| 413 | 3300009036 | Ga0105244_10058935 | Ga0105244_100589352 | 322 |
| 414 | 3300009174 | Ga0105241_10085593 | Ga0105241_100855934 | 322 |
| 415 | 3300009174 | Ga0105241_10496495 | Ga0105241_104964951 | 322 |
| 416 | 3300010375 | Ga0105239_10040629 | Ga0105239_100406292 | 322 |
| 417 | 3300013296 | Ga0157374_10396699 | Ga0157374_103966991 | 322 |
| 418 | 3300025298 | Ga0209050_1000093 | Ga0209050_1000093184 | 322 |
| 419 | 3300025907 | Ga0207645_10088850 | Ga0207645_100888502 | 322 |
| 420 | 3300025911 | Ga0207654_10024547 | Ga0207654_100245475 | 322 |
| 421 | 3300025919 | Ga0207657_10008390 | Ga0207657_100083908 | 322 |
| 422 | 3300025933 | Ga0207706_10094327 | Ga0207706_100943272 | 322 |
| 423 | 3300025934 | Ga0207686_10034213 | Ga0207686_100342132 | 322 |
| 424 | 3300025935 | Ga0207709_10055772 | Ga0207709_100557723 | 322 |
| 425 | 3300025939 | Ga0207665_10088635 | Ga0207665_100886352 | 322 |
| 426 | 3300025949 | Ga0207667_10014901 | Ga0207667_100149013 | 322 |
| 427 | 3300025972 | Ga0207668_10235369 | Ga0207668_102353692 | 322 |
| 428 | 3300028800 | Ga0265338_10016932 | Ga0265338_100169329 | 322 |
| 429 | 3300031665 | Ga0316575_10009325 | Ga0316575_100093252 | 322 |
| 430 | 3300031691 | Ga0316579_10032351 | Ga0316579_100323512 | 322 |
| 431 | 3300037312 | Ga0395899_0007423 | Ga0395899_0007423_3764_4855 | 322 |
| 432 | 3300037312 | Ga0395899_0037220 | Ga0395899_0037220_2481_3470 | 322 |
| 433 | 3300037312 | Ga0395899_0071794 | Ga0395899_0071794_1366_2355 | 322 |
| 434 | 3300037312 | Ga0395899_0078820 | Ga0395899_0078820_801_1790 | 322 |
| 435 | 3300037418 | Ga0395900_0002198 | Ga0395900_0002198_7913_8902 | 322 |
| 436 | 3300037418 | Ga0395900_0006564 | Ga0395900_0006564_160_1149 | 322 |
| 437 | 3300037418 | Ga0395900_0010142 | Ga0395900_0010142_5198_6187 | 322 |
| 438 | 3300037418 | Ga0395900_0114500 | Ga0395900_0114500_1556_2545 | 322 |
| 439 | 3300037466 | Ga0395898_0009879 | Ga0395898_0009879_7895_8884 | 322 |
| 440 | 3300037466 | Ga0395898_0016549 | Ga0395898_0016549_4713_5702 | 322 |
| 441 | 3300037471 | Ga0395905_0153168 | Ga0395905_0153168_741_1730 | 322 |
| 442 | 3300038443 | Ga0395901_0000089 | Ga0395901_0000089_50708_51799 | 322 |
| 443 | 3300038443 | Ga0395901_0027387 | Ga0395901_0027387_314_1303 | 322 |
| 444 | 3300038443 | Ga0395901_0140620 | Ga0395901_0140620_212_1303 | 322 |
| 445 | 3300038443 | Ga0395901_0354303 | Ga0395901_0354303_496_1497 | 322 |
| 446 | 3300038443 | Ga0395901_0386637 | Ga0395901_0386637_350_1339 | 322 |
| 447 | 3300039437 | Ga0436365_0243957 | Ga0436365_0243957_725_1738 | 322 |
| 448 | 3300042005 | Ga0439448_0028863 | Ga0439448_0028863_523_1512 | 322 |
| 449 | 3300042157 | Ga0439458_0008978 | Ga0439458_0008978_738_1727 | 322 |
| 450 | 3300042157 | Ga0439458_0013455 | Ga0439458_0013455_311_1402 | 322 |
| 451 | 3300044684 | Ga0466966_0125074 | Ga0466966_0125074_489_1478 | 322 |
| 452 | 3300044706 | Ga0466964_0001574 | Ga0466964_0001574_4322_5413 | 322 |
| 453 | 3300044842 | Ga0466957_0000053 | Ga0466957_0000053_25316_26305 | 322 |
| 454 | 3300044842 | Ga0466957_0108639 | Ga0466957_0108639_122_1111 | 322 |
| 455 | 3300045836 | Ga0466958_0055271 | Ga0466958_0055271_681_1670 | 322 |
| 456 | 3300045976 | Ga0466967_0004114 | Ga0466967_0004114_2012_3007 | 322 |
