F479005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 749 | 411 | 724 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10144764|Ga0157370_101447642 |
| Length | 195 |
| Sequence | LHLIDTADNRQSNVNILHYPSINPFHFMAEPFLSEIRMVSFNFAPKGWALANGQFLPINQNQALFALLGTTYGGNGQTNFALPDFRGRVPVHFGNGYNLGQRGGQEAHTITMSELPQHNHFVAAIDSGPSNSNDPSGAYLANTLPNNFYSTVPGSAGLNPATVSNVGGSQAHNNLQPFMVINFCIALQGIFPSQN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 3 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 4 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 5 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 6 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 7 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 8 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 9 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 10 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 11 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 12 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 13 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 14 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 15 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 16 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 17 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 18 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 19 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 20 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 21 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 22 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 23 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 24 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 25 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 26 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 27 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 28 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 29 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 30 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 31 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 32 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 34 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 35 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 38 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 47 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 92 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 158 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 236 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 273 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 274 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 279 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 280 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 281 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 282 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 283 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 284 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 285 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 286 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 287 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 288 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 289 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 290 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 291 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 292 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 293 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 294 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 295 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 296 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 297 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 329 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 330 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 332 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 333 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 346 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 347 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 348 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 349 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 350 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 351 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 352 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 353 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 354 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 356 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 358 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 361 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 362 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 363 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 364 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 365 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 367 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 368 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 373 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 375 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 388 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 393 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.19 |
| Metatranscriptomes | 7.48 |
| Isolates | 3.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.54 |
| Nodule | 1.87 |
| Rhizoplane | 0.53 |
| Rhizosphere | 85.31 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 3.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11776189 | 2162886012 | Unclassified | 912 |
| 2 | ARcpr5oldR_c000925 | 3300000041 | Bacteria | 3219 |
| 3 | ARcpr5yngRDRAFT_c000985 | 3300000043 | Bacteria | 3277 |
| 4 | CNBas_1000168 | 3300000531 | Bacteria | 2299 |
| 5 | JGI24744J21845_10049109 | 3300002077 | Bacteria | 779 |
| 6 | JGI25162J39368_1014118 | 3300002737 | Bacteria | 862 |
| 7 | JGI25164J39214_1003119 | 3300002772 | Bacteria | 2206 |
| 8 | JGI25152J39213_1000204 | 3300002773 | Bacteria | 39867 |
| 9 | JGI25150J39212_1000391 | 3300002774 | Bacteria | 20878 |
| 10 | JGI25165J46597_1000005 | 3300003214 | Bacteria | 623702 |
| 11 | JGI25153J46596_10001499 | 3300003215 | Bacteria | 13924 |
| 12 | JGI25153J46596_10011374 | 3300003215 | Bacteria | 3937 |
| 13 | rootH1_10182808 | 3300003316 | Bacteria | 1209 |
| 14 | rootH2_10252390 | 3300003320 | Bacteria | 1324 |
| 15 | Ga0055526_1000199 | 3300003771 | Bacteria | 51526 |
| 16 | Ga0055526_1000971 | 3300003771 | Bacteria | 21175 |
| 17 | Ga0055537_1002636 | 3300003773 | Bacteria | 5869 |
| 18 | Ga0055537_1006944 | 3300003773 | Bacteria | 2798 |
| 19 | Ga0055524_1000222 | 3300003775 | Bacteria | 60317 |
| 20 | Ga0055524_1001084 | 3300003775 | Bacteria | 16642 |
| 21 | Ga0055524_1002259 | 3300003775 | Bacteria | 10072 |
| 22 | Ga0055536_1003626 | 3300003781 | Bacteria | 8234 |
| 23 | Ga0055528_1046844 | 3300003790 | Bacteria | 908 |
| 24 | Ga0055530_10000308 | 3300003791 | Bacteria | 44319 |
| 25 | Ga0055530_10017439 | 3300003791 | Bacteria | 2251 |
| 26 | Ga0055531_10004463 | 3300003794 | Bacteria | 8514 |
| 27 | Ga0058861_11548928 | 3300004800 | Bacteria | 1711 |
| 28 | Ga0058862_12539277 | 3300004803 | Bacteria | 1894 |
| 29 | Ga0065165_1000123 | 3300005262 | Bacteria | 130852 |
| 30 | Ga0065165_1013696 | 3300005262 | Bacteria | 3203 |
| 31 | Ga0065165_1027329 | 3300005262 | Bacteria | 1862 |
| 32 | Ga0065704_10073218 | 3300005289 | Bacteria | 7435 |
| 33 | Ga0065704_10112644 | 3300005289 | Unclassified | 1911 |
| 34 | Ga0065704_10171087 | 3300005289 | Bacteria | 1291 |
| 35 | Ga0065704_10227387 | 3300005289 | Bacteria | 1054 |
| 36 | Ga0065715_10135302 | 3300005293 | Bacteria | 1940 |
| 37 | Ga0065715_10140686 | 3300005293 | Bacteria | 1811 |
| 38 | Ga0065715_10157220 | 3300005293 | Bacteria | 1665 |
| 39 | Ga0065715_10174159 | 3300005293 | Unclassified | 1524 |
| 40 | Ga0065707_10083232 | 3300005295 | Bacteria | 9903 |
| 41 | Ga0070658_10004705 | 3300005327 | Bacteria | 11094 |
| 42 | Ga0070658_10190346 | 3300005327 | Bacteria | 1729 |
| 43 | Ga0070683_100243314 | 3300005329 | Bacteria | 1711 |
| 44 | Ga0070670_100005938 | 3300005331 | Bacteria | 10326 |
| 45 | Ga0070670_100032782 | 3300005331 | Bacteria | 4476 |
| 46 | Ga0070670_100033105 | 3300005331 | Bacteria | 4453 |
| 47 | Ga0070670_100155239 | 3300005331 | Bacteria | 1982 |
| 48 | Ga0070670_101036824 | 3300005331 | Bacteria | 747 |
| 49 | Ga0068869_100030697 | 3300005334 | Bacteria | 3776 |
| 50 | Ga0068869_100047863 | 3300005334 | Bacteria | 3089 |
| 51 | Ga0068869_100162062 | 3300005334 | Viruses | 1741 |
| 52 | Ga0068869_100249855 | 3300005334 | Bacteria | 1416 |
| 53 | Ga0068869_100385625 | 3300005334 | Bacteria | 1149 |
| 54 | Ga0068869_100793891 | 3300005334 | Unclassified | 813 |
| 55 | Ga0070680_100000143 | 3300005336 | Bacteria | 43507 |
| 56 | Ga0070680_100000388 | 3300005336 | Bacteria | 29909 |
| 57 | Ga0070682_100000022 | 3300005337 | Bacteria | 209117 |
| 58 | Ga0070682_100000096 | 3300005337 | Bacteria | 79913 |
| 59 | Ga0070682_100000648 | 3300005337 | Bacteria | 21150 |
| 60 | Ga0070682_100003873 | 3300005337 | Bacteria | 8303 |
| 61 | Ga0070682_100110757 | 3300005337 | Bacteria | 1829 |
| 62 | Ga0068868_100000070 | 3300005338 | Bacteria | 59130 |
| 63 | Ga0068868_100001632 | 3300005338 | Bacteria | 15299 |
| 64 | Ga0070660_100001702 | 3300005339 | Bacteria | 15088 |
| 65 | Ga0070660_100002905 | 3300005339 | Bacteria | 11793 |
| 66 | Ga0070689_100000856 | 3300005340 | Bacteria | 18891 |
| 67 | Ga0070689_100026482 | 3300005340 | Bacteria | 4366 |
| 68 | Ga0070689_100029297 | 3300005340 | Bacteria | 4165 |
| 69 | Ga0070689_100350372 | 3300005340 | Bacteria | 1238 |
| 70 | Ga0070689_100382957 | 3300005340 | Bacteria | 1186 |
| 71 | Ga0070691_10295331 | 3300005341 | Bacteria | 883 |
| 72 | Ga0070687_100134125 | 3300005343 | Bacteria | 1433 |
| 73 | Ga0070661_100000114 | 3300005344 | Bacteria | 67216 |
| 74 | Ga0070661_100697784 | 3300005344 | Bacteria | 827 |
| 75 | Ga0070692_10005032 | 3300005345 | Bacteria | 5589 |
| 76 | Ga0070668_100300051 | 3300005347 | Bacteria | 1347 |
| 77 | Ga0070669_100013271 | 3300005353 | Bacteria | 5855 |
| 78 | Ga0070669_100015293 | 3300005353 | Bacteria | 5467 |
| 79 | Ga0070669_100069679 | 3300005353 | Bacteria | 2598 |
| 80 | Ga0070675_100074405 | 3300005354 | Bacteria | 2822 |
| 81 | Ga0070675_100783347 | 3300005354 | Bacteria | 871 |
| 82 | Ga0070671_100039938 | 3300005355 | Bacteria | 3896 |
| 83 | Ga0070671_100860962 | 3300005355 | Bacteria | 791 |
| 84 | Ga0070674_100079681 | 3300005356 | Bacteria | 2337 |
| 85 | Ga0070674_100136369 | 3300005356 | Bacteria | 1836 |
| 86 | Ga0070674_100467638 | 3300005356 | Bacteria | 1044 |
| 87 | Ga0070673_100202681 | 3300005364 | Bacteria | 1709 |
| 88 | Ga0070673_100383516 | 3300005364 | Bacteria | 1253 |
| 89 | Ga0070688_100180342 | 3300005365 | Bacteria | 1464 |
| 90 | Ga0070688_100575924 | 3300005365 | Bacteria | 859 |
| 91 | Ga0070688_101512092 | 3300005365 | Bacteria | 546 |
| 92 | Ga0070659_100000017 | 3300005366 | Bacteria | 163966 |
| 93 | Ga0070703_10008816 | 3300005406 | Bacteria | 2840 |
| 94 | Ga0070709_10112916 | 3300005434 | Bacteria | 1829 |
| 95 | Ga0070709_10497876 | 3300005434 | Bacteria | 925 |
| 96 | Ga0070701_10000892 | 3300005438 | Bacteria | 10755 |
| 97 | Ga0070701_10306468 | 3300005438 | Bacteria | 978 |
| 98 | Ga0070701_10818007 | 3300005438 | Bacteria | 637 |
| 99 | Ga0070711_100484196 | 3300005439 | Bacteria | 1018 |
| 100 | Ga0070705_100012212 | 3300005440 | Unclassified | 4360 |
| 101 | Ga0070705_100146417 | 3300005440 | Bacteria | 1561 |
| 102 | Ga0070705_100989591 | 3300005440 | Bacteria | 682 |
| 103 | Ga0070700_100026017 | 3300005441 | Bacteria | 3451 |
| 104 | Ga0070700_100137513 | 3300005441 | Bacteria | 1656 |
| 105 | Ga0070700_100535114 | 3300005441 | Bacteria | 908 |
| 106 | Ga0070694_100001863 | 3300005444 | Bacteria | 12489 |
| 107 | Ga0070694_100010967 | 3300005444 | Bacteria | 5606 |
| 108 | Ga0070694_100068348 | 3300005444 | Bacteria | 2442 |
| 109 | Ga0070694_100236540 | 3300005444 | Bacteria | 1376 |
| 110 | Ga0070708_100343826 | 3300005445 | Viruses | 1406 |
| 111 | Ga0070663_100928215 | 3300005455 | Bacteria | 753 |
| 112 | Ga0070678_100903786 | 3300005456 | Bacteria | 807 |
| 113 | Ga0070662_100243523 | 3300005457 | Bacteria | 1443 |
| 114 | Ga0070681_10000037 | 3300005458 | Bacteria | 96087 |
| 115 | Ga0070681_10030032 | 3300005458 | Bacteria | 5454 |
| 116 | Ga0068867_100240105 | 3300005459 | Bacteria | 1469 |
| 117 | Ga0068867_100496365 | 3300005459 | Unclassified | 1048 |
| 118 | Ga0070706_100008941 | 3300005467 | Bacteria | 9324 |
| 119 | Ga0070706_100035089 | 3300005467 | Bacteria | 4632 |
| 120 | Ga0070706_100155909 | 3300005467 | Bacteria | 2132 |
| 121 | Ga0070698_100002248 | 3300005471 | Bacteria | 21358 |
| 122 | Ga0070698_100004263 | 3300005471 | Bacteria | 15721 |
| 123 | Ga0070698_100012193 | 3300005471 | Bacteria | 9106 |
| 124 | Ga0070698_100013256 | 3300005471 | Bacteria | 8722 |
| 125 | Ga0070698_100861509 | 3300005471 | Bacteria | 851 |
