F478154

General Info

Members Datasets Scaffolds Average Seq Length
734 455 1468 217

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000246|Ga0395899_0000246_49742_50464
Length 240
Sequence MSTVTSTTSGSPMSDLMATMNTQAASTAASPDDVQAQTNKFMTLLVTQLKNQDPMNPMDNAQITSQLAQLSTVTGVNKLNTTLDSLKASYQSSETLAATNLIGHGVLVEGGNVALQNGKGVLGVELASAADSVQVVITDPKTGKDVETIDLGSQKAGTVPLAWDGIPDANKLDSSGNPIKLADGNYNFRVVATRAGQQLTDAKGLAYDSVASVSTGGTDGVKINLGGKGAVALADIKQVL

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
194 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
195 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
196 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
197 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
198 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
199 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
200 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
227 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
232 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
233 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
234 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
235 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
236 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
237 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
238 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
345 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
346 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
350 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
351 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
352 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
353 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
365 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
369 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
370 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
371 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
372 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
376 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
377 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
378 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
379 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
382 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
383 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
384 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
385 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
386 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
389 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
390 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
391 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
392 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
393 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
394 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
395 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
396 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
397 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
398 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
399 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
400 2643221585 Pelomonas sp. Root662 Isolate Unclassified
401 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
402 2643221638 Duganella sp. Root336D2 Isolate Unclassified
403 2643221645 Massilia sp. Root351 Isolate Unclassified
404 2643221656 Pelomonas sp. Root405 Isolate Unclassified
405 2643221660 Methylibium sp. Root1272 Isolate Unclassified
406 2643221664 Massilia sp. Root418 Isolate Unclassified
407 2643221683 Variovorax sp. Root473 Isolate Unclassified
408 2738541277 Variovorax sp. GV051 Isolate Unclassified
409 2738541280 Massilia sp. GV090 Isolate Unclassified
410 2738541300 Massilia sp. GV016 Isolate Unclassified
411 2738541307 Variovorax sp. GV008 Isolate Unclassified
412 2738543013 Variovorax sp. BT01 Isolate Unclassified
413 2738543018 Massilia sp. GV045 Isolate Unclassified
414 2738543019 Variovorax sp. GV040 Isolate Unclassified
415 2738543030 Massilia sp. GV097 Isolate Unclassified
416 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
417 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
418 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
419 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
420 2818991436 Collimonas arenae 515 Isolate Unclassified
421 2818991446 Variovorax sp. 1180 Isolate Unclassified
422 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
423 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
424 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
425 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
426 2842677519 Variovorax sp. R-72495 Isolate Unclassified
427 2842733646 Variovorax sp. R-72446 Isolate Unclassified
428 2842747753 Variovorax sp. R-72060 Isolate Unclassified
429 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
430 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
431 2885198086 Variovorax sp. 679 Isolate Unclassified
432 2885211737 Variovorax sp. 553 Isolate Unclassified
433 2899924645 Variovorax sp. 369 Isolate Unclassified
434 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
435 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
436 2904456579 Variovorax sp. 2002 Isolate Unclassified
437 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
438 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
439 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
440 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
441 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
442 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
443 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
444 2928037797 Variovorax sp. 1126 Isolate Unclassified
445 2928044640 Variovorax sp. 1128 Isolate Unclassified
446 2928051484 Variovorax sp. 1133 Isolate Unclassified
447 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
448 2928070936 Variovorax gossypii 1167 Isolate Unclassified
449 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
450 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
451 2929520902 Variovorax beijingensis 502 Isolate Unclassified
452 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
453 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
454 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
455 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.19
Metatranscriptomes 0.82
Isolates 8.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.43
Nodule 0.68
Rhizoplane 2.32
Rhizosphere 59.81
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000246 3300037312 Bacteria 72297
2 JGI24740J21852_10005400 3300001979 Bacteria 5412
3 JGI24739J22299_10019327 3300001989 Bacteria 2439
4 JGI25155J39150_1000232 3300002704 Bacteria 21825
5 JGI25162J39368_1000139 3300002737 Bacteria 78439
6 JGI25162J39368_1006367 3300002737 Bacteria 2056
7 JGI25154J39366_1000167 3300002738 Bacteria 51347
8 JGI25158J39367_1001073 3300002739 Bacteria 4965
9 JGI25163J39215_1001578 3300002771 Bacteria 3464
10 JGI25150J39212_1001793 3300002774 Bacteria 5716
11 JGI25150J39212_1009982 3300002774 Bacteria 1785
12 JGI25150J39212_1013954 3300002774 Bacteria 1376
13 JGI25159J45721_1000435 3300002987 Bacteria 19303
14 JGI25159J45721_1001010 3300002987 Bacteria 12125
15 JGI25159J45721_1018601 3300002987 Bacteria 1396
16 Ga0006759J45824_1061774 3300003163 Bacteria 2780
17 JGI25151J46595_10002229 3300003187 Bacteria 11962
18 JGI25151J46595_10018492 3300003187 Bacteria 2989
19 JGI25165J46597_1000227 3300003214 Bacteria 78439
20 JGI25153J46596_10087795 3300003215 Bacteria 759
21 rootH1_10092562 3300003316 Bacteria 3638
22 rootH2_10011746 3300003320 Bacteria 2643
23 rootL2_10038684 3300003322 Bacteria 7153
24 rootH1_10022702 3300003323 Bacteria 3321
25 JGI26128J50194_1001453 3300003347 Bacteria 1507
26 JGI25160J50197_1000093 3300003354 Bacteria 89962
27 JGI25160J50197_1021743 3300003354 Bacteria 1896
28 JGI25160J50197_1040714 3300003354 Bacteria 1074
29 JGI25161J50226_1000443 3300003374 Bacteria 19496
30 JGI25161J50226_1000777 3300003374 Bacteria 12125
31 JGI25161J50226_1005267 3300003374 Bacteria 2538
32 Ga0007410J51695_1038845 3300003574 Bacteria 3771
33 Ga0007409J51694_1018424 3300003575 Bacteria 3742
34 Ga0032354_1047181 3300003693 Bacteria 3724