| 457 | 3300045976 | Ga0466967_0008826 | Ga0466967_0008826_4469_5560 | 322 |
| 458 | 3300046474 | Ga0495605_0005663 | Ga0495605_0005663_5759_6847 | 322 |
| 459 | 3300046501 | Ga0495607_0000400 | Ga0495607_0000400_3693_4781 | 322 |
| 460 | 3300046513 | Ga0495616_0002532 | Ga0495616_0002532_2271_3359 | 322 |
| 461 | 3300046522 | Ga0495643_0028882 | Ga0495643_0028882_1103_2191 | 322 |
| 462 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_288883_289971 | 322 |
| 463 | 3300046615 | Ga0495656_0011809 | Ga0495656_0011809_57_1145 | 322 |
| 464 | 3300046616 | Ga0495668_0032029 | Ga0495668_0032029_430_1416 | 322 |
| 465 | 3300046665 | Ga0495661_0000023 | Ga0495661_0000023_11002_12090 | 322 |
| 466 | 3300046794 | Ga0495589_0000027 | Ga0495589_0000027_46154_47242 | 322 |
| 467 | 3300047319 | Ga0495674_0027735 | Ga0495674_0027735_1880_2866 | 322 |
| 468 | 3300047443 | Ga0495687_000019 | Ga0495687_000019_288883_289971 | 322 |
| 469 | 3300047445 | Ga0495677_0000055 | Ga0495677_0000055_51775_52863 | 322 |
| 470 | 3300048091 | Ga0495626_0000417 | Ga0495626_0000417_31046_32134 | 322 |
| 471 | 3300048908 | Ga0496105_0303759 | Ga0496105_0303759_136_1125 | 322 |
| 472 | 3300048925 | Ga0496122_0005591 | Ga0496122_0005591_8779_9762 | 322 |
| 473 | 3300048927 | Ga0496124_0018078 | Ga0496124_0018078_617_1708 | 322 |
| 474 | iso_pu_bacteria | 2848297114 | 2848300223 | 322 |
| 475 | 3300003762 | Ga0055542_1001795 | Ga0055542_10017958 | 323 |
| 476 | 3300005327 | Ga0070658_10047333 | Ga0070658_100473332 | 323 |
| 477 | 3300005330 | Ga0070690_100089660 | Ga0070690_1000896602 | 323 |
| 478 | 3300005331 | Ga0070670_100030601 | Ga0070670_1000306013 | 323 |
| 479 | 3300005335 | Ga0070666_10005910 | Ga0070666_100059102 | 323 |
| 480 | 3300005338 | Ga0068868_100100153 | Ga0068868_1001001534 | 323 |
| 481 | 3300005339 | Ga0070660_100009652 | Ga0070660_1000096527 | 323 |
| 482 | 3300005354 | Ga0070675_100126231 | Ga0070675_1001262312 | 323 |
| 483 | 3300005456 | Ga0070678_100001647 | Ga0070678_10000164710 | 323 |
| 484 | 3300005458 | Ga0070681_10146375 | Ga0070681_101463752 | 323 |
| 485 | 3300005458 | Ga0070681_10202976 | Ga0070681_102029762 | 323 |
| 486 | 3300005530 | Ga0070679_100130070 | Ga0070679_1001300703 | 323 |
| 487 | 3300005563 | Ga0068855_100127745 | Ga0068855_1001277453 | 323 |
| 488 | 3300005563 | Ga0068855_100242648 | Ga0068855_1002426483 | 323 |
| 489 | 3300005564 | Ga0070664_100200715 | Ga0070664_1002007151 | 323 |
| 490 | 3300005577 | Ga0068857_100025731 | Ga0068857_1000257313 | 323 |
| 491 | 3300005614 | Ga0068856_100103141 | Ga0068856_1001031414 | 323 |
| 492 | 3300005616 | Ga0068852_100144141 | Ga0068852_1001441412 | 323 |
| 493 | 3300005617 | Ga0068859_100106799 | Ga0068859_1001067994 | 323 |
| 494 | 3300005618 | Ga0068864_100169005 | Ga0068864_1001690052 | 323 |
| 495 | 3300005842 | Ga0068858_100037956 | Ga0068858_1000379562 | 323 |
| 496 | 3300006237 | Ga0097621_100040681 | Ga0097621_1000406814 | 323 |
| 497 | 3300006237 | Ga0097621_100056162 | Ga0097621_1000561622 | 323 |
| 498 | 3300006358 | Ga0068871_100004133 | Ga0068871_10000413311 | 323 |
| 499 | 3300006358 | Ga0068871_100061939 | Ga0068871_1000619393 | 323 |
| 500 | 3300006881 | Ga0068865_100066129 | Ga0068865_1000661294 | 323 |
| 501 | 3300006931 | Ga0097620_100106798 | Ga0097620_1001067983 | 323 |