| 126 | Ga0070699_100095275 | 3300005518 | Bacteria | 2606 |
| 127 | Ga0070699_100844890 | 3300005518 | Bacteria | 838 |
| 128 | Ga0070679_100000002 | 3300005530 | Bacteria | 312066 |
| 129 | Ga0070679_100018982 | 3300005530 | Bacteria | 6678 |
| 130 | Ga0070697_100000652 | 3300005536 | Bacteria | 26194 |
| 131 | Ga0070697_100000995 | 3300005536 | Bacteria | 21418 |
| 132 | Ga0070697_100456309 | 3300005536 | Bacteria | 1114 |
| 133 | Ga0070697_100495478 | 3300005536 | Bacteria | 1068 |
| 134 | Ga0068853_100194179 | 3300005539 | Bacteria | 1845 |
| 135 | Ga0068853_100980465 | 3300005539 | Bacteria | 813 |
| 136 | Ga0070672_100001157 | 3300005543 | Bacteria | 16121 |
| 137 | Ga0070686_100000004 | 3300005544 | Bacteria | 262514 |
| 138 | Ga0070696_100033027 | 3300005546 | Bacteria | 3554 |
| 139 | Ga0070696_100307112 | 3300005546 | Bacteria | 1217 |
| 140 | Ga0070696_100389361 | 3300005546 | Bacteria | 1088 |
| 141 | Ga0070696_100745829 | 3300005546 | Bacteria | 802 |
| 142 | Ga0070693_100004428 | 3300005547 | Bacteria | 6640 |
| 143 | Ga0070693_100008236 | 3300005547 | Bacteria | 5127 |
| 144 | Ga0070693_100079001 | 3300005547 | Bacteria | 1957 |
| 145 | Ga0070693_100294963 | 3300005547 | Bacteria | 1091 |
| 146 | Ga0070665_100000145 | 3300005548 | Bacteria | 131599 |
| 147 | Ga0070665_100000567 | 3300005548 | Bacteria | 51614 |
| 148 | Ga0070704_100046762 | 3300005549 | Bacteria | 3021 |
| 149 | Ga0070704_100085003 | 3300005549 | Viruses | 2341 |
| 150 | Ga0070704_100246798 | 3300005549 | Bacteria | 1464 |
| 151 | Ga0070704_100505038 | 3300005549 | Bacteria | 1050 |
| 152 | Ga0070704_100605475 | 3300005549 | Bacteria | 963 |
| 153 | Ga0068855_100350232 | 3300005563 | Bacteria | 1627 |
| 154 | Ga0068857_100049299 | 3300005577 | Bacteria | 3736 |
| 155 | Ga0068857_100527514 | 3300005577 | Viruses | 1110 |
| 156 | Ga0068857_100602767 | 3300005577 | Bacteria | 1038 |
| 157 | Ga0068854_100052893 | 3300005578 | Bacteria | 2914 |
| 158 | Ga0070702_100066019 | 3300005615 | Bacteria | 2120 |
| 159 | Ga0070702_100311744 | 3300005615 | Bacteria | 1093 |
| 160 | Ga0068852_100049225 | 3300005616 | Unclassified | 3604 |
| 161 | Ga0068852_100698599 | 3300005616 | Bacteria | 1024 |
| 162 | Ga0068859_100000577 | 3300005617 | Bacteria | 36570 |
| 163 | Ga0068859_100002668 | 3300005617 | Bacteria | 18112 |
| 164 | Ga0068859_100057777 | 3300005617 | Bacteria | 3907 |
| 165 | Ga0068859_100094382 | 3300005617 | Bacteria | 3044 |
| 166 | Ga0068859_100099968 | 3300005617 | Bacteria | 2956 |
| 167 | Ga0068859_100163536 | 3300005617 | Bacteria | 2305 |
| 168 | Ga0068859_100212513 | 3300005617 | Bacteria | 2021 |
| 169 | Ga0068859_100380275 | 3300005617 | Viruses | 1507 |
| 170 | Ga0068859_102219164 | 3300005617 | Bacteria | 606 |
| 171 | Ga0068864_100000032 | 3300005618 | Bacteria | 212983 |
| 172 | Ga0068864_100002419 | 3300005618 | Bacteria | 15420 |
| 173 | Ga0068864_100297772 | 3300005618 | Bacteria | 1509 |
| 174 | Ga0068864_101171815 | 3300005618 | Unclassified | 766 |
| 175 | Ga0068861_100006823 | 3300005719 | Bacteria | 7795 |
| 176 | Ga0068861_100027087 | 3300005719 | Bacteria | 4172 |
| 177 | Ga0068861_100744478 | 3300005719 | Bacteria | 915 |
| 178 | Ga0068861_101807576 | 3300005719 | Bacteria | 606 |
| 179 | Ga0068851_10004808 | 3300005834 | Bacteria | 6113 |
| 180 | Ga0068870_10001285 | 3300005840 | Bacteria | 10097 |
| 181 | Ga0068870_10021667 | 3300005840 | Unclassified | 3148 |
| 182 | Ga0068863_100006096 | 3300005841 | Bacteria | 11824 |
| 183 | Ga0068863_100050442 | 3300005841 | Bacteria | 3944 |
| 184 | Ga0068863_100096346 | 3300005841 | Bacteria | 2809 |
| 185 | Ga0068858_100007130 | 3300005842 | Bacteria | 10857 |
| 186 | Ga0068858_100032748 | 3300005842 | Bacteria | 4827 |
| 187 | Ga0068858_100053652 | 3300005842 | Unclassified | 3729 |
| 188 | Ga0068858_100486069 | 3300005842 | Bacteria | 1192 |
| 189 | Ga0068860_101437248 | 3300005843 | Bacteria | 711 |
| 190 | Ga0068862_100018222 | 3300005844 | Bacteria | 5845 |
| 191 | Ga0075365_10029151 | 3300006038 | Bacteria | 3525 |
| 192 | Ga0075364_10054039 | 3300006051 | Bacteria | 2626 |
| 193 | Ga0097621_100160018 | 3300006237 | Bacteria | 1935 |
| 194 | Ga0068871_100166569 | 3300006358 | Bacteria | 1887 |
| 195 | Ga0068871_100175510 | 3300006358 | Bacteria | 1839 |
| 196 | Ga0068871_101229467 | 3300006358 | Bacteria | 703 |
| 197 | Ga0075428_100007935 | 3300006844 | Bacteria | 11772 |
| 198 | Ga0075428_100039304 | 3300006844 | Bacteria | 5206 |
| 199 | Ga0075428_100307359 | 3300006844 | Viruses | 1704 |
| 200 | Ga0075430_100148054 | 3300006846 | Viruses | 1955 |
| 201 | Ga0075431_100096488 | 3300006847 | Bacteria | 3052 |
| 202 | Ga0075433_10006999 | 3300006852 | Bacteria | 8941 |
| 203 | Ga0075433_10148911 | 3300006852 | Bacteria | 2082 |
| 204 | Ga0075433_10187512 | 3300006852 | Viruses | 1840 |
| 205 | Ga0075434_100051241 | 3300006871 | Bacteria | 4102 |
| 206 | Ga0075434_100090267 | 3300006871 | Bacteria | 3066 |
| 207 | Ga0075434_100510860 | 3300006871 | Bacteria | 1222 |
| 208 | Ga0075434_100598563 | 3300006871 | Viruses | 1122 |
| 209 | Ga0075434_101400695 | 3300006871 | Unclassified | 709 |
| 210 | Ga0075429_100058501 | 3300006880 | Bacteria | 3357 |
| 211 | Ga0075429_100067193 | 3300006880 | Bacteria | 3120 |
| 212 | Ga0075429_100192137 | 3300006880 | Unclassified | 1788 |
| 213 | Ga0068865_100302738 | 3300006881 | Bacteria | 1280 |
| 214 | Ga0097620_100000577 | 3300006931 | Bacteria | 36570 |
| 215 | Ga0097620_100002668 | 3300006931 | Bacteria | 18112 |
| 216 | Ga0097620_100057780 | 3300006931 | Bacteria | 3907 |
| 217 | Ga0097620_100094381 | 3300006931 | Bacteria | 3044 |
| 218 | Ga0097620_100099964 | 3300006931 | Bacteria | 2956 |
| 219 | Ga0097620_100163530 | 3300006931 | Bacteria | 2305 |
| 220 | Ga0097620_100212504 | 3300006931 | Bacteria | 2021 |
| 221 | Ga0097620_100380248 | 3300006931 | Viruses | 1507 |
| 222 | Ga0097620_102218816 | 3300006931 | Bacteria | 606 |
| 223 | Ga0075435_100347412 | 3300007076 | Bacteria | 1271 |
| 224 | Ga0105250_10035176 | 3300009092 | Bacteria | 2009 |
| 225 | Ga0105250_10250702 | 3300009092 | Bacteria | 756 |
| 226 | Ga0105240_10052562 | 3300009093 | Bacteria | 5120 |
| 227 | Ga0105240_11092376 | 3300009093 | Bacteria | 849 |
| 228 | Ga0111539_10000026 | 3300009094 | Bacteria | 185695 |
| 229 | Ga0111539_10093138 | 3300009094 | Bacteria | 3540 |
| 230 | Ga0111539_10438326 | 3300009094 | Bacteria | 1521 |
| 231 | Ga0111539_10859209 | 3300009094 | Bacteria | 1055 |
| 232 | Ga0111539_11320662 | 3300009094 | Bacteria | 837 |
| 233 | Ga0105245_10003884 | 3300009098 | Bacteria | 13295 |
| 234 | Ga0105245_10011605 | 3300009098 | Bacteria | 7674 |
| 235 | Ga0105245_10449286 | 3300009098 | Bacteria | 1297 |
| 236 | Ga0105247_10160309 | 3300009101 | Bacteria | 1489 |
| 237 | Ga0114129_10075732 | 3300009147 | Bacteria | 4685 |
| 238 | Ga0114129_10312807 | 3300009147 | Bacteria | 2090 |
| 239 | Ga0114129_10827450 | 3300009147 | Bacteria | 1179 |
| 240 | Ga0105243_10008963 | 3300009148 | Bacteria | 7647 |
| 241 | Ga0105243_10081343 | 3300009148 | Bacteria | 2644 |
| 242 | Ga0105243_10175264 | 3300009148 | Bacteria | 1861 |
| 243 | Ga0105243_11642155 | 3300009148 | Bacteria | 670 |
| 244 | Ga0105241_10005988 | 3300009174 | Bacteria | 8973 |
| 245 | Ga0105241_10113753 | 3300009174 | Unclassified | 2170 |
| 246 | Ga0105242_10000271 | 3300009176 | Bacteria | 41189 |
| 247 | Ga0105242_10005282 | 3300009176 | Bacteria | 9971 |
| 248 | Ga0105242_10009637 | 3300009176 | Bacteria | 7401 |
| 249 | Ga0105242_11506489 | 3300009176 | Bacteria | 703 |
| 250 | Ga0105248_10058455 | 3300009177 | Bacteria | 4331 |
| 251 | Ga0105248_10248597 | 3300009177 | Bacteria | 2002 |
| 252 | Ga0105237_10005382 | 3300009545 | Bacteria | 14468 |
| 253 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 254 | Ga0105238_10000032 | 3300009551 | Bacteria | 178226 |
| 255 | Ga0105249_10241363 | 3300009553 | Bacteria | 1787 |
| 256 | Ga0105249_10619559 | 3300009553 | Bacteria | 1138 |
| 257 | Ga0105249_10634329 | 3300009553 | Bacteria | 1125 |
| 258 | Ga0105249_11037381 | 3300009553 | Bacteria | 889 |
| 259 | Ga0105239_10079382 | 3300010375 | Bacteria | 3611 |
| 260 | Ga0105239_10591396 | 3300010375 | Bacteria | 1265 |
| 261 | Ga0105246_10302787 | 3300011119 | Viruses | 1291 |
| 262 | Ga0157371_10010081 | 3300013102 | Bacteria | 7386 |
| 263 | Ga0157371_10014418 | 3300013102 | Bacteria | 5964 |
| 264 | Ga0157371_10016302 | 3300013102 | Bacteria | 5550 |
| 265 | Ga0157371_10729066 | 3300013102 | Bacteria | 743 |
| 266 | Ga0157371_10739062 | 3300013102 | Bacteria | 738 |
| 267 | Ga0157370_10012604 | 3300013104 | Bacteria | 8762 |
| 268 | Ga0157370_10144764 | 3300013104 | Bacteria | 2213 |
| 269 | Ga0157370_10373886 | 3300013104 | Bacteria | 1313 |
| 270 | Ga0157369_10020731 | 3300013105 | Bacteria | 7348 |
| 271 | Ga0157369_10156080 | 3300013105 | Bacteria | 2410 |
| 272 | Ga0157369_10171963 | 3300013105 | Bacteria | 2282 |
| 273 | Ga0157374_10000037 | 3300013296 | Bacteria | 170359 |
| 274 | Ga0157374_10137320 | 3300013296 | Bacteria | 2371 |
| 275 | Ga0157378_10052127 | 3300013297 | Bacteria | 3640 |
| 276 | Ga0157378_10053829 | 3300013297 | Bacteria | 3583 |
| 277 | Ga0157378_10067421 | 3300013297 | Unclassified | 3207 |
| 278 | Ga0157378_11337627 | 3300013297 | Bacteria | 758 |
| 279 | Ga0163162_10008008 | 3300013306 | Bacteria | 10308 |
| 280 | Ga0163162_10013880 | 3300013306 | Bacteria | 7870 |
| 281 | Ga0163162_10027811 | 3300013306 | Bacteria | 5594 |
| 282 | Ga0163162_10321978 | 3300013306 | Bacteria | 1678 |
| 283 | Ga0157372_10005077 | 3300013307 | Bacteria | 13994 |
| 284 | Ga0157372_10075983 | 3300013307 | Bacteria | 3792 |
| 285 | Ga0157372_10108478 | 3300013307 | Bacteria | 3177 |
| 286 | Ga0157372_10609372 | 3300013307 | Unclassified | 1272 |
| 287 | Ga0157375_10000001 | 3300013308 | Bacteria | 696576 |
| 288 | Ga0157375_10106594 | 3300013308 | Bacteria | 2894 |
| 289 | Ga0157375_11947460 | 3300013308 | Bacteria | 698 |
| 290 | Ga0163163_10121899 | 3300014325 | Viruses | 2642 |
| 291 | Ga0163163_10391176 | 3300014325 | Bacteria | 1448 |
| 292 | Ga0163163_10786983 | 3300014325 | Bacteria | 1014 |
| 293 | Ga0157380_10014240 | 3300014326 | Bacteria | 5817 |
| 294 | Ga0157380_10173413 | 3300014326 | Unclassified | 1887 |
| 295 | Ga0157380_10202352 | 3300014326 | Bacteria | 1763 |
| 296 | Ga0157380_10367547 | 3300014326 | Bacteria | 1352 |
| 297 | Ga0182008_10077830 | 3300014497 | Bacteria | 1632 |
| 298 | Ga0157377_10000008 | 3300014745 | Bacteria | 394748 |
| 299 | Ga0157377_10000049 | 3300014745 | Bacteria | 93091 |
| 300 | Ga0157377_10020590 | 3300014745 | Unclassified | 3458 |
| 301 | Ga0157376_10754001 | 3300014969 | Bacteria | 983 |
| 302 | Ga0182006_1037975 | 3300015261 | Bacteria | 1906 |
| 303 | Ga0163161_11098160 | 3300017792 | Bacteria | 684 |
| 304 | Ga0213873_10068213 | 3300021358 | Bacteria | 975 |
| 305 | Ga0213876_10000188 | 3300021384 | Bacteria | 64172 |
| 306 | Ga0213876_10043658 | 3300021384 | Bacteria | 2369 |
| 307 | Ga0213875_10109519 | 3300021388 | Bacteria | 1289 |
| 308 | Ga0213875_10384453 | 3300021388 | Bacteria | 668 |
| 309 | Ga0209436_112705 | 3300025208 | Bacteria | 1417 |
| 310 | Ga0207427_100028 | 3300025231 | Bacteria | 388949 |
| 311 | Ga0209437_100211 | 3300025233 | Bacteria | 108544 |
| 312 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 313 | Ga0207425_1014226 | 3300025245 | Bacteria | 1812 |
| 314 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 315 | Ga0209129_1015382 | 3300025258 | Bacteria | 1578 |
| 316 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 317 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 318 | Ga0209565_1000211 | 3300025263 | Bacteria | 67436 |
| 319 | Ga0209565_1001872 | 3300025263 | Bacteria | 8375 |
| 320 | Ga0209565_1003580 | 3300025263 | Bacteria | 4973 |
| 321 | Ga0209565_1012230 | 3300025263 | Bacteria | 2057 |
| 322 | Ga0209673_1002226 | 3300025273 | Bacteria | 14092 |
| 323 | Ga0209675_1000223 | 3300025291 | Bacteria | 58166 |
| 324 | Ga0209675_1026657 | 3300025291 | Bacteria | 1434 |
| 325 | Ga0209676_1000555 | 3300025292 | Bacteria | 56867 |
| 326 | Ga0209564_1000095 | 3300025295 | Bacteria | 237896 |
| 327 | Ga0209564_1001520 | 3300025295 | Bacteria | 23095 |
| 328 | Ga0209564_1027393 | 3300025295 | Bacteria | 1852 |
| 329 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 330 | Ga0209758_1012613 | 3300025297 | Bacteria | 4708 |
| 331 | Ga0209758_1026295 | 3300025297 | Bacteria | 2524 |
| 332 | Ga0209050_1000138 | 3300025298 | Bacteria | 173923 |
| 333 | Ga0209050_1000538 | 3300025298 | Bacteria | 62826 |
| 334 | Ga0209050_1008420 | 3300025298 | Bacteria | 5519 |
| 335 | Ga0209050_1010125 | 3300025298 | Bacteria | 4692 |
| 336 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 337 | Ga0209256_1000402 | 3300025299 | Bacteria | 68470 |
| 338 | Ga0209256_1000438 | 3300025299 | Bacteria | 64209 |
| 339 | Ga0209257_1002046 | 3300025304 | Bacteria | 21436 |
| 340 | Ga0207656_10002644 | 3300025321 | Bacteria | 6066 |