35 Ga0055538_1000002 3300003751 Bacteria 999437
36 Ga0055538_1000089 3300003751 Bacteria 78439
37 Ga0055539_1000002 3300003752 Bacteria 999437
38 Ga0055539_1000133 3300003752 Bacteria 78439
39 Ga0055533_1000004 3300003756 Bacteria 999437
40 Ga0055533_1000136 3300003756 Bacteria 78439
41 Ga0055525_1000002 3300003759 Bacteria 999437
42 Ga0055525_1000181 3300003759 Bacteria 78439
43 Ga0055535_1000128 3300003761 Bacteria 80324
44 Ga0055542_1000062 3300003762 Bacteria 161494
45 Ga0055526_1005872 3300003771 Bacteria 6884
46 Ga0055526_1030266 3300003771 Bacteria 1583
47 Ga0055537_1001084 3300003773 Bacteria 11962
48 Ga0055537_1005883 3300003773 Bacteria 3208
49 Ga0055537_1007440 3300003773 Bacteria 2639
50 Ga0055537_1012933 3300003773 Bacteria 1598
51 Ga0055537_1015602 3300003773 Bacteria 1324
52 Ga0055537_1017820 3300003773 Bacteria 1155
53 Ga0055524_1001380 3300003775 Bacteria 14047
54 Ga0055524_1023300 3300003775 Bacteria 1997
55 Ga0055536_1001927 3300003781 Bacteria 12006
56 Ga0055536_1008144 3300003781 Bacteria 4563
57 Ga0055534_1000948 3300003784 Bacteria 12920
58 Ga0055534_1001053 3300003784 Bacteria 11964
59 Ga0055534_1016169 3300003784 Bacteria 1345
60 Ga0055528_1001880 3300003790 Bacteria 11962
61 Ga0055528_1012891 3300003790 Bacteria 3208
62 Ga0055530_10001484 3300003791 Bacteria 17030
63 Ga0055530_10015131 3300003791 Bacteria 2538
64 Ga0055530_10019013 3300003791 Bacteria 2094
65 Ga0055530_10028949 3300003791 Bacteria 1488
66 Ga0055530_10033969 3300003791 Bacteria 1308
67 Ga0055530_10061243 3300003791 Bacteria 838
68 Ga0055540_1002723 3300003792 Bacteria 9092
69 Ga0055540_1004043 3300003792 Bacteria 6819
70 Ga0055531_10002613 3300003794 Bacteria 11930
71 Ga0055531_10002855 3300003794 Bacteria 11273
72 Ga0055531_10025190 3300003794 Bacteria 2169
73 Ga0055541_1000002 3300003841 Bacteria 896405
74 Ga0055541_1000088 3300003841 Bacteria 78439
75 Ga0055543_1001062 3300004625 Bacteria 12157
76 Ga0055543_1002173 3300004625 Bacteria 6747
77 Ga0055543_1028544 3300004625 Bacteria 982
78 Ga0055543_1035116 3300004625 Bacteria 862
79 Ga0065165_1002355 3300005262 Bacteria 16387
80 Ga0065165_1003150 3300005262 Bacteria 12163
81 Ga0065165_1003326 3300005262 Bacteria 11487
82 Ga0065165_1005438 3300005262 Bacteria 7159
83 Ga0065165_1010696 3300005262 Bacteria 3926
84 Ga0065165_1093270 3300005262 Bacteria 763
85 Ga0065165_1093295 3300005262 Bacteria 763
86 Ga0065715_10176599 3300005293 Bacteria 1507
87 Ga0070658_10392302 3300005327 Bacteria 1192
88 Ga0070676_10117420 3300005328 Bacteria 1665
89 Ga0070676_10305119 3300005328 Bacteria 1081
90 Ga0070690_100009287 3300005330 Bacteria 5692
91 Ga0070670_100190138 3300005331 Bacteria 1783
92 Ga0070670_100220794 3300005331 Bacteria 1649
93 Ga0070677_10126935 3300005333 Bacteria 1159
94 Ga0068869_100008611 3300005334 Bacteria 6588
95 Ga0068869_100302056 3300005334 Bacteria 1293
96 Ga0070666_10016940 3300005335 Bacteria 4666
97 Ga0070666_10598524 3300005335 Bacteria 804
98 Ga0070682_100198554 3300005337 Bacteria 1413
99 Ga0068868_100003776 3300005338 Bacteria 10572
100 Ga0070689_100042817 3300005340 Bacteria 3478
101 Ga0070668_100043051 3300005347 Bacteria 3462
102 Ga0070669_100006871 3300005353 Bacteria 8179
103 Ga0070669_100074476 3300005353 Bacteria 2517
104 Ga0070675_100005182 3300005354 Bacteria 9939
105 Ga0070671_100011467 3300005355 Bacteria 7124
106 Ga0070671_100194259 3300005355 Bacteria 1720
107 Ga0070674_100121405 3300005356 Bacteria 1935
108 Ga0070674_100262434 3300005356 Bacteria 1361
109 Ga0070673_100199632 3300005364 Bacteria 1722
110 Ga0070659_100534154 3300005366 Bacteria 1002
111 Ga0070659_100694937 3300005366 Bacteria 879
112 Ga0070667_100113441 3300005367 Bacteria 2352
113 Ga0070667_100267431 3300005367 Bacteria 1532
114 Ga0070700_100320199 3300005441 Bacteria 1139
115 Ga0070678_100000433 3300005456 Bacteria 19789
116 Ga0068867_100193453 3300005459 Bacteria 1624
117 Ga0070699_100371201 3300005518 Bacteria 1291
118 Ga0068853_100537284 3300005539 Bacteria 1106
119 Ga0070672_100536798 3300005543 Bacteria 1014
120 Ga0070672_100656276 3300005543 Bacteria 916
121 Ga0070686_100214980 3300005544 Bacteria 1386
122 Ga0070665_100458308 3300005548 Bacteria 1285
123 Ga0068855_100128624 3300005563 Unclassified 2894
124 Ga0070664_100097235 3300005564 Bacteria 2556
125 Ga0070664_100257738 3300005564 Bacteria 1569
126 Ga0070664_101079257 3300005564 Bacteria 756
127 Ga0068856_100412526 3300005614 Bacteria 1370
128 Ga0070702_100326379 3300005615 Bacteria 1071
129 Ga0068859_100001951 3300005617 Bacteria 21034
130 Ga0068864_100000906 3300005618 Bacteria 24897
131 Ga0068864_100763779 3300005618 Bacteria 948
132 Ga0068851_10001818 3300005834 Bacteria 9333
133 Ga0068851_10038410 3300005834 Bacteria 2402
134 Ga0068863_100002904 3300005841 Bacteria 16983
135 Ga0068858_100001403 3300005842 Bacteria 24769
136 Ga0068862_100010944 3300005844 Bacteria 7490
137 Ga0075364_10141236 3300006051 Bacteria 1620
138 Ga0075432_10037571 3300006058 Bacteria 1686
139 Ga0075362_10017911 3300006177 Bacteria 2924
140 Ga0075362_10187381 3300006177 Bacteria 1004
141 Ga0075369_10091514 3300006186 Bacteria 1358
142 Ga0075366_10030147 3300006195 Bacteria 3188
143 Ga0075370_10004045 3300006353 Bacteria 7049
144 Ga0068871_100001181 3300006358 Bacteria 17494
145 Ga0075428_100003503 3300006844 Bacteria 17191
146 Ga0075430_100274955 3300006846 Bacteria 1394
147 Ga0075433_11001649 3300006852 Bacteria 728
148 Ga0075434_100292777 3300006871 Bacteria 1648
149 Ga0097620_100001951 3300006931 Bacteria 21034
150 Ga0079104_1003534 3300006946 Bacteria 7191
151 Ga0079104_1024210 3300006946 Bacteria 1602
152 Ga0105244_10036999 3300009036 Bacteria 2553
153 Ga0105240_10995697 3300009093 Bacteria 897
154 Ga0111539_10010099 3300009094 Bacteria 11900
155 Ga0111539_10025158 3300009094 Bacteria 7298
156 Ga0111539_10029277 3300009094 Bacteria 6710
157 Ga0105243_10003849 3300009148 Bacteria 11994
158 Ga0105243_10343031 3300009148 Bacteria 1369
159 Ga0105248_10007110 3300009177 Bacteria 12262
160 Ga0105248_10081145 3300009177 Bacteria 3646
161 Ga0105237_10935396 3300009545 Bacteria 874
162 Ga0105249_10601863 3300009553 Bacteria 1154
163 Ga0105239_10560511 3300010375 Bacteria 1301
164 Ga0105239_10847809 3300010375 Bacteria 1048
165 Ga0105246_10068076 3300011119 Bacteria 2496
166 Ga0157347_1011299 3300012502 Bacteria 947
167 Ga0157370_10123676 3300013104 Bacteria 2415
168 Ga0157378_10088358 3300013297 Bacteria 2812
169 Ga0157372_10395325 3300013307 Bacteria 1611
170 Ga0157372_11027026 3300013307 Bacteria 954
171 Ga0157375_11452304 3300013308 Bacteria 809
172 Ga0163163_10010888 3300014325 Bacteria 8216
173 Ga0157380_10651153 3300014326 Bacteria 1051
174 Ga0157377_10403712 3300014745 Bacteria 931
175 Ga0157379_10170788 3300014968 Bacteria 1963
176 Ga0157376_10225003 3300014969 Bacteria 1740
177 Ga0182006_1035251 3300015261 Bacteria 1997
178 Ga0182006_1039514 3300015261 Bacteria 1861
179 Ga0182007_10043321 3300015262 Bacteria 1496
180 Ga0182005_1000075 3300015265 Bacteria 79711
181 Ga0163161_10019762 3300017792 Bacteria 4725
182 Ga0209435_100329 3300025206 Bacteria 11203
183 Ga0209760_101358 3300025207 Bacteria 2628
184 Ga0209436_100803 3300025208 Bacteria 12861
185 Ga0209436_101095 3300025208 Bacteria 10137
186 Ga0209784_100002 3300025224 Bacteria 1753105
187 Ga0209784_100071 3300025224 Bacteria 151400
188 Ga0209566_100003 3300025225 Bacteria 1753105
189 Ga0209566_100004 3300025225 Bacteria 1531866
190 Ga0209674_100004 3300025226 Bacteria 1753105
191 Ga0209674_100006 3300025226 Bacteria 1531866
192 Ga0209672_100319 3300025228 Bacteria 31820
193 Ga0209147_101404 3300025229 Bacteria 8838
194 Ga0209563_100006 3300025230 Bacteria 1753105
195 Ga0209563_100104 3300025230 Bacteria 151400
196 Ga0207427_100308 3300025231 Bacteria 33981
197 Ga0209437_100158 3300025233 Bacteria 151400
198 Ga0209437_100407 3300025233 Bacteria 39644
199 Ga0209258_100154 3300025242 Bacteria 158235
200 Ga0207425_1000153 3300025245 Bacteria 58689
201 Ga0207425_1000215 3300025245 Bacteria 45771
202 Ga0207425_1002841 3300025245 Bacteria 5827
203 Ga0207425_1027541 3300025245 Bacteria 1159
204 Ga0209646_1000121 3300025246 Bacteria 144839
205 Ga0209677_100003 3300025253 Bacteria 1753105
206 Ga0209677_100064 3300025253 Bacteria 151400
207 Ga0209148_1000145 3300025254 Bacteria 161352
208 Ga0209759_1000064 3300025256 Bacteria 193120
209 Ga0209129_1000054 3300025258 Bacteria 261997
210 Ga0209129_1009530 3300025258 Bacteria 2543
211 Ga0209233_1000005 3300025261 Bacteria 1531866
212 Ga0209565_1000317 3300025263 Bacteria 44071
213 Ga0209565_1001154 3300025263 Bacteria 12731
214 Ga0209565_1003106 3300025263 Bacteria 5572
215 Ga0209565_1003434 3300025263 Bacteria 5126
216 Ga0209565_1014333 3300025263 Bacteria 1824
217 Ga0209673_1000168 3300025273 Bacteria 135126
218 Ga0209673_1001793 3300025273 Bacteria 17739
219 Ga0209673_1010891 3300025273 Bacteria 3795
220 Ga0209130_1000206 3300025284 Bacteria 79198
221 Ga0209130_1000936 3300025284 Bacteria 23302
222 Ga0209130_1001133 3300025284 Bacteria 19524
223 Ga0209130_1001531 3300025284 Bacteria 14805
224 Ga0209130_1001936 3300025284 Bacteria 11521
225 Ga0209130_1016031 3300025284 Bacteria 1827
226 Ga0209675_1000548 3300025291 Bacteria 27388
227 Ga0209675_1002487 3300025291 Bacteria 9442
228 Ga0209675_1005202 3300025291 Bacteria 5514
229 Ga0209675_1005551 3300025291 Bacteria 5256
230 Ga0209675_1005577 3300025291 Bacteria 5239
231 Ga0209675_1019802 3300025291 Bacteria 1841
232 Ga0209676_1000103 3300025292 Bacteria 226908
233 Ga0209676_1000290 3300025292 Bacteria 103000
234 Ga0209676_1004993 3300025292 Bacteria 7110
235 Ga0209025_1000201 3300025294 Bacteria 145890
236 Ga0209025_1003493 3300025294 Bacteria 14805
237 Ga0209025_1035232 3300025294 Bacteria 2265
238 Ga0209564_1000175 3300025295 Bacteria 153109
239 Ga0209564_1000301 3300025295 Bacteria 97869
240 Ga0209564_1000408 3300025295 Bacteria 76528
241 Ga0209564_1008346 3300025295 Bacteria 5126
242 Ga0209758_1000034 3300025297 Bacteria 467637
243 Ga0209758_1011927 3300025297 Bacteria 4947
244 Ga0209758_1052022 3300025297 Bacteria 1420
245 Ga0209050_1000012 3300025298 Bacteria 813717
246 Ga0209050_1000334 3300025298 Bacteria 93637
247 Ga0209050_1001244 3300025298 Bacteria 29472
248 Ga0209050_1001265 3300025298 Bacteria 29124
249 Ga0209050_1004689 3300025298 Bacteria 9076
250 Ga0209050_1009167 3300025298 Bacteria 5116
251 Ga0209256_1000066 3300025299 Bacteria 247534
252 Ga0209256_1001063 3300025299 Bacteria 31840
253 Ga0209256_1002455 3300025299 Bacteria 15101
254 Ga0209256_1007843 3300025299 Bacteria 5126
255 Ga0207426_1000058 3300025302 Bacteria 363857
256 Ga0207426_1000067 3300025302 Bacteria 342108
257 Ga0207426_1000156 3300025302 Bacteria 178646
258 Ga0207426_1002715 3300025302 Bacteria 10774
259 Ga0209051_1000019 3300025303 Bacteria 511268
260 Ga0209051_1000141 3300025303 Bacteria 135837
261 Ga0209051_1002728 3300025303 Bacteria 12254
262 Ga0209257_1000010 3300025304 Bacteria 1158682
263 Ga0209257_1000024 3300025304 Bacteria 726068
264 Ga0209257_1003274 3300025304 Bacteria 14145
265 Ga0209257_1003493 3300025304 Bacteria 13388
266 Ga0209257_1015612 3300025304 Bacteria 3146
267 Ga0207656_10017790 3300025321 Bacteria 2789
268 Ga0207655_1057639 3300025728 Bacteria 1524
269 Ga0207682_10317580 3300025893 Bacteria 731
270 Ga0207688_10069121 3300025901 Bacteria 2001
271 Ga0207688_10156862 3300025901 Bacteria 1347
272 Ga0207680_10501026 3300025903 Bacteria 865
273 Ga0207645_10254322 3300025907 Bacteria 1163
274 Ga0207705_10382912 3300025909 Bacteria 1087
275 Ga0207681_10003632 3300025923 Bacteria 9592
276 Ga0207681_10011213 3300025923 Bacteria 5505
277 Ga0207659_10000197 3300025926 Bacteria 35939
278 Ga0207687_10653802 3300025927 Bacteria 889
279 Ga0207644_10008399 3300025931 Bacteria 6757
280 Ga0207690_10130272 3300025932 Bacteria 1840
281 Ga0207706_10078585 3300025933 Bacteria 2902
282 Ga0207706_10103984 3300025933 Bacteria 2498
283 Ga0207706_10186894 3300025933 Bacteria 1819
284 Ga0207709_10001503 3300025935 Bacteria 16107
285 Ga0207670_10029043 3300025936 Bacteria 3518
286 Ga0207669_10205777 3300025937 Bacteria 1432
287 Ga0207691_10074742 3300025940 Bacteria 3056
288 Ga0207711_10010276 3300025941 Bacteria 7773
289 Ga0207711_10042038 3300025941 Bacteria 3893
290 Ga0207689_10064420 3300025942 Bacteria 3016
291 Ga0207689_10212642 3300025942 Bacteria 1598
292 Ga0207679_10075260 3300025945 Bacteria 2561
293 Ga0207667_10016340 3300025949 Bacteria 8389
294 Ga0207651_10004622 3300025960 Bacteria 6970
295 Ga0207668_10001651 3300025972 Bacteria 13029
296 Ga0207658_10028665 3300025986 Bacteria 3923
297 Ga0207658_10226931 3300025986 Bacteria 1574
298 Ga0207677_10000523 3300026023 Bacteria 24613
299 Ga0207703_10000325 3300026035 Bacteria 51876
300 Ga0207702_10437168 3300026078 Bacteria 1267
301 Ga0207641_10002836 3300026088 Bacteria 15754
302 Ga0207648_10010700 3300026089 Bacteria 8670
303 Ga0207676_10000490 3300026095 Bacteria 33231
304 Ga0207676_10564587 3300026095 Bacteria 1089
305 Ga0207675_100058684 3300026118 Bacteria 3591
306 Ga0207683_10002270 3300026121 Bacteria 16848
307 Ga0207698_10019584 3300026142 Bacteria 4636
308 Ga0209281_1004842 3300027111 Bacteria 3908
309 Ga0209996_1004181 3300027395 Bacteria 1830
310 Ga0209995_1001842 3300027471 Bacteria 3307
311 Ga0209968_1001745 3300027526 Bacteria 3293
312 Ga0209971_1004493 3300027682 Bacteria 3313
313 Ga0209966_1001393 3300027695 Bacteria 4228
314 Ga0209974_10064530 3300027876 Bacteria 1243
315 Ga0207428_10011859 3300027907 Bacteria 7680
316 Ga0207428_10022108 3300027907 Bacteria 5371
317 Ga0207428_10310780 3300027907 Bacteria 1165
318 Ga0268266_10331171 3300028379 Bacteria 1427
319 Ga0268265_10039958 3300028380 Bacteria 3461
320 Ga0265336_10000441 3300028666 Bacteria 25397
321 Ga0307515_10001303 3300028794 Bacteria 56637
322 Ga0307515_10101925 3300028794 Bacteria 3459
323 Ga0265324_10000023 3300029957 Bacteria 164128
324 Ga0316177_1107325 3300030731 Bacteria 2467
325 Ga0316176_1061113 3300030732 Bacteria 4189
326 Ga0314311_1031728 3300030733 Bacteria 7577
327 Ga0316179_1098736 3300030734 Bacteria 3497
328 Ga0316183_1093598 3300030742 Bacteria 1410
329 Ga0316183_1122932 3300030742 Bacteria 7560
330 Ga0316183_1153415 3300030742 Bacteria 2004
331 Ga0316181_1071226 3300030744 Bacteria 895
332 Ga0316181_1114225 3300030744 Bacteria 2386
333 Ga0316182_1103194 3300030745 Bacteria 5077
334 Ga0316182_1425381 3300030745 Bacteria 1778
335 Ga0265330_10079256 3300031235 Bacteria 1416
336 Ga0265328_10000248 3300031239 Bacteria 24945
337 Ga0265328_10012941 3300031239 Bacteria 3312
338 Ga0265325_10000099 3300031241 Bacteria 61211
339 Ga0265331_10000121 3300031250 Bacteria 102519
340 Ga0265331_10003913 3300031250 Bacteria 9413
341 Ga0265331_10009950 3300031250 Bacteria 5291
342 Ga0265331_10018708 3300031250 Bacteria 3586
343 Ga0265327_10000133 3300031251 Bacteria 163887
344 Ga0265327_10000269 3300031251 Bacteria 102772
345 Ga0265327_10014963 3300031251 Bacteria 5045
346 Ga0307513_10114803 3300031456 Bacteria 2677
347 Ga0307513_10351245 3300031456 Bacteria 1222
348 Ga0307513_10565648 3300031456 Bacteria 848
349 Ga0307408_100001137 3300031548 Bacteria 20218
350 Ga0307408_100009699 3300031548 Bacteria 6346
351 Ga0307408_100051045 3300031548 Bacteria 2977
352 Ga0307408_100311534 3300031548 Bacteria 1323
353 Ga0307408_100339490 3300031548 Bacteria 1271
354 Ga0307408_100474355 3300031548 Bacteria 1090
355 Ga0265314_10040124 3300031711 Bacteria 3363
356 Ga0307405_10678482 3300031731 Bacteria 851
357 Ga0307406_10029379 3300031901 Bacteria 3329
358 Ga0307406_10109880 3300031901 Bacteria 1896
359 Ga0307412_10019109 3300031911 Bacteria 4140
360 Ga0307412_10242227 3300031911 Bacteria 1395
361 Ga0307412_10492918 3300031911 Bacteria 1018
362 Ga0307416_100449229 3300032002 Bacteria 1341
363 Ga0307414_10339772 3300032004 Bacteria 1285
364 Ga0307411_10019468 3300032005 Bacteria 3922
365 Ga0307411_10261224 3300032005 Bacteria 1367
366 Ga0373948_0019921 3300034817 Bacteria 1273
367 Ga0373944_0117873 3300035089 Bacteria 912
368 Ga0373952_0008739 3300035092 Bacteria 1926
369 Ga0373945_0010263 3300035116 Bacteria 3082
370 Ga0373955_0561851 3300035172 Bacteria 698
371 Ga0373937_0418991 3300036401 Bacteria 1271
372 Ga0395899_0002235 3300037312 Bacteria 15850
373 Ga0395899_0003602 3300037312 Bacteria 12249
374 Ga0395900_0000025 3300037418 Bacteria 321217
375 Ga0395900_0006448 3300037418 Bacteria 12229
376 Ga0395900_0008320 3300037418 Bacteria 10681
377 Ga0395900_0032081 3300037418 Bacteria 5401
378 Ga0395900_0051154 3300037418 Bacteria 4256
379 Ga0395900_0339759 3300037418 Bacteria 1477
380 Ga0395898_0004913 3300037466 Bacteria 14513
381 Ga0395898_0025860 3300037466 Bacteria 5909
382 Ga0395898_0167321 3300037466 Bacteria 2102
383 Ga0395905_0126584 3300037471 Bacteria 2402
384 Ga0395905_0343698 3300037471 Bacteria 1383
385 Ga0395901_0001654 3300038443 Bacteria 23028
386 Ga0395901_0034591 3300038443 Bacteria 5218
387 Ga0395901_0300180 3300038443 Bacteria 1665
388 Ga0436361_0019116 3300039447 Bacteria 1957
389 Ga0436361_0266042 3300039447 Bacteria 1383
390 Ga0436361_0630630 3300039447 Bacteria 964
391 Ga0436361_1177419 3300039447 Bacteria 10101
392 Ga0439436_0000336 3300041404 Bacteria 11576
393 Ga0439439_0014282 3300041406 Bacteria 1933
394 Ga0439465_0000517 3300041413 Bacteria 11531
395 Ga0451839_0574126 3300041496 Bacteria 761
396 Ga0439431_0002606 3300041997 Bacteria 3980
397 Ga0439442_002961 3300042002 Bacteria 3345
398 Ga0439445_0000347 3300042004 Bacteria 9147
399 Ga0439449_0000838 3300042007 Bacteria 11916
400 Ga0439452_000949 3300042010 Bacteria 13024
401 Ga0439455_0021651 3300042012 Bacteria 1535
402 Ga0439462_0000328 3300042015 Bacteria 8874
403 Ga0450904_000075 3300042139 Bacteria 22281
404 Ga0439434_0063453 3300042435 Bacteria 1157
405 Ga0439464_0007338 3300042439 Bacteria 2882
406 Ga0450916_011011 3300042530 Bacteria 1138
407 Ga0451577_0000013 3300042876 Bacteria 550689
408 Ga0451577_0065167 3300042876 Bacteria 3249
409 Ga0451577_0069745 3300042876 Bacteria 3135
410 Ga0451577_0450324 3300042876 Bacteria 1169
411 Ga0466969_0000097 3300044656 Bacteria 45819
412 Ga0466972_0000265 3300044658 Bacteria 33659
413 Ga0466972_0040534 3300044658 Bacteria 2268
414 Ga0453683_0000033 3300044673 Bacteria 241479
415 Ga0466965_0014752 3300044683 Bacteria 3700
416 Ga0466965_0036729 3300044683 Bacteria 2403
417 Ga0466965_0068092 3300044683 Bacteria 1787
418 Ga0466965_0092459 3300044683 Bacteria 1540
419 Ga0466966_0003941 3300044684 Bacteria 9804
420 Ga0466966_0008252 3300044684 Bacteria 6907
421 Ga0466961_0008327 3300044693 Bacteria 6601
422 Ga0453684_0000029 3300044712 Bacteria 757969
423 Ga0453684_0000085 3300044712 Bacteria 397817
424 Ga0453684_1217562 3300044712 Bacteria 790
425 Ga0466971_0036605 3300044719 Bacteria 2201
426 Ga0466960_0007982 3300044901 Bacteria 4321
427 Ga0466959_0012329 3300045049 Bacteria 6173
428 Ga0466959_0220810 3300045049 Bacteria 1314
429 Ga0451576_0000018 3300045051 Bacteria 550689
430 Ga0451576_0238947 3300045051 Bacteria 1898
431 Ga0495617_000651 3300046452 Bacteria 17427
432 Ga0495627_004855 3300046453 Bacteria 5534
433 Ga0495592_0435638 3300046454 Bacteria 824
434 Ga0495603_0023614 3300046455 Bacteria 3720
435 Ga0495590_0183418 3300046457 Bacteria 765
436 Ga0495629_0005224 3300046459 Bacteria 9712
437 Ga0495629_0110906 3300046459 Bacteria 1913
438 Ga0495638_0100164 3300046460 Bacteria 1734
439 Ga0495651_0005777 3300046462 Bacteria 9440
440 Ga0495651_0143502 3300046462 Bacteria 1728
441 Ga0495651_0143503 3300046462 Bacteria 1728
442 Ga0495605_0033243 3300046474 Bacteria 2619
443 Ga0495605_0056060 3300046474 Bacteria 1901
444 Ga0495584_0000043 3300046491 Bacteria 90007
445 Ga0495584_0000971 3300046491 Bacteria 17998
446 Ga0495584_0033751 3300046491 Bacteria 2590
447 Ga0495584_0119942 3300046491 Bacteria 1332
448 Ga0495584_0327143 3300046491 Bacteria 778
449 Ga0495585_0000224 3300046492 Bacteria 58217
450 Ga0495585_0007330 3300046492 Bacteria 6762
451 Ga0495585_0010898 3300046492 Bacteria 5402
452 Ga0495585_0026757 3300046492 Bacteria 3293
453 Ga0495585_0123676 3300046492 Bacteria 1367
454 Ga0495596_0013160 3300046500 Bacteria 3518
455 Ga0495596_0024505 3300046500 Bacteria 2441
456 Ga0495596_0137219 3300046500 Bacteria 949
457 Ga0495583_0000104 3300046506 Bacteria 142553
458 Ga0495583_0000366 3300046506 Bacteria 70369
459 Ga0495606_0011889 3300046507 Bacteria 7041
460 Ga0495606_0020830 3300046507 Bacteria 4819
461 Ga0495606_0053935 3300046507 Bacteria 2606
462 Ga0495606_0210000 3300046507 Bacteria 1103
463 Ga0495608_0006970 3300046511 Bacteria 7999
464 Ga0495608_0075952 3300046511 Bacteria 2189
465 Ga0495610_0029233 3300046512 Bacteria 2905
466 Ga0495616_0001943 3300046513 Bacteria 13903
467 Ga0495616_0016848 3300046513 Bacteria 4037
468 Ga0495616_0029544 3300046513 Bacteria 2892
469 Ga0495628_0000059 3300046516 Bacteria 87291
470 Ga0495631_0000414 3300046518 Bacteria 29474
471 Ga0495632_0000139 3300046519 Bacteria 74242
472 Ga0495632_0000477 3300046519 Bacteria 37994
473 Ga0495637_0012766 3300046520 Bacteria 4008
474 Ga0495643_0063578 3300046522 Bacteria 1951
475 Ga0495644_0010075 3300046523 Bacteria 3642
476 Ga0495644_0089782 3300046523 Bacteria 1159
477 Ga0495648_0000055 3300046524 Bacteria 158686
478 Ga0495648_0020636 3300046524 Bacteria 4587
479 Ga0495663_0104618 3300046525 Bacteria 935
480 Ga0495642_0046401 3300046528 Bacteria 1777
481 Ga0495642_0047667 3300046528 Bacteria 1755
482 Ga0495642_0058619 3300046528 Bacteria 1594
483 Ga0495642_0103957 3300046528 Bacteria 1211
484 Ga0495642_0125508 3300046528 Bacteria 1103
485 Ga0495652_0004625 3300046529 Bacteria 13120
486 Ga0495652_0035985 3300046529 Bacteria 4306
487 Ga0495652_0091223 3300046529 Bacteria 2491
488 Ga0495654_0011360 3300046530 Bacteria 4821
489 Ga0495654_0026180 3300046530 Bacteria 3001
490 Ga0495654_0081653 3300046530 Bacteria 1514
491 Ga0495654_0163312 3300046530 Bacteria 976
492 Ga0495665_0032630 3300046531 Bacteria 2785
493 Ga0495586_0011796 3300046535 Bacteria 4644
494 Ga0495586_0275999 3300046535 Bacteria 961
495 Ga0495598_0035539 3300046537 Bacteria 1427
496 Ga0495609_0000930 3300046538 Bacteria 21173
497 Ga0495609_0008139 3300046538 Bacteria 5157
498 Ga0495609_0159729 3300046538 Bacteria 956
499 Ga0495621_0022591 3300046539 Bacteria 2086
500 Ga0495597_0000031 3300046542 Bacteria 133296
501 Ga0495597_0012098 3300046542 Bacteria 4171
502 Ga0495597_0022101 3300046542 Bacteria 2952
503 Ga0495597_0186011 3300046542 Bacteria 837
504 Ga0495645_0054792 3300046543 Bacteria 2896
505 Ga0495622_0008305 3300046557 Bacteria 4809
506 Ga0495622_0013458 3300046557 Bacteria 3795
507 Ga0495633_0026036 3300046558 Bacteria 2873
508 Ga0495633_0053875 3300046558 Bacteria 1893
509 Ga0495668_0000230 3300046616 Bacteria 80675
510 Ga0495668_0000683 3300046616 Bacteria 40836
511 Ga0495668_0046564 3300046616 Bacteria 2409
512 Ga0495668_0130743 3300046616 Bacteria 1374
513 Ga0495668_0293019 3300046616 Bacteria 892
514 Ga0495634_0069678 3300046642 Bacteria 2320
515 Ga0495611_0010575 3300046648 Bacteria 3904
516 Ga0495625_0006092 3300046660 Bacteria 10816
517 Ga0495625_0014435 3300046660 Bacteria 6304
518 Ga0495625_0027871 3300046660 Bacteria 4243
519 Ga0495635_0114149 3300046663 Bacteria 1844
520 Ga0495659_0000031 3300046664 Bacteria 65868
521 Ga0495659_0005633 3300046664 Bacteria 3947
522 Ga0495659_0167153 3300046664 Bacteria 891
523 Ga0495661_0025164 3300046665 Bacteria 3847
524 Ga0495661_0046217 3300046665 Bacteria 2659
525 Ga0495588_0054168 3300046674 Bacteria 2069
526 Ga0495588_0056107 3300046674 Bacteria 2033
527 Ga0495623_0003538 3300046679 Bacteria 10338
528 Ga0495646_0002246 3300046680 Bacteria 11800
529 Ga0495646_0014471 3300046680 Bacteria 5017
530 Ga0495658_0042769 3300046683 Bacteria 2531
531 Ga0495658_0299131 3300046683 Bacteria 1017
532 Ga0495624_0008986 3300046690 Bacteria 6944
533 Ga0495624_0020855 3300046690 Bacteria 4354
534 Ga0495670_0000737 3300046691 Bacteria 15625
535 Ga0495670_0009408 3300046691 Bacteria 4803
536 Ga0495670_0016868 3300046691 Bacteria 3590
537 Ga0495671_0000345 3300046692 Bacteria 38587
538 Ga0495671_0032839 3300046692 Bacteria 2647
539 Ga0495671_0034132 3300046692 Bacteria 2588
540 Ga0495589_0001296 3300046794 Bacteria 14752
541 Ga0495660_0001900 3300046810 Bacteria 13682
542 Ga0495660_0024935 3300046810 Bacteria 3401
543 Ga0495660_0086226 3300046810 Bacteria 1639
544 Ga0495660_0155519 3300046810 Bacteria 1125
545 Ga0495581_0020199 3300047315 Bacteria 3867
546 Ga0495581_0087231 3300047315 Bacteria 1809
547 Ga0495604_0014340 3300047317 Bacteria 6321
548 Ga0495636_0008076 3300047318 Bacteria 4148
549 Ga0495636_0047087 3300047318 Bacteria 1800
550 Ga0495636_0115545 3300047318 Bacteria 1184
551 Ga0495636_0193880 3300047318 Bacteria 926
552 Ga0495674_0018515 3300047319 Bacteria 6482
553 Ga0495672_0000697 3300047320 Bacteria 37194
554 Ga0495672_0040990 3300047320 Bacteria 2803
555 Ga0495676_0008592 3300047321 Bacteria 9354
556 Ga0495680_0257541 3300047322 Bacteria 1235
557 Ga0495683_0011108 3300047323 Bacteria 4746
558 Ga0495683_0030881 3300047323 Bacteria 2731
559 Ga0495683_0141529 3300047323 Bacteria 1127
560 Ga0495683_0182511 3300047323 Bacteria 957
561 Ga0495687_000425 3300047443 Bacteria 52066
562 Ga0495687_019949 3300047443 Bacteria 3276
563 Ga0495675_0037891 3300047444 Bacteria 3070
564 Ga0495685_033249 3300047447 Bacteria 1772
565 Ga0495685_072105 3300047447 Bacteria 1156
566 Ga0495685_102008 3300047447 Bacteria 947
567 Ga0495673_0013535 3300047469 Bacteria 4280
568 Ga0495681_0086849 3300047470 Bacteria 1387
569 Ga0495686_0001840 3300047472 Bacteria 21298
570 Ga0495686_0001952 3300047472 Bacteria 20515
571 Ga0495593_0003348 3300047673 Bacteria 9602
572 Ga0495593_0034149 3300047673 Bacteria 2767
573 Ga0495602_0012279 3300048088 Bacteria 8815
574 Ga0495602_0147112 3300048088 Bacteria 1857
575 Ga0495614_0004433 3300048089 Bacteria 6329
576 Ga0495614_0028048 3300048089 Bacteria 2427
577 Ga0496101_0025960 3300048904 Bacteria 4069
578 Ga0496102_0000303 3300048905 Bacteria 62809
579 Ga0496102_0008357 3300048905 Bacteria 8864
580 Ga0496104_0016655 3300048907 Bacteria 6680
581 Ga0496104_0599187 3300048907 Bacteria 1012
582 Ga0496105_0053722 3300048908 Bacteria 3327
583 Ga0496108_0092103 3300048911 Bacteria 2577
584 Ga0496108_0135499 3300048911 Bacteria 2118
585 Ga0496109_0021519 3300048912 Bacteria 5703
586 Ga0496111_0291479 3300048914 Bacteria 1210
587 Ga0496112_0022844 3300048915 Bacteria 5967
588 Ga0496112_0745009 3300048915 Bacteria 906
589 Ga0496113_0398315 3300048916 Bacteria 1105
590 Ga0496115_0218223 3300048918 Bacteria 1574
591 Ga0496116_0015751 3300048919 Bacteria 5958
592 Ga0496117_0035885 3300048920 Bacteria 3716
593 Ga0496117_0044014 3300048920 Bacteria 3237
594 Ga0496117_0106121 3300048920 Bacteria 1764
595 Ga0496118_0000591 3300048921 Bacteria 59977
596 Ga0496118_0008346 3300048921 Bacteria 10724
597 Ga0496121_0008109 3300048924 Bacteria 12492
598 Ga0496121_0035885 3300048924 Bacteria 4430
599 Ga0496121_0038890 3300048924 Bacteria 4202
600 Ga0496121_0051448 3300048924 Bacteria 3469
601 Ga0496122_0004005 3300048925 Bacteria 18773
602 Ga0496122_0035075 3300048925 Bacteria 4092
603 Ga0496122_0067614 3300048925 Bacteria 2572
604 Ga0496122_0099386 3300048925 Bacteria 1951
605 Ga0496123_0000263 3300048926 Bacteria 105886
606 Ga0496123_0012224 3300048926 Bacteria 7342
607 Ga0496123_0037990 3300048926 Bacteria 3391
608 Ga0496123_0048163 3300048926 Bacteria 2870
609 Ga0496124_0006593 3300048927 Bacteria 12607
610 Ga0496124_0190458 3300048927 Bacteria 1570
611 Ga0496125_0001266 3300048928 Bacteria 37641
612 Ga0496125_0033541 3300048928 Bacteria 4541
613 Ga0496126_0067026 3300048929 Bacteria 3208
614 Ga0501306_000671 3300049127 Bacteria 2774
615 Ga0501310_000551 3300049130 Bacteria 3322
616 Ga0495678_000793 3300049459 Bacteria 28316
617 Ga0495682_0164343 3300049460 Bacteria 790
618 Ga0501032_0009626 3300049569 Bacteria 7002
619 Ga0501037_0061129 3300049573 Bacteria 2747
620 Ga0501038_0088818 3300049574 Bacteria 2594
621 Ga0501227_005511 3300049665 Bacteria 2708
622 Ga0501249_006469 3300049679 Bacteria 2409
623 Ga0501225_0012633 3300049705 Bacteria 2370
624 Ga0501262_000217 3300049759 Bacteria 7100
625 Ga0501279_001240 3300049775 Bacteria 3353
626 Ga0501035_0229866 3300049822 Bacteria 1581
627 Ga0501044_0451515 3300049823 Bacteria 1192
628 nmdc:mga0k408_44127_c1 3300050493 Bacteria 2570
629 nmdc:mga07m45_1446_c1 3300050496 Bacteria 10887
630 nmdc:mga07m45_42155_c1 3300050496 Bacteria 2558
631 nmdc:mga09592_238137_c1 3300050508 Bacteria 1577
632 nmdc:mga08y16_10865_c1 3300050511 Bacteria 9562
633 nmdc:mga08y16_15423_c1 3300050511 Bacteria 8036
634 nmdc:mga08y16_89743_c1 3300050511 Bacteria 3203
635 nmdc:mga0n895_576398_c1 3300050512 Bacteria 1129
636 nmdc:mga0a205_389369_c2 3300050515 Bacteria 932
637 nmdc:mga0sz30_139240_c1 3300050516 Bacteria 1071
638 Ga0495601_0056834 3300053077 Bacteria 2478
639 Ga0500643_015944 3300053087 Bacteria 2562
640 Ga0500644_0245787 3300053088 Bacteria 753
641 Ga0500651_0000054 3300053093 Bacteria 74519
642 Ga0500651_0008690 3300053093 Bacteria 5996
643 Ga0500566_0029659 3300053094 Bacteria 3195
644 Ga0500566_0042353 3300053094 Bacteria 2627
645 Ga0500650_0222796 3300053098 Bacteria 853
646 Ga0500571_000005 3300053110 Bacteria 109625
647 Ga0500572_078404 3300053111 Bacteria 1031
648 Ga0500592_003168 3300053116 Bacteria 2630
649 Ga0500593_001559 3300053117 Bacteria 8244
650 Ga0500593_002899 3300053117 Bacteria 6373
651 Ga0500594_0000763 3300053118 Bacteria 6854
652 Ga0500595_001889 3300053119 Bacteria 10795
653 Ga0500626_014812 3300053128 Bacteria 3387
654 Ga0500655_000895 3300053133 Bacteria 5782
655 Ga0500658_0024339 3300053134 Bacteria 2319
656 Ga0500559_0084954 3300053136 Bacteria 1443
657 Ga0500564_005575 3300053138 Bacteria 5158
658 Ga0500568_0002238 3300053139 Bacteria 11589
659 Ga0500573_0029700 3300053140 Bacteria 3151
660 Ga0500574_000299 3300053141 Bacteria 6083
661 Ga0500619_000249 3300053154 Bacteria 11573
662 Ga0500638_004055 3300053162 Bacteria 5560
663 Ga0500636_0058351 3300053177 Bacteria 2256
664 Ga0500625_076085 3300053729 Bacteria 1479
665 Ga0500645_011458 3300053730 Bacteria 2895
666 Ga0500645_049388 3300053730 Bacteria 1230
667 Ga0500596_008400 3300053735 Bacteria 1648
668 Ga0500661_002371 3300055283 Bacteria 3552
669 2511245911 2511231002 Bacteria 5042903
670 2511388063 2511231026 Bacteria 5225445
671 2521557993 2521172590 Bacteria 5047645
672 2553003125 2551306416 Bacteria 6152985
673 2599623234 2599185214 Bacteria 8209958
674 2599675548 2599185226 Bacteria 8233575
675 2599680839 2599185227 Bacteria 8246414
676 2599692854 2599185229 Bacteria 8216126
677 2643746399 2643221544 Bacteria 5886209
678 2643788260 2643221554 Bacteria 6603920
679 2643933124 2643221585 Bacteria 5812563
680 2644026609 2643221603 Bacteria 6147767
681 2644213810 2643221638 Bacteria 6579467
682 2644253938 2643221645 Bacteria 7207331
683 2644314373 2643221656 Bacteria 5809961
684 2644338728 2643221660 Bacteria 4208257
685 2644356709 2643221664 Bacteria 7272945
686 2644467161 2643221683 Bacteria 5749203
687 2738721247 2738541277 Bacteria 7458140
688 2738742102 2738541280 Bacteria 6630198
689 2738844555 2738541300 Bacteria 6675882
690 2738882744 2738541307 Bacteria 8606193
691 2739250545 2738543013 Bacteria 5618633
692 2739276065 2738543018 Bacteria 6718814
693 2739280446 2738543019 Bacteria 7459457
694 2739345411 2738543030 Bacteria 6719714
695 2765569120 2765235838 Bacteria 5445269
696 2808984020 2808606386 Bacteria 4471946
697 2809131108 2808606415 Bacteria 4576710
698 2809150557 2808606419 Bacteria 4576925
699 2819544802 2818991436 Bacteria 5376622
700 2819600369 2818991446 Bacteria 7757362
701 2819614859 2818991449 Bacteria 5518009
702 2831271837 2831265667 Bacteria 7184833
703 2838059675 2838054893 Bacteria 7451788
704 2839095993 2839094727 Bacteria 5534556
705 2842679835 2842677519 Bacteria 5615038
706 2842735769 2842733646 Bacteria 5716726
707 2842750922 2842747753 Bacteria 5578255
708 2852622072 2852618963 Bacteria 4577824
709 2885198063 2885192300 Bacteria 5882526
710 2885198671 2885198086 Bacteria 7212419
711 2885211949 2885211737 Bacteria 7212420
712 2899928460 2899924645 Bacteria 7487985
713 2904441230 2904439833 Bacteria 5931679
714 2904452435 2904449895 Bacteria 6927402
715 2904460966 2904456579 Bacteria 6819253
716 2904531829 2904530477 Bacteria 5876334
717 2904587945 2904584206 Bacteria 6028872
718 2904589895 2904589729 Bacteria 6113573
719 2904602719 2904601388 Bacteria 5884906
720 2919079777 2919079590 Bacteria 5946433
721 2919463933 2919462493 Bacteria 5817112
722 2923511242 2923510766 Bacteria 5926163
723 2928041381 2928037797 Bacteria 7273642
724 2928048223 2928044640 Bacteria 7271509
725 2928056065 2928051484 Bacteria 7773759
726 2928066453 2928064002 Bacteria 7419480
727 2928077403 2928070936 Bacteria 8062541
728 2928087702 2928084124 Bacteria 7159212
729 2928131178 2928130867 Bacteria 5467269
730 2929522949 2929520902 Bacteria 6765052
731 2945946069 2945945610 Bacteria 5951079
732 2945975668 2945972063 Bacteria 6086495
733 2954768889 2954767861 Bacteria 5535784
734 8002393554 8002392321 Bacteria 4159911
735 Ga0395899_0000246
736 JGI24740J21852_10005400
737 JGI24739J22299_10019327
738 JGI25155J39150_1000232
739 JGI25162J39368_1000139
740 JGI25162J39368_1006367
741 JGI25154J39366_1000167
742 JGI25158J39367_1001073
743 JGI25163J39215_1001578
744 JGI25150J39212_1001793
745 JGI25150J39212_1009982
746 JGI25150J39212_1013954
747 JGI25159J45721_1000435
748 JGI25159J45721_1001010
749 JGI25159J45721_1018601
750 Ga0006759J45824_1061774
751 JGI25151J46595_10002229
752 JGI25151J46595_10018492
753 JGI25165J46597_1000227
754 JGI25153J46596_10087795
755 rootH1_10092562
756 rootH2_10011746
757 rootL2_10038684
758 rootH1_10022702
759 JGI26128J50194_1001453
760 JGI25160J50197_1000093
761 JGI25160J50197_1021743
762 JGI25160J50197_1040714
763 JGI25161J50226_1000443
764 JGI25161J50226_1000777
765 JGI25161J50226_1005267
766 Ga0007410J51695_1038845
767 Ga0007409J51694_1018424
768 Ga0032354_1047181
769 Ga0055538_1000002
770 Ga0055538_1000089
771 Ga0055539_1000002
772 Ga0055539_1000133
773 Ga0055533_1000004
774 Ga0055533_1000136
775 Ga0055525_1000002
776 Ga0055525_1000181
777 Ga0055535_1000128
778 Ga0055542_1000062
779 Ga0055526_1005872
780 Ga0055526_1030266
781 Ga0055537_1001084
782 Ga0055537_1005883
783 Ga0055537_1007440
784 Ga0055537_1012933
785 Ga0055537_1015602
786 Ga0055537_1017820
787 Ga0055524_1001380
788 Ga0055524_1023300
789 Ga0055536_1001927
790 Ga0055536_1008144
791 Ga0055534_1000948
792 Ga0055534_1001053
793 Ga0055534_1016169
794 Ga0055528_1001880
795 Ga0055528_1012891
796 Ga0055530_10001484
797 Ga0055530_10015131
798 Ga0055530_10019013
799 Ga0055530_10028949
800 Ga0055530_10033969
801 Ga0055530_10061243
802 Ga0055540_1002723
803 Ga0055540_1004043
804 Ga0055531_10002613
805 Ga0055531_10002855
806 Ga0055531_10025190
807 Ga0055541_1000002
808 Ga0055541_1000088
809 Ga0055543_1001062
810 Ga0055543_1002173
811 Ga0055543_1028544
812 Ga0055543_1035116
813 Ga0065165_1002355
814 Ga0065165_1003150
815 Ga0065165_1003326
816 Ga0065165_1005438
817 Ga0065165_1010696
818 Ga0065165_1093270
819 Ga0065165_1093295
820 Ga0065715_10176599
821 Ga0070658_10392302
822 Ga0070676_10117420
823 Ga0070676_10305119
824 Ga0070690_100009287
825 Ga0070670_100190138
826 Ga0070670_100220794
827 Ga0070677_10126935
828 Ga0068869_100008611
829 Ga0068869_100302056
830 Ga0070666_10016940
831 Ga0070666_10598524
832 Ga0070682_100198554
833 Ga0068868_100003776
834 Ga0070689_100042817
835 Ga0070668_100043051
836 Ga0070669_100006871
837 Ga0070669_100074476
838 Ga0070675_100005182
839 Ga0070671_100011467
840 Ga0070671_100194259
841 Ga0070674_100121405
842 Ga0070674_100262434
843 Ga0070673_100199632
844 Ga0070659_100534154
845 Ga0070659_100694937
846 Ga0070667_100113441
847 Ga0070667_100267431
848 Ga0070700_100320199
849 Ga0070678_100000433
850 Ga0068867_100193453
851 Ga0070699_100371201
852 Ga0068853_100537284
853 Ga0070672_100536798
854 Ga0070672_100656276
855 Ga0070686_100214980
856 Ga0070665_100458308
857 Ga0068855_100128624
858 Ga0070664_100097235
859 Ga0070664_100257738
860 Ga0070664_101079257
861 Ga0068856_100412526
862 Ga0070702_100326379
863 Ga0068859_100001951
864 Ga0068864_100000906
865 Ga0068864_100763779
866 Ga0068851_10001818
867 Ga0068851_10038410
868 Ga0068863_100002904
869 Ga0068858_100001403
870 Ga0068862_100010944
871 Ga0075364_10141236
872 Ga0075432_10037571
873 Ga0075362_10017911
874 Ga0075362_10187381
875 Ga0075369_10091514
876 Ga0075366_10030147
877 Ga0075370_10004045
878 Ga0068871_100001181
879 Ga0075428_100003503
880 Ga0075430_100274955
881 Ga0075433_11001649
882 Ga0075434_100292777
883 Ga0097620_100001951
884 Ga0079104_1003534
885 Ga0079104_1024210
886 Ga0105244_10036999
887 Ga0105240_10995697
888 Ga0111539_10010099
889 Ga0111539_10025158
890 Ga0111539_10029277
891 Ga0105243_10003849
892 Ga0105243_10343031
893 Ga0105248_10007110
894 Ga0105248_10081145
895 Ga0105237_10935396
896 Ga0105249_10601863
897 Ga0105239_10560511
898 Ga0105239_10847809
899 Ga0105246_10068076
900 Ga0157347_1011299
901 Ga0157370_10123676
902 Ga0157378_10088358
903 Ga0157372_10395325
904 Ga0157372_11027026
905 Ga0157375_11452304
906 Ga0163163_10010888
907 Ga0157380_10651153
908 Ga0157377_10403712
909 Ga0157379_10170788
910 Ga0157376_10225003
911 Ga0182006_1035251
912 Ga0182006_1039514
913 Ga0182007_10043321
914 Ga0182005_1000075
915 Ga0163161_10019762
916 Ga0209435_100329
917 Ga0209760_101358
918 Ga0209436_100803
919 Ga0209436_101095
920 Ga0209784_100002
921 Ga0209784_100071
922 Ga0209566_100003
923 Ga0209566_100004
924 Ga0209674_100004
925 Ga0209674_100006
926 Ga0209672_100319
927 Ga0209147_101404
928 Ga0209563_100006
929 Ga0209563_100104
930 Ga0207427_100308
931 Ga0209437_100158
932 Ga0209437_100407
933 Ga0209258_100154
934 Ga0207425_1000153
935 Ga0207425_1000215
936 Ga0207425_1002841
937 Ga0207425_1027541
938 Ga0209646_1000121
939 Ga0209677_100003
940 Ga0209677_100064
941 Ga0209148_1000145
942 Ga0209759_1000064
943 Ga0209129_1000054
944 Ga0209129_1009530
945 Ga0209233_1000005
946 Ga0209565_1000317
947 Ga0209565_1001154
948 Ga0209565_1003106
949 Ga0209565_1003434
950 Ga0209565_1014333
951 Ga0209673_1000168
952 Ga0209673_1001793
953 Ga0209673_1010891
954 Ga0209130_1000206
955 Ga0209130_1000936
956 Ga0209130_1001133
957 Ga0209130_1001531
958 Ga0209130_1001936
959 Ga0209130_1016031
960 Ga0209675_1000548
961 Ga0209675_1002487
962 Ga0209675_1005202
963 Ga0209675_1005551
964 Ga0209675_1005577
965 Ga0209675_1019802
966 Ga0209676_1000103
967 Ga0209676_1000290
968 Ga0209676_1004993
969 Ga0209025_1000201
970 Ga0209025_1003493
971 Ga0209025_1035232
972 Ga0209564_1000175
973 Ga0209564_1000301
974 Ga0209564_1000408
975 Ga0209564_1008346
976 Ga0209758_1000034
977 Ga0209758_1011927
978 Ga0209758_1052022
979 Ga0209050_1000012
980 Ga0209050_1000334
981 Ga0209050_1001244
982 Ga0209050_1001265
983 Ga0209050_1004689
984 Ga0209050_1009167
985 Ga0209256_1000066
986 Ga0209256_1001063
987 Ga0209256_1002455
988 Ga0209256_1007843
989 Ga0207426_1000058
990 Ga0207426_1000067
991 Ga0207426_1000156
992 Ga0207426_1002715
993 Ga0209051_1000019
994 Ga0209051_1000141
995 Ga0209051_1002728
996 Ga0209257_1000010
997 Ga0209257_1000024
998 Ga0209257_1003274
999 Ga0209257_1003493
1000 Ga0209257_1015612
1001 Ga0207656_10017790
1002 Ga0207655_1057639
1003 Ga0207682_10317580
1004 Ga0207688_10069121
1005 Ga0207688_10156862
1006 Ga0207680_10501026
1007 Ga0207645_10254322
1008 Ga0207705_10382912
1009 Ga0207681_10003632
1010 Ga0207681_10011213
1011 Ga0207659_10000197
1012 Ga0207687_10653802
1013 Ga0207644_10008399
1014 Ga0207690_10130272
1015 Ga0207706_10078585
1016 Ga0207706_10103984
1017 Ga0207706_10186894
1018 Ga0207709_10001503
1019 Ga0207670_10029043
1020 Ga0207669_10205777
1021 Ga0207691_10074742
1022 Ga0207711_10010276
1023 Ga0207711_10042038
1024 Ga0207689_10064420
1025 Ga0207689_10212642
1026 Ga0207679_10075260
1027 Ga0207667_10016340
1028 Ga0207651_10004622
1029 Ga0207668_10001651
1030 Ga0207658_10028665
1031 Ga0207658_10226931
1032 Ga0207677_10000523
1033 Ga0207703_10000325
1034 Ga0207702_10437168
1035 Ga0207641_10002836
1036 Ga0207648_10010700
1037 Ga0207676_10000490
1038 Ga0207676_10564587
1039 Ga0207675_100058684
1040 Ga0207683_10002270
1041 Ga0207698_10019584
1042 Ga0209281_1004842
1043 Ga0209996_1004181
1044 Ga0209995_1001842
1045 Ga0209968_1001745
1046 Ga0209971_1004493
1047 Ga0209966_1001393
1048 Ga0209974_10064530
1049 Ga0207428_10011859
1050 Ga0207428_10022108
1051 Ga0207428_10310780
1052 Ga0268266_10331171
1053 Ga0268265_10039958
1054 Ga0265336_10000441
1055 Ga0307515_10001303
1056 Ga0307515_10101925
1057 Ga0265324_10000023
1058 Ga0316177_1107325
1059 Ga0316176_1061113
1060 Ga0314311_1031728
1061 Ga0316179_1098736
1062 Ga0316183_1093598
1063 Ga0316183_1122932
1064 Ga0316183_1153415
1065 Ga0316181_1071226
1066 Ga0316181_1114225
1067 Ga0316182_1103194
1068 Ga0316182_1425381
1069 Ga0265330_10079256
1070 Ga0265328_10000248
1071 Ga0265328_10012941
1072 Ga0265325_10000099
1073 Ga0265331_10000121
1074 Ga0265331_10003913
1075 Ga0265331_10009950
1076 Ga0265331_10018708
1077 Ga0265327_10000133
1078 Ga0265327_10000269
1079 Ga0265327_10014963
1080 Ga0307513_10114803
1081 Ga0307513_10351245
1082 Ga0307513_10565648
1083 Ga0307408_100001137
1084 Ga0307408_100009699
1085 Ga0307408_100051045
1086 Ga0307408_100311534
1087 Ga0307408_100339490
1088 Ga0307408_100474355
1089 Ga0265314_10040124
1090 Ga0307405_10678482
1091 Ga0307406_10029379
1092 Ga0307406_10109880
1093 Ga0307412_10019109
1094 Ga0307412_10242227
1095 Ga0307412_10492918
1096 Ga0307416_100449229
1097 Ga0307414_10339772
1098 Ga0307411_10019468
1099 Ga0307411_10261224
1100 Ga0373948_0019921
1101 Ga0373944_0117873
1102 Ga0373952_0008739
1103 Ga0373945_0010263
1104 Ga0373955_0561851
1105 Ga0373937_0418991
1106 Ga0395899_0002235
1107 Ga0395899_0003602
1108 Ga0395900_0000025
1109 Ga0395900_0006448
1110 Ga0395900_0008320
1111 Ga0395900_0032081
1112 Ga0395900_0051154
1113 Ga0395900_0339759
1114 Ga0395898_0004913
1115 Ga0395898_0025860
1116 Ga0395898_0167321
1117 Ga0395905_0126584
1118 Ga0395905_0343698
1119 Ga0395901_0001654
1120 Ga0395901_0034591
1121 Ga0395901_0300180
1122 Ga0436361_0019116
1123 Ga0436361_0266042
1124 Ga0436361_0630630
1125 Ga0436361_1177419
1126 Ga0439436_0000336
1127 Ga0439439_0014282
1128 Ga0439465_0000517
1129 Ga0451839_0574126
1130 Ga0439431_0002606
1131 Ga0439442_002961
1132 Ga0439445_0000347
1133 Ga0439449_0000838
1134 Ga0439452_000949
1135 Ga0439455_0021651
1136 Ga0439462_0000328
1137 Ga0450904_000075
1138 Ga0439434_0063453
1139 Ga0439464_0007338
1140 Ga0450916_011011
1141 Ga0451577_0000013
1142 Ga0451577_0065167
1143 Ga0451577_0069745
1144 Ga0451577_0450324
1145 Ga0466969_0000097
1146 Ga0466972_0000265
1147 Ga0466972_0040534
1148 Ga0453683_0000033
1149 Ga0466965_0014752
1150 Ga0466965_0036729
1151 Ga0466965_0068092
1152 Ga0466965_0092459
1153 Ga0466966_0003941
1154 Ga0466966_0008252
1155 Ga0466961_0008327
1156 Ga0453684_0000029
1157 Ga0453684_0000085
1158 Ga0453684_1217562
1159 Ga0466971_0036605
1160 Ga0466960_0007982
1161 Ga0466959_0012329
1162 Ga0466959_0220810
1163 Ga0451576_0000018
1164 Ga0451576_0238947
1165 Ga0495617_000651
1166 Ga0495627_004855
1167 Ga0495592_0435638
1168 Ga0495603_0023614
1169 Ga0495590_0183418
1170 Ga0495629_0005224
1171 Ga0495629_0110906
1172 Ga0495638_0100164
1173 Ga0495651_0005777
1174 Ga0495651_0143502
1175 Ga0495651_0143503
1176 Ga0495605_0033243
1177 Ga0495605_0056060
1178 Ga0495584_0000043
1179 Ga0495584_0000971
1180 Ga0495584_0033751
1181 Ga0495584_0119942
1182 Ga0495584_0327143
1183 Ga0495585_0000224
1184 Ga0495585_0007330
1185 Ga0495585_0010898
1186 Ga0495585_0026757
1187 Ga0495585_0123676
1188 Ga0495596_0013160
1189 Ga0495596_0024505
1190 Ga0495596_0137219
1191 Ga0495583_0000104
1192 Ga0495583_0000366
1193 Ga0495606_0011889
1194 Ga0495606_0020830
1195 Ga0495606_0053935
1196 Ga0495606_0210000
1197 Ga0495608_0006970
1198 Ga0495608_0075952
1199 Ga0495610_0029233
1200 Ga0495616_0001943
1201 Ga0495616_0016848
1202 Ga0495616_0029544
1203 Ga0495628_0000059
1204 Ga0495631_0000414
1205 Ga0495632_0000139
1206 Ga0495632_0000477
1207 Ga0495637_0012766
1208 Ga0495643_0063578
1209 Ga0495644_0010075
1210 Ga0495644_0089782
1211 Ga0495648_0000055
1212 Ga0495648_0020636
1213 Ga0495663_0104618
1214 Ga0495642_0046401
1215 Ga0495642_0047667
1216 Ga0495642_0058619
1217 Ga0495642_0103957
1218 Ga0495642_0125508
1219 Ga0495652_0004625
1220 Ga0495652_0035985
1221 Ga0495652_0091223
1222 Ga0495654_0011360
1223 Ga0495654_0026180
1224 Ga0495654_0081653
1225 Ga0495654_0163312
1226 Ga0495665_0032630
1227 Ga0495586_0011796
1228 Ga0495586_0275999
1229 Ga0495598_0035539
1230 Ga0495609_0000930
1231 Ga0495609_0008139
1232 Ga0495609_0159729
1233 Ga0495621_0022591
1234 Ga0495597_0000031
1235 Ga0495597_0012098
1236 Ga0495597_0022101
1237 Ga0495597_0186011
1238 Ga0495645_0054792
1239 Ga0495622_0008305
1240 Ga0495622_0013458
1241 Ga0495633_0026036
1242 Ga0495633_0053875
1243 Ga0495668_0000230
1244 Ga0495668_0000683
1245 Ga0495668_0046564
1246 Ga0495668_0130743
1247 Ga0495668_0293019
1248 Ga0495634_0069678
1249 Ga0495611_0010575
1250 Ga0495625_0006092
1251 Ga0495625_0014435
1252 Ga0495625_0027871
1253 Ga0495635_0114149
1254 Ga0495659_0000031
1255 Ga0495659_0005633
1256 Ga0495659_0167153
1257 Ga0495661_0025164
1258 Ga0495661_0046217
1259 Ga0495588_0054168
1260 Ga0495588_0056107
1261 Ga0495623_0003538
1262 Ga0495646_0002246
1263 Ga0495646_0014471
1264 Ga0495658_0042769
1265 Ga0495658_0299131
1266 Ga0495624_0008986
1267 Ga0495624_0020855
1268 Ga0495670_0000737
1269 Ga0495670_0009408
1270 Ga0495670_0016868
1271 Ga0495671_0000345
1272 Ga0495671_0032839
1273 Ga0495671_0034132
1274 Ga0495589_0001296
1275 Ga0495660_0001900
1276 Ga0495660_0024935
1277 Ga0495660_0086226
1278 Ga0495660_0155519
1279 Ga0495581_0020199
1280 Ga0495581_0087231
1281 Ga0495604_0014340
1282 Ga0495636_0008076
1283 Ga0495636_0047087
1284 Ga0495636_0115545
1285 Ga0495636_0193880
1286 Ga0495674_0018515
1287 Ga0495672_0000697
1288 Ga0495672_0040990
1289 Ga0495676_0008592
1290 Ga0495680_0257541
1291 Ga0495683_0011108
1292 Ga0495683_0030881
1293 Ga0495683_0141529
1294 Ga0495683_0182511
1295 Ga0495687_000425
1296 Ga0495687_019949
1297 Ga0495675_0037891
1298 Ga0495685_033249
1299 Ga0495685_072105
1300 Ga0495685_102008
1301 Ga0495673_0013535
1302 Ga0495681_0086849
1303 Ga0495686_0001840
1304 Ga0495686_0001952
1305 Ga0495593_0003348
1306 Ga0495593_0034149
1307 Ga0495602_0012279
1308 Ga0495602_0147112
1309 Ga0495614_0004433
1310 Ga0495614_0028048
1311 Ga0496101_0025960
1312 Ga0496102_0000303
1313 Ga0496102_0008357
1314 Ga0496104_0016655
1315 Ga0496104_0599187
1316 Ga0496105_0053722
1317 Ga0496108_0092103
1318 Ga0496108_0135499
1319 Ga0496109_0021519
1320 Ga0496111_0291479
1321 Ga0496112_0022844
1322 Ga0496112_0745009
1323 Ga0496113_0398315
1324 Ga0496115_0218223
1325 Ga0496116_0015751
1326 Ga0496117_0035885
1327 Ga0496117_0044014
1328 Ga0496117_0106121
1329 Ga0496118_0000591
1330 Ga0496118_0008346
1331 Ga0496121_0008109
1332 Ga0496121_0035885
1333 Ga0496121_0038890
1334 Ga0496121_0051448
1335 Ga0496122_0004005
1336 Ga0496122_0035075
1337 Ga0496122_0067614
1338 Ga0496122_0099386
1339 Ga0496123_0000263
1340 Ga0496123_0012224
1341 Ga0496123_0037990
1342 Ga0496123_0048163
1343 Ga0496124_0006593
1344 Ga0496124_0190458
1345 Ga0496125_0001266
1346 Ga0496125_0033541
1347 Ga0496126_0067026
1348 Ga0501306_000671
1349 Ga0501310_000551
1350 Ga0495678_000793
1351 Ga0495682_0164343
1352 Ga0501032_0009626
1353 Ga0501037_0061129
1354 Ga0501038_0088818
1355 Ga0501227_005511
1356 Ga0501249_006469
1357 Ga0501225_0012633
1358 Ga0501262_000217
1359 Ga0501279_001240
1360 Ga0501035_0229866
1361 Ga0501044_0451515
1362 nmdc:mga0k408_44127_c1
1363 nmdc:mga07m45_1446_c1
1364 nmdc:mga07m45_42155_c1
1365 nmdc:mga09592_238137_c1
1366 nmdc:mga08y16_10865_c1
1367 nmdc:mga08y16_15423_c1
1368 nmdc:mga08y16_89743_c1
1369 nmdc:mga0n895_576398_c1
1370 nmdc:mga0a205_389369_c2
1371 nmdc:mga0sz30_139240_c1
1372 Ga0495601_0056834
1373 Ga0500643_015944
1374 Ga0500644_0245787
1375 Ga0500651_0000054
1376 Ga0500651_0008690
1377 Ga0500566_0029659
1378 Ga0500566_0042353
1379 Ga0500650_0222796
1380 Ga0500571_000005
1381 Ga0500572_078404
1382 Ga0500592_003168
1383 Ga0500593_001559
1384 Ga0500593_002899
1385 Ga0500594_0000763
1386 Ga0500595_001889
1387 Ga0500626_014812
1388 Ga0500655_000895
1389 Ga0500658_0024339
1390 Ga0500559_0084954
1391 Ga0500564_005575
1392 Ga0500568_0002238
1393 Ga0500573_0029700
1394 Ga0500574_000299
1395 Ga0500619_000249
1396 Ga0500638_004055
1397 Ga0500636_0058351
1398 Ga0500625_076085
1399 Ga0500645_011458
1400 Ga0500645_049388
1401 Ga0500596_008400
1402 Ga0500661_002371
1403 2511245911
1404 2511388063
1405 2521557993
1406 2553003125
1407 2599623234
1408 2599675548
1409 2599680839
1410 2599692854
1411 2643746399
1412 2643788260
1413 2643933124
1414 2644026609
1415 2644213810
1416 2644253938
1417 2644314373
1418 2644338728
1419 2644356709
1420 2644467161
1421 2738721247
1422 2738742102
1423 2738844555
1424 2738882744
1425 2739250545
1426 2739276065
1427 2739280446
1428 2739345411
1429 2765569120
1430 2808984020
1431 2809131108
1432 2809150557
1433 2819544802
1434 2819600369
1435 2819614859
1436 2831271837
1437 2838059675
1438 2839095993
1439 2842679835
1440 2842735769
1441 2842750922
1442 2852622072
1443 2885198063
1444 2885198671
1445 2885211949
1446 2899928460
1447 2904441230
1448 2904452435
1449 2904460966
1450 2904531829
1451 2904587945
1452 2904589895
1453 2904602719
1454 2919079777
1455 2919463933
1456 2923511242
1457 2928041381
1458 2928048223
1459 2928056065
1460 2928066453
1461 2928077403
1462 2928087702
1463 2928131178
1464 2929522949
1465 2945946069
1466 2945975668
1467 2954768889
1468 8002393554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13861

FLgD_tudor

FlgD Tudor-like domain

93

237

0.96

PF03963

FlgD

Flagellar hook capping protein - N-terminal region

6

85

0.93

PF13860

FlgD_ig

FlgD Ig-like domain

111

196

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eh9-assembly2.cif.gz_B crystal structure of the flagellar hook cap fragment from salmonella enterica serovar typhimurium 0.941 73 211
7eh9-assembly1.cif.gz_A crystal structure of the flagellar hook cap fragment from salmonella enterica serovar typhimurium 0.9037 71 211
7eh9-assembly2.cif.gz_B crystal structure of the flagellar hook cap fragment from salmonella enterica serovar typhimurium 0.9016 73 211
7eh9-assembly1.cif.gz_A crystal structure of the flagellar hook cap fragment from salmonella enterica serovar typhimurium 0.8908 71 211
7eha-assembly1.cif.gz_B crystal structure of the flagellar hook cap from salmonella enterica serovar typhimurium 0.8795 43 211
ID Description Score Start End Superfamily
3c12A01 Mainly Beta;Roll;SH3 type barrels.; 0.8888 178 207 2.30.30.910
3osvD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8624 85 179 2.60.40.4070
3osvD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.844 85 179 2.60.40.4070
2v3bA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8431 180 203 3.50.50.60
1xdiB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7272 180 208 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A447MU82-F1-model_v4 Flagellar hook formation protein FlgD 0.9449 107 194 GO:0009288
AF-A0A2N2T7W6-F1-model_v4 Flagellar hook assembly protein FlgD 0.932 45 211
AF-A0A2M7C106-F1-model_v4 Flagellar biosynthesis protein FlgD 0.9285 107 211
AF-A0A2N2T7W6-F1-model_v4 Flagellar hook assembly protein FlgD 0.9208 45 211
AF-A0A2M7C106-F1-model_v4 Flagellar biosynthesis protein FlgD 0.9202 107 211

Map