| 502 | 3300006931 | Ga0097620_100128418 | Ga0097620_1001284183 | 323 |
| 503 | 3300009093 | Ga0105240_10000779 | Ga0105240_100007794 | 323 |
| 504 | 3300009093 | Ga0105240_10297267 | Ga0105240_102972672 | 323 |
| 505 | 3300009098 | Ga0105245_10031829 | Ga0105245_100318296 | 323 |
| 506 | 3300009098 | Ga0105245_10108052 | Ga0105245_101080522 | 323 |
| 507 | 3300009098 | Ga0105245_10120239 | Ga0105245_101202393 | 323 |
| 508 | 3300009176 | Ga0105242_10033980 | Ga0105242_100339803 | 323 |
| 509 | 3300009176 | Ga0105242_10078677 | Ga0105242_100786772 | 323 |
| 510 | 3300009176 | Ga0105242_10449645 | Ga0105242_104496451 | 323 |
| 511 | 3300009177 | Ga0105248_10018035 | Ga0105248_100180357 | 323 |
| 512 | 3300009545 | Ga0105237_10035885 | Ga0105237_100358852 | 323 |
| 513 | 3300009551 | Ga0105238_10032776 | Ga0105238_100327762 | 323 |
| 514 | 3300010375 | Ga0105239_10065083 | Ga0105239_100650833 | 323 |
| 515 | 3300010375 | Ga0105239_10147102 | Ga0105239_101471023 | 323 |
| 516 | 3300011119 | Ga0105246_10171245 | Ga0105246_101712452 | 323 |
| 517 | 3300013104 | Ga0157370_10017710 | Ga0157370_100177103 | 323 |
| 518 | 3300013105 | Ga0157369_10133926 | Ga0157369_101339263 | 323 |
| 519 | 3300013105 | Ga0157369_10167800 | Ga0157369_101678001 | 323 |
| 520 | 3300013296 | Ga0157374_10037930 | Ga0157374_100379305 | 323 |
| 521 | 3300013297 | Ga0157378_10138402 | Ga0157378_101384023 | 323 |
| 522 | 3300013306 | Ga0163162_10060031 | Ga0163162_100600315 | 323 |
| 523 | 3300013306 | Ga0163162_10071493 | Ga0163162_100714933 | 323 |
| 524 | 3300013307 | Ga0157372_10063926 | Ga0157372_100639262 | 323 |
| 525 | 3300013308 | Ga0157375_10102645 | Ga0157375_101026453 | 323 |
| 526 | 3300013308 | Ga0157375_10138616 | Ga0157375_101386163 | 323 |
| 527 | 3300014325 | Ga0163163_10012585 | Ga0163163_100125858 | 323 |
| 528 | 3300014325 | Ga0163163_10049839 | Ga0163163_100498395 | 323 |
| 529 | 3300014325 | Ga0163163_10233626 | Ga0163163_102336262 | 323 |
| 530 | 3300014968 | Ga0157379_10119673 | Ga0157379_101196733 | 323 |
| 531 | 3300014969 | Ga0157376_10388691 | Ga0157376_103886912 | 323 |
| 532 | 3300025254 | Ga0209148_1000146 | Ga0209148_100014627 | 323 |
| 533 | 3300025885 | Ga0207653_10039119 | Ga0207653_100391191 | 323 |
| 534 | 3300025903 | Ga0207680_10039239 | Ga0207680_100392392 | 323 |
| 535 | 3300025909 | Ga0207705_10044109 | Ga0207705_100441092 | 323 |
| 536 | 3300025911 | Ga0207654_10059788 | Ga0207654_100597884 | 323 |
| 537 | 3300025912 | Ga0207707_10030855 | Ga0207707_100308553 | 323 |
| 538 | 3300025912 | Ga0207707_10271427 | Ga0207707_102714272 | 323 |
| 539 | 3300025913 | Ga0207695_10018336 | Ga0207695_100183363 | 323 |
| 540 | 3300025913 | Ga0207695_10154906 | Ga0207695_101549063 | 323 |
| 541 | 3300025919 | Ga0207657_10015485 | Ga0207657_100154858 | 323 |
| 542 | 3300025921 | Ga0207652_10227369 | Ga0207652_102273692 | 323 |
| 543 | 3300025924 | Ga0207694_10005191 | Ga0207694_100051914 | 323 |
| 544 | 3300025927 | Ga0207687_10025307 | Ga0207687_100253073 | 323 |
| 545 | 3300025927 | Ga0207687_10028506 | Ga0207687_100285066 | 323 |
| 546 | 3300025927 | Ga0207687_10142627 | Ga0207687_101426272 | 323 |
| 547 | 3300025934 | Ga0207686_10043497 | Ga0207686_100434973 | 323 |
| 548 | 3300025934 | Ga0207686_10209194 | Ga0207686_102091942 | 323 |
| 549 | 3300025940 | Ga0207691_10071568 | Ga0207691_100715683 | 323 |
| 550 | 3300025941 | Ga0207711_10016461 | Ga0207711_100164616 | 323 |
| 551 | 3300025945 | Ga0207679_10078307 | Ga0207679_100783072 | 323 |
| 552 | 3300025949 | Ga0207667_10028927 | Ga0207667_100289273 | 323 |
| 553 | 3300025949 | Ga0207667_10261652 | Ga0207667_102616522 | 323 |
| 554 | 3300025986 | Ga0207658_10081068 | Ga0207658_100810682 | 323 |
| 555 | 3300026023 | Ga0207677_10003509 | Ga0207677_1000350910 | 323 |
| 556 | 3300026035 | Ga0207703_10008898 | Ga0207703_100088982 | 323 |
| 557 | 3300026089 | Ga0207648_10035805 | Ga0207648_100358052 | 323 |
| 558 | 3300026095 | Ga0207676_10047138 | Ga0207676_100471385 | 323 |
| 559 | 3300026116 | Ga0207674_10021605 | Ga0207674_100216052 | 323 |
| 560 | 3300026116 | Ga0207674_10069771 | Ga0207674_100697713 | 323 |
| 561 | 3300028379 | Ga0268266_10057684 | Ga0268266_100576843 | 323 |
| 562 | 3300028563 | Ga0265319_1001296 | Ga0265319_100129616 | 323 |
| 563 | 3300031240 | Ga0265320_10015580 | Ga0265320_100155803 | 323 |
| 564 | 3300031251 | Ga0265327_10003259 | Ga0265327_1000325912 | 323 |
| 565 | 3300031711 | Ga0265314_10002144 | Ga0265314_1000214410 | 323 |
| 566 | 3300031711 | Ga0265314_10018535 | Ga0265314_100185352 | 323 |
| 567 | 3300046460 | Ga0495638_0000187 | Ga0495638_0000187_34318_35307 | 323 |
| 568 | 3300046660 | Ga0495625_0001610 | Ga0495625_0001610_1848_2834 | 323 |
| 569 | 3300046694 | Ga0495649_0008508 | Ga0495649_0008508_412_1401 | 323 |
| 570 | 3300047472 | Ga0495686_0000159 | Ga0495686_0000159_30384_31376 | 323 |
| 571 | 3300047472 | Ga0495686_0011299 | Ga0495686_0011299_3459_4448 | 323 |
| 572 | 3300049822 | Ga0501035_0157232 | Ga0501035_0157232_75_1061 | 323 |
| 573 | 3300053134 | Ga0500658_0048722 | Ga0500658_0048722_675_1664 | 323 |
| 574 | 3300053153 | Ga0500616_0015346 | Ga0500616_0015346_385_1443 | 323 |
| 575 | 3300001989 | JGI24739J22299_10000155 | JGI24739J22299_1000015516 | 324 |
| 576 | 3300001990 | JGI24737J22298_10000087 | JGI24737J22298_1000008723 | 324 |
| 577 | 3300002067 | JGI24735J21928_10000192 | JGI24735J21928_1000019213 | 324 |
| 578 | 3300002075 | JGI24738J21930_10001254 | JGI24738J21930_100012542 | 324 |
| 579 | 3300005439 | Ga0070711_100070249 | Ga0070711_1000702491 | 324 |
| 580 | 3300005439 | Ga0070711_100243992 | Ga0070711_1002439922 | 324 |
| 581 | 3300005445 | Ga0070708_100012539 | Ga0070708_1000125396 | 324 |
| 582 | 3300005445 | Ga0070708_100014454 | Ga0070708_1000144542 | 324 |
| 583 | 3300005445 | Ga0070708_100063643 | Ga0070708_1000636432 | 324 |
| 584 | 3300005457 | Ga0070662_100008544 | Ga0070662_1000085443 | 324 |
| 585 | 3300005458 | Ga0070681_10021716 | Ga0070681_100217162 | 324 |
| 586 | 3300005468 | Ga0070707_100026575 | Ga0070707_1000265753 | 324 |
| 587 | 3300005468 | Ga0070707_100032329 | Ga0070707_1000323292 | 324 |
| 588 | 3300005471 | Ga0070698_100019533 | Ga0070698_1000195332 | 324 |
| 589 | 3300005471 | Ga0070698_100037911 | Ga0070698_1000379113 | 324 |
| 590 | 3300005471 | Ga0070698_100081236 | Ga0070698_1000812362 | 324 |
| 591 | 3300005518 | Ga0070699_100002783 | Ga0070699_1000027833 | 324 |
| 592 | 3300005536 | Ga0070697_100175967 | Ga0070697_1001759671 | 324 |
| 593 | 3300006028 | Ga0070717_10004583 | Ga0070717_100045837 | 324 |