| 341 | Ga0207653_10009230 | 3300025885 | Bacteria | 3072 |
| 342 | Ga0207643_10008324 | 3300025908 | Bacteria | 5565 |
| 343 | Ga0207643_10020727 | 3300025908 | Bacteria | 3609 |
| 344 | Ga0207643_10033692 | 3300025908 | Unclassified | 2866 |
| 345 | Ga0207705_10009322 | 3300025909 | Bacteria | 7138 |
| 346 | Ga0207705_10107749 | 3300025909 | Bacteria | 2056 |
| 347 | Ga0207684_10009442 | 3300025910 | Bacteria | 8614 |
| 348 | Ga0207684_10039428 | 3300025910 | Bacteria | 4007 |
| 349 | Ga0207684_10348975 | 3300025910 | Bacteria | 1274 |
| 350 | Ga0207654_10104104 | 3300025911 | Bacteria | 1754 |
| 351 | Ga0207654_10112047 | 3300025911 | Unclassified | 1699 |
| 352 | Ga0207707_10000011 | 3300025912 | Bacteria | 282857 |
| 353 | Ga0207671_10004857 | 3300025914 | Bacteria | 12651 |
| 354 | Ga0207663_10273715 | 3300025916 | Bacteria | 1251 |
| 355 | Ga0207660_10000289 | 3300025917 | Bacteria | 33248 |
| 356 | Ga0207660_10000892 | 3300025917 | Bacteria | 19647 |
| 357 | Ga0207662_10063431 | 3300025918 | Bacteria | 2222 |
| 358 | Ga0207662_10072505 | 3300025918 | Bacteria | 2087 |
| 359 | Ga0207662_10101789 | 3300025918 | Bacteria | 1781 |
| 360 | Ga0207657_10004411 | 3300025919 | Bacteria | 14887 |
| 361 | Ga0207657_10016857 | 3300025919 | Bacteria | 7031 |
| 362 | Ga0207649_10000011 | 3300025920 | Bacteria | 266219 |
| 363 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 364 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 365 | Ga0207652_10047761 | 3300025921 | Bacteria | 3657 |
| 366 | Ga0207681_10004339 | 3300025923 | Bacteria | 8754 |
| 367 | Ga0207681_10025850 | 3300025923 | Unclassified | 3781 |
| 368 | Ga0207681_10100805 | 3300025923 | Bacteria | 2082 |
| 369 | Ga0207681_10327611 | 3300025923 | Bacteria | 1220 |
| 370 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 371 | Ga0207694_10000041 | 3300025924 | Bacteria | 183415 |
| 372 | Ga0207650_10029226 | 3300025925 | Unclassified | 3961 |
| 373 | Ga0207650_10493203 | 3300025925 | Bacteria | 1023 |
| 374 | Ga0207650_10556141 | 3300025925 | Bacteria | 962 |
| 375 | Ga0207650_10619383 | 3300025925 | Bacteria | 911 |
| 376 | Ga0207650_10832887 | 3300025925 | Bacteria | 782 |
| 377 | Ga0207650_11066932 | 3300025925 | Bacteria | 687 |
| 378 | Ga0207659_10438798 | 3300025926 | Bacteria | 1098 |
| 379 | Ga0207687_10000765 | 3300025927 | Bacteria | 21679 |
| 380 | Ga0207687_10049999 | 3300025927 | Bacteria | 2909 |
| 381 | Ga0207687_10520265 | 3300025927 | Bacteria | 995 |
| 382 | Ga0207644_10835172 | 3300025931 | Bacteria | 771 |
| 383 | Ga0207690_10001390 | 3300025932 | Bacteria | 15206 |
| 384 | Ga0207690_10427288 | 3300025932 | Bacteria | 1061 |
| 385 | Ga0207706_10476503 | 3300025933 | Bacteria | 1078 |
| 386 | Ga0207686_10000285 | 3300025934 | Bacteria | 37479 |
| 387 | Ga0207686_10011983 | 3300025934 | Bacteria | 4759 |
| 388 | Ga0207686_10047887 | 3300025934 | Bacteria | 2645 |
| 389 | Ga0207709_10019847 | 3300025935 | Unclassified | 3784 |
| 390 | Ga0207670_10000357 | 3300025936 | Bacteria | 26785 |
| 391 | Ga0207670_10001484 | 3300025936 | Bacteria | 12322 |
| 392 | Ga0207670_10017283 | 3300025936 | Bacteria | 4359 |
| 393 | Ga0207670_10091604 | 3300025936 | Viruses | 2150 |
| 394 | Ga0207670_10192568 | 3300025936 | Bacteria | 1544 |
| 395 | Ga0207669_10259479 | 3300025937 | Bacteria | 1299 |
| 396 | Ga0207669_10370794 | 3300025937 | Bacteria | 1112 |
| 397 | Ga0207704_10007492 | 3300025938 | Bacteria | 5160 |
| 398 | Ga0207704_10267228 | 3300025938 | Bacteria | 1293 |
| 399 | Ga0207704_10679015 | 3300025938 | Bacteria | 851 |
| 400 | Ga0207691_10002812 | 3300025940 | Bacteria | 16965 |
| 401 | Ga0207691_10998772 | 3300025940 | Unclassified | 698 |
| 402 | Ga0207711_10370524 | 3300025941 | Bacteria | 1328 |
| 403 | Ga0207711_10434225 | 3300025941 | Bacteria | 1222 |
| 404 | Ga0207711_10783608 | 3300025941 | Bacteria | 888 |
| 405 | Ga0207689_10011030 | 3300025942 | Bacteria | 7767 |
| 406 | Ga0207689_10445389 | 3300025942 | Unclassified | 1082 |
| 407 | Ga0207689_10759026 | 3300025942 | Unclassified | 819 |
| 408 | Ga0207661_10214016 | 3300025944 | Bacteria | 1700 |
| 409 | Ga0207661_10227440 | 3300025944 | Bacteria | 1651 |
| 410 | Ga0207667_10314179 | 3300025949 | Bacteria | 1600 |
| 411 | Ga0207651_10002277 | 3300025960 | Bacteria | 9125 |
| 412 | Ga0207651_10518637 | 3300025960 | Bacteria | 1032 |
| 413 | Ga0207651_11002956 | 3300025960 | Bacteria | 746 |
| 414 | Ga0207712_10178561 | 3300025961 | Bacteria | 1665 |
| 415 | Ga0207640_10040150 | 3300025981 | Bacteria | 2966 |
| 416 | Ga0207640_10291547 | 3300025981 | Bacteria | 1287 |
| 417 | Ga0207677_10000070 | 3300026023 | Bacteria | 84502 |
| 418 | Ga0207677_10000071 | 3300026023 | Bacteria | 84386 |
| 419 | Ga0207677_10093911 | 3300026023 | Unclassified | 2188 |
| 420 | Ga0207703_10000022 | 3300026035 | Bacteria | 245723 |
| 421 | Ga0207703_10089622 | 3300026035 | Bacteria | 2583 |
| 422 | Ga0207703_10092434 | 3300026035 | Bacteria | 2546 |
| 423 | Ga0207703_10383991 | 3300026035 | Bacteria | 1300 |
| 424 | Ga0207639_10365682 | 3300026041 | Bacteria | 1292 |
| 425 | Ga0207678_10808273 | 3300026067 | Bacteria | 828 |
| 426 | Ga0207708_10102321 | 3300026075 | Viruses | 2218 |
| 427 | Ga0207708_10183271 | 3300026075 | Bacteria | 1663 |
| 428 | Ga0207641_10019185 | 3300026088 | Bacteria | 5610 |
| 429 | Ga0207641_10040000 | 3300026088 | Bacteria | 3922 |
| 430 | Ga0207641_10210657 | 3300026088 | Bacteria | 1797 |
| 431 | Ga0207648_10101772 | 3300026089 | Bacteria | 2517 |
| 432 | Ga0207648_10526459 | 3300026089 | Unclassified | 1084 |
| 433 | Ga0207676_10000033 | 3300026095 | Bacteria | 215361 |
| 434 | Ga0207676_10000852 | 3300026095 | Bacteria | 23666 |
| 435 | Ga0207676_10958630 | 3300026095 | Unclassified | 841 |
| 436 | Ga0207674_10044238 | 3300026116 | Bacteria | 4586 |
| 437 | Ga0207674_10054611 | 3300026116 | Viruses | 4066 |
| 438 | Ga0207674_10209767 | 3300026116 | Bacteria | 1897 |
| 439 | Ga0207674_10462552 | 3300026116 | Bacteria | 1226 |
| 440 | Ga0207675_100012195 | 3300026118 | Bacteria | 8028 |
| 441 | Ga0207675_100012847 | 3300026118 | Bacteria | 7820 |
| 442 | Ga0207675_101810222 | 3300026118 | Bacteria | 630 |
| 443 | Ga0207698_10184104 | 3300026142 | Bacteria | 1853 |
| 444 | Ga0207428_10000031 | 3300027907 | Bacteria | 235245 |
| 445 | Ga0207428_10002898 | 3300027907 | Bacteria | 17004 |
| 446 | Ga0268266_10000173 | 3300028379 | Bacteria | 117695 |
| 447 | Ga0268266_10001468 | 3300028379 | Bacteria | 28028 |
| 448 | Ga0268265_10016718 | 3300028380 | Bacteria | 5047 |
| 449 | Ga0268265_10073456 | 3300028380 | Unclassified | 2671 |
| 450 | Ga0268264_10024494 | 3300028381 | Bacteria | 4928 |
| 451 | Ga0265337_1042295 | 3300028556 | Bacteria | 1307 |
| 452 | Ga0265326_10000279 | 3300028558 | Bacteria | 23587 |
| 453 | Ga0265326_10009337 | 3300028558 | Bacteria | 2932 |
| 454 | Ga0265319_1004890 | 3300028563 | Bacteria | 6551 |
| 455 | Ga0265319_1051950 | 3300028563 | Bacteria | 1350 |
| 456 | Ga0265334_10006775 | 3300028573 | Bacteria | 4920 |
| 457 | Ga0265318_10006831 | 3300028577 | Bacteria | 5216 |
| 458 | Ga0265318_10036805 | 3300028577 | Bacteria | 1876 |
| 459 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 460 | Ga0265336_10029974 | 3300028666 | Bacteria | 1695 |
| 461 | Ga0307515_10131661 | 3300028794 | Bacteria | 2749 |
| 462 | Ga0265338_10020907 | 3300028800 | Bacteria | 6852 |
| 463 | Ga0265324_10000375 | 3300029957 | Bacteria | 32371 |
| 464 | Ga0265324_10036100 | 3300029957 | Bacteria | 1719 |
| 465 | Ga0265332_10025668 | 3300031238 | Bacteria | 2586 |
| 466 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 467 | Ga0265320_10016615 | 3300031240 | Bacteria | 4118 |
| 468 | Ga0265325_10009611 | 3300031241 | Bacteria | 5645 |
| 469 | Ga0265329_10023546 | 3300031242 | Bacteria | 2050 |
| 470 | Ga0265340_10004710 | 3300031247 | Bacteria | 7588 |
| 471 | Ga0265339_10067971 | 3300031249 | Bacteria | 1905 |
| 472 | Ga0265331_10007540 | 3300031250 | Bacteria | 6286 |
| 473 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 474 | Ga0265316_10040599 | 3300031344 | Bacteria | 3729 |
| 475 | Ga0307513_10014167 | 3300031456 | Bacteria | 9755 |
| 476 | Ga0307513_10445639 | 3300031456 | Bacteria | 1020 |
| 477 | Ga0307513_10674089 | 3300031456 | Bacteria | 740 |
| 478 | Ga0307408_100000022 | 3300031548 | Bacteria | 310242 |
| 479 | Ga0307408_100010949 | 3300031548 | Bacteria | 5985 |
| 480 | Ga0307408_100190138 | 3300031548 | Bacteria | 1653 |
| 481 | Ga0265313_10070499 | 3300031595 | Bacteria | 1610 |
| 482 | Ga0265314_10000585 | 3300031711 | Bacteria | 45849 |
| 483 | Ga0265314_10021751 | 3300031711 | Bacteria | 4924 |
| 484 | Ga0265342_10020889 | 3300031712 | Bacteria | 4189 |
| 485 | Ga0307405_10019269 | 3300031731 | Bacteria | 3785 |
| 486 | Ga0307405_10137293 | 3300031731 | Bacteria | 1699 |
| 487 | Ga0307405_10493685 | 3300031731 | Bacteria | 980 |
| 488 | Ga0307413_11024330 | 3300031824 | Unclassified | 709 |
| 489 | Ga0307410_10293997 | 3300031852 | Bacteria | 1279 |
| 490 | Ga0307410_10430761 | 3300031852 | Bacteria | 1072 |
| 491 | Ga0307406_10038862 | 3300031901 | Bacteria | 2948 |
| 492 | Ga0307406_10501915 | 3300031901 | Bacteria | 984 |
| 493 | Ga0307412_10016574 | 3300031911 | Bacteria | 4393 |
| 494 | Ga0307412_10051223 | 3300031911 | Bacteria | 2727 |
| 495 | Ga0307409_100213363 | 3300031995 | Bacteria | 1737 |
| 496 | Ga0307409_100325703 | 3300031995 | Bacteria | 1440 |
| 497 | Ga0307409_100436094 | 3300031995 | Bacteria | 1261 |
| 498 | Ga0307416_100102933 | 3300032002 | Bacteria | 2491 |
| 499 | Ga0307416_100218787 | 3300032002 | Bacteria | 1824 |
| 500 | Ga0307414_10016097 | 3300032004 | Bacteria | 4535 |
| 501 | Ga0307414_10034118 | 3300032004 | Unclassified | 3370 |
| 502 | Ga0307414_10121425 | 3300032004 | Bacteria | 2009 |
| 503 | Ga0307414_10232706 | 3300032004 | Bacteria | 1520 |
| 504 | Ga0307414_10366889 | 3300032004 | Bacteria | 1241 |
| 505 | Ga0307414_10422722 | 3300032004 | Viruses | 1162 |
| 506 | Ga0307414_10458126 | 3300032004 | Bacteria | 1120 |
| 507 | Ga0307414_10511725 | 3300032004 | Bacteria | 1064 |
| 508 | Ga0307411_10019979 | 3300032005 | Bacteria | 3884 |
| 509 | Ga0307411_10044726 | 3300032005 | Bacteria | 2843 |
| 510 | Ga0307411_10124797 | 3300032005 | Viruses | 1870 |
| 511 | Ga0307411_11064071 | 3300032005 | Bacteria | 727 |
| 512 | Ga0307415_100028042 | 3300032126 | Bacteria | 3576 |
| 513 | Ga0307415_100029978 | 3300032126 | Bacteria | 3484 |
| 514 | Ga0307415_100241306 | 3300032126 | Bacteria | 1462 |
| 515 | Ga0307415_101937038 | 3300032126 | Bacteria | 573 |
| 516 | Ga0307510_10041591 | 3300033180 | Bacteria | 5021 |
| 517 | Ga0373932_0005015 | 3300035112 | Bacteria | 3117 |
| 518 | Ga0373941_0011088 | 3300035115 | Bacteria | 2322 |
| 519 | Ga0373945_0327152 | 3300035116 | Bacteria | 661 |
| 520 | Ga0373956_0053579 | 3300035119 | Bacteria | 1816 |
| 521 | Ga0373957_0049865 | 3300035120 | Bacteria | 1599 |
| 522 | Ga0373924_0251458 | 3300035410 | Bacteria | 782 |
| 523 | Ga0373927_0293533 | 3300035695 | Bacteria | 1070 |
| 524 | Ga0373947_0604516 | 3300035725 | Bacteria | 747 |
| 525 | Ga0373925_0338071 | 3300037068 | Bacteria | 1221 |
| 526 | Ga0395900_0334906 | 3300037418 | Bacteria | 1490 |
| 527 | Ga0395900_0921551 | 3300037418 | Bacteria | 796 |
| 528 | Ga0395898_0036797 | 3300037466 | Bacteria | 4858 |
| 529 | Ga0395905_0003836 | 3300037471 | Bacteria | 15876 |
| 530 | Ga0395905_0058674 | 3300037471 | Bacteria | 3598 |
| 531 | Ga0436364_0358665 | 3300037853 | Bacteria | 767 |
| 532 | Ga0436364_0698855 | 3300037853 | Bacteria | 4563 |
| 533 | Ga0395901_0005616 | 3300038443 | Bacteria | 12695 |
| 534 | Ga0395901_0061189 | 3300038443 | Bacteria | 3918 |
| 535 | Ga0395901_0377352 | 3300038443 | Bacteria | 1460 |
| 536 | Ga0242422_04911 | 3300038699 | Viruses | 825 |
| 537 | Ga0237819_06714 | 3300038705 | Bacteria | 1706 |
| 538 | Ga0242420_014836 | 3300038996 | Bacteria | 1341 |
| 539 | Ga0436365_0182192 | 3300039437 | Bacteria | 2816 |
| 540 | Ga0436365_0311259 | 3300039437 | Bacteria | 72483 |
| 541 | Ga0436365_0478136 | 3300039437 | Bacteria | 2355 |
| 542 | Ga0436363_1606136 | 3300039450 | Bacteria | 615 |
| 543 | Ga0436362_0092156 | 3300039453 | Bacteria | 843 |
| 544 | Ga0436362_0597322 | 3300039453 | Bacteria | 18881 |
| 545 | Ga0439439_0024833 | 3300041406 | Bacteria | 1506 |
| 546 | Ga0439431_0005150 | 3300041997 | Bacteria | 2883 |
| 547 | Ga0439433_0050071 | 3300041999 | Unclassified | 984 |
| 548 | Ga0439442_059847 | 3300042002 | Unclassified | 807 |
| 549 | Ga0439454_090414 | 3300042011 | Bacteria | 565 |
| 550 | Ga0439455_0000820 | 3300042012 | Bacteria | 4736 |
| 551 | Ga0439457_100484 | 3300042014 | Unclassified | 674 |
| 552 | Ga0450922_010055 | 3300042124 | Unclassified | 904 |
| 553 | Ga0450922_026585 | 3300042124 | Bacteria | 617 |
| 554 | Ga0450890_019455 | 3300042127 | Bacteria | 915 |
| 555 | Ga0450894_006897 | 3300042131 | Unclassified | 1463 |
| 556 | Ga0450896_005192 | 3300042133 | Bacteria | 1775 |
| 557 | Ga0450898_001804 | 3300042134 | Unclassified | 2885 |
| 558 | Ga0450889_007697 | 3300042144 | Bacteria | 1089 |
| 559 | Ga0439458_0003285 | 3300042157 | Bacteria | 3814 |
| 560 | Ga0439434_0007007 | 3300042435 | Bacteria | 3293 |
| 561 | Ga0439459_0084783 | 3300042438 | Bacteria | 753 |
| 562 | Ga0450893_0023295 | 3300042532 | Bacteria | 1076 |
| 563 | Ga0453684_0920484 | 3300044712 | Bacteria | 935 |
| 564 | Ga0466957_0265945 | 3300044842 | Bacteria | 1144 |
| 565 | Ga0451576_0645660 | 3300045051 | Unclassified | 1112 |
| 566 | Ga0495580_0022765 | 3300046472 | Bacteria | 4606 |
| 567 | Ga0495580_0023793 | 3300046472 | Bacteria | 4493 |
| 568 | Ga0495582_0099570 | 3300046473 | Bacteria | 1627 |
| 569 | Ga0495664_0596919 | 3300046477 | Bacteria | 656 |
| 570 | Ga0495594_0069466 | 3300046499 | Bacteria | 1957 |
| 571 | Ga0495628_0064688 | 3300046516 | Bacteria | 2863 |
| 572 | Ga0495628_0350732 | 3300046516 | Bacteria | 1085 |
| 573 | Ga0495632_0048084 | 3300046519 | Bacteria | 2113 |
| 574 | Ga0495663_0000074 | 3300046525 | Bacteria | 45307 |
| 575 | Ga0495663_0276528 | 3300046525 | Bacteria | 601 |
| 576 | Ga0495665_0255190 | 3300046531 | Bacteria | 902 |
| 577 | Ga0495598_0000137 | 3300046537 | Bacteria | 12442 |
| 578 | Ga0495621_0001775 | 3300046539 | Bacteria | 5659 |
| 579 | Ga0495645_0306741 | 3300046543 | Bacteria | 1035 |
| 580 | Ga0495599_0082314 | 3300046678 | Bacteria | 2011 |
| 581 | Ga0495669_0031397 | 3300046684 | Unclassified | 2333 |
| 582 | Ga0495613_0348640 | 3300046689 | Bacteria | 1017 |
| 583 | Ga0495624_0068120 | 3300046690 | Bacteria | 2219 |
| 584 | Ga0495670_0005553 | 3300046691 | Bacteria | 6188 |
| 585 | Ga0495672_0026267 | 3300047320 | Unclassified | 3717 |
| 586 | Ga0495615_0119780 | 3300048090 | Bacteria | 760 |
| 587 | Ga0496106_0043934 | 3300048909 | Bacteria | 3354 |
| 588 | Ga0496112_0367070 | 3300048915 | Bacteria | 1381 |
| 589 | Ga0496115_0011740 | 3300048918 | Bacteria | 6578 |
| 590 | Ga0496115_0016640 | 3300048918 | Bacteria | 5604 |
| 591 | Ga0496124_0007663 | 3300048927 | Bacteria | 11420 |
| 592 | Ga0496125_0001113 | 3300048928 | Bacteria | 41129 |
| 593 | Ga0501306_007133 | 3300049127 | Bacteria | 1330 |
| 594 | Ga0501308_000861 | 3300049128 | Bacteria | 2204 |
| 595 | Ga0501308_003075 | 3300049128 | Bacteria | 1517 |
| 596 | Ga0501309_004240 | 3300049129 | Bacteria | 1663 |
| 597 | Ga0501309_007703 | 3300049129 | Bacteria | 1340 |
| 598 | Ga0501310_013464 | 3300049130 | Bacteria | 949 |
| 599 | Ga0501304_000321 | 3300049160 | Bacteria | 2313 |
| 600 | Ga0501305_001491 | 3300049161 | Bacteria | 2302 |
| 601 | Ga0501305_004817 | 3300049161 | Bacteria | 1607 |
| 602 | Ga0501307_000885 | 3300049162 | Bacteria | 2297 |
| 603 | Ga0501307_002106 | 3300049162 | Bacteria | 1811 |
| 604 | Ga0501292_003714 | 3300049515 | Bacteria | 2054 |
| 605 | Ga0501293_019648 | 3300049516 | Bacteria | 653 |
| 606 | Ga0501297_003996 | 3300049520 | Bacteria | 1491 |
| 607 | Ga0501298_001929 | 3300049521 | Bacteria | 3094 |
| 608 | Ga0501299_007771 | 3300049522 | Bacteria | 1722 |
| 609 | Ga0501311_001638 | 3300049527 | Bacteria | 2000 |
| 610 | Ga0501312_004054 | 3300049528 | Bacteria | 1706 |
| 611 | Ga0501318_009200 | 3300049534 | Bacteria | 1072 |
| 612 | Ga0501320_000512 | 3300049536 | Bacteria | 2307 |
| 613 | Ga0501321_000594 | 3300049537 | Bacteria | 2416 |
| 614 | Ga0501321_002776 | 3300049537 | Bacteria | 1551 |
| 615 | Ga0501322_000709 | 3300049538 | Bacteria | 1667 |
| 616 | Ga0501323_002531 | 3300049539 | Bacteria | 1782 |
| 617 | Ga0501323_003469 | 3300049539 | Bacteria | 1612 |
| 618 | Ga0501323_004507 | 3300049539 | Bacteria | 1478 |
| 619 | Ga0501324_000391 | 3300049540 | Bacteria | 2314 |
| 620 | Ga0501324_006008 | 3300049540 | Bacteria | 1010 |
| 621 | Ga0501329_00622 | 3300049545 | Bacteria | 1323 |
| 622 | Ga0501071_0097935 | 3300049587 | Bacteria | 2159 |
| 623 | Ga0501072_0019364 | 3300049588 | Bacteria | 5260 |
| 624 | Ga0501076_0981366 | 3300049592 | Bacteria | 696 |
| 625 | Ga0501198_002341 | 3300049649 | Bacteria | 2547 |
| 626 | Ga0501198_002373 | 3300049649 | Bacteria | 2532 |
| 627 | Ga0501201_004493 | 3300049651 | Bacteria | 1294 |
| 628 | Ga0501202_003871 | 3300049652 | Bacteria | 2585 |
| 629 | Ga0501206_007712 | 3300049653 | Bacteria | 1414 |
| 630 | Ga0501207_000161 | 3300049654 | Bacteria | 6256 |
| 631 | Ga0501207_003187 | 3300049654 | Bacteria | 2168 |
| 632 | Ga0501208_012883 | 3300049655 | Bacteria | 1238 |
| 633 | Ga0501209_007709 | 3300049656 | Bacteria | 2082 |
| 634 | Ga0501209_152183 | 3300049656 | Bacteria | 697 |
| 635 | Ga0501216_000468 | 3300049660 | Bacteria | 4794 |
| 636 | Ga0501216_012877 | 3300049660 | Bacteria | 1379 |
| 637 | Ga0501217_003208 | 3300049661 | Bacteria | 3285 |
| 638 | Ga0501217_010161 | 3300049661 | Bacteria | 2057 |
| 639 | Ga0501223_050023 | 3300049663 | Bacteria | 811 |
| 640 | Ga0501224_001416 | 3300049664 | Bacteria | 3178 |
| 641 | Ga0501227_006456 | 3300049665 | Bacteria | 2521 |
| 642 | Ga0501228_010963 | 3300049666 | Bacteria | 911 |
| 643 | Ga0501233_002196 | 3300049668 | Bacteria | 3418 |
| 644 | Ga0501233_022011 | 3300049668 | Bacteria | 1373 |
| 645 | Ga0501235_005061 | 3300049669 | Bacteria | 2861 |
| 646 | Ga0501247_006826 | 3300049677 | Bacteria | 1300 |
| 647 | Ga0501249_009938 | 3300049679 | Bacteria | 1983 |
| 648 | Ga0501253_001740 | 3300049683 | Bacteria | 2299 |
| 649 | Ga0501257_047174 | 3300049686 | Bacteria | 1068 |
| 650 | Ga0501259_039805 | 3300049688 | Bacteria | 920 |
| 651 | Ga0501260_001450 | 3300049689 | Bacteria | 1959 |
| 652 | Ga0501261_012231 | 3300049690 | Bacteria | 1152 |
| 653 | Ga0501221_045565 | 3300049704 | Bacteria | 972 |
| 654 | Ga0501225_0002871 | 3300049705 | Bacteria | 5290 |
| 655 | Ga0501225_0013234 | 3300049705 | Bacteria | 2312 |
| 656 | Ga0501234_000070 | 3300049707 | Bacteria | 12479 |
| 657 | Ga0501245_029318 | 3300049708 | Bacteria | 902 |
| 658 | Ga0501080_0634296 | 3300049742 | Bacteria | 946 |
| 659 | Ga0501241_047858 | 3300049758 | Bacteria | 840 |
| 660 | Ga0501272_020708 | 3300049769 | Bacteria | 789 |
| 661 | Ga0501273_005337 | 3300049770 | Bacteria | 1449 |
| 662 | Ga0501279_096903 | 3300049775 | Bacteria | 527 |
| 663 | Ga0501226_002550 | 3300049853 | Bacteria | 2216 |
| 664 | nmdc:mga00v17_44324_c1 | 3300050491 | Bacteria | 2682 |
| 665 | nmdc:mga0yw44_135300_c1 | 3300050492 | Bacteria | 1598 |
| 666 | nmdc:mga0yw44_337611_c1 | 3300050492 | Bacteria | 1013 |
| 667 | nmdc:mga05p37_257638_c1 | 3300050507 | Bacteria | 2090 |
| 668 | nmdc:mga05p37_264694_c1 | 3300050507 | Bacteria | 2056 |
| 669 | nmdc:mga05p37_425333_c1 | 3300050507 | Bacteria | 1544 |
| 670 | nmdc:mga05p37_963208_c1 | 3300050507 | Bacteria | 911 |
| 671 | nmdc:mga09592_85531_c1 | 3300050508 | Bacteria | 2690 |
| 672 | nmdc:mga09592_88245_c1 | 3300050508 | Bacteria | 2649 |
| 673 | nmdc:mga09592_91186_c1 | 3300050508 | Bacteria | 2604 |
| 674 | nmdc:mga0qj67_14195_c1 | 3300050509 | Bacteria | 6020 |
| 675 | nmdc:mga06r32_73682_c1 | 3300050510 | Bacteria | 3308 |
| 676 | nmdc:mga08y16_22_c1 | 3300050511 | Bacteria | 250162 |
| 677 | nmdc:mga08y16_31879_c1 | 3300050511 | Bacteria | 5542 |
| 678 | nmdc:mga08y16_413385_c1 | 3300050511 | Bacteria | 1379 |
| 679 | nmdc:mga0n895_1196188_c1 | 3300050512 | Unclassified | 734 |
| 680 | nmdc:mga0n895_1495086_c1 | 3300050512 | Bacteria | 642 |
| 681 | nmdc:mga0n895_261745_c1 | 3300050512 | Bacteria | 1755 |
| 682 | nmdc:mga0n895_27393_c1 | 3300050512 | Bacteria | 5414 |
| 683 | nmdc:mga0n895_88456_c1 | 3300050512 | Bacteria | 3097 |
| 684 | nmdc:mga0rr50_531299_c1 | 3300050513 | Bacteria | 1001 |
| 685 | nmdc:mga0rr50_98883_c1 | 3300050513 | Bacteria | 2288 |
| 686 | nmdc:mga0a205_27582_c1 | 3300050515 | Bacteria | 5424 |
| 687 | nmdc:mga0a205_80661_c1 | 3300050515 | Unclassified | 3143 |
| 688 | nmdc:mga0a205_94943_c1 | 3300050515 | Bacteria | 2881 |
| 689 | Ga0500646_0069647 | 3300053090 | Bacteria | 1052 |
| 690 | Ga0500641_0000580 | 3300053096 | Bacteria | 13189 |
| 691 | Ga0500594_0033618 | 3300053118 | Bacteria | 1365 |
| 692 | Ga0500658_0158618 | 3300053134 | Bacteria | 1023 |
| 693 | Ga0500568_0011991 | 3300053139 | Bacteria | 4000 |
| 694 | Ga0500627_0054218 | 3300053158 | Bacteria | 1753 |
| 695 | Ga0587084_011814 | 3300059477 | Bacteria | 1171 |
| 696 | Ga0587084_016336 | 3300059477 | Bacteria | 1058 |
| 697 | Ga0587084_027395 | 3300059477 | Bacteria | 896 |
| 698 | Ga0587066_013619 | 3300059490 | Bacteria | 1235 |
| 699 | Ga0587070_007002 | 3300059491 | Bacteria | 1546 |
| 700 | Ga0587070_096986 | 3300059491 | Bacteria | 672 |
| 701 | Ga0587077_015975 | 3300059493 | Bacteria | 1258 |
| 702 | Ga0587077_060150 | 3300059493 | Unclassified | 821 |
| 703 | Ga0587085_002150 | 3300059506 | Bacteria | 1973 |
| 704 | Ga0587086_004272 | 3300059507 | Bacteria | 1485 |
| 705 | Ga0587091_016189 | 3300059511 | Bacteria | 1240 |
| 706 | Ga0587092_001585 | 3300059512 | Bacteria | 2259 |
| 707 | Ga0587092_006074 | 3300059512 | Bacteria | 1516 |
| 708 | Ga0587125_021471 | 3300059607 | Unclassified | 765 |
| 709 | Ga0587101_017008 | 3300059623 | Bacteria | 1003 |
| 710 | Ga0587109_041391 | 3300059624 | Bacteria | 915 |
| 711 | Ga0587109_044481 | 3300059624 | Bacteria | 891 |
| 712 | Ga0587109_105073 | 3300059624 | Bacteria | 654 |
| 713 | Ga0587117_007307 | 3300059627 | Bacteria | 1262 |
| 714 | Ga0587062_041930 | 3300059639 | Unclassified | 746 |
| 715 | Ga0587068_039119 | 3300059641 | Bacteria | 852 |
| 716 | Ga0587072_012699 | 3300059643 | Bacteria | 1395 |
| 717 | Ga0587076_011628 | 3300059645 | Bacteria | 1298 |
| 718 | Ga0587079_034579 | 3300059647 | Bacteria | 990 |
| 719 | Ga0587079_048002 | 3300059647 | Unclassified | 886 |
| 720 | Ga0587079_091941 | 3300059647 | Unclassified | 711 |
| 721 | Ga0587071_048764 | 3300060344 | Bacteria | 870 |
| 722 | Ga0587111_0007287 | 3300060346 | Bacteria | 1792 |
| 723 | Ga0587111_0009384 | 3300060346 | Bacteria | 1649 |
| 724 | Ga0587111_0060396 | 3300060346 | Bacteria | 860 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_100783347 | Ga0070675_1007833471 | 134 |
| 2 | 3300005347 | Ga0070668_100300051 | Ga0070668_1003000512 | 145 |
| 3 | 3300005353 | Ga0070669_100069679 | Ga0070669_1000696793 | 145 |
| 4 | 3300005617 | Ga0068859_100099968 | Ga0068859_1000999683 | 145 |
| 5 | 3300005719 | Ga0068861_100027087 | Ga0068861_1000270873 | 145 |
| 6 | 3300006931 | Ga0097620_100099964 | Ga0097620_1000999643 | 145 |
| 7 | 3300025918 | Ga0207662_10101789 | Ga0207662_101017892 | 145 |
| 8 | 3300025923 | Ga0207681_10100805 | Ga0207681_101008051 | 145 |
| 9 | 3300026118 | Ga0207675_100012195 | Ga0207675_1000121953 | 145 |
| 10 | 3300005440 | Ga0070705_100146417 | Ga0070705_1001464172 | 147 |
| 11 | 3300005518 | Ga0070699_100095275 | Ga0070699_1000952752 | 148 |
| 12 | 3300005549 | Ga0070704_100605475 | Ga0070704_1006054752 | 148 |
| 13 | 3300059647 | Ga0587079_034579 | Ga0587079_034579_232_738 | 150 |
| 14 | 3300006852 | Ga0075433_10006999 | Ga0075433_100069992 | 152 |
| 15 | 3300049587 | Ga0501071_0097935 | Ga0501071_0097935_276_779 | 152 |
| 16 | 3300049592 | Ga0501076_0981366 | Ga0501076_0981366_31_534 | 152 |
| 17 | 3300050515 | nmdc:mga0a205_27582_c1 | nmdc:mga0a205_27582_c1_4409_4909 | 152 |
| 18 | 3300003771 | Ga0055526_1000971 | Ga0055526_10009712 | 153 |
| 19 | 3300003773 | Ga0055537_1002636 | Ga0055537_10026366 | 153 |
| 20 | 3300003790 | Ga0055528_1046844 | Ga0055528_10468441 | 153 |
| 21 | 3300005262 | Ga0065165_1027329 | Ga0065165_10273292 | 153 |
| 22 | 3300005536 | Ga0070697_100000995 | Ga0070697_10000099511 | 153 |
| 23 | 3300046516 | Ga0495628_0064688 | Ga0495628_0064688_2105_2626 | 153 |
| 24 | 3300050507 | nmdc:mga05p37_963208_c1 | nmdc:mga05p37_963208_c1_416_883 | 153 |
| 25 | 3300005337 | Ga0070682_100000648 | Ga0070682_1000006484 | 154 |
| 26 | 3300039437 | Ga0436365_0311259 | Ga0436365_0311259_31362_31835 | 154 |
| 27 | 3300039453 | Ga0436362_0597322 | Ga0436362_0597322_18082_18555 | 154 |
| 28 | 3300005289 | Ga0065704_10112644 | Ga0065704_101126441 | 155 |
| 29 | 3300005546 | Ga0070696_100389361 | Ga0070696_1003893612 | 155 |
| 30 | 3300005547 | Ga0070693_100008236 | Ga0070693_1000082367 | 155 |
| 31 | 3300005615 | Ga0070702_100311744 | Ga0070702_1003117442 | 155 |
| 32 | 3300025292 | Ga0209676_1000555 | Ga0209676_100055533 | 155 |
| 33 | 3300005334 | Ga0068869_100162062 | Ga0068869_1001620622 | 156 |
| 34 | 3300005353 | Ga0070669_100013271 | Ga0070669_1000132711 | 156 |
| 35 | 3300005577 | Ga0068857_100527514 | Ga0068857_1005275142 | 156 |
| 36 | 3300005618 | Ga0068864_100297772 | Ga0068864_1002977722 | 156 |
| 37 | 3300009092 | Ga0105250_10250702 | Ga0105250_102507021 | 156 |
| 38 | 3300014325 | Ga0163163_10121899 | Ga0163163_101218992 | 156 |
| 39 | 3300014745 | Ga0157377_10020590 | Ga0157377_100205903 | 156 |
| 40 | 3300025923 | Ga0207681_10025850 | Ga0207681_100258506 | 156 |
| 41 | 3300025936 | Ga0207670_10091604 | Ga0207670_100916042 | 156 |
| 42 | 3300026023 | Ga0207677_10093911 | Ga0207677_100939113 | 156 |
| 43 | 3300026075 | Ga0207708_10102321 | Ga0207708_101023212 | 156 |
| 44 | 3300028380 | Ga0268265_10073456 | Ga0268265_100734564 | 156 |
| 45 | 3300035115 | Ga0373941_0011088 | Ga0373941_0011088_1090_1572 | 156 |
| 46 | iso_pu_bacteria | 2878738818 | 2878739700 | 156 |
| 47 | iso_pu_bacteria | 2884763398 | 2884766979 | 156 |
| 48 | iso_pu_bacteria | 2924718760 | 2924724005 | 156 |
| 49 | iso_pu_bacteria | 2924776078 | 2924777229 | 156 |
| 50 | iso_pu_bacteria | 2937972304 | 2937975676 | 156 |
| 51 | iso_pu_bacteria | 2958034702 | 2958035275 | 156 |
| 52 | iso_pu_bacteria | 2958041894 | 2958044307 | 156 |
| 53 | iso_pu_bacteria | 2958084443 | 2958087834 | 156 |
| 54 | iso_pu_bacteria | 2970593180 | 2970594297 | 156 |
| 55 | 3300006358 | Ga0068871_101229467 | Ga0068871_1012294672 | 157 |
| 56 | 3300006881 | Ga0068865_100302738 | Ga0068865_1003027382 | 157 |
| 57 | 3300009551 | Ga0105238_10000001 | Ga0105238_100000011787 | 157 |
| 58 | 3300025938 | Ga0207704_10267228 | Ga0207704_102672282 | 157 |
| 59 | 3300046525 | Ga0495663_0000074 | Ga0495663_0000074_7905_8426 | 157 |
| 60 | 3300050510 | nmdc:mga06r32_73682_c1 | nmdc:mga06r32_73682_c1_2196_2678 | 157 |
| 61 | 3300050513 | nmdc:mga0rr50_531299_c1 | nmdc:mga0rr50_531299_c1_241_744 | 157 |
| 62 | 3300059607 | Ga0587125_021471 | Ga0587125_021471_66_590 | 157 |
| 63 | 3300059647 | Ga0587079_048002 | Ga0587079_048002_347_871 | 157 |
| 64 | 3300005444 | Ga0070694_100010967 | Ga0070694_1000109677 | 158 |
| 65 | 3300009094 | Ga0111539_10000026 | Ga0111539_1000002677 | 158 |
| 66 | 3300009098 | Ga0105245_10003884 | Ga0105245_100038842 | 158 |
| 67 | 3300009098 | Ga0105245_10449286 | Ga0105245_104492862 | 158 |
| 68 | 3300010375 | Ga0105239_10591396 | Ga0105239_105913962 | 158 |
| 69 | 3300013102 | Ga0157371_10739062 | Ga0157371_107390622 | 158 |
| 70 | 3300050513 | nmdc:mga0rr50_98883_c1 | nmdc:mga0rr50_98883_c1_800_1288 | 158 |
| 71 | 3300003316 | rootH1_10182808 | rootH1_101828082 | 159 |
| 72 | 3300005334 | Ga0068869_100047863 | Ga0068869_1000478632 | 159 |
| 73 | 3300005340 | Ga0070689_100350372 | Ga0070689_1003503722 | 159 |
| 74 | 3300005356 | Ga0070674_100136369 | Ga0070674_1001363693 | 159 |
| 75 | 3300005445 | Ga0070708_100343826 | Ga0070708_1003438262 | 159 |
| 76 | 3300005471 | Ga0070698_100004263 | Ga0070698_10000426310 | 159 |
| 77 | 3300005719 | Ga0068861_101807576 | Ga0068861_1018075761 | 159 |
| 78 | 3300006844 | Ga0075428_100307359 | Ga0075428_1003073592 | 159 |
| 79 | 3300006846 | Ga0075430_100148054 | Ga0075430_1001480542 | 159 |
| 80 | 3300006880 | Ga0075429_100192137 | Ga0075429_1001921372 | 159 |
| 81 | 3300009094 | Ga0111539_10438326 | Ga0111539_104383262 | 159 |
| 82 | 3300009094 | Ga0111539_10859209 | Ga0111539_108592091 | 159 |
| 83 | 3300009147 | Ga0114129_10075732 | Ga0114129_100757323 | 159 |
| 84 | 3300009553 | Ga0105249_10634329 | Ga0105249_106343292 | 159 |
| 85 | 3300013297 | Ga0157378_10067421 | Ga0157378_100674212 | 159 |
| 86 | 3300014326 | Ga0157380_10173413 | Ga0157380_101734132 | 159 |
| 87 | 3300041406 | Ga0439439_0024833 | Ga0439439_0024833_953_1453 | 159 |
| 88 | 3300041997 | Ga0439431_0005150 | Ga0439431_0005150_1261_1761 | 159 |
| 89 | 3300041999 | Ga0439433_0050071 | Ga0439433_0050071_435_935 | 159 |
| 90 | 3300042002 | Ga0439442_059847 | Ga0439442_059847_181_681 | 159 |
| 91 | 3300042011 | Ga0439454_090414 | Ga0439454_090414_47_547 | 159 |
| 92 | 3300042014 | Ga0439457_100484 | Ga0439457_100484_152_652 | 159 |
| 93 | 3300042124 | Ga0450922_010055 | Ga0450922_010055_380_880 | 159 |
| 94 | 3300042124 | Ga0450922_026585 | Ga0450922_026585_16_516 | 159 |
| 95 | 3300042131 | Ga0450894_006897 | Ga0450894_006897_408_908 | 159 |
| 96 | 3300042133 | Ga0450896_005192 | Ga0450896_005192_931_1431 | 159 |
| 97 | 3300042134 | Ga0450898_001804 | Ga0450898_001804_2148_2648 | 159 |
| 98 | 3300042435 | Ga0439434_0007007 | Ga0439434_0007007_2344_2844 | 159 |
| 99 | 3300048918 | Ga0496115_0011740 | Ga0496115_0011740_2242_2745 | 159 |
| 100 | 3300049588 | Ga0501072_0019364 | Ga0501072_0019364_2811_3323 | 159 |
| 101 | 3300050507 | nmdc:mga05p37_264694_c1 | nmdc:mga05p37_264694_c1_658_1218 | 159 |
| 102 | 3300050508 | nmdc:mga09592_88245_c1 | nmdc:mga09592_88245_c1_727_1227 | 159 |
| 103 | 3300050509 | nmdc:mga0qj67_14195_c1 | nmdc:mga0qj67_14195_c1_1036_1596 | 159 |
| 104 | 3300050511 | nmdc:mga08y16_413385_c1 | nmdc:mga08y16_413385_c1_243_746 | 159 |
| 105 | iso_pu_bacteria | 2512875016 | 2512933673 | 159 |
| 106 | iso_pu_bacteria | 2585428094 | 2587861745 | 159 |
| 107 | iso_pu_bacteria | 2876363079 | 2876364072 | 159 |
| 108 | iso_pu_bacteria | 2903448605 | 2903453826 | 159 |
| 109 | iso_pu_bacteria | 2903521522 | 2903525768 | 159 |
| 110 | iso_pu_bacteria | 2903528002 | 2903532685 | 159 |
| 111 | iso_pu_bacteria | 2937848649 | 2937853891 | 159 |
| 112 | iso_pu_bacteria | 2963644680 | 2963645530 | 159 |
| 113 | iso_pu_bacteria | 2968083720 | 2968085136 | 159 |
| 114 | iso_pu_bacteria | 2977922695 | 2977924687 | 159 |
| 115 | iso_pu_bacteria | 3004211236 | 3004218478 | 159 |
| 116 | iso_pu_bacteria | 3004218560 | 3004222889 | 159 |
| 117 | 3300002737 | JGI25162J39368_1014118 | JGI25162J39368_10141182 | 160 |
| 118 | 3300002772 | JGI25164J39214_1003119 | JGI25164J39214_10031192 | 160 |
| 119 | 3300003214 | JGI25165J46597_1000005 | JGI25165J46597_100000566 | 160 |
| 120 | 3300005336 | Ga0070680_100000388 | Ga0070680_1000003887 | 160 |
| 121 | 3300005337 | Ga0070682_100110757 | Ga0070682_1001107572 | 160 |
| 122 | 3300005339 | Ga0070660_100002905 | Ga0070660_10000290511 | 160 |
| 123 | 3300005458 | Ga0070681_10030032 | Ga0070681_100300323 | 160 |
| 124 | 3300005530 | Ga0070679_100000002 | Ga0070679_1000000025 | 160 |
| 125 | 3300005548 | Ga0070665_100000145 | Ga0070665_100000145147 | 160 |
| 126 | 3300009147 | Ga0114129_10312807 | Ga0114129_103128073 | 160 |
| 127 | 3300013296 | Ga0157374_10000037 | Ga0157374_100000372 | 160 |
| 128 | 3300014745 | Ga0157377_10000008 | Ga0157377_100000082 | 160 |
| 129 | 3300025231 | Ga0207427_100028 | Ga0207427_10002886 | 160 |
| 130 | 3300025233 | Ga0209437_100211 | Ga0209437_10021170 | 160 |
| 131 | 3300025261 | Ga0209233_1000001 | Ga0209233_1000001584 | 160 |
| 132 | 3300025917 | Ga0207660_10000892 | Ga0207660_1000089217 | 160 |
| 133 | 3300025919 | Ga0207657_10016857 | Ga0207657_100168574 | 160 |
| 134 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001491 | 160 |
| 135 | 3300025921 | Ga0207652_10000002 | Ga0207652_10000002237 | 160 |
| 136 | 3300028379 | Ga0268266_10000173 | Ga0268266_100001732 | 160 |
| 137 | 3300037418 | Ga0395900_0921551 | Ga0395900_0921551_129_632 | 160 |
| 138 | 3300038443 | Ga0395901_0061189 | Ga0395901_0061189_3045_3548 | 160 |
| 139 | 3300050507 | nmdc:mga05p37_257638_c1 | nmdc:mga05p37_257638_c1_694_1197 | 160 |
| 140 | 3300005356 | Ga0070674_100467638 | Ga0070674_1004676381 | 161 |
| 141 | 3300005546 | Ga0070696_100307112 | Ga0070696_1003071122 | 161 |
| 142 | 3300009176 | Ga0105242_10005282 | Ga0105242_100052828 | 161 |
| 143 | 3300013297 | Ga0157378_11337627 | Ga0157378_113376272 | 161 |
| 144 | 3300025934 | Ga0207686_10011983 | Ga0207686_100119836 | 161 |
| 145 | 3300025937 | Ga0207669_10259479 | Ga0207669_102594791 | 161 |
| 146 | 3300031852 | Ga0307410_10293997 | Ga0307410_102939973 | 161 |
| 147 | 3300031995 | Ga0307409_100213363 | Ga0307409_1002133632 | 161 |
| 148 | 3300032005 | Ga0307411_10044726 | Ga0307411_100447264 | 161 |
| 149 | 3300032126 | Ga0307415_101937038 | Ga0307415_1019370381 | 161 |
| 150 | 3300053134 | Ga0500658_0158618 | Ga0500658_0158618_281_781 | 161 |
| 151 | iso_pu_bacteria | 2513020052 | 2513234669 | 161 |
| 152 | iso_pu_bacteria | 2522125168 | 2522550813 | 161 |
| 153 | iso_pu_bacteria | 2816332280 | 2817416931 | 161 |
| 154 | iso_pu_bacteria | 2919683626 | 2919684230 | 161 |
| 155 | 3300002773 | JGI25152J39213_1000204 | JGI25152J39213_10002046 | 162 |
| 156 | 3300002774 | JGI25150J39212_1000391 | JGI25150J39212_10003916 | 162 |
| 157 | 3300003215 | JGI25153J46596_10011374 | JGI25153J46596_100113746 | 162 |
| 158 | 3300003771 | Ga0055526_1000199 | Ga0055526_10001996 | 162 |
| 159 | 3300003775 | Ga0055524_1000222 | Ga0055524_100022227 | 162 |
| 160 | 3300003775 | Ga0055524_1002259 | Ga0055524_10022594 | 162 |
| 161 | 3300003791 | Ga0055530_10000308 | Ga0055530_100003086 | 162 |
| 162 | 3300005289 | Ga0065704_10227387 | Ga0065704_102273872 | 162 |
| 163 | 3300005295 | Ga0065707_10083232 | Ga0065707_100832329 | 162 |
| 164 | 3300005327 | Ga0070658_10004705 | Ga0070658_100047059 | 162 |
| 165 | 3300005337 | Ga0070682_100000022 | Ga0070682_1000000222 | 162 |
| 166 | 3300005338 | Ga0068868_100000070 | Ga0068868_10000007021 | 162 |
| 167 | 3300005356 | Ga0070674_100079681 | Ga0070674_1000796814 | 162 |
| 168 | 3300005365 | Ga0070688_100180342 | Ga0070688_1001803423 | 162 |
| 169 | 3300005441 | Ga0070700_100137513 | Ga0070700_1001375132 | 162 |
| 170 | 3300005444 | Ga0070694_100236540 | Ga0070694_1002365402 | 162 |
| 171 | 3300005617 | Ga0068859_100002668 | Ga0068859_1000026686 | 162 |
| 172 | 3300005617 | Ga0068859_102219164 | Ga0068859_1022191641 | 162 |
| 173 | 3300005719 | Ga0068861_100744478 | Ga0068861_1007444782 | 162 |
| 174 | 3300005842 | Ga0068858_100486069 | Ga0068858_1004860691 | 162 |
| 175 | 3300005844 | Ga0068862_100018222 | Ga0068862_1000182225 | 162 |
| 176 | 3300006844 | Ga0075428_100007935 | Ga0075428_10000793510 | 162 |
| 177 | 3300006844 | Ga0075428_100039304 | Ga0075428_1000393046 | 162 |
| 178 | 3300006847 | Ga0075431_100096488 | Ga0075431_1000964886 | 162 |
| 179 | 3300006880 | Ga0075429_100058501 | Ga0075429_1000585012 | 162 |
| 180 | 3300006931 | Ga0097620_100002668 | Ga0097620_1000026686 | 162 |
| 181 | 3300006931 | Ga0097620_102218816 | Ga0097620_1022188161 | 162 |
| 182 | 3300007076 | Ga0075435_100347412 | Ga0075435_1003474122 | 162 |
| 183 | 3300009094 | Ga0111539_10093138 | Ga0111539_100931385 | 162 |
| 184 | 3300009094 | Ga0111539_11320662 | Ga0111539_113206622 | 162 |
| 185 | 3300009176 | Ga0105242_10000271 | Ga0105242_100002719 | 162 |
| 186 | 3300009551 | Ga0105238_10000032 | Ga0105238_10000032142 | 162 |
| 187 | 3300009553 | Ga0105249_10619559 | Ga0105249_106195592 | 162 |
| 188 | 3300013102 | Ga0157371_10014418 | Ga0157371_100144181 | 162 |
| 189 | 3300013102 | Ga0157371_10016302 | Ga0157371_100163025 | 162 |
| 190 | 3300013105 | Ga0157369_10156080 | Ga0157369_101560802 | 162 |
| 191 | 3300013297 | Ga0157378_10052127 | Ga0157378_100521275 | 162 |
| 192 | 3300013306 | Ga0163162_10027811 | Ga0163162_100278113 | 162 |
| 193 | 3300013306 | Ga0163162_10321978 | Ga0163162_103219782 | 162 |
| 194 | 3300013307 | Ga0157372_10075983 | Ga0157372_100759832 | 162 |
| 195 | 3300013307 | Ga0157372_10108478 | Ga0157372_101084782 | 162 |
| 196 | 3300025245 | Ga0207425_1000001 | Ga0207425_100000191 | 162 |
| 197 | 3300025258 | Ga0209129_1000003 | Ga0209129_100000391 | 162 |
| 198 | 3300025258 | Ga0209129_1015382 | Ga0209129_10153822 | 162 |
| 199 | 3300025263 | Ga0209565_1001872 | Ga0209565_10018726 | 162 |
| 200 | 3300025263 | Ga0209565_1003580 | Ga0209565_10035803 | 162 |
| 201 | 3300025263 | Ga0209565_1012230 | Ga0209565_10122302 | 162 |
| 202 | 3300025291 | Ga0209675_1000223 | Ga0209675_100022351 | 162 |
| 203 | 3300025295 | Ga0209564_1000095 | Ga0209564_100009569 | 162 |
| 204 | 3300025295 | Ga0209564_1001520 | Ga0209564_100152012 | 162 |
| 205 | 3300025297 | Ga0209758_1000041 | Ga0209758_100004139 | 162 |
| 206 | 3300025298 | Ga0209050_1000138 | Ga0209050_100013889 | 162 |
| 207 | 3300025299 | Ga0209256_1000402 | Ga0209256_100040229 | 162 |
| 208 | 3300025299 | Ga0209256_1000438 | Ga0209256_100043821 | 162 |
| 209 | 3300025909 | Ga0207705_10009322 | Ga0207705_100093222 | 162 |
| 210 | 3300025924 | Ga0207694_10000041 | Ga0207694_10000041142 | 162 |
| 211 | 3300025934 | Ga0207686_10000285 | Ga0207686_1000028511 | 162 |
| 212 | 3300025937 | Ga0207669_10370794 | Ga0207669_103707942 | 162 |
| 213 | 3300025961 | Ga0207712_10178561 | Ga0207712_101785612 | 162 |
| 214 | 3300026023 | Ga0207677_10000070 | Ga0207677_1000007018 | 162 |
| 215 | 3300026118 | Ga0207675_101810222 | Ga0207675_1018102221 | 162 |
| 216 | 3300027907 | Ga0207428_10002898 | Ga0207428_100028986 | 162 |
| 217 | 3300028380 | Ga0268265_10016718 | Ga0268265_100167187 | 162 |
| 218 | 3300028563 | Ga0265319_1051950 | Ga0265319_10519502 | 162 |
| 219 | 3300028577 | Ga0265318_10036805 | Ga0265318_100368052 | 162 |
| 220 | 3300028794 | Ga0307515_10131661 | Ga0307515_101316614 | 162 |
| 221 | 3300031548 | Ga0307408_100000022 | Ga0307408_100000022220 | 162 |
| 222 | 3300031548 | Ga0307408_100190138 | Ga0307408_1001901382 | 162 |
| 223 | 3300031731 | Ga0307405_10019269 | Ga0307405_100192693 | 162 |
| 224 | 3300031852 | Ga0307410_10430761 | Ga0307410_104307612 | 162 |
| 225 | 3300031901 | Ga0307406_10501915 | Ga0307406_105019151 | 162 |
| 226 | 3300031911 | Ga0307412_10051223 | Ga0307412_100512232 | 162 |
| 227 | 3300031995 | Ga0307409_100325703 | Ga0307409_1003257032 | 162 |
| 228 | 3300032002 | Ga0307416_100218787 | Ga0307416_1002187873 | 162 |
| 229 | 3300032004 | Ga0307414_10458126 | Ga0307414_104581262 | 162 |
| 230 | 3300032005 | Ga0307411_10019979 | Ga0307411_100199794 | 162 |
| 231 | 3300032126 | Ga0307415_100028042 | Ga0307415_1000280423 | 162 |
| 232 | 3300037466 | Ga0395898_0036797 | Ga0395898_0036797_150_650 | 162 |
| 233 | 3300037471 | Ga0395905_0058674 | Ga0395905_0058674_141_641 | 162 |
| 234 | 3300038443 | Ga0395901_0005616 | Ga0395901_0005616_9151_9651 | 162 |
| 235 | 3300047320 | Ga0495672_0026267 | Ga0495672_0026267_959_1456 | 162 |
| 236 | 3300048090 | Ga0495615_0119780 | Ga0495615_0119780_96_596 | 162 |
| 237 | 3300048909 | Ga0496106_0043934 | Ga0496106_0043934_309_806 | 162 |
| 238 | 3300049520 | Ga0501297_003996 | Ga0501297_003996_491_1006 | 162 |
| 239 | 3300049521 | Ga0501298_001929 | Ga0501298_001929_1997_2512 | 162 |
| 240 | 3300049522 | Ga0501299_007771 | Ga0501299_007771_535_1050 | 162 |
| 241 | 3300049539 | Ga0501323_004507 | Ga0501323_004507_318_833 | 162 |
| 242 | 3300049649 | Ga0501198_002373 | Ga0501198_002373_1703_2218 | 162 |
| 243 | 3300049651 | Ga0501201_004493 | Ga0501201_004493_662_1177 | 162 |
| 244 | 3300049654 | Ga0501207_003187 | Ga0501207_003187_431_946 | 162 |
| 245 | 3300049655 | Ga0501208_012883 | Ga0501208_012883_313_828 | 162 |
| 246 | 3300049656 | Ga0501209_152183 | Ga0501209_152183_55_570 | 162 |
| 247 | 3300049660 | Ga0501216_012877 | Ga0501216_012877_328_843 | 162 |
| 248 | 3300049661 | Ga0501217_003208 | Ga0501217_003208_2236_2751 | 162 |
| 249 | 3300049666 | Ga0501228_010963 | Ga0501228_010963_165_680 | 162 |
| 250 | 3300049668 | Ga0501233_022011 | Ga0501233_022011_330_845 | 162 |
| 251 | 3300049669 | Ga0501235_005061 | Ga0501235_005061_2124_2639 | 162 |
| 252 | 3300049677 | Ga0501247_006826 | Ga0501247_006826_510_1025 | 162 |
| 253 | 3300049683 | Ga0501253_001740 | Ga0501253_001740_1205_1720 | 162 |
| 254 | 3300049688 | Ga0501259_039805 | Ga0501259_039805_296_811 | 162 |
| 255 | 3300049689 | Ga0501260_001450 | Ga0501260_001450_1301_1816 | 162 |
| 256 | 3300049690 | Ga0501261_012231 | Ga0501261_012231_252_767 | 162 |
| 257 | 3300049705 | Ga0501225_0013234 | Ga0501225_0013234_1301_1816 | 162 |
| 258 | 3300049708 | Ga0501245_029318 | Ga0501245_029318_190_705 | 162 |
| 259 | 3300049758 | Ga0501241_047858 | Ga0501241_047858_101_616 | 162 |
| 260 | 3300049770 | Ga0501273_005337 | Ga0501273_005337_805_1320 | 162 |
| 261 | 3300050508 | nmdc:mga09592_85531_c1 | nmdc:mga09592_85531_c1_1287_1802 | 162 |
| 262 | 3300050511 | nmdc:mga08y16_31879_c1 | nmdc:mga08y16_31879_c1_360_875 | 162 |
| 263 | 3300059624 | Ga0587109_044481 | Ga0587109_044481_297_815 | 162 |
| 264 | 3300003320 | rootH2_10252390 | rootH2_102523901 | 163 |
| 265 | 3300005293 | Ga0065715_10140686 | Ga0065715_101406862 | 163 |
| 266 | 3300005293 | Ga0065715_10157220 | Ga0065715_101572203 | 163 |
| 267 | 3300005293 | Ga0065715_10174159 | Ga0065715_101741592 | 163 |
| 268 | 3300005327 | Ga0070658_10190346 | Ga0070658_101903462 | 163 |
| 269 | 3300005329 | Ga0070683_100243314 | Ga0070683_1002433142 | 163 |
| 270 | 3300005331 | Ga0070670_100005938 | Ga0070670_1000059383 | 163 |
| 271 | 3300005331 | Ga0070670_100033105 | Ga0070670_1000331054 | 163 |
| 272 | 3300005331 | Ga0070670_100155239 | Ga0070670_1001552392 | 163 |
| 273 | 3300005334 | Ga0068869_100793891 | Ga0068869_1007938911 | 163 |
| 274 | 3300005337 | Ga0070682_100000096 | Ga0070682_10000009610 | 163 |
| 275 | 3300005338 | Ga0068868_100001632 | Ga0068868_1000016327 | 163 |
| 276 | 3300005339 | Ga0070660_100001702 | Ga0070660_1000017027 | 163 |
| 277 | 3300005340 | Ga0070689_100026482 | Ga0070689_1000264822 | 163 |
| 278 | 3300005340 | Ga0070689_100029297 | Ga0070689_1000292974 | 163 |
| 279 | 3300005340 | Ga0070689_100382957 | Ga0070689_1003829571 | 163 |
| 280 | 3300005341 | Ga0070691_10295331 | Ga0070691_102953311 | 163 |
| 281 | 3300005343 | Ga0070687_100134125 | Ga0070687_1001341252 | 163 |
| 282 | 3300005344 | Ga0070661_100000114 | Ga0070661_10000011451 | 163 |
| 283 | 3300005344 | Ga0070661_100697784 | Ga0070661_1006977841 | 163 |
| 284 | 3300005353 | Ga0070669_100015293 | Ga0070669_1000152933 | 163 |
| 285 | 3300005354 | Ga0070675_100074405 | Ga0070675_1000744054 | 163 |
| 286 | 3300005355 | Ga0070671_100039938 | Ga0070671_1000399384 | 163 |
| 287 | 3300005364 | Ga0070673_100202681 | Ga0070673_1002026812 | 163 |
| 288 | 3300005365 | Ga0070688_101512092 | Ga0070688_1015120921 | 163 |
| 289 | 3300005366 | Ga0070659_100000017 | Ga0070659_100000017149 | 163 |
| 290 | 3300005439 | Ga0070711_100484196 | Ga0070711_1004841962 | 163 |
| 291 | 3300005440 | Ga0070705_100989591 | Ga0070705_1009895911 | 163 |
| 292 | 3300005456 | Ga0070678_100903786 | Ga0070678_1009037862 | 163 |
| 293 | 3300005459 | Ga0068867_100240105 | Ga0068867_1002401052 | 163 |
| 294 | 3300005467 | Ga0070706_100035089 | Ga0070706_1000350893 | 163 |
| 295 | 3300005471 | Ga0070698_100012193 | Ga0070698_1000121937 | 163 |
| 296 | 3300005536 | Ga0070697_100000652 | Ga0070697_1000006526 | 163 |
| 297 | 3300005536 | Ga0070697_100456309 | Ga0070697_1004563092 | 163 |
| 298 | 3300005539 | Ga0068853_100194179 | Ga0068853_1001941791 | 163 |
| 299 | 3300005543 | Ga0070672_100001157 | Ga0070672_1000011574 | 163 |
| 300 | 3300005546 | Ga0070696_100745829 | Ga0070696_1007458291 | 163 |
| 301 | 3300005549 | Ga0070704_100085003 | Ga0070704_1000850033 | 163 |
| 302 | 3300005549 | Ga0070704_100246798 | Ga0070704_1002467982 | 163 |
| 303 | 3300005577 | Ga0068857_100049299 | Ga0068857_1000492993 | 163 |
| 304 | 3300005617 | Ga0068859_100163536 | Ga0068859_1001635362 | 163 |
| 305 | 3300005617 | Ga0068859_100212513 | Ga0068859_1002125133 | 163 |
| 306 | 3300005617 | Ga0068859_100380275 | Ga0068859_1003802752 | 163 |
| 307 | 3300005618 | Ga0068864_100000032 | Ga0068864_100000032177 | 163 |
| 308 | 3300005618 | Ga0068864_100002419 | Ga0068864_1000024195 | 163 |
| 309 | 3300005840 | Ga0068870_10001285 | Ga0068870_100012858 | 163 |
| 310 | 3300005841 | Ga0068863_100050442 | Ga0068863_1000504422 | 163 |
| 311 | 3300005842 | Ga0068858_100007130 | Ga0068858_1000071306 | 163 |
| 312 | 3300005842 | Ga0068858_100053652 | Ga0068858_1000536523 | 163 |
| 313 | 3300006038 | Ga0075365_10029151 | Ga0075365_100291512 | 163 |
| 314 | 3300006358 | Ga0068871_100166569 | Ga0068871_1001665693 | 163 |
| 315 | 3300006852 | Ga0075433_10148911 | Ga0075433_101489113 | 163 |
| 316 | 3300006871 | Ga0075434_100051241 | Ga0075434_1000512413 | 163 |
| 317 | 3300006871 | Ga0075434_100510860 | Ga0075434_1005108601 | 163 |
| 318 | 3300006871 | Ga0075434_101400695 | Ga0075434_1014006952 | 163 |
| 319 | 3300006931 | Ga0097620_100163530 | Ga0097620_1001635302 | 163 |
| 320 | 3300006931 | Ga0097620_100212504 | Ga0097620_1002125042 | 163 |
| 321 | 3300006931 | Ga0097620_100380248 | Ga0097620_1003802482 | 163 |
| 322 | 3300009093 | Ga0105240_11092376 | Ga0105240_110923761 | 163 |
| 323 | 3300009098 | Ga0105245_10011605 | Ga0105245_100116054 | 163 |
| 324 | 3300009148 | Ga0105243_10008963 | Ga0105243_100089638 | 163 |
| 325 | 3300009148 | Ga0105243_10081343 | Ga0105243_100813432 | 163 |
| 326 | 3300009174 | Ga0105241_10005988 | Ga0105241_100059885 | 163 |
| 327 | 3300009176 | Ga0105242_10009637 | Ga0105242_100096375 | 163 |
| 328 | 3300009177 | Ga0105248_10058455 | Ga0105248_100584555 | 163 |
| 329 | 3300009553 | Ga0105249_10241363 | Ga0105249_102413633 | 163 |
| 330 | 3300011119 | Ga0105246_10302787 | Ga0105246_103027872 | 163 |
| 331 | 3300013102 | Ga0157371_10729066 | Ga0157371_107290662 | 163 |
| 332 | 3300013104 | Ga0157370_10373886 | Ga0157370_103738862 | 163 |
| 333 | 3300013296 | Ga0157374_10137320 | Ga0157374_101373202 | 163 |
| 334 | 3300013306 | Ga0163162_10013880 | Ga0163162_100138804 | 163 |
| 335 | 3300013308 | Ga0157375_10000001 | Ga0157375_10000001557 | 163 |
| 336 | 3300013308 | Ga0157375_10106594 | Ga0157375_101065941 | 163 |
| 337 | 3300013308 | Ga0157375_11947460 | Ga0157375_119474601 | 163 |
| 338 | 3300014325 | Ga0163163_10391176 | Ga0163163_103911762 | 163 |
| 339 | 3300014326 | Ga0157380_10014240 | Ga0157380_100142402 | 163 |
| 340 | 3300014326 | Ga0157380_10367547 | Ga0157380_103675472 | 163 |
| 341 | 3300014497 | Ga0182008_10077830 | Ga0182008_100778302 | 163 |
| 342 | 3300017792 | Ga0163161_11098160 | Ga0163161_110981601 | 163 |
| 343 | 3300021384 | Ga0213876_10043658 | Ga0213876_100436582 | 163 |
| 344 | 3300025908 | Ga0207643_10008324 | Ga0207643_100083243 | 163 |
| 345 | 3300025908 | Ga0207643_10020727 | Ga0207643_100207272 | 163 |
| 346 | 3300025909 | Ga0207705_10107749 | Ga0207705_101077493 | 163 |
| 347 | 3300025910 | Ga0207684_10039428 | Ga0207684_100394283 | 163 |
| 348 | 3300025910 | Ga0207684_10348975 | Ga0207684_103489752 | 163 |
| 349 | 3300025911 | Ga0207654_10104104 | Ga0207654_101041042 | 163 |
| 350 | 3300025916 | Ga0207663_10273715 | Ga0207663_102737152 | 163 |
| 351 | 3300025918 | Ga0207662_10063431 | Ga0207662_100634313 | 163 |
| 352 | 3300025919 | Ga0207657_10004411 | Ga0207657_100044117 | 163 |
| 353 | 3300025920 | Ga0207649_10000011 | Ga0207649_1000001111 | 163 |
| 354 | 3300025923 | Ga0207681_10004339 | Ga0207681_100043393 | 163 |
| 355 | 3300025925 | Ga0207650_10029226 | Ga0207650_100292263 | 163 |
| 356 | 3300025925 | Ga0207650_10556141 | Ga0207650_105561412 | 163 |
| 357 | 3300025925 | Ga0207650_10619383 | Ga0207650_106193831 | 163 |
| 358 | 3300025926 | Ga0207659_10438798 | Ga0207659_104387981 | 163 |
| 359 | 3300025927 | Ga0207687_10000765 | Ga0207687_100007653 | 163 |
| 360 | 3300025927 | Ga0207687_10049999 | Ga0207687_100499992 | 163 |
| 361 | 3300025927 | Ga0207687_10520265 | Ga0207687_105202652 | 163 |
| 362 | 3300025931 | Ga0207644_10835172 | Ga0207644_108351722 | 163 |
| 363 | 3300025932 | Ga0207690_10001390 | Ga0207690_100013907 | 163 |
| 364 | 3300025934 | Ga0207686_10047887 | Ga0207686_100478872 | 163 |
| 365 | 3300025935 | Ga0207709_10019847 | Ga0207709_100198475 | 163 |
| 366 | 3300025936 | Ga0207670_10001484 | Ga0207670_100014848 | 163 |
| 367 | 3300025936 | Ga0207670_10017283 | Ga0207670_100172833 | 163 |
| 368 | 3300025940 | Ga0207691_10002812 | Ga0207691_100028124 | 163 |
| 369 | 3300025940 | Ga0207691_10998772 | Ga0207691_109987721 | 163 |
| 370 | 3300025941 | Ga0207711_10434225 | Ga0207711_104342252 | 163 |
| 371 | 3300025942 | Ga0207689_10445389 | Ga0207689_104453892 | 163 |
| 372 | 3300025942 | Ga0207689_10759026 | Ga0207689_107590262 | 163 |
| 373 | 3300025944 | Ga0207661_10214016 | Ga0207661_102140163 | 163 |
| 374 | 3300025944 | Ga0207661_10227440 | Ga0207661_102274403 | 163 |
| 375 | 3300025960 | Ga0207651_10518637 | Ga0207651_105186372 | 163 |
| 376 | 3300025981 | Ga0207640_10291547 | Ga0207640_102915472 | 163 |
| 377 | 3300026023 | Ga0207677_10000071 | Ga0207677_1000007165 | 163 |
| 378 | 3300026035 | Ga0207703_10000022 | Ga0207703_10000022189 | 163 |
| 379 | 3300026035 | Ga0207703_10089622 | Ga0207703_100896224 | 163 |
| 380 | 3300026035 | Ga0207703_10383991 | Ga0207703_103839911 | 163 |
| 381 | 3300026041 | Ga0207639_10365682 | Ga0207639_103656823 | 163 |
| 382 | 3300026075 | Ga0207708_10183271 | Ga0207708_101832712 | 163 |
| 383 | 3300026088 | Ga0207641_10019185 | Ga0207641_100191853 | 163 |
| 384 | 3300026089 | Ga0207648_10101772 | Ga0207648_101017722 | 163 |
| 385 | 3300026095 | Ga0207676_10000033 | Ga0207676_10000033175 | 163 |
| 386 | 3300026095 | Ga0207676_10000852 | Ga0207676_100008526 | 163 |
| 387 | 3300026116 | Ga0207674_10054611 | Ga0207674_100546113 | 163 |
| 388 | 3300027907 | Ga0207428_10000031 | Ga0207428_1000003170 | 163 |
| 389 | 3300028381 | Ga0268264_10024494 | Ga0268264_100244945 | 163 |
| 390 | 3300028558 | Ga0265326_10000279 | Ga0265326_100002792 | 163 |
| 391 | 3300028654 | Ga0265322_10000003 | Ga0265322_1000000328 | 163 |
| 392 | 3300028666 | Ga0265336_10029974 | Ga0265336_100299742 | 163 |
| 393 | 3300029957 | Ga0265324_10000375 | Ga0265324_1000037517 | 163 |
| 394 | 3300031240 | Ga0265320_10000001 | Ga0265320_1000000128 | 163 |
| 395 | 3300031242 | Ga0265329_10023546 | Ga0265329_100235463 | 163 |
| 396 | 3300031250 | Ga0265331_10007540 | Ga0265331_100075406 | 163 |
| 397 | 3300031251 | Ga0265327_10000003 | Ga0265327_1000000328 | 163 |
| 398 | 3300031548 | Ga0307408_100010949 | Ga0307408_1000109494 | 163 |
| 399 | 3300031711 | Ga0265314_10000585 | Ga0265314_1000058528 | 163 |
| 400 | 3300031731 | Ga0307405_10137293 | Ga0307405_101372933 | 163 |
| 401 | 3300031901 | Ga0307406_10038862 | Ga0307406_100388623 | 163 |
| 402 | 3300031911 | Ga0307412_10016574 | Ga0307412_100165746 | 163 |
| 403 | 3300031995 | Ga0307409_100436094 | Ga0307409_1004360942 | 163 |
| 404 | 3300032002 | Ga0307416_100102933 | Ga0307416_1001029333 | 163 |
| 405 | 3300032004 | Ga0307414_10016097 | Ga0307414_100160976 | 163 |
| 406 | 3300032004 | Ga0307414_10511725 | Ga0307414_105117251 | 163 |
| 407 | 3300032126 | Ga0307415_100029978 | Ga0307415_1000299782 | 163 |
| 408 | 3300035116 | Ga0373945_0327152 | Ga0373945_0327152_79_576 | 163 |
| 409 | 3300035695 | Ga0373927_0293533 | Ga0373927_0293533_287_784 | 163 |
| 410 | 3300035725 | Ga0373947_0604516 | Ga0373947_0604516_128_625 | 163 |
| 411 | 3300037068 | Ga0373925_0338071 | Ga0373925_0338071_284_781 | 163 |
| 412 | 3300039437 | Ga0436365_0182192 | Ga0436365_0182192_2261_2761 | 163 |
| 413 | 3300039437 | Ga0436365_0478136 | Ga0436365_0478136_1548_2048 | 163 |
| 414 | 3300039450 | Ga0436363_1606136 | Ga0436363_1606136_82_600 | 163 |
| 415 | 3300039453 | Ga0436362_0092156 | Ga0436362_0092156_233_733 | 163 |
| 416 | 3300042012 | Ga0439455_0000820 | Ga0439455_0000820_2483_3001 | 163 |
| 417 | 3300042127 | Ga0450890_019455 | Ga0450890_019455_227_745 | 163 |
| 418 | 3300042144 | Ga0450889_007697 | Ga0450889_007697_479_997 | 163 |
| 419 | 3300042157 | Ga0439458_0003285 | Ga0439458_0003285_972_1490 | 163 |
| 420 | 3300046472 | Ga0495580_0023793 | Ga0495580_0023793_890_1387 | 163 |
| 421 | 3300046473 | Ga0495582_0099570 | Ga0495582_0099570_138_635 | 163 |
| 422 | 3300046499 | Ga0495594_0069466 | Ga0495594_0069466_832_1329 | 163 |
| 423 | 3300046519 | Ga0495632_0048084 | Ga0495632_0048084_1518_2018 | 163 |
| 424 | 3300046531 | Ga0495665_0255190 | Ga0495665_0255190_92_589 | 163 |
| 425 | 3300046537 | Ga0495598_0000137 | Ga0495598_0000137_8107_8628 | 163 |
| 426 | 3300046539 | Ga0495621_0001775 | Ga0495621_0001775_1208_1729 | 163 |
| 427 | 3300046689 | Ga0495613_0348640 | Ga0495613_0348640_445_942 | 163 |
| 428 | 3300046690 | Ga0495624_0068120 | Ga0495624_0068120_1402_1899 | 163 |
| 429 | 3300048918 | Ga0496115_0016640 | Ga0496115_0016640_133_624 | 163 |
| 430 | 3300049127 | Ga0501306_007133 | Ga0501306_007133_23_541 | 163 |
| 431 | 3300049128 | Ga0501308_000861 | Ga0501308_000861_893_1411 | 163 |
| 432 | 3300049128 | Ga0501308_003075 | Ga0501308_003075_790_1308 | 163 |
| 433 | 3300049129 | Ga0501309_004240 | Ga0501309_004240_847_1365 | 163 |
| 434 | 3300049129 | Ga0501309_007703 | Ga0501309_007703_798_1316 | 163 |
| 435 | 3300049130 | Ga0501310_013464 | Ga0501310_013464_307_825 | 163 |
| 436 | 3300049160 | Ga0501304_000321 | Ga0501304_000321_794_1312 | 163 |
| 437 | 3300049161 | Ga0501305_001491 | Ga0501305_001491_991_1509 | 163 |
| 438 | 3300049161 | Ga0501305_004817 | Ga0501305_004817_781_1299 | 163 |
| 439 | 3300049162 | Ga0501307_000885 | Ga0501307_000885_995_1513 | 163 |
| 440 | 3300049162 | Ga0501307_002106 | Ga0501307_002106_500_1018 | 163 |
| 441 | 3300049515 | Ga0501292_003714 | Ga0501292_003714_682_1200 | 163 |
| 442 | 3300049516 | Ga0501293_019648 | Ga0501293_019648_31_549 | 163 |
| 443 | 3300049527 | Ga0501311_001638 | Ga0501311_001638_786_1304 | 163 |
| 444 | 3300049528 | Ga0501312_004054 | Ga0501312_004054_395_913 | 163 |
| 445 | 3300049534 | Ga0501318_009200 | Ga0501318_009200_436_954 | 163 |
| 446 | 3300049536 | Ga0501320_000512 | Ga0501320_000512_996_1514 | 163 |
| 447 | 3300049537 | Ga0501321_000594 | Ga0501321_000594_796_1314 | 163 |
| 448 | 3300049537 | Ga0501321_002776 | Ga0501321_002776_790_1308 | 163 |
| 449 | 3300049538 | Ga0501322_000709 | Ga0501322_000709_360_878 | 163 |
| 450 | 3300049539 | Ga0501323_002531 | Ga0501323_002531_471_989 | 163 |
| 451 | 3300049539 | Ga0501323_003469 | Ga0501323_003469_311_829 | 163 |
| 452 | 3300049540 | Ga0501324_000391 | Ga0501324_000391_794_1312 | 163 |
| 453 | 3300049540 | Ga0501324_006008 | Ga0501324_006008_439_957 | 163 |
| 454 | 3300049545 | Ga0501329_00622 | Ga0501329_00622_785_1303 | 163 |
| 455 | 3300049649 | Ga0501198_002341 | Ga0501198_002341_996_1514 | 163 |
| 456 | 3300049652 | Ga0501202_003871 | Ga0501202_003871_379_897 | 163 |
| 457 | 3300049653 | Ga0501206_007712 | Ga0501206_007712_288_806 | 163 |
| 458 | 3300049654 | Ga0501207_000161 | Ga0501207_000161_378_896 | 163 |
| 459 | 3300049656 | Ga0501209_007709 | Ga0501209_007709_297_815 | 163 |
| 460 | 3300049660 | Ga0501216_000468 | Ga0501216_000468_4005_4523 | 163 |
| 461 | 3300049661 | Ga0501217_010161 | Ga0501217_010161_985_1503 | 163 |
| 462 | 3300049664 | Ga0501224_001416 | Ga0501224_001416_687_1205 | 163 |
| 463 | 3300049665 | Ga0501227_006456 | Ga0501227_006456_1019_1537 | 163 |
| 464 | 3300049668 | Ga0501233_002196 | Ga0501233_002196_1790_2308 | 163 |
| 465 | 3300049679 | Ga0501249_009938 | Ga0501249_009938_378_896 | 163 |
| 466 | 3300049704 | Ga0501221_045565 | Ga0501221_045565_37_555 | 163 |
| 467 | 3300049705 | Ga0501225_0002871 | Ga0501225_0002871_1099_1617 | 163 |
| 468 | 3300049707 | Ga0501234_000070 | Ga0501234_000070_521_1039 | 163 |
| 469 | 3300049769 | Ga0501272_020708 | Ga0501272_020708_93_611 | 163 |
| 470 | 3300049853 | Ga0501226_002550 | Ga0501226_002550_837_1355 | 163 |
| 471 | 3300050492 | nmdc:mga0yw44_135300_c1 | nmdc:mga0yw44_135300_c1_222_719 | 163 |
| 472 | 3300050511 | nmdc:mga08y16_22_c1 | nmdc:mga08y16_22_c1_105657_106157 | 163 |
| 473 | 3300050512 | nmdc:mga0n895_1196188_c1 | nmdc:mga0n895_1196188_c1_96_614 | 163 |
| 474 | 3300050512 | nmdc:mga0n895_261745_c1 | nmdc:mga0n895_261745_c1_565_1065 | 163 |
| 475 | 3300050515 | nmdc:mga0a205_94943_c1 | nmdc:mga0a205_94943_c1_1991_2482 | 163 |
| 476 | 3300053139 | Ga0500568_0011991 | Ga0500568_0011991_3345_3881 | 163 |
| 477 | 3300059477 | Ga0587084_016336 | Ga0587084_016336_515_1033 | 163 |
| 478 | 3300059490 | Ga0587066_013619 | Ga0587066_013619_211_729 | 163 |
| 479 | 3300059491 | Ga0587070_007002 | Ga0587070_007002_812_1330 | 163 |
| 480 | 3300059491 | Ga0587070_096986 | Ga0587070_096986_131_631 | 163 |
| 481 | 3300059506 | Ga0587085_002150 | Ga0587085_002150_449_967 | 163 |
| 482 | 3300059512 | Ga0587092_001585 | Ga0587092_001585_809_1327 | 163 |
| 483 | 3300059623 | Ga0587101_017008 | Ga0587101_017008_369_887 | 163 |
| 484 | 3300059624 | Ga0587109_105073 | Ga0587109_105073_119_625 | 163 |
| 485 | 3300059627 | Ga0587117_007307 | Ga0587117_007307_93_599 | 163 |
| 486 | 3300059641 | Ga0587068_039119 | Ga0587068_039119_276_794 | 163 |
| 487 | 3300059643 | Ga0587072_012699 | Ga0587072_012699_818_1318 | 163 |
| 488 | 3300060344 | Ga0587071_048764 | Ga0587071_048764_207_725 | 163 |
| 489 | 3300060346 | Ga0587111_0009384 | Ga0587111_0009384_812_1330 | 163 |
| 490 | 3300000531 | CNBas_1000168 | CNBas_10001683 | 164 |
| 491 | 3300003791 | Ga0055530_10017439 | Ga0055530_100174394 | 164 |
| 492 | 3300005331 | Ga0070670_100032782 | Ga0070670_1000327825 | 164 |
| 493 | 3300005331 | Ga0070670_101036824 | Ga0070670_1010368241 | 164 |
| 494 | 3300005334 | Ga0068869_100385625 | Ga0068869_1003856252 | 164 |
| 495 | 3300005337 | Ga0070682_100003873 | Ga0070682_1000038735 | 164 |
| 496 | 3300005340 | Ga0070689_100000856 | Ga0070689_1000008563 | 164 |
| 497 | 3300005345 | Ga0070692_10005032 | Ga0070692_100050324 | 164 |
| 498 | 3300005365 | Ga0070688_100575924 | Ga0070688_1005759242 | 164 |
| 499 | 3300005406 | Ga0070703_10008816 | Ga0070703_100088161 | 164 |
| 500 | 3300005434 | Ga0070709_10112916 | Ga0070709_101129161 | 164 |
| 501 | 3300005438 | Ga0070701_10000892 | Ga0070701_100008922 | 164 |
| 502 | 3300005438 | Ga0070701_10306468 | Ga0070701_103064682 | 164 |
| 503 | 3300005438 | Ga0070701_10818007 | Ga0070701_108180071 | 164 |
| 504 | 3300005440 | Ga0070705_100012212 | Ga0070705_1000122124 | 164 |
| 505 | 3300005441 | Ga0070700_100026017 | Ga0070700_1000260172 | 164 |
| 506 | 3300005441 | Ga0070700_100535114 | Ga0070700_1005351142 | 164 |
| 507 | 3300005444 | Ga0070694_100001863 | Ga0070694_10000186310 | 164 |
| 508 | 3300005471 | Ga0070698_100002248 | Ga0070698_1000022485 | 164 |
| 509 | 3300005471 | Ga0070698_100861509 | Ga0070698_1008615091 | 164 |
| 510 | 3300005518 | Ga0070699_100844890 | Ga0070699_1008448901 | 164 |
| 511 | 3300005544 | Ga0070686_100000004 | Ga0070686_100000004157 | 164 |
| 512 | 3300005546 | Ga0070696_100033027 | Ga0070696_1000330274 | 164 |
| 513 | 3300005547 | Ga0070693_100004428 | Ga0070693_1000044285 | 164 |
| 514 | 3300005549 | Ga0070704_100046762 | Ga0070704_1000467625 | 164 |
| 515 | 3300005577 | Ga0068857_100602767 | Ga0068857_1006027672 | 164 |
| 516 | 3300005615 | Ga0070702_100066019 | Ga0070702_1000660194 | 164 |
| 517 | 3300005616 | Ga0068852_100049225 | Ga0068852_1000492255 | 164 |
| 518 | 3300005616 | Ga0068852_100698599 | Ga0068852_1006985992 | 164 |
| 519 | 3300005617 | Ga0068859_100057777 | Ga0068859_1000577773 | 164 |
| 520 | 3300005617 | Ga0068859_100094382 | Ga0068859_1000943825 | 164 |
| 521 | 3300005618 | Ga0068864_101171815 | Ga0068864_1011718151 | 164 |
| 522 | 3300005834 | Ga0068851_10004808 | Ga0068851_100048086 | 164 |
| 523 | 3300005840 | Ga0068870_10021667 | Ga0068870_100216676 | 164 |
| 524 | 3300005841 | Ga0068863_100006096 | Ga0068863_1000060968 | 164 |
| 525 | 3300005841 | Ga0068863_100096346 | Ga0068863_1000963463 | 164 |
| 526 | 3300005842 | Ga0068858_100032748 | Ga0068858_1000327485 | 164 |
| 527 | 3300005843 | Ga0068860_101437248 | Ga0068860_1014372482 | 164 |
| 528 | 3300006237 | Ga0097621_100160018 | Ga0097621_1001600182 | 164 |
| 529 | 3300006871 | Ga0075434_100598563 | Ga0075434_1005985632 | 164 |
| 530 | 3300006931 | Ga0097620_100057780 | Ga0097620_1000577804 | 164 |
| 531 | 3300006931 | Ga0097620_100094381 | Ga0097620_1000943815 | 164 |
| 532 | 3300009093 | Ga0105240_10052562 | Ga0105240_100525625 | 164 |
| 533 | 3300009147 | Ga0114129_10827450 | Ga0114129_108274502 | 164 |
| 534 | 3300009148 | Ga0105243_11642155 | Ga0105243_116421551 | 164 |
| 535 | 3300009174 | Ga0105241_10113753 | Ga0105241_101137532 | 164 |
| 536 | 3300009545 | Ga0105237_10005382 | Ga0105237_100053827 | 164 |
| 537 | 3300013104 | Ga0157370_10144764 | Ga0157370_101447642 | 164 |
| 538 | 3300013307 | Ga0157372_10005077 | Ga0157372_100050775 | 164 |
| 539 | 3300014325 | Ga0163163_10786983 | Ga0163163_107869832 | 164 |
| 540 | 3300014745 | Ga0157377_10000049 | Ga0157377_1000004973 | 164 |
| 541 | 3300021388 | Ga0213875_10109519 | Ga0213875_101095192 | 164 |
| 542 | 3300025263 | Ga0209565_1000211 | Ga0209565_100021128 | 164 |
| 543 | 3300025297 | Ga0209758_1026295 | Ga0209758_10262952 | 164 |
| 544 | 3300025298 | Ga0209050_1000538 | Ga0209050_100053849 | 164 |
| 545 | 3300025298 | Ga0209050_1008420 | Ga0209050_10084202 | 164 |
| 546 | 3300025321 | Ga0207656_10002644 | Ga0207656_100026446 | 164 |
| 547 | 3300025885 | Ga0207653_10009230 | Ga0207653_100092305 | 164 |
| 548 | 3300025908 | Ga0207643_10033692 | Ga0207643_100336925 | 164 |
| 549 | 3300025911 | Ga0207654_10112047 | Ga0207654_101120472 | 164 |
| 550 | 3300025914 | Ga0207671_10004857 | Ga0207671_100048579 | 164 |
| 551 | 3300025918 | Ga0207662_10072505 | Ga0207662_100725051 | 164 |
| 552 | 3300025925 | Ga0207650_10493203 | Ga0207650_104932031 | 164 |
| 553 | 3300025925 | Ga0207650_10832887 | Ga0207650_108328871 | 164 |
| 554 | 3300025925 | Ga0207650_11066932 | Ga0207650_110669321 | 164 |
| 555 | 3300025932 | Ga0207690_10427288 | Ga0207690_104272882 | 164 |
| 556 | 3300025936 | Ga0207670_10000357 | Ga0207670_1000035719 | 164 |
| 557 | 3300025938 | Ga0207704_10679015 | Ga0207704_106790152 | 164 |
| 558 | 3300025941 | Ga0207711_10783608 | Ga0207711_107836081 | 164 |
| 559 | 3300025960 | Ga0207651_11002956 | Ga0207651_110029562 | 164 |
| 560 | 3300026035 | Ga0207703_10092434 | Ga0207703_100924343 | 164 |
| 561 | 3300026088 | Ga0207641_10040000 | Ga0207641_100400006 | 164 |
| 562 | 3300026088 | Ga0207641_10210657 | Ga0207641_102106571 | 164 |
| 563 | 3300026095 | Ga0207676_10958630 | Ga0207676_109586301 | 164 |
| 564 | 3300026116 | Ga0207674_10044238 | Ga0207674_100442382 | 164 |
| 565 | 3300026116 | Ga0207674_10209767 | Ga0207674_102097672 | 164 |
| 566 | 3300026116 | Ga0207674_10462552 | Ga0207674_104625522 | 164 |
| 567 | 3300026142 | Ga0207698_10184104 | Ga0207698_101841042 | 164 |
| 568 | 3300028556 | Ga0265337_1042295 | Ga0265337_10422952 | 164 |
| 569 | 3300028558 | Ga0265326_10009337 | Ga0265326_100093372 | 164 |
| 570 | 3300028563 | Ga0265319_1004890 | Ga0265319_10048902 | 164 |
| 571 | 3300028573 | Ga0265334_10006775 | Ga0265334_100067755 | 164 |
| 572 | 3300028577 | Ga0265318_10006831 | Ga0265318_100068313 | 164 |
| 573 | 3300028800 | Ga0265338_10020907 | Ga0265338_100209076 | 164 |
| 574 | 3300029957 | Ga0265324_10036100 | Ga0265324_100361002 | 164 |
| 575 | 3300031238 | Ga0265332_10025668 | Ga0265332_100256682 | 164 |
| 576 | 3300031240 | Ga0265320_10016615 | Ga0265320_100166152 | 164 |
| 577 | 3300031241 | Ga0265325_10009611 | Ga0265325_100096116 | 164 |
| 578 | 3300031247 | Ga0265340_10004710 | Ga0265340_100047108 | 164 |
| 579 | 3300031249 | Ga0265339_10067971 | Ga0265339_100679713 | 164 |
| 580 | 3300031344 | Ga0265316_10040599 | Ga0265316_100405993 | 164 |
| 581 | 3300031595 | Ga0265313_10070499 | Ga0265313_100704993 | 164 |
| 582 | 3300031711 | Ga0265314_10021751 | Ga0265314_100217516 | 164 |
| 583 | 3300031712 | Ga0265342_10020889 | Ga0265342_100208892 | 164 |
| 584 | 3300031731 | Ga0307405_10493685 | Ga0307405_104936851 | 164 |
| 585 | 3300032126 | Ga0307415_100241306 | Ga0307415_1002413061 | 164 |
| 586 | 3300037418 | Ga0395900_0334906 | Ga0395900_0334906_378_881 | 164 |
| 587 | 3300037471 | Ga0395905_0003836 | Ga0395905_0003836_4323_4826 | 164 |
| 588 | 3300037853 | Ga0436364_0698855 | Ga0436364_0698855_1574_2083 | 164 |
| 589 | 3300038443 | Ga0395901_0377352 | Ga0395901_0377352_697_1200 | 164 |
| 590 | 3300038996 | Ga0242420_014836 | Ga0242420_014836_403_903 | 164 |
| 591 | 3300044712 | Ga0453684_0920484 | Ga0453684_0920484_422_925 | 164 |
| 592 | 3300044842 | Ga0466957_0265945 | Ga0466957_0265945_636_1130 | 164 |
| 593 | 3300046472 | Ga0495580_0022765 | Ga0495580_0022765_1148_1657 | 164 |
| 594 | 3300049663 | Ga0501223_050023 | Ga0501223_050023_133_636 | 164 |
| 595 | 3300049686 | Ga0501257_047174 | Ga0501257_047174_366_869 | 164 |
| 596 | 3300049775 | Ga0501279_096903 | Ga0501279_096903_13_516 | 164 |
| 597 | 3300050512 | nmdc:mga0n895_27393_c1 | nmdc:mga0n895_27393_c1_4707_5207 | 164 |
| 598 | 3300059477 | Ga0587084_011814 | Ga0587084_011814_38_562 | 164 |
| 599 | 3300059477 | Ga0587084_027395 | Ga0587084_027395_114_614 | 164 |
| 600 | 3300059493 | Ga0587077_015975 | Ga0587077_015975_300_794 | 164 |
| 601 | 3300059493 | Ga0587077_060150 | Ga0587077_060150_252_776 | 164 |
| 602 | 3300059507 | Ga0587086_004272 | Ga0587086_004272_659_1153 | 164 |
| 603 | 3300059511 | Ga0587091_016189 | Ga0587091_016189_440_934 | 164 |
| 604 | 3300059512 | Ga0587092_006074 | Ga0587092_006074_367_861 | 164 |
| 605 | 3300059624 | Ga0587109_041391 | Ga0587109_041391_327_851 | 164 |
| 606 | 3300059639 | Ga0587062_041930 | Ga0587062_041930_106_630 | 164 |
| 607 | 3300059645 | Ga0587076_011628 | Ga0587076_011628_146_640 | 164 |
| 608 | 3300059647 | Ga0587079_091941 | Ga0587079_091941_36_560 | 164 |
| 609 | 3300060346 | Ga0587111_0007287 | Ga0587111_0007287_836_1330 | 164 |
| 610 | 3300060346 | Ga0587111_0060396 | Ga0587111_0060396_156_680 | 164 |
| 611 | 3300000041 | ARcpr5oldR_c000925 | ARcpr5oldR_0009255 | 165 |
| 612 | 3300000043 | ARcpr5yngRDRAFT_c000985 | ARcpr5yngRDRAFT_0009855 | 165 |
| 613 | 3300002077 | JGI24744J21845_10049109 | JGI24744J21845_100491092 | 165 |
| 614 | 3300003215 | JGI25153J46596_10001499 | JGI25153J46596_100014996 | 165 |
| 615 | 3300003773 | Ga0055537_1006944 | Ga0055537_10069442 | 165 |
| 616 | 3300003775 | Ga0055524_1001084 | Ga0055524_100108421 | 165 |
| 617 | 3300003781 | Ga0055536_1003626 | Ga0055536_10036266 | 165 |
| 618 | 3300003794 | Ga0055531_10004463 | Ga0055531_100044636 | 165 |
| 619 | 3300005262 | Ga0065165_1000123 | Ga0065165_100012314 | 165 |
| 620 | 3300005262 | Ga0065165_1013696 | Ga0065165_10136966 | 165 |
| 621 | 3300005289 | Ga0065704_10073218 | Ga0065704_100732181 | 165 |
| 622 | 3300005289 | Ga0065704_10171087 | Ga0065704_101710872 | 165 |
| 623 | 3300005334 | Ga0068869_100249855 | Ga0068869_1002498552 | 165 |
| 624 | 3300005459 | Ga0068867_100496365 | Ga0068867_1004963652 | 165 |
| 625 | 3300005578 | Ga0068854_100052893 | Ga0068854_1000528932 | 165 |
| 626 | 3300006880 | Ga0075429_100067193 | Ga0075429_1000671932 | 165 |
| 627 | 3300009092 | Ga0105250_10035176 | Ga0105250_100351762 | 165 |
| 628 | 3300009553 | Ga0105249_11037381 | Ga0105249_110373811 | 165 |
| 629 | 3300013102 | Ga0157371_10010081 | Ga0157371_100100816 | 165 |
| 630 | 3300013104 | Ga0157370_10012604 | Ga0157370_100126043 | 165 |
| 631 | 3300013105 | Ga0157369_10020731 | Ga0157369_100207316 | 165 |
| 632 | 3300014326 | Ga0157380_10202352 | Ga0157380_102023522 | 165 |
| 633 | 3300015261 | Ga0182006_1037975 | Ga0182006_10379752 | 165 |
| 634 | 3300021358 | Ga0213873_10068213 | Ga0213873_100682132 | 165 |
| 635 | 3300021384 | Ga0213876_10000188 | Ga0213876_1000018846 | 165 |
| 636 | 3300025208 | Ga0209436_112705 | Ga0209436_1127051 | 165 |
| 637 | 3300025245 | Ga0207425_1014226 | Ga0207425_10142263 | 165 |
| 638 | 3300025263 | Ga0209565_1000011 | Ga0209565_1000011237 | 165 |
| 639 | 3300025273 | Ga0209673_1002226 | Ga0209673_100222611 | 165 |
| 640 | 3300025291 | Ga0209675_1026657 | Ga0209675_10266573 | 165 |
| 641 | 3300025295 | Ga0209564_1027393 | Ga0209564_10273933 | 165 |
| 642 | 3300025297 | Ga0209758_1012613 | Ga0209758_10126139 | 165 |
| 643 | 3300025298 | Ga0209050_1010125 | Ga0209050_10101253 | 165 |
| 644 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016362 | 165 |
| 645 | 3300025304 | Ga0209257_1002046 | Ga0209257_100204619 | 165 |
| 646 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000012820 | 165 |
| 647 | 3300025936 | Ga0207670_10192568 | Ga0207670_101925681 | 165 |
| 648 | 3300025981 | Ga0207640_10040150 | Ga0207640_100401504 | 165 |
| 649 | 3300026089 | Ga0207648_10526459 | Ga0207648_105264592 | 165 |
| 650 | 3300031456 | Ga0307513_10014167 | Ga0307513_100141676 | 165 |
| 651 | 3300031456 | Ga0307513_10445639 | Ga0307513_104456392 | 165 |
| 652 | 3300032004 | Ga0307414_10366889 | Ga0307414_103668891 | 165 |
| 653 | 3300033180 | Ga0307510_10041591 | Ga0307510_100415912 | 165 |
| 654 | 3300038699 | Ga0242422_04911 | Ga0242422_04911_296_796 | 165 |
| 655 | 3300046684 | Ga0495669_0031397 | Ga0495669_0031397_555_1061 | 165 |
| 656 | 3300046691 | Ga0495670_0005553 | Ga0495670_0005553_4568_5077 | 165 |
| 657 | 3300048927 | Ga0496124_0007663 | Ga0496124_0007663_5057_5566 | 165 |
| 658 | 3300048928 | Ga0496125_0001113 | Ga0496125_0001113_33727_34236 | 165 |
| 659 | 3300050508 | nmdc:mga09592_91186_c1 | nmdc:mga09592_91186_c1_1124_1642 | 165 |
| 660 | 3300053096 | Ga0500641_0000580 | Ga0500641_0000580_2714_3223 | 165 |
| 661 | 3300053118 | Ga0500594_0033618 | Ga0500594_0033618_367_876 | 165 |
| 662 | 3300005444 | Ga0070694_100068348 | Ga0070694_1000683481 | 166 |
| 663 | 3300005467 | Ga0070706_100155909 | Ga0070706_1001559092 | 166 |
| 664 | 3300005471 | Ga0070698_100013256 | Ga0070698_1000132565 | 166 |
| 665 | 3300005536 | Ga0070697_100495478 | Ga0070697_1004954782 | 166 |
| 666 | 3300005547 | Ga0070693_100079001 | Ga0070693_1000790012 | 166 |
| 667 | 3300005547 | Ga0070693_100294963 | Ga0070693_1002949632 | 166 |
| 668 | 3300005549 | Ga0070704_100505038 | Ga0070704_1005050382 | 166 |
| 669 | 3300005563 | Ga0068855_100350232 | Ga0068855_1003502323 | 166 |
| 670 | 3300005617 | Ga0068859_100000577 | Ga0068859_1000005777 | 166 |
| 671 | 3300005719 | Ga0068861_100006823 | Ga0068861_1000068234 | 166 |
| 672 | 3300006358 | Ga0068871_100175510 | Ga0068871_1001755103 | 166 |
| 673 | 3300006852 | Ga0075433_10187512 | Ga0075433_101875121 | 166 |
| 674 | 3300006871 | Ga0075434_100090267 | Ga0075434_1000902674 | 166 |
| 675 | 3300006931 | Ga0097620_100000577 | Ga0097620_1000005777 | 166 |
| 676 | 3300009101 | Ga0105247_10160309 | Ga0105247_101603092 | 166 |
| 677 | 3300009177 | Ga0105248_10248597 | Ga0105248_102485973 | 166 |
| 678 | 3300013306 | Ga0163162_10008008 | Ga0163162_1000800810 | 166 |
| 679 | 3300014969 | Ga0157376_10754001 | Ga0157376_107540011 | 166 |
| 680 | 3300025923 | Ga0207681_10327611 | Ga0207681_103276112 | 166 |
| 681 | 3300025941 | Ga0207711_10370524 | Ga0207711_103705242 | 166 |
| 682 | 3300025949 | Ga0207667_10314179 | Ga0207667_103141793 | 166 |
| 683 | 3300026118 | Ga0207675_100012847 | Ga0207675_1000128475 | 166 |
| 684 | 3300031456 | Ga0307513_10674089 | Ga0307513_106740892 | 166 |
| 685 | 3300035119 | Ga0373956_0053579 | Ga0373956_0053579_21_521 | 166 |
| 686 | 3300035120 | Ga0373957_0049865 | Ga0373957_0049865_825_1325 | 166 |
| 687 | 3300035410 | Ga0373924_0251458 | Ga0373924_0251458_90_590 | 166 |
| 688 | 3300042532 | Ga0450893_0023295 | Ga0450893_0023295_154_696 | 166 |
| 689 | 3300048915 | Ga0496112_0367070 | Ga0496112_0367070_742_1275 | 166 |
| 690 | 3300050507 | nmdc:mga05p37_425333_c1 | nmdc:mga05p37_425333_c1_830_1363 | 166 |
| 691 | 3300050512 | nmdc:mga0n895_1495086_c1 | nmdc:mga0n895_1495086_c1_61_594 | 166 |
| 692 | 3300050512 | nmdc:mga0n895_88456_c1 | nmdc:mga0n895_88456_c1_1774_2307 | 166 |
| 693 | 3300050515 | nmdc:mga0a205_80661_c1 | nmdc:mga0a205_80661_c1_1195_1728 | 166 |
| 694 | 3300005434 | Ga0070709_10497876 | Ga0070709_104978762 | 167 |
| 695 | 3300005455 | Ga0070663_100928215 | Ga0070663_1009282151 | 167 |
| 696 | 3300005457 | Ga0070662_100243523 | Ga0070662_1002435232 | 167 |
| 697 | 3300005539 | Ga0068853_100980465 | Ga0068853_1009804652 | 167 |
| 698 | 3300006051 | Ga0075364_10054039 | Ga0075364_100540392 | 167 |
| 699 | 3300013307 | Ga0157372_10609372 | Ga0157372_106093723 | 167 |
| 700 | 3300021388 | Ga0213875_10384453 | Ga0213875_103844531 | 167 |
| 701 | 3300025933 | Ga0207706_10476503 | Ga0207706_104765032 | 167 |
| 702 | 3300026067 | Ga0207678_10808273 | Ga0207678_108082731 | 167 |
| 703 | 3300035112 | Ga0373932_0005015 | Ga0373932_0005015_2199_2702 | 167 |
| 704 | 3300037853 | Ga0436364_0358665 | Ga0436364_0358665_184_690 | 167 |
| 705 | 3300042438 | Ga0439459_0084783 | Ga0439459_0084783_70_612 | 167 |
| 706 | 3300049742 | Ga0501080_0634296 | Ga0501080_0634296_36_578 | 167 |
| 707 | 3300050491 | nmdc:mga00v17_44324_c1 | nmdc:mga00v17_44324_c1_1339_1842 | 167 |
| 708 | 3300050492 | nmdc:mga0yw44_337611_c1 | nmdc:mga0yw44_337611_c1_209_712 | 167 |
| 709 | 3300053158 | Ga0500627_0054218 | Ga0500627_0054218_817_1356 | 167 |
| 710 | 3300004800 | Ga0058861_11548928 | Ga0058861_115489283 | 168 |
| 711 | 3300004803 | Ga0058862_12539277 | Ga0058862_125392771 | 168 |
| 712 | 3300005336 | Ga0070680_100000143 | Ga0070680_10000014336 | 168 |
| 713 | 3300005355 | Ga0070671_100860962 | Ga0070671_1008609622 | 168 |
| 714 | 3300005364 | Ga0070673_100383516 | Ga0070673_1003835162 | 168 |
| 715 | 3300005458 | Ga0070681_10000037 | Ga0070681_10000037110 | 168 |
| 716 | 3300005530 | Ga0070679_100018982 | Ga0070679_1000189824 | 168 |
| 717 | 3300009148 | Ga0105243_10175264 | Ga0105243_101752641 | 168 |
| 718 | 3300009176 | Ga0105242_11506489 | Ga0105242_115064891 | 168 |
| 719 | 3300010375 | Ga0105239_10079382 | Ga0105239_100793824 | 168 |
| 720 | 3300013105 | Ga0157369_10171963 | Ga0157369_101719632 | 168 |
| 721 | 3300013297 | Ga0157378_10053829 | Ga0157378_100538295 | 168 |
| 722 | 3300025912 | Ga0207707_10000011 | Ga0207707_10000011109 | 168 |
| 723 | 3300025917 | Ga0207660_10000289 | Ga0207660_1000028925 | 168 |
| 724 | 3300025921 | Ga0207652_10047761 | Ga0207652_100477617 | 168 |
| 725 | 3300025938 | Ga0207704_10007492 | Ga0207704_100074925 | 168 |
| 726 | 3300025960 | Ga0207651_10002277 | Ga0207651_100022779 | 168 |
| 727 | 3300038705 | Ga0237819_06714 | Ga0237819_06714_639_1181 | 168 |
| 728 | 3300046477 | Ga0495664_0596919 | Ga0495664_0596919_16_552 | 168 |
| 729 | 3300046516 | Ga0495628_0350732 | Ga0495628_0350732_308_844 | 168 |
| 730 | 3300046525 | Ga0495663_0276528 | Ga0495663_0276528_32_574 | 168 |
| 731 | 3300046543 | Ga0495645_0306741 | Ga0495645_0306741_24_560 | 168 |
| 732 | 3300046678 | Ga0495599_0082314 | Ga0495599_0082314_1070_1606 | 168 |
| 733 | 3300053090 | Ga0500646_0069647 | Ga0500646_0069647_216_758 | 168 |
| 734 | 3300005548 | Ga0070665_100000567 | Ga0070665_1000005674 | 169 |
| 735 | 3300028379 | Ga0268266_10001468 | Ga0268266_1000146824 | 169 |
| 736 | 3300031824 | Ga0307413_11024330 | Ga0307413_110243302 | 169 |
| 737 | 3300032004 | Ga0307414_10232706 | Ga0307414_102327062 | 169 |
| 738 | 3300032005 | Ga0307411_11064071 | Ga0307411_110640712 | 169 |
| 739 | 3300032004 | Ga0307414_10034118 | Ga0307414_100341181 | 170 |
| 740 | 3300032004 | Ga0307414_10121425 | Ga0307414_101214252 | 170 |
| 741 | 3300032004 | Ga0307414_10422722 | Ga0307414_104227222 | 170 |
| 742 | 3300032005 | Ga0307411_10124797 | Ga0307411_101247972 | 170 |
| 743 | 3300005467 | Ga0070706_100008941 | Ga0070706_1000089412 | 174 |
| 744 | 3300025910 | Ga0207684_10009442 | Ga0207684_100094421 | 174 |
| 745 | 3300045051 | Ga0451576_0645660 | Ga0451576_0645660_21_545 | 174 |
| 746 | 2162886012 | MBSR1b_contig_11776189 | MBSR1b_0475.00003160 | 175 |
| 747 | 3300005293 | Ga0065715_10135302 | Ga0065715_101353022 | 175 |
| 748 | 3300005334 | Ga0068869_100030697 | Ga0068869_1000306972 | 175 |
| 749 | 3300025942 | Ga0207689_10011030 | Ga0207689_100110304 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lye-assembly1.cif.gz_A-3 | re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues | 0.8204 | 6 | 59 |
| 5iv5-assembly1.cif.gz_O | cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex | 0.4339 | 6 | 167 |
| 5iv5-assembly1.cif.gz_O | cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex | 0.4058 | 6 | 167 |
| 2xgf-assembly1.cif.gz_C | structure of the bacteriophage t4 long tail fibre needle-shaped receptor-binding tip | 0.399 | 8 | 167 |
| 5hx2-assembly1.cif.gz_G | in vitro assembled star-shaped hubless t4 baseplate | 0.3945 | 5 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ocyA01 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.803 | 6 | 59 | 3.90.1340.10 |
| 1h6wA03 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.7533 | 10 | 59 | 3.90.1340.10 |
| 2xgfC01 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.7358 | 10 | 57 | 3.90.1340.10 |
| 1ocyA01 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.5899 | 6 | 59 | 3.90.1340.10 |
| 1h6wA03 | Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain | 0.5761 | 10 | 59 | 3.90.1340.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258GTC9-F1-model_v4 | Phage tail collar domain-containing protein | 0.9471 | 3 | 57 |
|
| AF-A0A537LTI6-F1-model_v4 | Phage tail collar domain-containing protein | 0.8055 | 1 | 72 |
|
| AF-A0A533TTP2-F1-model_v4 | Phage tail protein | 0.7885 | 3 | 74 |
|
| AF-A0A7Y9T2D4-F1-model_v4 | Microcystin-dependent protein | 0.7805 | 2 | 175 |
|
| AF-A0A7Y9T2D4-F1-model_v4 | Microcystin-dependent protein | 0.772 | 2 | 175 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar