F479005

General Info

Members Datasets Scaffolds Average Seq Length
749 411 724 169

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10144764|Ga0157370_101447642
Length 195
Sequence LHLIDTADNRQSNVNILHYPSINPFHFMAEPFLSEIRMVSFNFAPKGWALANGQFLPINQNQALFALLGTTYGGNGQTNFALPDFRGRVPVHFGNGYNLGQRGGQEAHTITMSELPQHNHFVAAIDSGPSNSNDPSGAYLANTLPNNFYSTVPGSAGLNPATVSNVGGSQAHNNLQPFMVINFCIALQGIFPSQN

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
5 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
6 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
7 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
8 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
9 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
10 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
11 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
12 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
13 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
14 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
15 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
16 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
17 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
18 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
19 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
20 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
21 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
22 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
23 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
24 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
25 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
26 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
27 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
28 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
29 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
30 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
62 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
93 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
158 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
163 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
224 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
225 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
226 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
227 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
228 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
229 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
233 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
234 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
235 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
236 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
240 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
260 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
273 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
274 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
279 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
280 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
281 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
282 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
283 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
284 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
285 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
286 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
287 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
288 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
289 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
290 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
291 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
292 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
293 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
294 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
297 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
329 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
330 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
331 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
332 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
333 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
346 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
347 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
348 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
349 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
350 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
351 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
352 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
353 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
354 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
355 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
356 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
357 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
358 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
359 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
360 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
361 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
362 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
363 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
364 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
365 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
366 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
367 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
368 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
369 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
370 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
373 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
374 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
375 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
376 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
388 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
389 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
390 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.19
Metatranscriptomes 7.48
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.54
Nodule 1.87
Rhizoplane 0.53
Rhizosphere 85.31
Stem 0
Stem Tuber 0.13
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11776189 2162886012 Unclassified 912
2 ARcpr5oldR_c000925 3300000041 Bacteria 3219
3 ARcpr5yngRDRAFT_c000985 3300000043 Bacteria 3277
4 CNBas_1000168 3300000531 Bacteria 2299
5 JGI24744J21845_10049109 3300002077 Bacteria 779
6 JGI25162J39368_1014118 3300002737 Bacteria 862
7 JGI25164J39214_1003119 3300002772 Bacteria 2206
8 JGI25152J39213_1000204 3300002773 Bacteria 39867
9 JGI25150J39212_1000391 3300002774 Bacteria 20878
10 JGI25165J46597_1000005 3300003214 Bacteria 623702
11 JGI25153J46596_10001499 3300003215 Bacteria 13924
12 JGI25153J46596_10011374 3300003215 Bacteria 3937
13 rootH1_10182808 3300003316 Bacteria 1209
14 rootH2_10252390 3300003320 Bacteria 1324
15 Ga0055526_1000199 3300003771 Bacteria 51526
16 Ga0055526_1000971 3300003771 Bacteria 21175
17 Ga0055537_1002636 3300003773 Bacteria 5869
18 Ga0055537_1006944 3300003773 Bacteria 2798
19 Ga0055524_1000222 3300003775 Bacteria 60317
20 Ga0055524_1001084 3300003775 Bacteria 16642
21 Ga0055524_1002259 3300003775 Bacteria 10072
22 Ga0055536_1003626 3300003781 Bacteria 8234
23 Ga0055528_1046844 3300003790 Bacteria 908
24 Ga0055530_10000308 3300003791 Bacteria 44319
25 Ga0055530_10017439 3300003791 Bacteria 2251
26 Ga0055531_10004463 3300003794 Bacteria 8514
27 Ga0058861_11548928 3300004800 Bacteria 1711
28 Ga0058862_12539277 3300004803 Bacteria 1894
29 Ga0065165_1000123 3300005262 Bacteria 130852
30 Ga0065165_1013696 3300005262 Bacteria 3203
31 Ga0065165_1027329 3300005262 Bacteria 1862
32 Ga0065704_10073218 3300005289 Bacteria 7435
33 Ga0065704_10112644 3300005289 Unclassified 1911
34 Ga0065704_10171087 3300005289 Bacteria 1291
35 Ga0065704_10227387 3300005289 Bacteria 1054
36 Ga0065715_10135302 3300005293 Bacteria 1940
37 Ga0065715_10140686 3300005293 Bacteria 1811
38 Ga0065715_10157220 3300005293 Bacteria 1665
39 Ga0065715_10174159 3300005293 Unclassified 1524
40 Ga0065707_10083232 3300005295 Bacteria 9903
41 Ga0070658_10004705 3300005327 Bacteria 11094
42 Ga0070658_10190346 3300005327 Bacteria 1729
43 Ga0070683_100243314 3300005329 Bacteria 1711
44 Ga0070670_100005938 3300005331 Bacteria 10326
45 Ga0070670_100032782 3300005331 Bacteria 4476
46 Ga0070670_100033105 3300005331 Bacteria 4453
47 Ga0070670_100155239 3300005331 Bacteria 1982
48 Ga0070670_101036824 3300005331 Bacteria 747
49 Ga0068869_100030697 3300005334 Bacteria 3776
50 Ga0068869_100047863 3300005334 Bacteria 3089
51 Ga0068869_100162062 3300005334 Viruses 1741
52 Ga0068869_100249855 3300005334 Bacteria 1416
53 Ga0068869_100385625 3300005334 Bacteria 1149
54 Ga0068869_100793891 3300005334 Unclassified 813
55 Ga0070680_100000143 3300005336 Bacteria 43507
56 Ga0070680_100000388 3300005336 Bacteria 29909
57 Ga0070682_100000022 3300005337 Bacteria 209117
58 Ga0070682_100000096 3300005337 Bacteria 79913
59 Ga0070682_100000648 3300005337 Bacteria 21150
60 Ga0070682_100003873 3300005337 Bacteria 8303
61 Ga0070682_100110757 3300005337 Bacteria 1829
62 Ga0068868_100000070 3300005338 Bacteria 59130
63 Ga0068868_100001632 3300005338 Bacteria 15299
64 Ga0070660_100001702 3300005339 Bacteria 15088
65 Ga0070660_100002905 3300005339 Bacteria 11793
66 Ga0070689_100000856 3300005340 Bacteria 18891
67 Ga0070689_100026482 3300005340 Bacteria 4366
68 Ga0070689_100029297 3300005340 Bacteria 4165
69 Ga0070689_100350372 3300005340 Bacteria 1238
70 Ga0070689_100382957 3300005340 Bacteria 1186
71 Ga0070691_10295331 3300005341 Bacteria 883
72 Ga0070687_100134125 3300005343 Bacteria 1433
73 Ga0070661_100000114 3300005344 Bacteria 67216
74 Ga0070661_100697784 3300005344 Bacteria 827
75 Ga0070692_10005032 3300005345 Bacteria 5589
76 Ga0070668_100300051 3300005347 Bacteria 1347
77 Ga0070669_100013271 3300005353 Bacteria 5855
78 Ga0070669_100015293 3300005353 Bacteria 5467
79 Ga0070669_100069679 3300005353 Bacteria 2598
80 Ga0070675_100074405 3300005354 Bacteria 2822
81 Ga0070675_100783347 3300005354 Bacteria 871
82 Ga0070671_100039938 3300005355 Bacteria 3896
83 Ga0070671_100860962 3300005355 Bacteria 791
84 Ga0070674_100079681 3300005356 Bacteria 2337
85 Ga0070674_100136369 3300005356 Bacteria 1836
86 Ga0070674_100467638 3300005356 Bacteria 1044
87 Ga0070673_100202681 3300005364 Bacteria 1709
88 Ga0070673_100383516 3300005364 Bacteria 1253
89 Ga0070688_100180342 3300005365 Bacteria 1464
90 Ga0070688_100575924 3300005365 Bacteria 859
91 Ga0070688_101512092 3300005365 Bacteria 546
92 Ga0070659_100000017 3300005366 Bacteria 163966
93 Ga0070703_10008816 3300005406 Bacteria 2840
94 Ga0070709_10112916 3300005434 Bacteria 1829
95 Ga0070709_10497876 3300005434 Bacteria 925
96 Ga0070701_10000892 3300005438 Bacteria 10755
97 Ga0070701_10306468 3300005438 Bacteria 978
98 Ga0070701_10818007 3300005438 Bacteria 637
99 Ga0070711_100484196 3300005439 Bacteria 1018
100 Ga0070705_100012212 3300005440 Unclassified 4360
101 Ga0070705_100146417 3300005440 Bacteria 1561
102 Ga0070705_100989591 3300005440 Bacteria 682
103 Ga0070700_100026017 3300005441 Bacteria 3451
104 Ga0070700_100137513 3300005441 Bacteria 1656
105 Ga0070700_100535114 3300005441 Bacteria 908
106 Ga0070694_100001863 3300005444 Bacteria 12489
107 Ga0070694_100010967 3300005444 Bacteria 5606
108 Ga0070694_100068348 3300005444 Bacteria 2442
109 Ga0070694_100236540 3300005444 Bacteria 1376
110 Ga0070708_100343826 3300005445 Viruses 1406
111 Ga0070663_100928215 3300005455 Bacteria 753
112 Ga0070678_100903786 3300005456 Bacteria 807
113 Ga0070662_100243523 3300005457 Bacteria 1443
114 Ga0070681_10000037 3300005458 Bacteria 96087
115 Ga0070681_10030032 3300005458 Bacteria 5454
116 Ga0068867_100240105 3300005459 Bacteria 1469
117 Ga0068867_100496365 3300005459 Unclassified 1048
118 Ga0070706_100008941 3300005467 Bacteria 9324
119 Ga0070706_100035089 3300005467 Bacteria 4632
120 Ga0070706_100155909 3300005467 Bacteria 2132
121 Ga0070698_100002248 3300005471 Bacteria 21358
122 Ga0070698_100004263 3300005471 Bacteria 15721
123 Ga0070698_100012193 3300005471 Bacteria 9106
124 Ga0070698_100013256 3300005471 Bacteria 8722
125 Ga0070698_100861509 3300005471 Bacteria 851
126 Ga0070699_100095275 3300005518 Bacteria 2606
127 Ga0070699_100844890 3300005518 Bacteria 838
128 Ga0070679_100000002 3300005530 Bacteria 312066
129 Ga0070679_100018982 3300005530 Bacteria 6678
130 Ga0070697_100000652 3300005536 Bacteria 26194
131 Ga0070697_100000995 3300005536 Bacteria 21418
132 Ga0070697_100456309 3300005536 Bacteria 1114
133 Ga0070697_100495478 3300005536 Bacteria 1068
134 Ga0068853_100194179 3300005539 Bacteria 1845
135 Ga0068853_100980465 3300005539 Bacteria 813
136 Ga0070672_100001157 3300005543 Bacteria 16121
137 Ga0070686_100000004 3300005544 Bacteria 262514
138 Ga0070696_100033027 3300005546 Bacteria 3554
139 Ga0070696_100307112 3300005546 Bacteria 1217
140 Ga0070696_100389361 3300005546 Bacteria 1088
141 Ga0070696_100745829 3300005546 Bacteria 802
142 Ga0070693_100004428 3300005547 Bacteria 6640
143 Ga0070693_100008236 3300005547 Bacteria 5127
144 Ga0070693_100079001 3300005547 Bacteria 1957
145 Ga0070693_100294963 3300005547 Bacteria 1091
146 Ga0070665_100000145 3300005548 Bacteria 131599
147 Ga0070665_100000567 3300005548 Bacteria 51614
148 Ga0070704_100046762 3300005549 Bacteria 3021
149 Ga0070704_100085003 3300005549 Viruses 2341
150 Ga0070704_100246798 3300005549 Bacteria 1464
151 Ga0070704_100505038 3300005549 Bacteria 1050
152 Ga0070704_100605475 3300005549 Bacteria 963
153 Ga0068855_100350232 3300005563 Bacteria 1627
154 Ga0068857_100049299 3300005577 Bacteria 3736
155 Ga0068857_100527514 3300005577 Viruses 1110
156 Ga0068857_100602767 3300005577 Bacteria 1038
157 Ga0068854_100052893 3300005578 Bacteria 2914
158 Ga0070702_100066019 3300005615 Bacteria 2120
159 Ga0070702_100311744 3300005615 Bacteria 1093
160 Ga0068852_100049225 3300005616 Unclassified 3604
161 Ga0068852_100698599 3300005616 Bacteria 1024
162 Ga0068859_100000577 3300005617 Bacteria 36570
163 Ga0068859_100002668 3300005617 Bacteria 18112
164 Ga0068859_100057777 3300005617 Bacteria 3907
165 Ga0068859_100094382 3300005617 Bacteria 3044
166 Ga0068859_100099968 3300005617 Bacteria 2956
167 Ga0068859_100163536 3300005617 Bacteria 2305
168 Ga0068859_100212513 3300005617 Bacteria 2021
169 Ga0068859_100380275 3300005617 Viruses 1507
170 Ga0068859_102219164 3300005617 Bacteria 606
171 Ga0068864_100000032 3300005618 Bacteria 212983
172 Ga0068864_100002419 3300005618 Bacteria 15420
173 Ga0068864_100297772 3300005618 Bacteria 1509
174 Ga0068864_101171815 3300005618 Unclassified 766
175 Ga0068861_100006823 3300005719 Bacteria 7795
176 Ga0068861_100027087 3300005719 Bacteria 4172
177 Ga0068861_100744478 3300005719 Bacteria 915
178 Ga0068861_101807576 3300005719 Bacteria 606
179 Ga0068851_10004808 3300005834 Bacteria 6113
180 Ga0068870_10001285 3300005840 Bacteria 10097
181 Ga0068870_10021667 3300005840 Unclassified 3148
182 Ga0068863_100006096 3300005841 Bacteria 11824
183 Ga0068863_100050442 3300005841 Bacteria 3944
184 Ga0068863_100096346 3300005841 Bacteria 2809
185 Ga0068858_100007130 3300005842 Bacteria 10857
186 Ga0068858_100032748 3300005842 Bacteria 4827
187 Ga0068858_100053652 3300005842 Unclassified 3729
188 Ga0068858_100486069 3300005842 Bacteria 1192
189 Ga0068860_101437248 3300005843 Bacteria 711
190 Ga0068862_100018222 3300005844 Bacteria 5845
191 Ga0075365_10029151 3300006038 Bacteria 3525
192 Ga0075364_10054039 3300006051 Bacteria 2626
193 Ga0097621_100160018 3300006237 Bacteria 1935
194 Ga0068871_100166569 3300006358 Bacteria 1887
195 Ga0068871_100175510 3300006358 Bacteria 1839
196 Ga0068871_101229467 3300006358 Bacteria 703
197 Ga0075428_100007935 3300006844 Bacteria 11772
198 Ga0075428_100039304 3300006844 Bacteria 5206
199 Ga0075428_100307359 3300006844 Viruses 1704
200 Ga0075430_100148054 3300006846 Viruses 1955
201 Ga0075431_100096488 3300006847 Bacteria 3052
202 Ga0075433_10006999 3300006852 Bacteria 8941
203 Ga0075433_10148911 3300006852 Bacteria 2082
204 Ga0075433_10187512 3300006852 Viruses 1840
205 Ga0075434_100051241 3300006871 Bacteria 4102
206 Ga0075434_100090267 3300006871 Bacteria 3066
207 Ga0075434_100510860 3300006871 Bacteria 1222
208 Ga0075434_100598563 3300006871 Viruses 1122
209 Ga0075434_101400695 3300006871 Unclassified 709
210 Ga0075429_100058501 3300006880 Bacteria 3357
211 Ga0075429_100067193 3300006880 Bacteria 3120
212 Ga0075429_100192137 3300006880 Unclassified 1788
213 Ga0068865_100302738 3300006881 Bacteria 1280
214 Ga0097620_100000577 3300006931 Bacteria 36570
215 Ga0097620_100002668 3300006931 Bacteria 18112
216 Ga0097620_100057780 3300006931 Bacteria 3907
217 Ga0097620_100094381 3300006931 Bacteria 3044
218 Ga0097620_100099964 3300006931 Bacteria 2956
219 Ga0097620_100163530 3300006931 Bacteria 2305
220 Ga0097620_100212504 3300006931 Bacteria 2021
221 Ga0097620_100380248 3300006931 Viruses 1507
222 Ga0097620_102218816 3300006931 Bacteria 606
223 Ga0075435_100347412 3300007076 Bacteria 1271
224 Ga0105250_10035176 3300009092 Bacteria 2009
225 Ga0105250_10250702 3300009092 Bacteria 756
226 Ga0105240_10052562 3300009093 Bacteria 5120
227 Ga0105240_11092376 3300009093 Bacteria 849
228 Ga0111539_10000026 3300009094 Bacteria 185695
229 Ga0111539_10093138 3300009094 Bacteria 3540
230 Ga0111539_10438326 3300009094 Bacteria 1521
231 Ga0111539_10859209 3300009094 Bacteria 1055
232 Ga0111539_11320662 3300009094 Bacteria 837
233 Ga0105245_10003884 3300009098 Bacteria 13295
234 Ga0105245_10011605 3300009098 Bacteria 7674
235 Ga0105245_10449286 3300009098 Bacteria 1297
236 Ga0105247_10160309 3300009101 Bacteria 1489
237 Ga0114129_10075732 3300009147 Bacteria 4685
238 Ga0114129_10312807 3300009147 Bacteria 2090
239 Ga0114129_10827450 3300009147 Bacteria 1179
240 Ga0105243_10008963 3300009148 Bacteria 7647
241 Ga0105243_10081343 3300009148 Bacteria 2644
242 Ga0105243_10175264 3300009148 Bacteria 1861
243 Ga0105243_11642155 3300009148 Bacteria 670
244 Ga0105241_10005988 3300009174 Bacteria 8973
245 Ga0105241_10113753 3300009174 Unclassified 2170
246 Ga0105242_10000271 3300009176 Bacteria 41189
247 Ga0105242_10005282 3300009176 Bacteria 9971
248 Ga0105242_10009637 3300009176 Bacteria 7401
249 Ga0105242_11506489 3300009176 Bacteria 703
250 Ga0105248_10058455 3300009177 Bacteria 4331
251 Ga0105248_10248597 3300009177 Bacteria 2002
252 Ga0105237_10005382 3300009545 Bacteria 14468
253 Ga0105238_10000001 3300009551 Bacteria 2036163
254 Ga0105238_10000032 3300009551 Bacteria 178226
255 Ga0105249_10241363 3300009553 Bacteria 1787
256 Ga0105249_10619559 3300009553 Bacteria 1138
257 Ga0105249_10634329 3300009553 Bacteria 1125
258 Ga0105249_11037381 3300009553 Bacteria 889
259 Ga0105239_10079382 3300010375 Bacteria 3611
260 Ga0105239_10591396 3300010375 Bacteria 1265
261 Ga0105246_10302787 3300011119 Viruses 1291
262 Ga0157371_10010081 3300013102 Bacteria 7386
263 Ga0157371_10014418 3300013102 Bacteria 5964
264 Ga0157371_10016302 3300013102 Bacteria 5550
265 Ga0157371_10729066 3300013102 Bacteria 743
266 Ga0157371_10739062 3300013102 Bacteria 738
267 Ga0157370_10012604 3300013104 Bacteria 8762
268 Ga0157370_10144764 3300013104 Bacteria 2213
269 Ga0157370_10373886 3300013104 Bacteria 1313
270 Ga0157369_10020731 3300013105 Bacteria 7348
271 Ga0157369_10156080 3300013105 Bacteria 2410
272 Ga0157369_10171963 3300013105 Bacteria 2282
273 Ga0157374_10000037 3300013296 Bacteria 170359
274 Ga0157374_10137320 3300013296 Bacteria 2371
275 Ga0157378_10052127 3300013297 Bacteria 3640
276 Ga0157378_10053829 3300013297 Bacteria 3583
277 Ga0157378_10067421 3300013297 Unclassified 3207
278 Ga0157378_11337627 3300013297 Bacteria 758
279 Ga0163162_10008008 3300013306 Bacteria 10308
280 Ga0163162_10013880 3300013306 Bacteria 7870
281 Ga0163162_10027811 3300013306 Bacteria 5594
282 Ga0163162_10321978 3300013306 Bacteria 1678
283 Ga0157372_10005077 3300013307 Bacteria 13994
284 Ga0157372_10075983 3300013307 Bacteria 3792
285 Ga0157372_10108478 3300013307 Bacteria 3177
286 Ga0157372_10609372 3300013307 Unclassified 1272
287 Ga0157375_10000001 3300013308 Bacteria 696576
288 Ga0157375_10106594 3300013308 Bacteria 2894
289 Ga0157375_11947460 3300013308 Bacteria 698
290 Ga0163163_10121899 3300014325 Viruses 2642
291 Ga0163163_10391176 3300014325 Bacteria 1448
292 Ga0163163_10786983 3300014325 Bacteria 1014
293 Ga0157380_10014240 3300014326 Bacteria 5817
294 Ga0157380_10173413 3300014326 Unclassified 1887
295 Ga0157380_10202352 3300014326 Bacteria 1763
296 Ga0157380_10367547 3300014326 Bacteria 1352
297 Ga0182008_10077830 3300014497 Bacteria 1632
298 Ga0157377_10000008 3300014745 Bacteria 394748
299 Ga0157377_10000049 3300014745 Bacteria 93091
300 Ga0157377_10020590 3300014745 Unclassified 3458
301 Ga0157376_10754001 3300014969 Bacteria 983
302 Ga0182006_1037975 3300015261 Bacteria 1906
303 Ga0163161_11098160 3300017792 Bacteria 684
304 Ga0213873_10068213 3300021358 Bacteria 975
305 Ga0213876_10000188 3300021384 Bacteria 64172
306 Ga0213876_10043658 3300021384 Bacteria 2369
307 Ga0213875_10109519 3300021388 Bacteria 1289
308 Ga0213875_10384453 3300021388 Bacteria 668
309 Ga0209436_112705 3300025208 Bacteria 1417
310 Ga0207427_100028 3300025231 Bacteria 388949
311 Ga0209437_100211 3300025233 Bacteria 108544
312 Ga0207425_1000001 3300025245 Bacteria 2525432
313 Ga0207425_1014226 3300025245 Bacteria 1812
314 Ga0209129_1000003 3300025258 Bacteria 903689
315 Ga0209129_1015382 3300025258 Bacteria 1578
316 Ga0209233_1000001 3300025261 Bacteria 2992747
317 Ga0209565_1000011 3300025263 Bacteria 637062
318 Ga0209565_1000211 3300025263 Bacteria 67436
319 Ga0209565_1001872 3300025263 Bacteria 8375
320 Ga0209565_1003580 3300025263 Bacteria 4973
321 Ga0209565_1012230 3300025263 Bacteria 2057
322 Ga0209673_1002226 3300025273 Bacteria 14092
323 Ga0209675_1000223 3300025291 Bacteria 58166
324 Ga0209675_1026657 3300025291 Bacteria 1434
325 Ga0209676_1000555 3300025292 Bacteria 56867
326 Ga0209564_1000095 3300025295 Bacteria 237896
327 Ga0209564_1001520 3300025295 Bacteria 23095
328 Ga0209564_1027393 3300025295 Bacteria 1852
329 Ga0209758_1000041 3300025297 Bacteria 410328
330 Ga0209758_1012613 3300025297 Bacteria 4708
331 Ga0209758_1026295 3300025297 Bacteria 2524
332 Ga0209050_1000138 3300025298 Bacteria 173923
333 Ga0209050_1000538 3300025298 Bacteria 62826
334 Ga0209050_1008420 3300025298 Bacteria 5519
335 Ga0209050_1010125 3300025298 Bacteria 4692
336 Ga0209256_1000016 3300025299 Bacteria 599092
337 Ga0209256_1000402 3300025299 Bacteria 68470
338 Ga0209256_1000438 3300025299 Bacteria 64209
339 Ga0209257_1002046 3300025304 Bacteria 21436
340 Ga0207656_10002644 3300025321 Bacteria 6066
341 Ga0207653_10009230 3300025885 Bacteria 3072
342 Ga0207643_10008324 3300025908 Bacteria 5565
343 Ga0207643_10020727 3300025908 Bacteria 3609
344 Ga0207643_10033692 3300025908 Unclassified 2866
345 Ga0207705_10009322 3300025909 Bacteria 7138
346 Ga0207705_10107749 3300025909 Bacteria 2056
347 Ga0207684_10009442 3300025910 Bacteria 8614
348 Ga0207684_10039428 3300025910 Bacteria 4007
349 Ga0207684_10348975 3300025910 Bacteria 1274
350 Ga0207654_10104104 3300025911 Bacteria 1754
351 Ga0207654_10112047 3300025911 Unclassified 1699
352 Ga0207707_10000011 3300025912 Bacteria 282857
353 Ga0207671_10004857 3300025914 Bacteria 12651
354 Ga0207663_10273715 3300025916 Bacteria 1251
355 Ga0207660_10000289 3300025917 Bacteria 33248
356 Ga0207660_10000892 3300025917 Bacteria 19647
357 Ga0207662_10063431 3300025918 Bacteria 2222
358 Ga0207662_10072505 3300025918 Bacteria 2087
359 Ga0207662_10101789 3300025918 Bacteria 1781
360 Ga0207657_10004411 3300025919 Bacteria 14887
361 Ga0207657_10016857 3300025919 Bacteria 7031
362 Ga0207649_10000011 3300025920 Bacteria 266219
363 Ga0207652_10000001 3300025921 Bacteria 1006643
364 Ga0207652_10000002 3300025921 Bacteria 878035
365 Ga0207652_10047761 3300025921 Bacteria 3657
366 Ga0207681_10004339 3300025923 Bacteria 8754
367 Ga0207681_10025850 3300025923 Unclassified 3781
368 Ga0207681_10100805 3300025923 Bacteria 2082
369 Ga0207681_10327611 3300025923 Bacteria 1220
370 Ga0207694_10000001 3300025924 Bacteria 4078485
371 Ga0207694_10000041 3300025924 Bacteria 183415
372 Ga0207650_10029226 3300025925 Unclassified 3961
373 Ga0207650_10493203 3300025925 Bacteria 1023
374 Ga0207650_10556141 3300025925 Bacteria 962
375 Ga0207650_10619383 3300025925 Bacteria 911
376 Ga0207650_10832887 3300025925 Bacteria 782
377 Ga0207650_11066932 3300025925 Bacteria 687
378 Ga0207659_10438798 3300025926 Bacteria 1098
379 Ga0207687_10000765 3300025927 Bacteria 21679
380 Ga0207687_10049999 3300025927 Bacteria 2909
381 Ga0207687_10520265 3300025927 Bacteria 995
382 Ga0207644_10835172 3300025931 Bacteria 771
383 Ga0207690_10001390 3300025932 Bacteria 15206
384 Ga0207690_10427288 3300025932 Bacteria 1061
385 Ga0207706_10476503 3300025933 Bacteria 1078
386 Ga0207686_10000285 3300025934 Bacteria 37479
387 Ga0207686_10011983 3300025934 Bacteria 4759
388 Ga0207686_10047887 3300025934 Bacteria 2645
389 Ga0207709_10019847 3300025935 Unclassified 3784
390 Ga0207670_10000357 3300025936 Bacteria 26785
391 Ga0207670_10001484 3300025936 Bacteria 12322
392 Ga0207670_10017283 3300025936 Bacteria 4359
393 Ga0207670_10091604 3300025936 Viruses 2150
394 Ga0207670_10192568 3300025936 Bacteria 1544
395 Ga0207669_10259479 3300025937 Bacteria 1299
396 Ga0207669_10370794 3300025937 Bacteria 1112
397 Ga0207704_10007492 3300025938 Bacteria 5160
398 Ga0207704_10267228 3300025938 Bacteria 1293
399 Ga0207704_10679015 3300025938 Bacteria 851
400 Ga0207691_10002812 3300025940 Bacteria 16965
401 Ga0207691_10998772 3300025940 Unclassified 698
402 Ga0207711_10370524 3300025941 Bacteria 1328
403 Ga0207711_10434225 3300025941 Bacteria 1222
404 Ga0207711_10783608 3300025941 Bacteria 888
405 Ga0207689_10011030 3300025942 Bacteria 7767
406 Ga0207689_10445389 3300025942 Unclassified 1082
407 Ga0207689_10759026 3300025942 Unclassified 819
408 Ga0207661_10214016 3300025944 Bacteria 1700
409 Ga0207661_10227440 3300025944 Bacteria 1651
410 Ga0207667_10314179 3300025949 Bacteria 1600
411 Ga0207651_10002277 3300025960 Bacteria 9125
412 Ga0207651_10518637 3300025960 Bacteria 1032
413 Ga0207651_11002956 3300025960 Bacteria 746
414 Ga0207712_10178561 3300025961 Bacteria 1665
415 Ga0207640_10040150 3300025981 Bacteria 2966
416 Ga0207640_10291547 3300025981 Bacteria 1287
417 Ga0207677_10000070 3300026023 Bacteria 84502
418 Ga0207677_10000071 3300026023 Bacteria 84386
419 Ga0207677_10093911 3300026023 Unclassified 2188
420 Ga0207703_10000022 3300026035 Bacteria 245723
421 Ga0207703_10089622 3300026035 Bacteria 2583
422 Ga0207703_10092434 3300026035 Bacteria 2546
423 Ga0207703_10383991 3300026035 Bacteria 1300
424 Ga0207639_10365682 3300026041 Bacteria 1292
425 Ga0207678_10808273 3300026067 Bacteria 828
426 Ga0207708_10102321 3300026075 Viruses 2218
427 Ga0207708_10183271 3300026075 Bacteria 1663
428 Ga0207641_10019185 3300026088 Bacteria 5610
429 Ga0207641_10040000 3300026088 Bacteria 3922
430 Ga0207641_10210657 3300026088 Bacteria 1797
431 Ga0207648_10101772 3300026089 Bacteria 2517
432 Ga0207648_10526459 3300026089 Unclassified 1084
433 Ga0207676_10000033 3300026095 Bacteria 215361
434 Ga0207676_10000852 3300026095 Bacteria 23666
435 Ga0207676_10958630 3300026095 Unclassified 841
436 Ga0207674_10044238 3300026116 Bacteria 4586
437 Ga0207674_10054611 3300026116 Viruses 4066
438 Ga0207674_10209767 3300026116 Bacteria 1897
439 Ga0207674_10462552 3300026116 Bacteria 1226
440 Ga0207675_100012195 3300026118 Bacteria 8028
441 Ga0207675_100012847 3300026118 Bacteria 7820
442 Ga0207675_101810222 3300026118 Bacteria 630
443 Ga0207698_10184104 3300026142 Bacteria 1853
444 Ga0207428_10000031 3300027907 Bacteria 235245
445 Ga0207428_10002898 3300027907 Bacteria 17004
446 Ga0268266_10000173 3300028379 Bacteria 117695
447 Ga0268266_10001468 3300028379 Bacteria 28028
448 Ga0268265_10016718 3300028380 Bacteria 5047
449 Ga0268265_10073456 3300028380 Unclassified 2671
450 Ga0268264_10024494 3300028381 Bacteria 4928
451 Ga0265337_1042295 3300028556 Bacteria 1307
452 Ga0265326_10000279 3300028558 Bacteria 23587
453 Ga0265326_10009337 3300028558 Bacteria 2932
454 Ga0265319_1004890 3300028563 Bacteria 6551
455 Ga0265319_1051950 3300028563 Bacteria 1350
456 Ga0265334_10006775 3300028573 Bacteria 4920
457 Ga0265318_10006831 3300028577 Bacteria 5216
458 Ga0265318_10036805 3300028577 Bacteria 1876
459 Ga0265322_10000003 3300028654 Bacteria 468671
460 Ga0265336_10029974 3300028666 Bacteria 1695
461 Ga0307515_10131661 3300028794 Bacteria 2749
462 Ga0265338_10020907 3300028800 Bacteria 6852
463 Ga0265324_10000375 3300029957 Bacteria 32371
464 Ga0265324_10036100 3300029957 Bacteria 1719
465 Ga0265332_10025668 3300031238 Bacteria 2586
466 Ga0265320_10000001 3300031240 Bacteria 847191
467 Ga0265320_10016615 3300031240 Bacteria 4118
468 Ga0265325_10009611 3300031241 Bacteria 5645
469 Ga0265329_10023546 3300031242 Bacteria 2050
470 Ga0265340_10004710 3300031247 Bacteria 7588
471 Ga0265339_10067971 3300031249 Bacteria 1905
472 Ga0265331_10007540 3300031250 Bacteria 6286
473 Ga0265327_10000003 3300031251 Bacteria 852750
474 Ga0265316_10040599 3300031344 Bacteria 3729
475 Ga0307513_10014167 3300031456 Bacteria 9755
476 Ga0307513_10445639 3300031456 Bacteria 1020
477 Ga0307513_10674089 3300031456 Bacteria 740
478 Ga0307408_100000022 3300031548 Bacteria 310242
479 Ga0307408_100010949 3300031548 Bacteria 5985
480 Ga0307408_100190138 3300031548 Bacteria 1653
481 Ga0265313_10070499 3300031595 Bacteria 1610
482 Ga0265314_10000585 3300031711 Bacteria 45849
483 Ga0265314_10021751 3300031711 Bacteria 4924
484 Ga0265342_10020889 3300031712 Bacteria 4189
485 Ga0307405_10019269 3300031731 Bacteria 3785
486 Ga0307405_10137293 3300031731 Bacteria 1699
487 Ga0307405_10493685 3300031731 Bacteria 980
488 Ga0307413_11024330 3300031824 Unclassified 709
489 Ga0307410_10293997 3300031852 Bacteria 1279
490 Ga0307410_10430761 3300031852 Bacteria 1072
491 Ga0307406_10038862 3300031901 Bacteria 2948
492 Ga0307406_10501915 3300031901 Bacteria 984
493 Ga0307412_10016574 3300031911 Bacteria 4393
494 Ga0307412_10051223 3300031911 Bacteria 2727
495 Ga0307409_100213363 3300031995 Bacteria 1737
496 Ga0307409_100325703 3300031995 Bacteria 1440
497 Ga0307409_100436094 3300031995 Bacteria 1261
498 Ga0307416_100102933 3300032002 Bacteria 2491
499 Ga0307416_100218787 3300032002 Bacteria 1824
500 Ga0307414_10016097 3300032004 Bacteria 4535
501 Ga0307414_10034118 3300032004 Unclassified 3370
502 Ga0307414_10121425 3300032004 Bacteria 2009
503 Ga0307414_10232706 3300032004 Bacteria 1520
504 Ga0307414_10366889 3300032004 Bacteria 1241
505 Ga0307414_10422722 3300032004 Viruses 1162
506 Ga0307414_10458126 3300032004 Bacteria 1120
507 Ga0307414_10511725 3300032004 Bacteria 1064
508 Ga0307411_10019979 3300032005 Bacteria 3884
509 Ga0307411_10044726 3300032005 Bacteria 2843
510 Ga0307411_10124797 3300032005 Viruses 1870
511 Ga0307411_11064071 3300032005 Bacteria 727
512 Ga0307415_100028042 3300032126 Bacteria 3576
513 Ga0307415_100029978 3300032126 Bacteria 3484
514 Ga0307415_100241306 3300032126 Bacteria 1462
515 Ga0307415_101937038 3300032126 Bacteria 573
516 Ga0307510_10041591 3300033180 Bacteria 5021
517 Ga0373932_0005015 3300035112 Bacteria 3117
518 Ga0373941_0011088 3300035115 Bacteria 2322
519 Ga0373945_0327152 3300035116 Bacteria 661
520 Ga0373956_0053579 3300035119 Bacteria 1816
521 Ga0373957_0049865 3300035120 Bacteria 1599
522 Ga0373924_0251458 3300035410 Bacteria 782
523 Ga0373927_0293533 3300035695 Bacteria 1070
524 Ga0373947_0604516 3300035725 Bacteria 747
525 Ga0373925_0338071 3300037068 Bacteria 1221
526 Ga0395900_0334906 3300037418 Bacteria 1490
527 Ga0395900_0921551 3300037418 Bacteria 796
528 Ga0395898_0036797 3300037466 Bacteria 4858
529 Ga0395905_0003836 3300037471 Bacteria 15876
530 Ga0395905_0058674 3300037471 Bacteria 3598
531 Ga0436364_0358665 3300037853 Bacteria 767
532 Ga0436364_0698855 3300037853 Bacteria 4563
533 Ga0395901_0005616 3300038443 Bacteria 12695
534 Ga0395901_0061189 3300038443 Bacteria 3918
535 Ga0395901_0377352 3300038443 Bacteria 1460
536 Ga0242422_04911 3300038699 Viruses 825
537 Ga0237819_06714 3300038705 Bacteria 1706
538 Ga0242420_014836 3300038996 Bacteria 1341
539 Ga0436365_0182192 3300039437 Bacteria 2816
540 Ga0436365_0311259 3300039437 Bacteria 72483
541 Ga0436365_0478136 3300039437 Bacteria 2355
542 Ga0436363_1606136 3300039450 Bacteria 615
543 Ga0436362_0092156 3300039453 Bacteria 843
544 Ga0436362_0597322 3300039453 Bacteria 18881
545 Ga0439439_0024833 3300041406 Bacteria 1506
546 Ga0439431_0005150 3300041997 Bacteria 2883
547 Ga0439433_0050071 3300041999 Unclassified 984
548 Ga0439442_059847 3300042002 Unclassified 807
549 Ga0439454_090414 3300042011 Bacteria 565
550 Ga0439455_0000820 3300042012 Bacteria 4736
551 Ga0439457_100484 3300042014 Unclassified 674
552 Ga0450922_010055 3300042124 Unclassified 904
553 Ga0450922_026585 3300042124 Bacteria 617
554 Ga0450890_019455 3300042127 Bacteria 915
555 Ga0450894_006897 3300042131 Unclassified 1463
556 Ga0450896_005192 3300042133 Bacteria 1775
557 Ga0450898_001804 3300042134 Unclassified 2885
558 Ga0450889_007697 3300042144 Bacteria 1089
559 Ga0439458_0003285 3300042157 Bacteria 3814
560 Ga0439434_0007007 3300042435 Bacteria 3293
561 Ga0439459_0084783 3300042438 Bacteria 753
562 Ga0450893_0023295 3300042532 Bacteria 1076
563 Ga0453684_0920484 3300044712 Bacteria 935
564 Ga0466957_0265945 3300044842 Bacteria 1144
565 Ga0451576_0645660 3300045051 Unclassified 1112
566 Ga0495580_0022765 3300046472 Bacteria 4606
567 Ga0495580_0023793 3300046472 Bacteria 4493
568 Ga0495582_0099570 3300046473 Bacteria 1627
569 Ga0495664_0596919 3300046477 Bacteria 656
570 Ga0495594_0069466 3300046499 Bacteria 1957
571 Ga0495628_0064688 3300046516 Bacteria 2863
572 Ga0495628_0350732 3300046516 Bacteria 1085
573 Ga0495632_0048084 3300046519 Bacteria 2113
574 Ga0495663_0000074 3300046525 Bacteria 45307
575 Ga0495663_0276528 3300046525 Bacteria 601
576 Ga0495665_0255190 3300046531 Bacteria 902
577 Ga0495598_0000137 3300046537 Bacteria 12442
578 Ga0495621_0001775 3300046539 Bacteria 5659
579 Ga0495645_0306741 3300046543 Bacteria 1035
580 Ga0495599_0082314 3300046678 Bacteria 2011
581 Ga0495669_0031397 3300046684 Unclassified 2333
582 Ga0495613_0348640 3300046689 Bacteria 1017
583 Ga0495624_0068120 3300046690 Bacteria 2219
584 Ga0495670_0005553 3300046691 Bacteria 6188
585 Ga0495672_0026267 3300047320 Unclassified 3717
586 Ga0495615_0119780 3300048090 Bacteria 760
587 Ga0496106_0043934 3300048909 Bacteria 3354
588 Ga0496112_0367070 3300048915 Bacteria 1381
589 Ga0496115_0011740 3300048918 Bacteria 6578
590 Ga0496115_0016640 3300048918 Bacteria 5604
591 Ga0496124_0007663 3300048927 Bacteria 11420
592 Ga0496125_0001113 3300048928 Bacteria 41129
593 Ga0501306_007133 3300049127 Bacteria 1330
594 Ga0501308_000861 3300049128 Bacteria 2204
595 Ga0501308_003075 3300049128 Bacteria 1517
596 Ga0501309_004240 3300049129 Bacteria 1663
597 Ga0501309_007703 3300049129 Bacteria 1340
598 Ga0501310_013464 3300049130 Bacteria 949
599 Ga0501304_000321 3300049160 Bacteria 2313
600 Ga0501305_001491 3300049161 Bacteria 2302
601 Ga0501305_004817 3300049161 Bacteria 1607
602 Ga0501307_000885 3300049162 Bacteria 2297
603 Ga0501307_002106 3300049162 Bacteria 1811
604 Ga0501292_003714 3300049515 Bacteria 2054
605 Ga0501293_019648 3300049516 Bacteria 653
606 Ga0501297_003996 3300049520 Bacteria 1491
607 Ga0501298_001929 3300049521 Bacteria 3094
608 Ga0501299_007771 3300049522 Bacteria 1722
609 Ga0501311_001638 3300049527 Bacteria 2000
610 Ga0501312_004054 3300049528 Bacteria 1706
611 Ga0501318_009200 3300049534 Bacteria 1072
612 Ga0501320_000512 3300049536 Bacteria 2307
613 Ga0501321_000594 3300049537 Bacteria 2416
614 Ga0501321_002776 3300049537 Bacteria 1551
615 Ga0501322_000709 3300049538 Bacteria 1667
616 Ga0501323_002531 3300049539 Bacteria 1782
617 Ga0501323_003469 3300049539 Bacteria 1612
618 Ga0501323_004507 3300049539 Bacteria 1478
619 Ga0501324_000391 3300049540 Bacteria 2314
620 Ga0501324_006008 3300049540 Bacteria 1010
621 Ga0501329_00622 3300049545 Bacteria 1323
622 Ga0501071_0097935 3300049587 Bacteria 2159
623 Ga0501072_0019364 3300049588 Bacteria 5260
624 Ga0501076_0981366 3300049592 Bacteria 696
625 Ga0501198_002341 3300049649 Bacteria 2547
626 Ga0501198_002373 3300049649 Bacteria 2532
627 Ga0501201_004493 3300049651 Bacteria 1294
628 Ga0501202_003871 3300049652 Bacteria 2585
629 Ga0501206_007712 3300049653 Bacteria 1414
630 Ga0501207_000161 3300049654 Bacteria 6256
631 Ga0501207_003187 3300049654 Bacteria 2168
632 Ga0501208_012883 3300049655 Bacteria 1238
633 Ga0501209_007709 3300049656 Bacteria 2082
634 Ga0501209_152183 3300049656 Bacteria 697
635 Ga0501216_000468 3300049660 Bacteria 4794
636 Ga0501216_012877 3300049660 Bacteria 1379
637 Ga0501217_003208 3300049661 Bacteria 3285
638 Ga0501217_010161 3300049661 Bacteria 2057
639 Ga0501223_050023 3300049663 Bacteria 811
640 Ga0501224_001416 3300049664 Bacteria 3178
641 Ga0501227_006456 3300049665 Bacteria 2521
642 Ga0501228_010963 3300049666 Bacteria 911
643 Ga0501233_002196 3300049668 Bacteria 3418
644 Ga0501233_022011 3300049668 Bacteria 1373
645 Ga0501235_005061 3300049669 Bacteria 2861
646 Ga0501247_006826 3300049677 Bacteria 1300
647 Ga0501249_009938 3300049679 Bacteria 1983
648 Ga0501253_001740 3300049683 Bacteria 2299
649 Ga0501257_047174 3300049686 Bacteria 1068
650 Ga0501259_039805 3300049688 Bacteria 920
651 Ga0501260_001450 3300049689 Bacteria 1959
652 Ga0501261_012231 3300049690 Bacteria 1152
653 Ga0501221_045565 3300049704 Bacteria 972
654 Ga0501225_0002871 3300049705 Bacteria 5290
655 Ga0501225_0013234 3300049705 Bacteria 2312
656 Ga0501234_000070 3300049707 Bacteria 12479
657 Ga0501245_029318 3300049708 Bacteria 902
658 Ga0501080_0634296 3300049742 Bacteria 946
659 Ga0501241_047858 3300049758 Bacteria 840
660 Ga0501272_020708 3300049769 Bacteria 789
661 Ga0501273_005337 3300049770 Bacteria 1449
662 Ga0501279_096903 3300049775 Bacteria 527
663 Ga0501226_002550 3300049853 Bacteria 2216
664 nmdc:mga00v17_44324_c1 3300050491 Bacteria 2682
665 nmdc:mga0yw44_135300_c1 3300050492 Bacteria 1598
666 nmdc:mga0yw44_337611_c1 3300050492 Bacteria 1013
667 nmdc:mga05p37_257638_c1 3300050507 Bacteria 2090
668 nmdc:mga05p37_264694_c1 3300050507 Bacteria 2056
669 nmdc:mga05p37_425333_c1 3300050507 Bacteria 1544
670 nmdc:mga05p37_963208_c1 3300050507 Bacteria 911
671 nmdc:mga09592_85531_c1 3300050508 Bacteria 2690
672 nmdc:mga09592_88245_c1 3300050508 Bacteria 2649
673 nmdc:mga09592_91186_c1 3300050508 Bacteria 2604
674 nmdc:mga0qj67_14195_c1 3300050509 Bacteria 6020
675 nmdc:mga06r32_73682_c1 3300050510 Bacteria 3308
676 nmdc:mga08y16_22_c1 3300050511 Bacteria 250162
677 nmdc:mga08y16_31879_c1 3300050511 Bacteria 5542
678 nmdc:mga08y16_413385_c1 3300050511 Bacteria 1379
679 nmdc:mga0n895_1196188_c1 3300050512 Unclassified 734
680 nmdc:mga0n895_1495086_c1 3300050512 Bacteria 642
681 nmdc:mga0n895_261745_c1 3300050512 Bacteria 1755
682 nmdc:mga0n895_27393_c1 3300050512 Bacteria 5414
683 nmdc:mga0n895_88456_c1 3300050512 Bacteria 3097
684 nmdc:mga0rr50_531299_c1 3300050513 Bacteria 1001
685 nmdc:mga0rr50_98883_c1 3300050513 Bacteria 2288
686 nmdc:mga0a205_27582_c1 3300050515 Bacteria 5424
687 nmdc:mga0a205_80661_c1 3300050515 Unclassified 3143
688 nmdc:mga0a205_94943_c1 3300050515 Bacteria 2881
689 Ga0500646_0069647 3300053090 Bacteria 1052
690 Ga0500641_0000580 3300053096 Bacteria 13189
691 Ga0500594_0033618 3300053118 Bacteria 1365
692 Ga0500658_0158618 3300053134 Bacteria 1023
693 Ga0500568_0011991 3300053139 Bacteria 4000
694 Ga0500627_0054218 3300053158 Bacteria 1753
695 Ga0587084_011814 3300059477 Bacteria 1171
696 Ga0587084_016336 3300059477 Bacteria 1058
697 Ga0587084_027395 3300059477 Bacteria 896
698 Ga0587066_013619 3300059490 Bacteria 1235
699 Ga0587070_007002 3300059491 Bacteria 1546
700 Ga0587070_096986 3300059491 Bacteria 672
701 Ga0587077_015975 3300059493 Bacteria 1258
702 Ga0587077_060150 3300059493 Unclassified 821
703 Ga0587085_002150 3300059506 Bacteria 1973
704 Ga0587086_004272 3300059507 Bacteria 1485
705 Ga0587091_016189 3300059511 Bacteria 1240
706 Ga0587092_001585 3300059512 Bacteria 2259
707 Ga0587092_006074 3300059512 Bacteria 1516
708 Ga0587125_021471 3300059607 Unclassified 765
709 Ga0587101_017008 3300059623 Bacteria 1003
710 Ga0587109_041391 3300059624 Bacteria 915
711 Ga0587109_044481 3300059624 Bacteria 891
712 Ga0587109_105073 3300059624 Bacteria 654
713 Ga0587117_007307 3300059627 Bacteria 1262
714 Ga0587062_041930 3300059639 Unclassified 746
715 Ga0587068_039119 3300059641 Bacteria 852
716 Ga0587072_012699 3300059643 Bacteria 1395
717 Ga0587076_011628 3300059645 Bacteria 1298
718 Ga0587079_034579 3300059647 Bacteria 990
719 Ga0587079_048002 3300059647 Unclassified 886
720 Ga0587079_091941 3300059647 Unclassified 711
721 Ga0587071_048764 3300060344 Bacteria 870
722 Ga0587111_0007287 3300060346 Bacteria 1792
723 Ga0587111_0009384 3300060346 Bacteria 1649
724 Ga0587111_0060396 3300060346 Bacteria 860

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100783347 Ga0070675_1007833471 134
2 3300005347 Ga0070668_100300051 Ga0070668_1003000512 145
3 3300005353 Ga0070669_100069679 Ga0070669_1000696793 145
4 3300005617 Ga0068859_100099968 Ga0068859_1000999683 145
5 3300005719 Ga0068861_100027087 Ga0068861_1000270873 145
6 3300006931 Ga0097620_100099964 Ga0097620_1000999643 145
7 3300025918 Ga0207662_10101789 Ga0207662_101017892 145
8 3300025923 Ga0207681_10100805 Ga0207681_101008051 145
9 3300026118 Ga0207675_100012195 Ga0207675_1000121953 145
10 3300005440 Ga0070705_100146417 Ga0070705_1001464172 147
11 3300005518 Ga0070699_100095275 Ga0070699_1000952752 148
12 3300005549 Ga0070704_100605475 Ga0070704_1006054752 148
13 3300059647 Ga0587079_034579 Ga0587079_034579_232_738 150
14 3300006852 Ga0075433_10006999 Ga0075433_100069992 152
15 3300049587 Ga0501071_0097935 Ga0501071_0097935_276_779 152
16 3300049592 Ga0501076_0981366 Ga0501076_0981366_31_534 152
17 3300050515 nmdc:mga0a205_27582_c1 nmdc:mga0a205_27582_c1_4409_4909 152
18 3300003771 Ga0055526_1000971 Ga0055526_10009712 153
19 3300003773 Ga0055537_1002636 Ga0055537_10026366 153
20 3300003790 Ga0055528_1046844 Ga0055528_10468441 153
21 3300005262 Ga0065165_1027329 Ga0065165_10273292 153
22 3300005536 Ga0070697_100000995 Ga0070697_10000099511 153
23 3300046516 Ga0495628_0064688 Ga0495628_0064688_2105_2626 153
24 3300050507 nmdc:mga05p37_963208_c1 nmdc:mga05p37_963208_c1_416_883 153
25 3300005337 Ga0070682_100000648 Ga0070682_1000006484 154
26 3300039437 Ga0436365_0311259 Ga0436365_0311259_31362_31835 154
27 3300039453 Ga0436362_0597322 Ga0436362_0597322_18082_18555 154
28 3300005289 Ga0065704_10112644 Ga0065704_101126441 155
29 3300005546 Ga0070696_100389361 Ga0070696_1003893612 155
30 3300005547 Ga0070693_100008236 Ga0070693_1000082367 155
31 3300005615 Ga0070702_100311744 Ga0070702_1003117442 155
32 3300025292 Ga0209676_1000555 Ga0209676_100055533 155
33 3300005334 Ga0068869_100162062 Ga0068869_1001620622 156
34 3300005353 Ga0070669_100013271 Ga0070669_1000132711 156
35 3300005577 Ga0068857_100527514 Ga0068857_1005275142 156
36 3300005618 Ga0068864_100297772 Ga0068864_1002977722 156
37 3300009092 Ga0105250_10250702 Ga0105250_102507021 156
38 3300014325 Ga0163163_10121899 Ga0163163_101218992 156
39 3300014745 Ga0157377_10020590 Ga0157377_100205903 156
40 3300025923 Ga0207681_10025850 Ga0207681_100258506 156
41 3300025936 Ga0207670_10091604 Ga0207670_100916042 156
42 3300026023 Ga0207677_10093911 Ga0207677_100939113 156
43 3300026075 Ga0207708_10102321 Ga0207708_101023212 156
44 3300028380 Ga0268265_10073456 Ga0268265_100734564 156
45 3300035115 Ga0373941_0011088 Ga0373941_0011088_1090_1572 156
46 iso_pu_bacteria 2878738818 2878739700 156
47 iso_pu_bacteria 2884763398 2884766979 156
48 iso_pu_bacteria 2924718760 2924724005 156
49 iso_pu_bacteria 2924776078 2924777229 156
50 iso_pu_bacteria 2937972304 2937975676 156
51 iso_pu_bacteria 2958034702 2958035275 156
52 iso_pu_bacteria 2958041894 2958044307 156
53 iso_pu_bacteria 2958084443 2958087834 156
54 iso_pu_bacteria 2970593180 2970594297 156
55 3300006358 Ga0068871_101229467 Ga0068871_1012294672 157
56 3300006881 Ga0068865_100302738 Ga0068865_1003027382 157
57 3300009551 Ga0105238_10000001 Ga0105238_100000011787 157
58 3300025938 Ga0207704_10267228 Ga0207704_102672282 157
59 3300046525 Ga0495663_0000074 Ga0495663_0000074_7905_8426 157
60 3300050510 nmdc:mga06r32_73682_c1 nmdc:mga06r32_73682_c1_2196_2678 157
61 3300050513 nmdc:mga0rr50_531299_c1 nmdc:mga0rr50_531299_c1_241_744 157
62 3300059607 Ga0587125_021471 Ga0587125_021471_66_590 157
63 3300059647 Ga0587079_048002 Ga0587079_048002_347_871 157
64 3300005444 Ga0070694_100010967 Ga0070694_1000109677 158
65 3300009094 Ga0111539_10000026 Ga0111539_1000002677 158
66 3300009098 Ga0105245_10003884 Ga0105245_100038842 158
67 3300009098 Ga0105245_10449286 Ga0105245_104492862 158
68 3300010375 Ga0105239_10591396 Ga0105239_105913962 158
69 3300013102 Ga0157371_10739062 Ga0157371_107390622 158
70 3300050513 nmdc:mga0rr50_98883_c1 nmdc:mga0rr50_98883_c1_800_1288 158
71 3300003316 rootH1_10182808 rootH1_101828082 159
72 3300005334 Ga0068869_100047863 Ga0068869_1000478632 159
73 3300005340 Ga0070689_100350372 Ga0070689_1003503722 159
74 3300005356 Ga0070674_100136369 Ga0070674_1001363693 159
75 3300005445 Ga0070708_100343826 Ga0070708_1003438262 159
76 3300005471 Ga0070698_100004263 Ga0070698_10000426310 159
77 3300005719 Ga0068861_101807576 Ga0068861_1018075761 159
78 3300006844 Ga0075428_100307359 Ga0075428_1003073592 159
79 3300006846 Ga0075430_100148054 Ga0075430_1001480542 159
80 3300006880 Ga0075429_100192137 Ga0075429_1001921372 159
81 3300009094 Ga0111539_10438326 Ga0111539_104383262 159
82 3300009094 Ga0111539_10859209 Ga0111539_108592091 159
83 3300009147 Ga0114129_10075732 Ga0114129_100757323 159
84 3300009553 Ga0105249_10634329 Ga0105249_106343292 159
85 3300013297 Ga0157378_10067421 Ga0157378_100674212 159
86 3300014326 Ga0157380_10173413 Ga0157380_101734132 159
87 3300041406 Ga0439439_0024833 Ga0439439_0024833_953_1453 159
88 3300041997 Ga0439431_0005150 Ga0439431_0005150_1261_1761 159
89 3300041999 Ga0439433_0050071 Ga0439433_0050071_435_935 159
90 3300042002 Ga0439442_059847 Ga0439442_059847_181_681 159
91 3300042011 Ga0439454_090414 Ga0439454_090414_47_547 159
92 3300042014 Ga0439457_100484 Ga0439457_100484_152_652 159
93 3300042124 Ga0450922_010055 Ga0450922_010055_380_880 159
94 3300042124 Ga0450922_026585 Ga0450922_026585_16_516 159
95 3300042131 Ga0450894_006897 Ga0450894_006897_408_908 159
96 3300042133 Ga0450896_005192 Ga0450896_005192_931_1431 159
97 3300042134 Ga0450898_001804 Ga0450898_001804_2148_2648 159
98 3300042435 Ga0439434_0007007 Ga0439434_0007007_2344_2844 159
99 3300048918 Ga0496115_0011740 Ga0496115_0011740_2242_2745 159
100 3300049588 Ga0501072_0019364 Ga0501072_0019364_2811_3323 159
101 3300050507 nmdc:mga05p37_264694_c1 nmdc:mga05p37_264694_c1_658_1218 159
102 3300050508 nmdc:mga09592_88245_c1 nmdc:mga09592_88245_c1_727_1227 159
103 3300050509 nmdc:mga0qj67_14195_c1 nmdc:mga0qj67_14195_c1_1036_1596 159
104 3300050511 nmdc:mga08y16_413385_c1 nmdc:mga08y16_413385_c1_243_746 159
105 iso_pu_bacteria 2512875016 2512933673 159
106 iso_pu_bacteria 2585428094 2587861745 159
107 iso_pu_bacteria 2876363079 2876364072 159
108 iso_pu_bacteria 2903448605 2903453826 159
109 iso_pu_bacteria 2903521522 2903525768 159
110 iso_pu_bacteria 2903528002 2903532685 159
111 iso_pu_bacteria 2937848649 2937853891 159
112 iso_pu_bacteria 2963644680 2963645530 159
113 iso_pu_bacteria 2968083720 2968085136 159
114 iso_pu_bacteria 2977922695 2977924687 159
115 iso_pu_bacteria 3004211236 3004218478 159
116 iso_pu_bacteria 3004218560 3004222889 159
117 3300002737 JGI25162J39368_1014118 JGI25162J39368_10141182 160
118 3300002772 JGI25164J39214_1003119 JGI25164J39214_10031192 160
119 3300003214 JGI25165J46597_1000005 JGI25165J46597_100000566 160
120 3300005336 Ga0070680_100000388 Ga0070680_1000003887 160
121 3300005337 Ga0070682_100110757 Ga0070682_1001107572 160
122 3300005339 Ga0070660_100002905 Ga0070660_10000290511 160
123 3300005458 Ga0070681_10030032 Ga0070681_100300323 160
124 3300005530 Ga0070679_100000002 Ga0070679_1000000025 160
125 3300005548 Ga0070665_100000145 Ga0070665_100000145147 160
126 3300009147 Ga0114129_10312807 Ga0114129_103128073 160
127 3300013296 Ga0157374_10000037 Ga0157374_100000372 160
128 3300014745 Ga0157377_10000008 Ga0157377_100000082 160
129 3300025231 Ga0207427_100028 Ga0207427_10002886 160
130 3300025233 Ga0209437_100211 Ga0209437_10021170 160
131 3300025261 Ga0209233_1000001 Ga0209233_1000001584 160
132 3300025917 Ga0207660_10000892 Ga0207660_1000089217 160
133 3300025919 Ga0207657_10016857 Ga0207657_100168574 160
134 3300025921 Ga0207652_10000001 Ga0207652_10000001491 160
135 3300025921 Ga0207652_10000002 Ga0207652_10000002237 160
136 3300028379 Ga0268266_10000173 Ga0268266_100001732 160
137 3300037418 Ga0395900_0921551 Ga0395900_0921551_129_632 160
138 3300038443 Ga0395901_0061189 Ga0395901_0061189_3045_3548 160
139 3300050507 nmdc:mga05p37_257638_c1 nmdc:mga05p37_257638_c1_694_1197 160
140 3300005356 Ga0070674_100467638 Ga0070674_1004676381 161
141 3300005546 Ga0070696_100307112 Ga0070696_1003071122 161
142 3300009176 Ga0105242_10005282 Ga0105242_100052828 161
143 3300013297 Ga0157378_11337627 Ga0157378_113376272 161
144 3300025934 Ga0207686_10011983 Ga0207686_100119836 161
145 3300025937 Ga0207669_10259479 Ga0207669_102594791 161
146 3300031852 Ga0307410_10293997 Ga0307410_102939973 161
147 3300031995 Ga0307409_100213363 Ga0307409_1002133632 161
148 3300032005 Ga0307411_10044726 Ga0307411_100447264 161
149 3300032126 Ga0307415_101937038 Ga0307415_1019370381 161
150 3300053134 Ga0500658_0158618 Ga0500658_0158618_281_781 161
151 iso_pu_bacteria 2513020052 2513234669 161
152 iso_pu_bacteria 2522125168 2522550813 161
153 iso_pu_bacteria 2816332280 2817416931 161
154 iso_pu_bacteria 2919683626 2919684230 161
155 3300002773 JGI25152J39213_1000204 JGI25152J39213_10002046 162
156 3300002774 JGI25150J39212_1000391 JGI25150J39212_10003916 162
157 3300003215 JGI25153J46596_10011374 JGI25153J46596_100113746 162
158 3300003771 Ga0055526_1000199 Ga0055526_10001996 162
159 3300003775 Ga0055524_1000222 Ga0055524_100022227 162
160 3300003775 Ga0055524_1002259 Ga0055524_10022594 162
161 3300003791 Ga0055530_10000308 Ga0055530_100003086 162
162 3300005289 Ga0065704_10227387 Ga0065704_102273872 162
163 3300005295 Ga0065707_10083232 Ga0065707_100832329 162
164 3300005327 Ga0070658_10004705 Ga0070658_100047059 162
165 3300005337 Ga0070682_100000022 Ga0070682_1000000222 162
166 3300005338 Ga0068868_100000070 Ga0068868_10000007021 162
167 3300005356 Ga0070674_100079681 Ga0070674_1000796814 162
168 3300005365 Ga0070688_100180342 Ga0070688_1001803423 162
169 3300005441 Ga0070700_100137513 Ga0070700_1001375132 162
170 3300005444 Ga0070694_100236540 Ga0070694_1002365402 162
171 3300005617 Ga0068859_100002668 Ga0068859_1000026686 162
172 3300005617 Ga0068859_102219164 Ga0068859_1022191641 162
173 3300005719 Ga0068861_100744478 Ga0068861_1007444782 162
174 3300005842 Ga0068858_100486069 Ga0068858_1004860691 162
175 3300005844 Ga0068862_100018222 Ga0068862_1000182225 162
176 3300006844 Ga0075428_100007935 Ga0075428_10000793510 162
177 3300006844 Ga0075428_100039304 Ga0075428_1000393046 162
178 3300006847 Ga0075431_100096488 Ga0075431_1000964886 162
179 3300006880 Ga0075429_100058501 Ga0075429_1000585012 162
180 3300006931 Ga0097620_100002668 Ga0097620_1000026686 162
181 3300006931 Ga0097620_102218816 Ga0097620_1022188161 162
182 3300007076 Ga0075435_100347412 Ga0075435_1003474122 162
183 3300009094 Ga0111539_10093138 Ga0111539_100931385 162
184 3300009094 Ga0111539_11320662 Ga0111539_113206622 162
185 3300009176 Ga0105242_10000271 Ga0105242_100002719 162
186 3300009551 Ga0105238_10000032 Ga0105238_10000032142 162
187 3300009553 Ga0105249_10619559 Ga0105249_106195592 162
188 3300013102 Ga0157371_10014418 Ga0157371_100144181 162
189 3300013102 Ga0157371_10016302 Ga0157371_100163025 162
190 3300013105 Ga0157369_10156080 Ga0157369_101560802 162
191 3300013297 Ga0157378_10052127 Ga0157378_100521275 162
192 3300013306 Ga0163162_10027811 Ga0163162_100278113 162
193 3300013306 Ga0163162_10321978 Ga0163162_103219782 162
194 3300013307 Ga0157372_10075983 Ga0157372_100759832 162
195 3300013307 Ga0157372_10108478 Ga0157372_101084782 162
196 3300025245 Ga0207425_1000001 Ga0207425_100000191 162
197 3300025258 Ga0209129_1000003 Ga0209129_100000391 162
198 3300025258 Ga0209129_1015382 Ga0209129_10153822 162
199 3300025263 Ga0209565_1001872 Ga0209565_10018726 162
200 3300025263 Ga0209565_1003580 Ga0209565_10035803 162
201 3300025263 Ga0209565_1012230 Ga0209565_10122302 162
202 3300025291 Ga0209675_1000223 Ga0209675_100022351 162
203 3300025295 Ga0209564_1000095 Ga0209564_100009569 162
204 3300025295 Ga0209564_1001520 Ga0209564_100152012 162
205 3300025297 Ga0209758_1000041 Ga0209758_100004139 162
206 3300025298 Ga0209050_1000138 Ga0209050_100013889 162
207 3300025299 Ga0209256_1000402 Ga0209256_100040229 162
208 3300025299 Ga0209256_1000438 Ga0209256_100043821 162
209 3300025909 Ga0207705_10009322 Ga0207705_100093222 162
210 3300025924 Ga0207694_10000041 Ga0207694_10000041142 162
211 3300025934 Ga0207686_10000285 Ga0207686_1000028511 162
212 3300025937 Ga0207669_10370794 Ga0207669_103707942 162
213 3300025961 Ga0207712_10178561 Ga0207712_101785612 162
214 3300026023 Ga0207677_10000070 Ga0207677_1000007018 162
215 3300026118 Ga0207675_101810222 Ga0207675_1018102221 162
216 3300027907 Ga0207428_10002898 Ga0207428_100028986 162
217 3300028380 Ga0268265_10016718 Ga0268265_100167187 162
218 3300028563 Ga0265319_1051950 Ga0265319_10519502 162
219 3300028577 Ga0265318_10036805 Ga0265318_100368052 162
220 3300028794 Ga0307515_10131661 Ga0307515_101316614 162
221 3300031548 Ga0307408_100000022 Ga0307408_100000022220 162
222 3300031548 Ga0307408_100190138 Ga0307408_1001901382 162
223 3300031731 Ga0307405_10019269 Ga0307405_100192693 162
224 3300031852 Ga0307410_10430761 Ga0307410_104307612 162
225 3300031901 Ga0307406_10501915 Ga0307406_105019151 162
226 3300031911 Ga0307412_10051223 Ga0307412_100512232 162
227 3300031995 Ga0307409_100325703 Ga0307409_1003257032 162
228 3300032002 Ga0307416_100218787 Ga0307416_1002187873 162
229 3300032004 Ga0307414_10458126 Ga0307414_104581262 162
230 3300032005 Ga0307411_10019979 Ga0307411_100199794 162
231 3300032126 Ga0307415_100028042 Ga0307415_1000280423 162
232 3300037466 Ga0395898_0036797 Ga0395898_0036797_150_650 162
233 3300037471 Ga0395905_0058674 Ga0395905_0058674_141_641 162
234 3300038443 Ga0395901_0005616 Ga0395901_0005616_9151_9651 162
235 3300047320 Ga0495672_0026267 Ga0495672_0026267_959_1456 162
236 3300048090 Ga0495615_0119780 Ga0495615_0119780_96_596 162
237 3300048909 Ga0496106_0043934 Ga0496106_0043934_309_806 162
238 3300049520 Ga0501297_003996 Ga0501297_003996_491_1006 162
239 3300049521 Ga0501298_001929 Ga0501298_001929_1997_2512 162
240 3300049522 Ga0501299_007771 Ga0501299_007771_535_1050 162
241 3300049539 Ga0501323_004507 Ga0501323_004507_318_833 162
242 3300049649 Ga0501198_002373 Ga0501198_002373_1703_2218 162
243 3300049651 Ga0501201_004493 Ga0501201_004493_662_1177 162
244 3300049654 Ga0501207_003187 Ga0501207_003187_431_946 162
245 3300049655 Ga0501208_012883 Ga0501208_012883_313_828 162
246 3300049656 Ga0501209_152183 Ga0501209_152183_55_570 162
247 3300049660 Ga0501216_012877 Ga0501216_012877_328_843 162
248 3300049661 Ga0501217_003208 Ga0501217_003208_2236_2751 162
249 3300049666 Ga0501228_010963 Ga0501228_010963_165_680 162
250 3300049668 Ga0501233_022011 Ga0501233_022011_330_845 162
251 3300049669 Ga0501235_005061 Ga0501235_005061_2124_2639 162
252 3300049677 Ga0501247_006826 Ga0501247_006826_510_1025 162
253 3300049683 Ga0501253_001740 Ga0501253_001740_1205_1720 162
254 3300049688 Ga0501259_039805 Ga0501259_039805_296_811 162
255 3300049689 Ga0501260_001450 Ga0501260_001450_1301_1816 162
256 3300049690 Ga0501261_012231 Ga0501261_012231_252_767 162
257 3300049705 Ga0501225_0013234 Ga0501225_0013234_1301_1816 162
258 3300049708 Ga0501245_029318 Ga0501245_029318_190_705 162
259 3300049758 Ga0501241_047858 Ga0501241_047858_101_616 162
260 3300049770 Ga0501273_005337 Ga0501273_005337_805_1320 162
261 3300050508 nmdc:mga09592_85531_c1 nmdc:mga09592_85531_c1_1287_1802 162
262 3300050511 nmdc:mga08y16_31879_c1 nmdc:mga08y16_31879_c1_360_875 162
263 3300059624 Ga0587109_044481 Ga0587109_044481_297_815 162
264 3300003320 rootH2_10252390 rootH2_102523901 163
265 3300005293 Ga0065715_10140686 Ga0065715_101406862 163
266 3300005293 Ga0065715_10157220 Ga0065715_101572203 163
267 3300005293 Ga0065715_10174159 Ga0065715_101741592 163
268 3300005327 Ga0070658_10190346 Ga0070658_101903462 163
269 3300005329 Ga0070683_100243314 Ga0070683_1002433142 163
270 3300005331 Ga0070670_100005938 Ga0070670_1000059383 163
271 3300005331 Ga0070670_100033105 Ga0070670_1000331054 163
272 3300005331 Ga0070670_100155239 Ga0070670_1001552392 163
273 3300005334 Ga0068869_100793891 Ga0068869_1007938911 163
274 3300005337 Ga0070682_100000096 Ga0070682_10000009610 163
275 3300005338 Ga0068868_100001632 Ga0068868_1000016327 163
276 3300005339 Ga0070660_100001702 Ga0070660_1000017027 163
277 3300005340 Ga0070689_100026482 Ga0070689_1000264822 163
278 3300005340 Ga0070689_100029297 Ga0070689_1000292974 163
279 3300005340 Ga0070689_100382957 Ga0070689_1003829571 163
280 3300005341 Ga0070691_10295331 Ga0070691_102953311 163
281 3300005343 Ga0070687_100134125 Ga0070687_1001341252 163
282 3300005344 Ga0070661_100000114 Ga0070661_10000011451 163
283 3300005344 Ga0070661_100697784 Ga0070661_1006977841 163
284 3300005353 Ga0070669_100015293 Ga0070669_1000152933 163
285 3300005354 Ga0070675_100074405 Ga0070675_1000744054 163
286 3300005355 Ga0070671_100039938 Ga0070671_1000399384 163
287 3300005364 Ga0070673_100202681 Ga0070673_1002026812 163
288 3300005365 Ga0070688_101512092 Ga0070688_1015120921 163
289 3300005366 Ga0070659_100000017 Ga0070659_100000017149 163
290 3300005439 Ga0070711_100484196 Ga0070711_1004841962 163
291 3300005440 Ga0070705_100989591 Ga0070705_1009895911 163
292 3300005456 Ga0070678_100903786 Ga0070678_1009037862 163
293 3300005459 Ga0068867_100240105 Ga0068867_1002401052 163
294 3300005467 Ga0070706_100035089 Ga0070706_1000350893 163
295 3300005471 Ga0070698_100012193 Ga0070698_1000121937 163
296 3300005536 Ga0070697_100000652 Ga0070697_1000006526 163
297 3300005536 Ga0070697_100456309 Ga0070697_1004563092 163
298 3300005539 Ga0068853_100194179 Ga0068853_1001941791 163
299 3300005543 Ga0070672_100001157 Ga0070672_1000011574 163
300 3300005546 Ga0070696_100745829 Ga0070696_1007458291 163
301 3300005549 Ga0070704_100085003 Ga0070704_1000850033 163
302 3300005549 Ga0070704_100246798 Ga0070704_1002467982 163
303 3300005577 Ga0068857_100049299 Ga0068857_1000492993 163
304 3300005617 Ga0068859_100163536 Ga0068859_1001635362 163
305 3300005617 Ga0068859_100212513 Ga0068859_1002125133 163
306 3300005617 Ga0068859_100380275 Ga0068859_1003802752 163
307 3300005618 Ga0068864_100000032 Ga0068864_100000032177 163
308 3300005618 Ga0068864_100002419 Ga0068864_1000024195 163
309 3300005840 Ga0068870_10001285 Ga0068870_100012858 163
310 3300005841 Ga0068863_100050442 Ga0068863_1000504422 163
311 3300005842 Ga0068858_100007130 Ga0068858_1000071306 163
312 3300005842 Ga0068858_100053652 Ga0068858_1000536523 163
313 3300006038 Ga0075365_10029151 Ga0075365_100291512 163
314 3300006358 Ga0068871_100166569 Ga0068871_1001665693 163
315 3300006852 Ga0075433_10148911 Ga0075433_101489113 163
316 3300006871 Ga0075434_100051241 Ga0075434_1000512413 163
317 3300006871 Ga0075434_100510860 Ga0075434_1005108601 163
318 3300006871 Ga0075434_101400695 Ga0075434_1014006952 163
319 3300006931 Ga0097620_100163530 Ga0097620_1001635302 163
320 3300006931 Ga0097620_100212504 Ga0097620_1002125042 163
321 3300006931 Ga0097620_100380248 Ga0097620_1003802482 163
322 3300009093 Ga0105240_11092376 Ga0105240_110923761 163
323 3300009098 Ga0105245_10011605 Ga0105245_100116054 163
324 3300009148 Ga0105243_10008963 Ga0105243_100089638 163
325 3300009148 Ga0105243_10081343 Ga0105243_100813432 163
326 3300009174 Ga0105241_10005988 Ga0105241_100059885 163
327 3300009176 Ga0105242_10009637 Ga0105242_100096375 163
328 3300009177 Ga0105248_10058455 Ga0105248_100584555 163
329 3300009553 Ga0105249_10241363 Ga0105249_102413633 163
330 3300011119 Ga0105246_10302787 Ga0105246_103027872 163
331 3300013102 Ga0157371_10729066 Ga0157371_107290662 163
332 3300013104 Ga0157370_10373886 Ga0157370_103738862 163
333 3300013296 Ga0157374_10137320 Ga0157374_101373202 163
334 3300013306 Ga0163162_10013880 Ga0163162_100138804 163
335 3300013308 Ga0157375_10000001 Ga0157375_10000001557 163
336 3300013308 Ga0157375_10106594 Ga0157375_101065941 163
337 3300013308 Ga0157375_11947460 Ga0157375_119474601 163
338 3300014325 Ga0163163_10391176 Ga0163163_103911762 163
339 3300014326 Ga0157380_10014240 Ga0157380_100142402 163
340 3300014326 Ga0157380_10367547 Ga0157380_103675472 163
341 3300014497 Ga0182008_10077830 Ga0182008_100778302 163
342 3300017792 Ga0163161_11098160 Ga0163161_110981601 163
343 3300021384 Ga0213876_10043658 Ga0213876_100436582 163
344 3300025908 Ga0207643_10008324 Ga0207643_100083243 163
345 3300025908 Ga0207643_10020727 Ga0207643_100207272 163
346 3300025909 Ga0207705_10107749 Ga0207705_101077493 163
347 3300025910 Ga0207684_10039428 Ga0207684_100394283 163
348 3300025910 Ga0207684_10348975 Ga0207684_103489752 163
349 3300025911 Ga0207654_10104104 Ga0207654_101041042 163
350 3300025916 Ga0207663_10273715 Ga0207663_102737152 163
351 3300025918 Ga0207662_10063431 Ga0207662_100634313 163
352 3300025919 Ga0207657_10004411 Ga0207657_100044117 163
353 3300025920 Ga0207649_10000011 Ga0207649_1000001111 163
354 3300025923 Ga0207681_10004339 Ga0207681_100043393 163
355 3300025925 Ga0207650_10029226 Ga0207650_100292263 163
356 3300025925 Ga0207650_10556141 Ga0207650_105561412 163
357 3300025925 Ga0207650_10619383 Ga0207650_106193831 163
358 3300025926 Ga0207659_10438798 Ga0207659_104387981 163
359 3300025927 Ga0207687_10000765 Ga0207687_100007653 163
360 3300025927 Ga0207687_10049999 Ga0207687_100499992 163
361 3300025927 Ga0207687_10520265 Ga0207687_105202652 163
362 3300025931 Ga0207644_10835172 Ga0207644_108351722 163
363 3300025932 Ga0207690_10001390 Ga0207690_100013907 163
364 3300025934 Ga0207686_10047887 Ga0207686_100478872 163
365 3300025935 Ga0207709_10019847 Ga0207709_100198475 163
366 3300025936 Ga0207670_10001484 Ga0207670_100014848 163
367 3300025936 Ga0207670_10017283 Ga0207670_100172833 163
368 3300025940 Ga0207691_10002812 Ga0207691_100028124 163
369 3300025940 Ga0207691_10998772 Ga0207691_109987721 163
370 3300025941 Ga0207711_10434225 Ga0207711_104342252 163
371 3300025942 Ga0207689_10445389 Ga0207689_104453892 163
372 3300025942 Ga0207689_10759026 Ga0207689_107590262 163
373 3300025944 Ga0207661_10214016 Ga0207661_102140163 163
374 3300025944 Ga0207661_10227440 Ga0207661_102274403 163
375 3300025960 Ga0207651_10518637 Ga0207651_105186372 163
376 3300025981 Ga0207640_10291547 Ga0207640_102915472 163
377 3300026023 Ga0207677_10000071 Ga0207677_1000007165 163
378 3300026035 Ga0207703_10000022 Ga0207703_10000022189 163
379 3300026035 Ga0207703_10089622 Ga0207703_100896224 163
380 3300026035 Ga0207703_10383991 Ga0207703_103839911 163
381 3300026041 Ga0207639_10365682 Ga0207639_103656823 163
382 3300026075 Ga0207708_10183271 Ga0207708_101832712 163
383 3300026088 Ga0207641_10019185 Ga0207641_100191853 163
384 3300026089 Ga0207648_10101772 Ga0207648_101017722 163
385 3300026095 Ga0207676_10000033 Ga0207676_10000033175 163
386 3300026095 Ga0207676_10000852 Ga0207676_100008526 163
387 3300026116 Ga0207674_10054611 Ga0207674_100546113 163
388 3300027907 Ga0207428_10000031 Ga0207428_1000003170 163
389 3300028381 Ga0268264_10024494 Ga0268264_100244945 163
390 3300028558 Ga0265326_10000279 Ga0265326_100002792 163
391 3300028654 Ga0265322_10000003 Ga0265322_1000000328 163
392 3300028666 Ga0265336_10029974 Ga0265336_100299742 163
393 3300029957 Ga0265324_10000375 Ga0265324_1000037517 163
394 3300031240 Ga0265320_10000001 Ga0265320_1000000128 163
395 3300031242 Ga0265329_10023546 Ga0265329_100235463 163
396 3300031250 Ga0265331_10007540 Ga0265331_100075406 163
397 3300031251 Ga0265327_10000003 Ga0265327_1000000328 163
398 3300031548 Ga0307408_100010949 Ga0307408_1000109494 163
399 3300031711 Ga0265314_10000585 Ga0265314_1000058528 163
400 3300031731 Ga0307405_10137293 Ga0307405_101372933 163
401 3300031901 Ga0307406_10038862 Ga0307406_100388623 163
402 3300031911 Ga0307412_10016574 Ga0307412_100165746 163
403 3300031995 Ga0307409_100436094 Ga0307409_1004360942 163
404 3300032002 Ga0307416_100102933 Ga0307416_1001029333 163
405 3300032004 Ga0307414_10016097 Ga0307414_100160976 163
406 3300032004 Ga0307414_10511725 Ga0307414_105117251 163
407 3300032126 Ga0307415_100029978 Ga0307415_1000299782 163
408 3300035116 Ga0373945_0327152 Ga0373945_0327152_79_576 163
409 3300035695 Ga0373927_0293533 Ga0373927_0293533_287_784 163
410 3300035725 Ga0373947_0604516 Ga0373947_0604516_128_625 163
411 3300037068 Ga0373925_0338071 Ga0373925_0338071_284_781 163
412 3300039437 Ga0436365_0182192 Ga0436365_0182192_2261_2761 163
413 3300039437 Ga0436365_0478136 Ga0436365_0478136_1548_2048 163
414 3300039450 Ga0436363_1606136 Ga0436363_1606136_82_600 163
415 3300039453 Ga0436362_0092156 Ga0436362_0092156_233_733 163
416 3300042012 Ga0439455_0000820 Ga0439455_0000820_2483_3001 163
417 3300042127 Ga0450890_019455 Ga0450890_019455_227_745 163
418 3300042144 Ga0450889_007697 Ga0450889_007697_479_997 163
419 3300042157 Ga0439458_0003285 Ga0439458_0003285_972_1490 163
420 3300046472 Ga0495580_0023793 Ga0495580_0023793_890_1387 163
421 3300046473 Ga0495582_0099570 Ga0495582_0099570_138_635 163
422 3300046499 Ga0495594_0069466 Ga0495594_0069466_832_1329 163
423 3300046519 Ga0495632_0048084 Ga0495632_0048084_1518_2018 163
424 3300046531 Ga0495665_0255190 Ga0495665_0255190_92_589 163
425 3300046537 Ga0495598_0000137 Ga0495598_0000137_8107_8628 163
426 3300046539 Ga0495621_0001775 Ga0495621_0001775_1208_1729 163
427 3300046689 Ga0495613_0348640 Ga0495613_0348640_445_942 163
428 3300046690 Ga0495624_0068120 Ga0495624_0068120_1402_1899 163
429 3300048918 Ga0496115_0016640 Ga0496115_0016640_133_624 163
430 3300049127 Ga0501306_007133 Ga0501306_007133_23_541 163
431 3300049128 Ga0501308_000861 Ga0501308_000861_893_1411 163
432 3300049128 Ga0501308_003075 Ga0501308_003075_790_1308 163
433 3300049129 Ga0501309_004240 Ga0501309_004240_847_1365 163
434 3300049129 Ga0501309_007703 Ga0501309_007703_798_1316 163
435 3300049130 Ga0501310_013464 Ga0501310_013464_307_825 163
436 3300049160 Ga0501304_000321 Ga0501304_000321_794_1312 163
437 3300049161 Ga0501305_001491 Ga0501305_001491_991_1509 163
438 3300049161 Ga0501305_004817 Ga0501305_004817_781_1299 163
439 3300049162 Ga0501307_000885 Ga0501307_000885_995_1513 163
440 3300049162 Ga0501307_002106 Ga0501307_002106_500_1018 163
441 3300049515 Ga0501292_003714 Ga0501292_003714_682_1200 163
442 3300049516 Ga0501293_019648 Ga0501293_019648_31_549 163
443 3300049527 Ga0501311_001638 Ga0501311_001638_786_1304 163
444 3300049528 Ga0501312_004054 Ga0501312_004054_395_913 163
445 3300049534 Ga0501318_009200 Ga0501318_009200_436_954 163
446 3300049536 Ga0501320_000512 Ga0501320_000512_996_1514 163
447 3300049537 Ga0501321_000594 Ga0501321_000594_796_1314 163
448 3300049537 Ga0501321_002776 Ga0501321_002776_790_1308 163
449 3300049538 Ga0501322_000709 Ga0501322_000709_360_878 163
450 3300049539 Ga0501323_002531 Ga0501323_002531_471_989 163
451 3300049539 Ga0501323_003469 Ga0501323_003469_311_829 163
452 3300049540 Ga0501324_000391 Ga0501324_000391_794_1312 163
453 3300049540 Ga0501324_006008 Ga0501324_006008_439_957 163
454 3300049545 Ga0501329_00622 Ga0501329_00622_785_1303 163
455 3300049649 Ga0501198_002341 Ga0501198_002341_996_1514 163
456 3300049652 Ga0501202_003871 Ga0501202_003871_379_897 163
457 3300049653 Ga0501206_007712 Ga0501206_007712_288_806 163
458 3300049654 Ga0501207_000161 Ga0501207_000161_378_896 163
459 3300049656 Ga0501209_007709 Ga0501209_007709_297_815 163
460 3300049660 Ga0501216_000468 Ga0501216_000468_4005_4523 163
461 3300049661 Ga0501217_010161 Ga0501217_010161_985_1503 163
462 3300049664 Ga0501224_001416 Ga0501224_001416_687_1205 163
463 3300049665 Ga0501227_006456 Ga0501227_006456_1019_1537 163
464 3300049668 Ga0501233_002196 Ga0501233_002196_1790_2308 163
465 3300049679 Ga0501249_009938 Ga0501249_009938_378_896 163
466 3300049704 Ga0501221_045565 Ga0501221_045565_37_555 163
467 3300049705 Ga0501225_0002871 Ga0501225_0002871_1099_1617 163
468 3300049707 Ga0501234_000070 Ga0501234_000070_521_1039 163
469 3300049769 Ga0501272_020708 Ga0501272_020708_93_611 163
470 3300049853 Ga0501226_002550 Ga0501226_002550_837_1355 163
471 3300050492 nmdc:mga0yw44_135300_c1 nmdc:mga0yw44_135300_c1_222_719 163
472 3300050511 nmdc:mga08y16_22_c1 nmdc:mga08y16_22_c1_105657_106157 163
473 3300050512 nmdc:mga0n895_1196188_c1 nmdc:mga0n895_1196188_c1_96_614 163
474 3300050512 nmdc:mga0n895_261745_c1 nmdc:mga0n895_261745_c1_565_1065 163
475 3300050515 nmdc:mga0a205_94943_c1 nmdc:mga0a205_94943_c1_1991_2482 163
476 3300053139 Ga0500568_0011991 Ga0500568_0011991_3345_3881 163
477 3300059477 Ga0587084_016336 Ga0587084_016336_515_1033 163
478 3300059490 Ga0587066_013619 Ga0587066_013619_211_729 163
479 3300059491 Ga0587070_007002 Ga0587070_007002_812_1330 163
480 3300059491 Ga0587070_096986 Ga0587070_096986_131_631 163
481 3300059506 Ga0587085_002150 Ga0587085_002150_449_967 163
482 3300059512 Ga0587092_001585 Ga0587092_001585_809_1327 163
483 3300059623 Ga0587101_017008 Ga0587101_017008_369_887 163
484 3300059624 Ga0587109_105073 Ga0587109_105073_119_625 163
485 3300059627 Ga0587117_007307 Ga0587117_007307_93_599 163
486 3300059641 Ga0587068_039119 Ga0587068_039119_276_794 163
487 3300059643 Ga0587072_012699 Ga0587072_012699_818_1318 163
488 3300060344 Ga0587071_048764 Ga0587071_048764_207_725 163
489 3300060346 Ga0587111_0009384 Ga0587111_0009384_812_1330 163
490 3300000531 CNBas_1000168 CNBas_10001683 164
491 3300003791 Ga0055530_10017439 Ga0055530_100174394 164
492 3300005331 Ga0070670_100032782 Ga0070670_1000327825 164
493 3300005331 Ga0070670_101036824 Ga0070670_1010368241 164
494 3300005334 Ga0068869_100385625 Ga0068869_1003856252 164
495 3300005337 Ga0070682_100003873 Ga0070682_1000038735 164
496 3300005340 Ga0070689_100000856 Ga0070689_1000008563 164
497 3300005345 Ga0070692_10005032 Ga0070692_100050324 164
498 3300005365 Ga0070688_100575924 Ga0070688_1005759242 164
499 3300005406 Ga0070703_10008816 Ga0070703_100088161 164
500 3300005434 Ga0070709_10112916 Ga0070709_101129161 164
501 3300005438 Ga0070701_10000892 Ga0070701_100008922 164
502 3300005438 Ga0070701_10306468 Ga0070701_103064682 164
503 3300005438 Ga0070701_10818007 Ga0070701_108180071 164
504 3300005440 Ga0070705_100012212 Ga0070705_1000122124 164
505 3300005441 Ga0070700_100026017 Ga0070700_1000260172 164
506 3300005441 Ga0070700_100535114 Ga0070700_1005351142 164
507 3300005444 Ga0070694_100001863 Ga0070694_10000186310 164
508 3300005471 Ga0070698_100002248 Ga0070698_1000022485 164
509 3300005471 Ga0070698_100861509 Ga0070698_1008615091 164
510 3300005518 Ga0070699_100844890 Ga0070699_1008448901 164
511 3300005544 Ga0070686_100000004 Ga0070686_100000004157 164
512 3300005546 Ga0070696_100033027 Ga0070696_1000330274 164
513 3300005547 Ga0070693_100004428 Ga0070693_1000044285 164
514 3300005549 Ga0070704_100046762 Ga0070704_1000467625 164
515 3300005577 Ga0068857_100602767 Ga0068857_1006027672 164
516 3300005615 Ga0070702_100066019 Ga0070702_1000660194 164
517 3300005616 Ga0068852_100049225 Ga0068852_1000492255 164
518 3300005616 Ga0068852_100698599 Ga0068852_1006985992 164
519 3300005617 Ga0068859_100057777 Ga0068859_1000577773 164
520 3300005617 Ga0068859_100094382 Ga0068859_1000943825 164
521 3300005618 Ga0068864_101171815 Ga0068864_1011718151 164
522 3300005834 Ga0068851_10004808 Ga0068851_100048086 164
523 3300005840 Ga0068870_10021667 Ga0068870_100216676 164
524 3300005841 Ga0068863_100006096 Ga0068863_1000060968 164
525 3300005841 Ga0068863_100096346 Ga0068863_1000963463 164
526 3300005842 Ga0068858_100032748 Ga0068858_1000327485 164
527 3300005843 Ga0068860_101437248 Ga0068860_1014372482 164
528 3300006237 Ga0097621_100160018 Ga0097621_1001600182 164
529 3300006871 Ga0075434_100598563 Ga0075434_1005985632 164
530 3300006931 Ga0097620_100057780 Ga0097620_1000577804 164
531 3300006931 Ga0097620_100094381 Ga0097620_1000943815 164
532 3300009093 Ga0105240_10052562 Ga0105240_100525625 164
533 3300009147 Ga0114129_10827450 Ga0114129_108274502 164
534 3300009148 Ga0105243_11642155 Ga0105243_116421551 164
535 3300009174 Ga0105241_10113753 Ga0105241_101137532 164
536 3300009545 Ga0105237_10005382 Ga0105237_100053827 164
537 3300013104 Ga0157370_10144764 Ga0157370_101447642 164
538 3300013307 Ga0157372_10005077 Ga0157372_100050775 164
539 3300014325 Ga0163163_10786983 Ga0163163_107869832 164
540 3300014745 Ga0157377_10000049 Ga0157377_1000004973 164
541 3300021388 Ga0213875_10109519 Ga0213875_101095192 164
542 3300025263 Ga0209565_1000211 Ga0209565_100021128 164
543 3300025297 Ga0209758_1026295 Ga0209758_10262952 164
544 3300025298 Ga0209050_1000538 Ga0209050_100053849 164
545 3300025298 Ga0209050_1008420 Ga0209050_10084202 164
546 3300025321 Ga0207656_10002644 Ga0207656_100026446 164
547 3300025885 Ga0207653_10009230 Ga0207653_100092305 164
548 3300025908 Ga0207643_10033692 Ga0207643_100336925 164
549 3300025911 Ga0207654_10112047 Ga0207654_101120472 164
550 3300025914 Ga0207671_10004857 Ga0207671_100048579 164
551 3300025918 Ga0207662_10072505 Ga0207662_100725051 164
552 3300025925 Ga0207650_10493203 Ga0207650_104932031 164
553 3300025925 Ga0207650_10832887 Ga0207650_108328871 164
554 3300025925 Ga0207650_11066932 Ga0207650_110669321 164
555 3300025932 Ga0207690_10427288 Ga0207690_104272882 164
556 3300025936 Ga0207670_10000357 Ga0207670_1000035719 164
557 3300025938 Ga0207704_10679015 Ga0207704_106790152 164
558 3300025941 Ga0207711_10783608 Ga0207711_107836081 164
559 3300025960 Ga0207651_11002956 Ga0207651_110029562 164
560 3300026035 Ga0207703_10092434 Ga0207703_100924343 164
561 3300026088 Ga0207641_10040000 Ga0207641_100400006 164
562 3300026088 Ga0207641_10210657 Ga0207641_102106571 164
563 3300026095 Ga0207676_10958630 Ga0207676_109586301 164
564 3300026116 Ga0207674_10044238 Ga0207674_100442382 164
565 3300026116 Ga0207674_10209767 Ga0207674_102097672 164
566 3300026116 Ga0207674_10462552 Ga0207674_104625522 164
567 3300026142 Ga0207698_10184104 Ga0207698_101841042 164
568 3300028556 Ga0265337_1042295 Ga0265337_10422952 164
569 3300028558 Ga0265326_10009337 Ga0265326_100093372 164
570 3300028563 Ga0265319_1004890 Ga0265319_10048902 164
571 3300028573 Ga0265334_10006775 Ga0265334_100067755 164
572 3300028577 Ga0265318_10006831 Ga0265318_100068313 164
573 3300028800 Ga0265338_10020907 Ga0265338_100209076 164
574 3300029957 Ga0265324_10036100 Ga0265324_100361002 164
575 3300031238 Ga0265332_10025668 Ga0265332_100256682 164
576 3300031240 Ga0265320_10016615 Ga0265320_100166152 164
577 3300031241 Ga0265325_10009611 Ga0265325_100096116 164
578 3300031247 Ga0265340_10004710 Ga0265340_100047108 164
579 3300031249 Ga0265339_10067971 Ga0265339_100679713 164
580 3300031344 Ga0265316_10040599 Ga0265316_100405993 164
581 3300031595 Ga0265313_10070499 Ga0265313_100704993 164
582 3300031711 Ga0265314_10021751 Ga0265314_100217516 164
583 3300031712 Ga0265342_10020889 Ga0265342_100208892 164
584 3300031731 Ga0307405_10493685 Ga0307405_104936851 164
585 3300032126 Ga0307415_100241306 Ga0307415_1002413061 164
586 3300037418 Ga0395900_0334906 Ga0395900_0334906_378_881 164
587 3300037471 Ga0395905_0003836 Ga0395905_0003836_4323_4826 164
588 3300037853 Ga0436364_0698855 Ga0436364_0698855_1574_2083 164
589 3300038443 Ga0395901_0377352 Ga0395901_0377352_697_1200 164
590 3300038996 Ga0242420_014836 Ga0242420_014836_403_903 164
591 3300044712 Ga0453684_0920484 Ga0453684_0920484_422_925 164
592 3300044842 Ga0466957_0265945 Ga0466957_0265945_636_1130 164
593 3300046472 Ga0495580_0022765 Ga0495580_0022765_1148_1657 164
594 3300049663 Ga0501223_050023 Ga0501223_050023_133_636 164
595 3300049686 Ga0501257_047174 Ga0501257_047174_366_869 164
596 3300049775 Ga0501279_096903 Ga0501279_096903_13_516 164
597 3300050512 nmdc:mga0n895_27393_c1 nmdc:mga0n895_27393_c1_4707_5207 164
598 3300059477 Ga0587084_011814 Ga0587084_011814_38_562 164
599 3300059477 Ga0587084_027395 Ga0587084_027395_114_614 164
600 3300059493 Ga0587077_015975 Ga0587077_015975_300_794 164
601 3300059493 Ga0587077_060150 Ga0587077_060150_252_776 164
602 3300059507 Ga0587086_004272 Ga0587086_004272_659_1153 164
603 3300059511 Ga0587091_016189 Ga0587091_016189_440_934 164
604 3300059512 Ga0587092_006074 Ga0587092_006074_367_861 164
605 3300059624 Ga0587109_041391 Ga0587109_041391_327_851 164
606 3300059639 Ga0587062_041930 Ga0587062_041930_106_630 164
607 3300059645 Ga0587076_011628 Ga0587076_011628_146_640 164
608 3300059647 Ga0587079_091941 Ga0587079_091941_36_560 164
609 3300060346 Ga0587111_0007287 Ga0587111_0007287_836_1330 164
610 3300060346 Ga0587111_0060396 Ga0587111_0060396_156_680 164
611 3300000041 ARcpr5oldR_c000925 ARcpr5oldR_0009255 165
612 3300000043 ARcpr5yngRDRAFT_c000985 ARcpr5yngRDRAFT_0009855 165
613 3300002077 JGI24744J21845_10049109 JGI24744J21845_100491092 165
614 3300003215 JGI25153J46596_10001499 JGI25153J46596_100014996 165
615 3300003773 Ga0055537_1006944 Ga0055537_10069442 165
616 3300003775 Ga0055524_1001084 Ga0055524_100108421 165
617 3300003781 Ga0055536_1003626 Ga0055536_10036266 165
618 3300003794 Ga0055531_10004463 Ga0055531_100044636 165
619 3300005262 Ga0065165_1000123 Ga0065165_100012314 165
620 3300005262 Ga0065165_1013696 Ga0065165_10136966 165
621 3300005289 Ga0065704_10073218 Ga0065704_100732181 165
622 3300005289 Ga0065704_10171087 Ga0065704_101710872 165
623 3300005334 Ga0068869_100249855 Ga0068869_1002498552 165
624 3300005459 Ga0068867_100496365 Ga0068867_1004963652 165
625 3300005578 Ga0068854_100052893 Ga0068854_1000528932 165
626 3300006880 Ga0075429_100067193 Ga0075429_1000671932 165
627 3300009092 Ga0105250_10035176 Ga0105250_100351762 165
628 3300009553 Ga0105249_11037381 Ga0105249_110373811 165
629 3300013102 Ga0157371_10010081 Ga0157371_100100816 165
630 3300013104 Ga0157370_10012604 Ga0157370_100126043 165
631 3300013105 Ga0157369_10020731 Ga0157369_100207316 165
632 3300014326 Ga0157380_10202352 Ga0157380_102023522 165
633 3300015261 Ga0182006_1037975 Ga0182006_10379752 165
634 3300021358 Ga0213873_10068213 Ga0213873_100682132 165
635 3300021384 Ga0213876_10000188 Ga0213876_1000018846 165
636 3300025208 Ga0209436_112705 Ga0209436_1127051 165
637 3300025245 Ga0207425_1014226 Ga0207425_10142263 165
638 3300025263 Ga0209565_1000011 Ga0209565_1000011237 165
639 3300025273 Ga0209673_1002226 Ga0209673_100222611 165
640 3300025291 Ga0209675_1026657 Ga0209675_10266573 165
641 3300025295 Ga0209564_1027393 Ga0209564_10273933 165
642 3300025297 Ga0209758_1012613 Ga0209758_10126139 165
643 3300025298 Ga0209050_1010125 Ga0209050_10101253 165
644 3300025299 Ga0209256_1000016 Ga0209256_1000016362 165
645 3300025304 Ga0209257_1002046 Ga0209257_100204619 165
646 3300025924 Ga0207694_10000001 Ga0207694_100000012820 165
647 3300025936 Ga0207670_10192568 Ga0207670_101925681 165
648 3300025981 Ga0207640_10040150 Ga0207640_100401504 165
649 3300026089 Ga0207648_10526459 Ga0207648_105264592 165
650 3300031456 Ga0307513_10014167 Ga0307513_100141676 165
651 3300031456 Ga0307513_10445639 Ga0307513_104456392 165
652 3300032004 Ga0307414_10366889 Ga0307414_103668891 165
653 3300033180 Ga0307510_10041591 Ga0307510_100415912 165
654 3300038699 Ga0242422_04911 Ga0242422_04911_296_796 165
655 3300046684 Ga0495669_0031397 Ga0495669_0031397_555_1061 165
656 3300046691 Ga0495670_0005553 Ga0495670_0005553_4568_5077 165
657 3300048927 Ga0496124_0007663 Ga0496124_0007663_5057_5566 165
658 3300048928 Ga0496125_0001113 Ga0496125_0001113_33727_34236 165
659 3300050508 nmdc:mga09592_91186_c1 nmdc:mga09592_91186_c1_1124_1642 165
660 3300053096 Ga0500641_0000580 Ga0500641_0000580_2714_3223 165
661 3300053118 Ga0500594_0033618 Ga0500594_0033618_367_876 165
662 3300005444 Ga0070694_100068348 Ga0070694_1000683481 166
663 3300005467 Ga0070706_100155909 Ga0070706_1001559092 166
664 3300005471 Ga0070698_100013256 Ga0070698_1000132565 166
665 3300005536 Ga0070697_100495478 Ga0070697_1004954782 166
666 3300005547 Ga0070693_100079001 Ga0070693_1000790012 166
667 3300005547 Ga0070693_100294963 Ga0070693_1002949632 166
668 3300005549 Ga0070704_100505038 Ga0070704_1005050382 166
669 3300005563 Ga0068855_100350232 Ga0068855_1003502323 166
670 3300005617 Ga0068859_100000577 Ga0068859_1000005777 166
671 3300005719 Ga0068861_100006823 Ga0068861_1000068234 166
672 3300006358 Ga0068871_100175510 Ga0068871_1001755103 166
673 3300006852 Ga0075433_10187512 Ga0075433_101875121 166
674 3300006871 Ga0075434_100090267 Ga0075434_1000902674 166
675 3300006931 Ga0097620_100000577 Ga0097620_1000005777 166
676 3300009101 Ga0105247_10160309 Ga0105247_101603092 166
677 3300009177 Ga0105248_10248597 Ga0105248_102485973 166
678 3300013306 Ga0163162_10008008 Ga0163162_1000800810 166
679 3300014969 Ga0157376_10754001 Ga0157376_107540011 166
680 3300025923 Ga0207681_10327611 Ga0207681_103276112 166
681 3300025941 Ga0207711_10370524 Ga0207711_103705242 166
682 3300025949 Ga0207667_10314179 Ga0207667_103141793 166
683 3300026118 Ga0207675_100012847 Ga0207675_1000128475 166
684 3300031456 Ga0307513_10674089 Ga0307513_106740892 166
685 3300035119 Ga0373956_0053579 Ga0373956_0053579_21_521 166
686 3300035120 Ga0373957_0049865 Ga0373957_0049865_825_1325 166
687 3300035410 Ga0373924_0251458 Ga0373924_0251458_90_590 166
688 3300042532 Ga0450893_0023295 Ga0450893_0023295_154_696 166
689 3300048915 Ga0496112_0367070 Ga0496112_0367070_742_1275 166
690 3300050507 nmdc:mga05p37_425333_c1 nmdc:mga05p37_425333_c1_830_1363 166
691 3300050512 nmdc:mga0n895_1495086_c1 nmdc:mga0n895_1495086_c1_61_594 166
692 3300050512 nmdc:mga0n895_88456_c1 nmdc:mga0n895_88456_c1_1774_2307 166
693 3300050515 nmdc:mga0a205_80661_c1 nmdc:mga0a205_80661_c1_1195_1728 166
694 3300005434 Ga0070709_10497876 Ga0070709_104978762 167
695 3300005455 Ga0070663_100928215 Ga0070663_1009282151 167
696 3300005457 Ga0070662_100243523 Ga0070662_1002435232 167
697 3300005539 Ga0068853_100980465 Ga0068853_1009804652 167
698 3300006051 Ga0075364_10054039 Ga0075364_100540392 167
699 3300013307 Ga0157372_10609372 Ga0157372_106093723 167
700 3300021388 Ga0213875_10384453 Ga0213875_103844531 167
701 3300025933 Ga0207706_10476503 Ga0207706_104765032 167
702 3300026067 Ga0207678_10808273 Ga0207678_108082731 167
703 3300035112 Ga0373932_0005015 Ga0373932_0005015_2199_2702 167
704 3300037853 Ga0436364_0358665 Ga0436364_0358665_184_690 167
705 3300042438 Ga0439459_0084783 Ga0439459_0084783_70_612 167
706 3300049742 Ga0501080_0634296 Ga0501080_0634296_36_578 167
707 3300050491 nmdc:mga00v17_44324_c1 nmdc:mga00v17_44324_c1_1339_1842 167
708 3300050492 nmdc:mga0yw44_337611_c1 nmdc:mga0yw44_337611_c1_209_712 167
709 3300053158 Ga0500627_0054218 Ga0500627_0054218_817_1356 167
710 3300004800 Ga0058861_11548928 Ga0058861_115489283 168
711 3300004803 Ga0058862_12539277 Ga0058862_125392771 168
712 3300005336 Ga0070680_100000143 Ga0070680_10000014336 168
713 3300005355 Ga0070671_100860962 Ga0070671_1008609622 168
714 3300005364 Ga0070673_100383516 Ga0070673_1003835162 168
715 3300005458 Ga0070681_10000037 Ga0070681_10000037110 168
716 3300005530 Ga0070679_100018982 Ga0070679_1000189824 168
717 3300009148 Ga0105243_10175264 Ga0105243_101752641 168
718 3300009176 Ga0105242_11506489 Ga0105242_115064891 168
719 3300010375 Ga0105239_10079382 Ga0105239_100793824 168
720 3300013105 Ga0157369_10171963 Ga0157369_101719632 168
721 3300013297 Ga0157378_10053829 Ga0157378_100538295 168
722 3300025912 Ga0207707_10000011 Ga0207707_10000011109 168
723 3300025917 Ga0207660_10000289 Ga0207660_1000028925 168
724 3300025921 Ga0207652_10047761 Ga0207652_100477617 168
725 3300025938 Ga0207704_10007492 Ga0207704_100074925 168
726 3300025960 Ga0207651_10002277 Ga0207651_100022779 168
727 3300038705 Ga0237819_06714 Ga0237819_06714_639_1181 168
728 3300046477 Ga0495664_0596919 Ga0495664_0596919_16_552 168
729 3300046516 Ga0495628_0350732 Ga0495628_0350732_308_844 168
730 3300046525 Ga0495663_0276528 Ga0495663_0276528_32_574 168
731 3300046543 Ga0495645_0306741 Ga0495645_0306741_24_560 168
732 3300046678 Ga0495599_0082314 Ga0495599_0082314_1070_1606 168
733 3300053090 Ga0500646_0069647 Ga0500646_0069647_216_758 168
734 3300005548 Ga0070665_100000567 Ga0070665_1000005674 169
735 3300028379 Ga0268266_10001468 Ga0268266_1000146824 169
736 3300031824 Ga0307413_11024330 Ga0307413_110243302 169
737 3300032004 Ga0307414_10232706 Ga0307414_102327062 169
738 3300032005 Ga0307411_11064071 Ga0307411_110640712 169
739 3300032004 Ga0307414_10034118 Ga0307414_100341181 170
740 3300032004 Ga0307414_10121425 Ga0307414_101214252 170
741 3300032004 Ga0307414_10422722 Ga0307414_104227222 170
742 3300032005 Ga0307411_10124797 Ga0307411_101247972 170
743 3300005467 Ga0070706_100008941 Ga0070706_1000089412 174
744 3300025910 Ga0207684_10009442 Ga0207684_100094421 174
745 3300045051 Ga0451576_0645660 Ga0451576_0645660_21_545 174
746 2162886012 MBSR1b_contig_11776189 MBSR1b_0475.00003160 175
747 3300005293 Ga0065715_10135302 Ga0065715_101353022 175
748 3300005334 Ga0068869_100030697 Ga0068869_1000306972 175
749 3300025942 Ga0207689_10011030 Ga0207689_100110304 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

34

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lye-assembly1.cif.gz_A-3 re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues 0.8204 6 59
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.4339 6 167
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.4058 6 167
2xgf-assembly1.cif.gz_C structure of the bacteriophage t4 long tail fibre needle-shaped receptor-binding tip 0.399 8 167
5hx2-assembly1.cif.gz_G in vitro assembled star-shaped hubless t4 baseplate 0.3945 5 167
ID Description Score Start End Superfamily
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.803 6 59 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.7533 10 59 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.7358 10 57 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.5899 6 59 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.5761 10 59 3.90.1340.10
ID Description Score Start End GO Terms
AF-A0A258GTC9-F1-model_v4 Phage tail collar domain-containing protein 0.9471 3 57
AF-A0A537LTI6-F1-model_v4 Phage tail collar domain-containing protein 0.8055 1 72
AF-A0A533TTP2-F1-model_v4 Phage tail protein 0.7885 3 74
AF-A0A7Y9T2D4-F1-model_v4 Microcystin-dependent protein 0.7805 2 175
AF-A0A7Y9T2D4-F1-model_v4 Microcystin-dependent protein 0.772 2 175

Feature Viewer

pLDDT pTM Quality
73.32 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map