| 594 | 3300006163 | Ga0070715_10155786 | Ga0070715_101557861 | 324 |
| 595 | 3300006173 | Ga0070716_100001520 | Ga0070716_1000015207 | 324 |
| 596 | 3300006173 | Ga0070716_100005798 | Ga0070716_1000057986 | 324 |
| 597 | 3300006871 | Ga0075434_100181432 | Ga0075434_1001814322 | 324 |
| 598 | 3300006914 | Ga0075436_100066930 | Ga0075436_1000669303 | 324 |
| 599 | 3300007265 | Ga0099794_10033959 | Ga0099794_100339592 | 324 |
| 600 | 3300021377 | Ga0213874_10010712 | Ga0213874_100107124 | 324 |
| 601 | 3300021441 | Ga0213871_10031656 | Ga0213871_100316561 | 324 |
| 602 | 3300025904 | Ga0207647_10000604 | Ga0207647_100006047 | 324 |
| 603 | 3300025905 | Ga0207685_10097221 | Ga0207685_100972211 | 324 |
| 604 | 3300025910 | Ga0207684_10025533 | Ga0207684_100255334 | 324 |
| 605 | 3300025916 | Ga0207663_10029782 | Ga0207663_100297822 | 324 |
| 606 | 3300025922 | Ga0207646_10051556 | Ga0207646_100515563 | 324 |
| 607 | 3300025922 | Ga0207646_10178785 | Ga0207646_101787852 | 324 |
| 608 | 3300025922 | Ga0207646_10383139 | Ga0207646_103831391 | 324 |
| 609 | 3300025933 | Ga0207706_10001626 | Ga0207706_100016265 | 324 |
| 610 | 3300025939 | Ga0207665_10000024 | Ga0207665_100000243 | 324 |
| 611 | 3300025939 | Ga0207665_10318408 | Ga0207665_103184082 | 324 |
| 612 | 3300026142 | Ga0207698_10025155 | Ga0207698_100251552 | 324 |
| 613 | 3300026142 | Ga0207698_10077620 | Ga0207698_100776202 | 324 |
| 614 | 3300027671 | Ga0209588_1001362 | Ga0209588_10013622 | 324 |
| 615 | 3300027671 | Ga0209588_1016141 | Ga0209588_10161412 | 324 |
| 616 | 3300027671 | Ga0209588_1020632 | Ga0209588_10206322 | 324 |
| 617 | 3300037471 | Ga0395905_0213405 | Ga0395905_0213405_36_1067 | 324 |
| 618 | 3300037853 | Ga0436364_0643307 | Ga0436364_0643307_468_1478 | 324 |
| 619 | 3300037853 | Ga0436364_0892362 | Ga0436364_0892362_847_1875 | 324 |
| 620 | 3300039438 | Ga0436360_0245961 | Ga0436360_0245961_35_1039 | 324 |
| 621 | 3300044684 | Ga0466966_0004926 | Ga0466966_0004926_5477_6481 | 324 |
| 622 | 3300044712 | Ga0453684_0027086 | Ga0453684_0027086_5951_6934 | 324 |
| 623 | 3300048920 | Ga0496117_0073746 | Ga0496117_0073746_1270_2259 | 324 |
| 624 | 3300048921 | Ga0496118_0024957 | Ga0496118_0024957_514_1503 | 324 |
| 625 | 3300048923 | Ga0496120_0007039 | Ga0496120_0007039_4486_5475 | 324 |
| 626 | 3300048924 | Ga0496121_0003572 | Ga0496121_0003572_10959_11948 | 324 |
| 627 | 3300048924 | Ga0496121_0084550 | Ga0496121_0084550_239_1228 | 324 |
| 628 | 3300048925 | Ga0496122_0086143 | Ga0496122_0086143_1082_2071 | 324 |
| 629 | 3300048925 | Ga0496122_0087405 | Ga0496122_0087405_117_1106 | 324 |
| 630 | 3300048928 | Ga0496125_0003511 | Ga0496125_0003511_3720_4709 | 324 |
| 631 | 3300048929 | Ga0496126_0005341 | Ga0496126_0005341_6653_7642 | 324 |
| 632 | 3300050513 | nmdc:mga0rr50_79322_c1 | nmdc:mga0rr50_79322_c1_1417_2409 | 324 |
| 633 | 3300050514 | nmdc:mga08x19_57670_c1 | nmdc:mga08x19_57670_c1_480_1472 | 324 |
| 634 | 3300005356 | Ga0070674_100246201 | Ga0070674_1002462011 | 325 |
| 635 | 3300005365 | Ga0070688_100005952 | Ga0070688_1000059523 | 325 |
| 636 | 3300005434 | Ga0070709_10018076 | Ga0070709_100180763 | 325 |
| 637 | 3300005435 | Ga0070714_100107549 | Ga0070714_1001075492 | 325 |
| 638 | 3300005440 | Ga0070705_100179691 | Ga0070705_1001796912 | 325 |
| 639 | 3300005548 | Ga0070665_100001237 | Ga0070665_1000012374 | 325 |
| 640 | 3300005577 | Ga0068857_100434249 | Ga0068857_1004342492 | 325 |
| 641 | 3300005617 | Ga0068859_100245892 | Ga0068859_1002458922 | 325 |
| 642 | 3300005841 | Ga0068863_100012703 | Ga0068863_1000127034 | 325 |
| 643 | 3300005842 | Ga0068858_100064239 | Ga0068858_1000642393 | 325 |
| 644 | 3300005842 | Ga0068858_100203928 | Ga0068858_1002039282 | 325 |
| 645 | 3300006175 | Ga0070712_100053422 | Ga0070712_1000534222 | 325 |
| 646 | 3300006237 | Ga0097621_100002270 | Ga0097621_1000022702 | 325 |
| 647 | 3300006358 | Ga0068871_100029721 | Ga0068871_1000297213 | 325 |
| 648 | 3300006871 | Ga0075434_100101644 | Ga0075434_1001016442 | 325 |
| 649 | 3300006914 | Ga0075436_100182085 | Ga0075436_1001820851 | 325 |
| 650 | 3300006931 | Ga0097620_100245904 | Ga0097620_1002459042 | 325 |
| 651 | 3300009174 | Ga0105241_10000033 | Ga0105241_1000003320 | 325 |
| 652 | 3300009176 | Ga0105242_10019574 | Ga0105242_100195744 | 325 |
| 653 | 3300009177 | Ga0105248_10206465 | Ga0105248_102064652 | 325 |
| 654 | 3300009545 | Ga0105237_10024447 | Ga0105237_100244473 | 325 |
| 655 | 3300010375 | Ga0105239_10374212 | Ga0105239_103742121 | 325 |
| 656 | 3300013297 | Ga0157378_10033649 | Ga0157378_100336492 | 325 |
| 657 | 3300013308 | Ga0157375_10619332 | Ga0157375_106193321 | 325 |
| 658 | 3300014968 | Ga0157379_10174617 | Ga0157379_101746172 | 325 |
| 659 | 3300014969 | Ga0157376_10000008 | Ga0157376_10000008139 | 325 |
| 660 | 3300014969 | Ga0157376_10002432 | Ga0157376_100024328 | 325 |
| 661 | 3300021358 | Ga0213873_10030802 | Ga0213873_100308022 | 325 |
| 662 | 3300021361 | Ga0213872_10000700 | Ga0213872_1000070012 | 325 |
| 663 | 3300021361 | Ga0213872_10029132 | Ga0213872_100291322 | 325 |
| 664 | 3300021384 | Ga0213876_10001370 | Ga0213876_100013702 | 325 |
| 665 | 3300021388 | Ga0213875_10005331 | Ga0213875_100053315 | 325 |
| 666 | 3300025934 | Ga0207686_10125546 | Ga0207686_101255462 | 325 |
| 667 | 3300026035 | Ga0207703_10118569 | Ga0207703_101185692 | 325 |
| 668 | 3300026078 | Ga0207702_10480132 | Ga0207702_104801322 | 325 |
| 669 | 3300026088 | Ga0207641_10002979 | Ga0207641_1000297912 | 325 |
| 670 | 3300028379 | Ga0268266_10000112 | Ga0268266_10000112104 | 325 |
| 671 | 3300028381 | Ga0268264_10391036 | Ga0268264_103910362 | 325 |
| 672 | 3300035114 | Ga0373939_0059944 | Ga0373939_0059944_187_1176 | 325 |
| 673 | 3300037853 | Ga0436364_0534877 | Ga0436364_0534877_364_1359 | 325 |
| 674 | 3300037853 | Ga0436364_1554448 | Ga0436364_1554448_1982_2977 | 325 |
| 675 | 3300039437 | Ga0436365_0172644 | Ga0436365_0172644_1218_2213 | 325 |
| 676 | 3300039437 | Ga0436365_0364010 | Ga0436365_0364010_37966_38964 | 325 |
| 677 | 3300039438 | Ga0436360_0281448 | Ga0436360_0281448_365_1363 | 325 |
| 678 | 3300039447 | Ga0436361_0073268 | Ga0436361_0073268_4528_5526 | 325 |
| 679 | 3300039447 | Ga0436361_0833078 | Ga0436361_0833078_17709_18704 | 325 |
| 680 | 3300039447 | Ga0436361_0897890 | Ga0436361_0897890_305_1303 | 325 |
| 681 | 3300039447 | Ga0436361_1013109 | Ga0436361_1013109_1103_2101 | 325 |
| 682 | 3300041451 | Ga0451791_0545886 | Ga0451791_0545886_244_1236 | 325 |
| 683 | 3300044712 | Ga0453684_0057979 | Ga0453684_0057979_2837_3829 | 325 |
| 684 | 3300044712 | Ga0453684_0302925 | Ga0453684_0302925_621_1613 | 325 |
| 685 | 3300046455 | Ga0495603_0008347 | Ga0495603_0008347_3573_4571 | 325 |
| 686 | 3300046460 | Ga0495638_0033155 | Ga0495638_0033155_2283_3278 | 325 |
| 687 | 3300046461 | Ga0495641_0094915 | Ga0495641_0094915_288_1286 | 325 |
| 688 | 3300046472 | Ga0495580_0024637 | Ga0495580_0024637_2575_3573 | 325 |
| 689 | 3300046473 | Ga0495582_0034734 | Ga0495582_0034734_388_1386 | 325 |
| 690 | 3300046477 | Ga0495664_0103854 | Ga0495664_0103854_30_1025 | 325 |
| 691 | 3300046500 | Ga0495596_0045928 | Ga0495596_0045928_490_1485 | 325 |
| 692 | 3300046501 | Ga0495607_0004295 | Ga0495607_0004295_8485_9480 | 325 |
| 693 | 3300046517 | Ga0495630_0223265 | Ga0495630_0223265_409_1407 | 325 |
| 694 | 3300046519 | Ga0495632_0018477 | Ga0495632_0018477_526_1521 | 325 |
| 695 | 3300046523 | Ga0495644_0019544 | Ga0495644_0019544_459_1454 | 325 |
| 696 | 3300046642 | Ga0495634_0081620 | Ga0495634_0081620_99_1097 | 325 |
| 697 | 3300046648 | Ga0495611_0008043 | Ga0495611_0008043_2020_3015 | 325 |
| 698 | 3300046681 | Ga0495647_0009997 | Ga0495647_0009997_1113_2111 | 325 |
| 699 | 3300046689 | Ga0495613_0139559 | Ga0495613_0139559_433_1431 | 325 |
| 700 | 3300046690 | Ga0495624_0039187 | Ga0495624_0039187_829_1824 | 325 |
| 701 | 3300046810 | Ga0495660_0002222 | Ga0495660_0002222_5613_6608 | 325 |
| 702 | 3300047315 | Ga0495581_0021689 | Ga0495581_0021689_1549_2547 | 325 |
| 703 | 3300047315 | Ga0495581_0132613 | Ga0495581_0132613_323_1318 | 325 |
| 704 | 3300047318 | Ga0495636_0017133 | Ga0495636_0017133_1100_2095 | 325 |
| 705 | 3300047319 | Ga0495674_0042277 | Ga0495674_0042277_421_1419 | 325 |
| 706 | 3300047320 | Ga0495672_0019772 | Ga0495672_0019772_647_1642 | 325 |
| 707 | 3300047322 | Ga0495680_0008081 | Ga0495680_0008081_4646_5644 | 325 |
| 708 | 3300047323 | Ga0495683_0011736 | Ga0495683_0011736_2273_3268 | 325 |
| 709 | 3300047445 | Ga0495677_0000388 | Ga0495677_0000388_7128_8123 | 325 |
| 710 | 3300047446 | Ga0495679_003096 | Ga0495679_003096_4768_5763 | 325 |
| 711 | 3300047470 | Ga0495681_0014480 | Ga0495681_0014480_1721_2716 | 325 |
| 712 | 3300047471 | Ga0495684_0010148 | Ga0495684_0010148_4765_5763 | 325 |
| 713 | 3300048089 | Ga0495614_0059895 | Ga0495614_0059895_324_1322 | 325 |
| 714 | 3300048091 | Ga0495626_0015783 | Ga0495626_0015783_2337_3332 | 325 |
| 715 | 3300049664 | Ga0501224_007719 | Ga0501224_007719_83_1153 | 325 |
| 716 | 3300050493 | nmdc:mga0k408_55665_c2 | nmdc:mga0k408_55665_c2_10_1008 | 325 |
| 717 | 3300050512 | nmdc:mga0n895_171744_c1 | nmdc:mga0n895_171744_c1_687_1685 | 325 |
| 718 | 3300050512 | nmdc:mga0n895_24134_c1 | nmdc:mga0n895_24134_c1_4561_5571 | 325 |
| 719 | 3300050512 | nmdc:mga0n895_30093_c1 | nmdc:mga0n895_30093_c1_2508_3506 | 325 |
| 720 | 3300050513 | nmdc:mga0rr50_20898_c1 | nmdc:mga0rr50_20898_c1_1737_2753 | 325 |
| 721 | 3300050514 | nmdc:mga08x19_161052_c1 | nmdc:mga08x19_161052_c1_430_1428 | 325 |
| 722 | 3300050515 | nmdc:mga0a205_454451_c1 | nmdc:mga0a205_454451_c1_80_1078 | 325 |
| 723 | 3300053085 | Ga0495619_0110536 | Ga0495619_0110536_12_1010 | 325 |
| 724 | 3300053116 | Ga0500592_015485 | Ga0500592_015485_53_1048 | 325 |
| 725 | 3300039438 | Ga0436360_0743755 | Ga0436360_0743755_196_1197 | 326 |
| 726 | 3300039447 | Ga0436361_0313172 | Ga0436361_0313172_168_1169 | 326 |
| 727 | 2162886006 | SwRhRL3b_contig_699357 | SwRhRL3b_0890.00000530 | 329 |
| 728 | 2162886006 | SwRhRL3b_contig_806853 | SwRhRL3b_0271.00001060 | 329 |
| 729 | 2162886007 | SwRhRL2b_contig_454664 | SwRhRL2b_0472.00000640 | 329 |
| 730 | 3300003320 | rootH2_10031165 | rootH2_100311658 | 329 |
| 731 | 3300005289 | Ga0065704_10070425 | Ga0065704_1007042521 | 329 |
| 732 | 3300005295 | Ga0065707_10003564 | Ga0065707_100035642 | 329 |
| 733 | 3300005295 | Ga0065707_10082025 | Ga0065707_1008202521 | 329 |
| 734 | 3300005331 | Ga0070670_100090283 | Ga0070670_1000902834 | 329 |
| 735 | 3300005334 | Ga0068869_100129883 | Ga0068869_1001298832 | 329 |
| 736 | 3300005338 | Ga0068868_100107131 | Ga0068868_1001071312 | 329 |
| 737 | 3300005340 | Ga0070689_100146124 | Ga0070689_1001461242 | 329 |
| 738 | 3300005356 | Ga0070674_100389741 | Ga0070674_1003897411 | 329 |
| 739 | 3300005539 | Ga0068853_100148597 | Ga0068853_1001485972 | 329 |
| 740 | 3300005543 | Ga0070672_100061477 | Ga0070672_1000614772 | 329 |
| 741 | 3300005616 | Ga0068852_100103350 | Ga0068852_1001033502 | 329 |
| 742 | 3300006237 | Ga0097621_100060596 | Ga0097621_1000605962 | 329 |
| 743 | 3300011119 | Ga0105246_10209967 | Ga0105246_102099672 | 329 |
| 744 | 3300013306 | Ga0163162_10015187 | Ga0163162_100151874 | 329 |
| 745 | 3300013308 | Ga0157375_10086391 | Ga0157375_100863912 | 329 |
| 746 | 3300014969 | Ga0157376_10092052 | Ga0157376_100920521 | 329 |
| 747 | 3300025940 | Ga0207691_10044156 | Ga0207691_100441562 | 329 |
| 748 | 3300025942 | Ga0207689_10026741 | Ga0207689_100267414 | 329 |
| 749 | 3300026142 | Ga0207698_10070924 | Ga0207698_100709242 | 329 |
| 750 | 3300050508 | nmdc:mga09592_52083_c1 | nmdc:mga09592_52083_c1_1307_2302 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pz1-assembly2.cif.gz_B | structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) | 0.9244 | 1 | 317 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9222 | 1 | 317 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9095 | 1 | 317 |
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9046 | 1 | 317 |
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9 | 3 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9568 | 1 | 321 | 3.20.20.100 |
| af_P49249_9_269_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9487 | 3 | 255 | 3.20.20.100 |
| af_A0A1D6KUU8_358_629_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9458 | 73 | 327 | 3.20.20.100 |
| af_Q09923_6_337_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9379 | 4 | 329 | 3.20.20.100 |
| af_A0A0R0ETH2_7_234_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.934 | 1 | 222 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q0JE28-F1-model_v4 | Os04g0338100 protein | 0.99 | 108 | 192 |
|
| AF-A0A7J8U949-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9879 | 97 | 207 |
GO:0004033
GO:0005737 GO:0016020 |
| AF-A0A317LPZ2-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.987 | 1 | 329 |
GO:0004033
GO:0005737 |
| AF-A0A1J5PSL3-F1-model_v4 | General stress protein 69 (EC 1.1.1.-) | 0.9829 | 138 | 329 |
GO:0004033
GO:0005737 |
| AF-A0A317LPZ2-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9809 | 1 | 329 |
GO:0004033
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar