F477510

General Info

Members Datasets Scaffolds Average Seq Length
723 338 695 222

Family's Representative Sequence

Representative Sequence 3300041446|Ga0451794_34338|Ga0451794_34338_21_641
Length 206
Sequence VLPNFEERTAYGFKRMDPYTKLFEDRIIFLGVQVDDASADDVMAQLLVLESQDPDRDITLYINSPGGSFTALTAIYDTMQYVKPDIQTVCLGQAASAAAVLLAAGTKGKRLALPNARVLIHQPAMAGGDYGQASDIEIQANEVLRMRTWLEDTIALHSNRSVETVKKDIERDKILTAPMALEYGLVDQVLEGRKANTAVESAPSGS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
9 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
10 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
11 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
12 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
13 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
14 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
15 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
16 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
17 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
18 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
19 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
20 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
21 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
22 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
23 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
24 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
25 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
26 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
27 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
28 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
29 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
30 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
102 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
165 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
200 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
201 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
244 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
278 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
279 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
290 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
291 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
292 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
293 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
294 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
300 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
314 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
315 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
319 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
320 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
321 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
322 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
327 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
328 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
331 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
332 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
333 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.3
Metatranscriptomes 0.83
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.94
Nodule 0.28
Rhizoplane 6.64
Rhizosphere 68.88
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1224202 2162886007 Bacteria 1165
2 SwRhRL2b_contig_1416263 2162886007 Bacteria 1941
3 SwRhRL2b_contig_2569509 2162886007 Bacteria 2392
4 SwRhRL2b_contig_2664059 2162886007 Bacteria 809
5 SwRhRL2b_contig_3522643 2162886007 Bacteria 45893
6 SwRhRL2b_contig_635847 2162886007 Bacteria 869
7 JGI24748J21848_1009287 3300002074 Bacteria 1159
8 JGI24751J29686_10000031 3300002459 Bacteria 89551
9 JGI24751J29686_10000719 3300002459 Bacteria 8078
10 JGI24751J29686_10005318 3300002459 Bacteria 2620
11 JGI24751J29686_10035974 3300002459 Bacteria 1026
12 Ga0055536_1021245 3300003781 Bacteria 1975
13 Ga0055534_1004606 3300003784 Bacteria 3932
14 Ga0055530_10000522 3300003791 Bacteria 33291
15 Ga0055530_10017827 3300003791 Bacteria 2210
16 Ga0055531_10004791 3300003794 Bacteria 8082
17 Ga0055531_10028736 3300003794 Bacteria 1910
18 Ga0055531_10029712 3300003794 Bacteria 1854
19 Ga0065704_10000191 3300005289 Bacteria 318191
20 Ga0065704_10078946 3300005289 Bacteria 4297
21 Ga0065704_10079247 3300005289 Bacteria 4216
22 Ga0065704_10095287 3300005289 Bacteria 2495
23 Ga0065707_10087592 3300005295 Bacteria 4963
24 Ga0065707_10088698 3300005295 Bacteria 4571
25 Ga0065707_10204279 3300005295 Bacteria 1284
26 Ga0065707_10222156 3300005295 Bacteria 1221
27 Ga0070658_10000083 3300005327 Bacteria 89189
28 Ga0070658_10450792 3300005327 Bacteria 1108
29 Ga0070683_100057780 3300005329 Bacteria 3604
30 Ga0070690_100052816 3300005330 Bacteria 2599
31 Ga0070670_100000082 3300005331 Bacteria 91524
32 Ga0070670_100067274 3300005331 Bacteria 3074
33 Ga0070670_100083476 3300005331 Bacteria 2745
34 Ga0070670_100202480 3300005331 Bacteria 1725
35 Ga0070666_10008034 3300005335 Bacteria 6528
36 Ga0070666_10009267 3300005335 Bacteria 6134
37 Ga0070666_10305667 3300005335 Bacteria 1133
38 Ga0070666_10314165 3300005335 Bacteria 1117
39 Ga0070682_100198129 3300005337 Bacteria 1415
40 Ga0070682_100294758 3300005337 Bacteria 1188
41 Ga0068868_100024869 3300005338 Bacteria 4547
42 Ga0070660_100006436 3300005339 Bacteria 8143
43 Ga0070689_100326494 3300005340 Bacteria 1283
44 Ga0070689_100539569 3300005340 Bacteria 1004
45 Ga0070661_100020806 3300005344 Bacteria 4681
46 Ga0070692_10095011 3300005345 Bacteria 1626
47 Ga0070668_100002681 3300005347 Bacteria 13086
48 Ga0070668_100024005 3300005347 Bacteria 4617
49 Ga0070668_100034733 3300005347 Bacteria 3843
50 Ga0070668_100276260 3300005347 Bacteria 1402
51 Ga0070669_100000015 3300005353 Bacteria 197597
52 Ga0070669_100000068 3300005353 Bacteria 103282
53 Ga0070669_100000302 3300005353 Bacteria 38805
54 Ga0070669_100000981 3300005353 Bacteria 20797
55 Ga0070669_100097466 3300005353 Bacteria 2213
56 Ga0070669_100168004 3300005353 Bacteria 1709
57 Ga0070669_100168729 3300005353 Bacteria 1705
58 Ga0070675_100467551 3300005354 Bacteria 1133
59 Ga0070671_100000089 3300005355 Bacteria 58283
60 Ga0070671_100000134 3300005355 Bacteria 47424
61 Ga0070671_100001395 3300005355 Bacteria 18046
62 Ga0070671_100003720 3300005355 Bacteria 11966
63 Ga0070673_100046966 3300005364 Bacteria 3357
64 Ga0070659_100725902 3300005366 Bacteria 860
65 Ga0070667_100000003 3300005367 Bacteria 447715
66 Ga0070667_100000079 3300005367 Bacteria 119348
67 Ga0070667_100000596 3300005367 Bacteria 35305
68 Ga0070667_100001189 3300005367 Bacteria 23666
69 Ga0070667_100002832 3300005367 Bacteria 14969
70 Ga0070667_100010600 3300005367 Bacteria 7610
71 Ga0070667_100010961 3300005367 Bacteria 7495
72 Ga0070663_100232029 3300005455 Bacteria 1454
73 Ga0070678_100461791 3300005456 Bacteria 1114
74 Ga0070662_100030704 3300005457 Bacteria 3764
75 Ga0070662_100113008 3300005457 Bacteria 2071
76 Ga0070681_10024323 3300005458 Bacteria 6097
77 Ga0070681_10057594 3300005458 Bacteria 3866
78 Ga0070685_10019365 3300005466 Bacteria 3670
79 Ga0070679_100479771 3300005530 Bacteria 1188
80 Ga0070679_100570115 3300005530 Bacteria 1076
81 Ga0070679_100756616 3300005530 Bacteria 914
82 Ga0068853_100005144 3300005539 Bacteria 10223
83 Ga0068853_100011368 3300005539 Bacteria 7230
84 Ga0068853_100384275 3300005539 Bacteria 1311
85 Ga0068853_100471584 3300005539 Bacteria 1182
86 Ga0070665_100000269 3300005548 Bacteria 85401
87 Ga0070665_100079605 3300005548 Bacteria 3282
88 Ga0070665_100132020 3300005548 Bacteria 2499
89 Ga0068855_100002272 3300005563 Bacteria 23733
90 Ga0068855_100007914 3300005563 Bacteria 12842
91 Ga0068855_100013433 3300005563 Bacteria 9873
92 Ga0068855_100024810 3300005563 Bacteria 7173
93 Ga0068855_100044725 3300005563 Bacteria 5240
94 Ga0068855_100074599 3300005563 Bacteria 3939
95 Ga0068855_100157527 3300005563 Bacteria 2579
96 Ga0070664_100002256 3300005564 Bacteria 15513
97 Ga0068857_100070421 3300005577 Bacteria 3115
98 Ga0068857_100244826 3300005577 Bacteria 1642
99 Ga0068854_100154451 3300005578 Bacteria 1772
100 Ga0068854_100215145 3300005578 Bacteria 1518
101 Ga0068854_100338230 3300005578 Bacteria 1229
102 Ga0068856_100016862 3300005614 Bacteria 7079
103 Ga0068856_100298666 3300005614 Bacteria 1628
104 Ga0068852_100001919 3300005616 Bacteria 14168
105 Ga0068852_100318541 3300005616 Bacteria 1510
106 Ga0068852_100330095 3300005616 Bacteria 1484
107 Ga0068859_100009721 3300005617 Bacteria 9712
108 Ga0068859_100028521 3300005617 Bacteria 5597
109 Ga0068859_100061966 3300005617 Bacteria 3769
110 Ga0068859_100153303 3300005617 Bacteria 2380
111 Ga0068859_100622143 3300005617 Bacteria 1172
112 Ga0068864_100000177 3300005618 Bacteria 58504
113 Ga0068864_100039916 3300005618 Bacteria 4013
114 Ga0068864_100083152 3300005618 Bacteria 2811
115 Ga0068851_10013626 3300005834 Bacteria 3850
116 Ga0068863_100000072 3300005841 Bacteria 113996
117 Ga0068863_100009914 3300005841 Bacteria 9276
118 Ga0068863_100019937 3300005841 Bacteria 6415
119 Ga0068863_100025665 3300005841 Bacteria 5620
120 Ga0068863_100057842 3300005841 Bacteria 3669
121 Ga0068863_100067756 3300005841 Bacteria 3376
122 Ga0068863_100121456 3300005841 Bacteria 2491
123 Ga0068863_100296307 3300005841 Bacteria 1568
124 Ga0068858_100000629 3300005842 Bacteria 36674
125 Ga0068858_100002239 3300005842 Bacteria 19548
126 Ga0068858_100006270 3300005842 Bacteria 11591
127 Ga0068858_100035655 3300005842 Bacteria 4613
128 Ga0068858_100572951 3300005842 Bacteria 1094
129 Ga0068860_100000068 3300005843 Bacteria 179208
130 Ga0068860_100000247 3300005843 Bacteria 81527
131 Ga0068860_100010439 3300005843 Bacteria 9181
132 Ga0068860_100016506 3300005843 Bacteria 7202
133 Ga0068860_100052638 3300005843 Bacteria 3872
134 Ga0068860_100113915 3300005843 Bacteria 2586
135 Ga0068860_100180451 3300005843 Bacteria 2040
136 Ga0068862_100000006 3300005844 Bacteria 346828
137 Ga0068862_100001068 3300005844 Bacteria 26256
138 Ga0068862_100014472 3300005844 Bacteria 6546
139 Ga0068862_100028292 3300005844 Bacteria 4718
140 Ga0068862_100040797 3300005844 Bacteria 3946
141 Ga0075368_10000037 3300006042 Bacteria 31007
142 Ga0075368_10000105 3300006042 Bacteria 21597
143 Ga0075363_100008472 3300006048 Bacteria 4790
144 Ga0075363_100008959 3300006048 Bacteria 4686
145 Ga0075364_10080877 3300006051 Bacteria 2148
146 Ga0075364_10083270 3300006051 Bacteria 2117
147 Ga0075364_10117366 3300006051 Bacteria 1779
148 Ga0075364_10138467 3300006051 Bacteria 1636
149 Ga0075432_10000520 3300006058 Bacteria 11566
150 Ga0075432_10136357 3300006058 Bacteria 933
151 Ga0070712_100650330 3300006175 Bacteria 896
152 Ga0075362_10000064 3300006177 Bacteria 30699
153 Ga0075362_10006427 3300006177 Bacteria 4380
154 Ga0075362_10036123 3300006177 Bacteria 2160
155 Ga0075362_10042089 3300006177 Bacteria 2017
156 Ga0075367_10000128 3300006178 Bacteria 22259
157 Ga0075367_10030964 3300006178 Bacteria 3071
158 Ga0075369_10000970 3300006186 Bacteria 9559
159 Ga0075369_10004039 3300006186 Bacteria 5391
160 Ga0075366_10008535 3300006195 Bacteria 5700
161 Ga0075366_10224807 3300006195 Bacteria 1144
162 Ga0075366_10253919 3300006195 Bacteria 1073
163 Ga0097621_100014154 3300006237 Bacteria 5965
164 Ga0075370_10000015 3300006353 Bacteria 62164
165 Ga0075370_10005064 3300006353 Bacteria 6494
166 Ga0075370_10026108 3300006353 Bacteria 3233
167 Ga0075370_10051552 3300006353 Bacteria 2334
168 Ga0075370_10070644 3300006353 Bacteria 1997
169 Ga0075370_10071592 3300006353 Bacteria 1984
170 Ga0075370_10137017 3300006353 Bacteria 1430
171 Ga0075370_10151338 3300006353 Bacteria 1360
172 Ga0068871_100041847 3300006358 Bacteria 3675
173 Ga0068865_100117514 3300006881 Bacteria 1971
174 Ga0097620_100009721 3300006931 Bacteria 9712
175 Ga0097620_100028521 3300006931 Bacteria 5597
176 Ga0097620_100061965 3300006931 Bacteria 3769
177 Ga0097620_100153306 3300006931 Bacteria 2380
178 Ga0097620_100622132 3300006931 Bacteria 1172
179 Ga0079104_1018187 3300006946 Bacteria 1999
180 Ga0099795_10000004 3300007788 Bacteria 108633
181 Ga0105251_10005048 3300009011 Bacteria 8752
182 Ga0105250_10005410 3300009092 Bacteria 5732
183 Ga0105240_10000353 3300009093 Bacteria 86068
184 Ga0105240_10009142 3300009093 Bacteria 14064
185 Ga0105240_10011684 3300009093 Bacteria 12201
186 Ga0105245_10001970 3300009098 Bacteria 18634
187 Ga0105245_10155936 3300009098 Bacteria 2162
188 Ga0105247_10072080 3300009101 Bacteria 2162
189 Ga0105247_10140211 3300009101 Bacteria 1583
190 Ga0105241_10293156 3300009174 Bacteria 1394
191 Ga0105241_10369037 3300009174 Bacteria 1251
192 Ga0105242_10010167 3300009176 Bacteria 7207
193 Ga0105248_10008931 3300009177 Bacteria 11020
194 Ga0105248_10014154 3300009177 Bacteria 8782
195 Ga0105248_10041442 3300009177 Bacteria 5162
196 Ga0105248_10064851 3300009177 Bacteria 4100
197 Ga0105248_10356343 3300009177 Bacteria 1647
198 Ga0105249_10054869 3300009553 Bacteria 3644
199 Ga0105249_10133867 3300009553 Bacteria 2369
200 Ga0105249_10258778 3300009553 Bacteria 1728
201 Ga0105249_10430744 3300009553 Bacteria 1355
202 Ga0105148_100116 3300009978 Bacteria 12323
203 Ga0105147_102108 3300009982 Bacteria 1637
204 Ga0099796_10000006 3300010159 Bacteria 66689
205 Ga0105246_10000087 3300011119 Bacteria 39160
206 Ga0157373_10008651 3300013100 Bacteria 7552
207 Ga0157373_10041584 3300013100 Bacteria 3287
208 Ga0157371_10009506 3300013102 Bacteria 7647
209 Ga0157371_10016337 3300013102 Bacteria 5544
210 Ga0157371_10026448 3300013102 Bacteria 4218
211 Ga0157371_10254931 3300013102 Bacteria 1264
212 Ga0157370_10005931 3300013104 Bacteria 13613
213 Ga0157370_10675602 3300013104 Bacteria 943
214 Ga0157369_10001820 3300013105 Bacteria 25807
215 Ga0163162_10079818 3300013306 Bacteria 3338
216 Ga0163162_10300672 3300013306 Bacteria 1737
217 Ga0163162_10349642 3300013306 Bacteria 1611
218 Ga0157372_10448838 3300013307 Bacteria 1503
219 Ga0157372_11556998 3300013307 Bacteria 761
220 Ga0157375_10020343 3300013308 Bacteria 6060
221 Ga0157375_10042154 3300013308 Bacteria 4415
222 Ga0157375_10587825 3300013308 Bacteria 1273
223 Ga0157380_10000114 3300014326 Bacteria 44326
224 Ga0157380_10069482 3300014326 Bacteria 2842
225 Ga0157377_10207225 3300014745 Bacteria 1248
226 Ga0157379_10005229 3300014968 Bacteria 11145
227 Ga0157379_10177370 3300014968 Bacteria 1924
228 Ga0157376_10004074 3300014969 Bacteria 10113
229 Ga0163161_10001464 3300017792 Bacteria 17451
230 Ga0163161_10098148 3300017792 Bacteria 2177
231 Ga0163161_10244060 3300017792 Bacteria 1398
232 Ga0209565_1029745 3300025263 Bacteria 1071
233 Ga0209675_1001006 3300025291 Bacteria 17716
234 Ga0209676_1000557 3300025292 Bacteria 56440
235 Ga0209676_1002559 3300025292 Bacteria 12585
236 Ga0209676_1019878 3300025292 Bacteria 2298
237 Ga0209025_1022462 3300025294 Bacteria 3341
238 Ga0209025_1060056 3300025294 Bacteria 1430
239 Ga0209050_1000017 3300025298 Bacteria 728928
240 Ga0209050_1000279 3300025298 Bacteria 109034
241 Ga0209050_1013681 3300025298 Bacteria 3577
242 Ga0209050_1040295 3300025298 Bacteria 1303
243 Ga0209257_1001118 3300025304 Bacteria 34674
244 Ga0209257_1001176 3300025304 Bacteria 33109
245 Ga0209257_1001719 3300025304 Bacteria 24483
246 Ga0209257_1020289 3300025304 Bacteria 2463
247 Ga0207697_10031958 3300025315 Bacteria 2153
248 Ga0207697_10062846 3300025315 Bacteria 1547
249 Ga0207697_10126261 3300025315 Bacteria 1103
250 Ga0207696_1002487 3300025711 Bacteria 9005
251 Ga0207713_1004184 3300025735 Bacteria 9465
252 Ga0207713_1035091 3300025735 Bacteria 2169
253 Ga0207710_10072197 3300025900 Bacteria 1584
254 Ga0207710_10110281 3300025900 Bacteria 1306
255 Ga0207680_10024028 3300025903 Bacteria 3338
256 Ga0207680_10032272 3300025903 Bacteria 2975
257 Ga0207680_10066969 3300025903 Bacteria 2210
258 Ga0207680_10237526 3300025903 Bacteria 1255
259 Ga0207680_10367909 3300025903 Bacteria 1012
260 Ga0207705_10000009 3300025909 Bacteria 576128
261 Ga0207705_10001354 3300025909 Bacteria 19563
262 Ga0207705_10005547 3300025909 Bacteria 9434
263 Ga0207705_10011717 3300025909 Bacteria 6335
264 Ga0207705_10397501 3300025909 Bacteria 1066
265 Ga0207705_10400742 3300025909 Bacteria 1061
266 Ga0207654_10151618 3300025911 Bacteria 1488
267 Ga0207707_10072692 3300025912 Bacteria 2998
268 Ga0207707_10092771 3300025912 Bacteria 2638
269 Ga0207707_10108767 3300025912 Bacteria 2424
270 Ga0207707_10428571 3300025912 Bacteria 1133
271 Ga0207695_10002735 3300025913 Bacteria 25716
272 Ga0207695_10008077 3300025913 Bacteria 13239
273 Ga0207695_10012520 3300025913 Bacteria 10172
274 Ga0207657_10001362 3300025919 Bacteria 26044
275 Ga0207649_10018161 3300025920 Bacteria 3994
276 Ga0207652_10012713 3300025921 Bacteria 6807
277 Ga0207652_10106091 3300025921 Bacteria 2486
278 Ga0207652_10131554 3300025921 Bacteria 2232
279 Ga0207681_10000001 3300025923 Bacteria 1105841
280 Ga0207681_10000105 3300025923 Bacteria 71882
281 Ga0207681_10000313 3300025923 Bacteria 35417
282 Ga0207681_10003146 3300025923 Bacteria 10373
283 Ga0207681_10044921 3300025923 Bacteria 2963
284 Ga0207681_10067170 3300025923 Bacteria 2485
285 Ga0207681_10146749 3300025923 Bacteria 1763
286 Ga0207681_10149537 3300025923 Bacteria 1748
287 Ga0207681_10423043 3300025923 Bacteria 1079
288 Ga0207694_10025058 3300025924 Bacteria 4533
289 Ga0207650_10000050 3300025925 Bacteria 169589
290 Ga0207650_10039490 3300025925 Bacteria 3449
291 Ga0207650_10071376 3300025925 Bacteria 2612
292 Ga0207650_10092278 3300025925 Bacteria 2316
293 Ga0207650_10145132 3300025925 Bacteria 1868
294 Ga0207659_10213193 3300025926 Bacteria 1549
295 Ga0207687_10026260 3300025927 Bacteria 3898
296 Ga0207687_10069633 3300025927 Bacteria 2510
297 Ga0207664_10843554 3300025929 Bacteria 824
298 Ga0207644_10000005 3300025931 Bacteria 441948
299 Ga0207644_10000160 3300025931 Bacteria 49009
300 Ga0207644_10000276 3300025931 Bacteria 34060
301 Ga0207644_10005221 3300025931 Bacteria 8480
302 Ga0207644_10139843 3300025931 Bacteria 1863
303 Ga0207644_10205454 3300025931 Bacteria 1555
304 Ga0207690_10090933 3300025932 Bacteria 2156
305 Ga0207690_10160664 3300025932 Bacteria 1674
306 Ga0207706_10000264 3300025933 Bacteria 57037
307 Ga0207706_10005923 3300025933 Bacteria 11369
308 Ga0207706_10015282 3300025933 Bacteria 6942
309 Ga0207704_10081223 3300025938 Bacteria 2096
310 Ga0207711_10002611 3300025941 Bacteria 15995
311 Ga0207711_10002631 3300025941 Bacteria 15903
312 Ga0207711_10157593 3300025941 Bacteria 2053
313 Ga0207711_10179752 3300025941 Bacteria 1923
314 Ga0207689_10219317 3300025942 Bacteria 1571
315 Ga0207667_10001954 3300025949 Bacteria 25835
316 Ga0207667_10005167 3300025949 Bacteria 15946
317 Ga0207667_10027172 3300025949 Bacteria 6236
318 Ga0207667_10031548 3300025949 Bacteria 5720
319 Ga0207667_10048740 3300025949 Bacteria 4478
320 Ga0207651_10048862 3300025960 Bacteria 2863
321 Ga0207712_10153623 3300025961 Bacteria 1780
322 Ga0207668_10000045 3300025972 Bacteria 103160
323 Ga0207668_10012461 3300025972 Bacteria 5205
324 Ga0207668_10016913 3300025972 Bacteria 4563
325 Ga0207668_10087069 3300025972 Bacteria 2283
326 Ga0207668_10218981 3300025972 Bacteria 1527
327 Ga0207668_10781698 3300025972 Bacteria 844
328 Ga0207640_10131617 3300025981 Bacteria 1809
329 Ga0207640_10138693 3300025981 Bacteria 1769
330 Ga0207640_10232176 3300025981 Bacteria 1420
331 Ga0207658_10000002 3300025986 Bacteria 1364188
332 Ga0207658_10002247 3300025986 Bacteria 14307
333 Ga0207658_10004812 3300025986 Bacteria 9338
334 Ga0207658_10006902 3300025986 Bacteria 7731
335 Ga0207658_10017257 3300025986 Bacteria 4973
336 Ga0207658_10039180 3300025986 Bacteria 3418
337 Ga0207658_10096249 3300025986 Bacteria 2308
338 Ga0207677_10065767 3300026023 Bacteria 2531
339 Ga0207703_10000862 3300026035 Bacteria 29697
340 Ga0207703_10005238 3300026035 Bacteria 10464
341 Ga0207703_10017314 3300026035 Bacteria 5625
342 Ga0207703_10096203 3300026035 Bacteria 2499
343 Ga0207639_10000652 3300026041 Bacteria 23918
344 Ga0207639_10013955 3300026041 Bacteria 5637
345 Ga0207639_10086936 3300026041 Bacteria 2491
346 Ga0207678_10010061 3300026067 Bacteria 8299
347 Ga0207641_10000084 3300026088 Bacteria 133555
348 Ga0207641_10004253 3300026088 Bacteria 12470
349 Ga0207641_10014418 3300026088 Bacteria 6476
350 Ga0207641_10074389 3300026088 Bacteria 2930
351 Ga0207641_10084699 3300026088 Bacteria 2760
352 Ga0207641_10162128 3300026088 Bacteria 2033
353 Ga0207641_10594574 3300026088 Bacteria 1083
354 Ga0207648_10202867 3300026089 Bacteria 1759
355 Ga0207676_10000004 3300026095 Bacteria 725417
356 Ga0207676_10003660 3300026095 Bacteria 10868
357 Ga0207676_10041001 3300026095 Bacteria 3551
358 Ga0207674_10016614 3300026116 Bacteria 8047
359 Ga0207674_10036217 3300026116 Bacteria 5144
360 Ga0207674_10156519 3300026116 Bacteria 2234
361 Ga0207674_10321678 3300026116 Bacteria 1496
362 Ga0207674_10352766 3300026116 Bacteria 1422
363 Ga0207674_10495110 3300026116 Bacteria 1181
364 Ga0207675_100000295 3300026118 Bacteria 48065
365 Ga0207683_10227364 3300026121 Bacteria 1701
366 Ga0207698_10000084 3300026142 Bacteria 62453
367 Ga0207698_10096807 3300026142 Bacteria 2433
368 Ga0207698_10296588 3300026142 Bacteria 1503
369 Ga0207698_10653695 3300026142 Bacteria 1042
370 Ga0209281_1036510 3300027111 Bacteria 849
371 Ga0209179_1000009 3300027512 Bacteria 76604
372 Ga0209813_10000030 3300027866 Bacteria 65385
373 Ga0209813_10000086 3300027866 Bacteria 34481
374 Ga0209974_10012619 3300027876 Bacteria 2822
375 Ga0268266_10000334 3300028379 Bacteria 73724
376 Ga0268266_10064439 3300028379 Bacteria 3166
377 Ga0268266_10113198 3300028379 Bacteria 2406
378 Ga0268265_10000002 3300028380 Bacteria 1035381
379 Ga0268265_10000946 3300028380 Bacteria 26688
380 Ga0268265_10009588 3300028380 Bacteria 6539
381 Ga0268265_10019703 3300028380 Bacteria 4696
382 Ga0268265_10052298 3300028380 Bacteria 3088
383 Ga0268265_10334085 3300028380 Bacteria 1377
384 Ga0268265_10673199 3300028380 Bacteria 997
385 Ga0268264_10000103 3300028381 Bacteria 222439
386 Ga0268264_10000253 3300028381 Bacteria 98587
387 Ga0268264_10009442 3300028381 Bacteria 8079
388 Ga0268264_10039602 3300028381 Bacteria 3894
389 Ga0268264_10051702 3300028381 Bacteria 3425
390 Ga0268264_10085974 3300028381 Bacteria 2701
391 Ga0268264_10089499 3300028381 Bacteria 2650
392 Ga0268264_10102485 3300028381 Bacteria 2491
393 Ga0265338_10222996 3300028800 Bacteria 1407
394 Ga0265340_10115545 3300031247 Bacteria 1237
395 Ga0307513_10001613 3300031456 Bacteria 32387
396 Ga0307513_10208649 3300031456 Bacteria 1787
397 Ga0307408_100252426 3300031548 Bacteria 1455
398 Ga0307408_100545711 3300031548 Bacteria 1022
399 Ga0307508_10032618 3300031616 Bacteria 4705
400 Ga0307405_10003498 3300031731 Bacteria 7227
401 Ga0307405_10272346 3300031731 Bacteria 1270
402 Ga0307405_10436721 3300031731 Bacteria 1034
403 Ga0307413_10012334 3300031824 Bacteria 4250
404 Ga0307413_10189132 3300031824 Bacteria 1476
405 Ga0307413_10868285 3300031824 Bacteria 764
406 Ga0307413_10876693 3300031824 Bacteria 760
407 Ga0307410_10194546 3300031852 Bacteria 1544
408 Ga0307406_10571546 3300031901 Bacteria 928
409 Ga0307412_10001508 3300031911 Bacteria 12930
410 Ga0307412_10024702 3300031911 Bacteria 3712
411 Ga0307412_10175744 3300031911 Bacteria 1605
412 Ga0307412_10242702 3300031911 Bacteria 1394
413 Ga0307412_10547447 3300031911 Bacteria 971
414 Ga0307409_100030100 3300031995 Bacteria 3895
415 Ga0307416_100049825 3300032002 Bacteria 3333
416 Ga0307414_10000705 3300032004 Bacteria 17072
417 Ga0307414_10001084 3300032004 Bacteria 13916
418 Ga0307414_10029850 3300032004 Bacteria 3554
419 Ga0307414_10037742 3300032004 Bacteria 3237
420 Ga0307414_10056773 3300032004 Bacteria 2748
421 Ga0307414_10134263 3300032004 Bacteria 1926
422 Ga0307414_10219753 3300032004 Bacteria 1559
423 Ga0307414_10248363 3300032004 Bacteria 1477
424 Ga0307414_10423646 3300032004 Bacteria 1161
425 Ga0307414_10491403 3300032004 Bacteria 1084
426 Ga0307414_10623916 3300032004 Bacteria 969
427 Ga0307411_10104385 3300032005 Bacteria 2012
428 Ga0307411_10775929 3300032005 Bacteria 842
429 Ga0307415_100076393 3300032126 Bacteria 2374
430 Ga0316593_10207597 3300032168 Bacteria 725
431 Ga0373938_0090870 3300034957 Bacteria 755
432 Ga0373937_0589995 3300036401 Bacteria 1055
433 Ga0316582_0002953 3300036647 Bacteria 8188
434 Ga0316584_0360708 3300036712 Bacteria 1042
435 Ga0373925_0135830 3300037068 Bacteria 1922
436 Ga0395900_0680055 3300037418 Bacteria 964
437 Ga0395905_0588016 3300037471 Bacteria 1015
438 Ga0436365_0809192 3300039437 Bacteria 1880
439 Ga0436365_1004127 3300039437 Bacteria 910
440 Ga0436361_0795199 3300039447 Bacteria 71391
441 Ga0436362_0652764 3300039453 Bacteria 11891
442 Ga0451794_34338 3300041446 Bacteria 880
443 Ga0451793_1178553 3300041452 Bacteria 1835
444 Ga0451795_0306834 3300041456 Bacteria 2576
445 Ga0451798_0275487 3300041458 Bacteria 1568
446 Ga0451837_1228643 3300041494 Bacteria 1442
447 Ga0451839_1432329 3300041496 Bacteria 867
448 Ga0453684_0305197 3300044712 Bacteria 1808
449 Ga0453684_0840433 3300044712 Bacteria 987
450 Ga0451576_0000393 3300045051 Bacteria 101814
451 Ga0451576_0233962 3300045051 Bacteria 1919
452 Ga0451576_0745474 3300045051 Bacteria 1029
453 Ga0495627_001098 3300046453 Bacteria 17664
454 Ga0495629_0000146 3300046459 Bacteria 61760
455 Ga0495638_0073995 3300046460 Bacteria 2078
456 Ga0495650_0002319 3300046471 Bacteria 15764
457 Ga0495650_0003325 3300046471 Bacteria 11850
458 Ga0495580_0003640 3300046472 Bacteria 13053
459 Ga0495639_0101109 3300046475 Bacteria 1361
460 Ga0495596_0001173 3300046500 Bacteria 15369
461 Ga0495596_0004200 3300046500 Bacteria 7076
462 Ga0495607_0016080 3300046501 Bacteria 4834
463 Ga0495583_0023741 3300046506 Bacteria 3095
464 Ga0495583_0042264 3300046506 Bacteria 2130
465 Ga0495606_0055232 3300046507 Bacteria 2569
466 Ga0495610_0000061 3300046512 Bacteria 130986
467 Ga0495610_0000419 3300046512 Bacteria 43586
468 Ga0495610_0000439 3300046512 Bacteria 42869
469 Ga0495610_0072290 3300046512 Bacteria 1606
470 Ga0495620_0213274 3300046515 Bacteria 740
471 Ga0495628_0109223 3300046516 Bacteria 2129
472 Ga0495632_0000105 3300046519 Bacteria 85761
473 Ga0495632_0090193 3300046519 Bacteria 1454
474 Ga0495643_0000047 3300046522 Bacteria 217914
475 Ga0495643_0000292 3300046522 Bacteria 70858
476 Ga0495643_0011234 3300046522 Bacteria 5468
477 Ga0495643_0094972 3300046522 Bacteria 1534
478 Ga0495648_0100538 3300046524 Bacteria 1597
479 Ga0495663_0000009 3300046525 Bacteria 256308
480 Ga0495642_0012505 3300046528 Bacteria 3272
481 Ga0495654_0093743 3300046530 Bacteria 1390
482 Ga0495654_0155411 3300046530 Bacteria 1008
483 Ga0495654_0178414 3300046530 Bacteria 921
484 Ga0495609_0009392 3300046538 Bacteria 4733
485 Ga0495645_0000664 3300046543 Bacteria 23737
486 Ga0495633_0000178 3300046558 Bacteria 82451
487 Ga0495633_0027054 3300046558 Bacteria 2807
488 Ga0495633_0069624 3300046558 Bacteria 1642
489 Ga0495667_0010947 3300046559 Bacteria 6130
490 Ga0495668_0000004 3300046616 Bacteria 574236
491 Ga0495668_0149714 3300046616 Bacteria 1278
492 Ga0495668_0354815 3300046616 Bacteria 805
493 Ga0495625_0000553 3300046660 Bacteria 54796
494 Ga0495625_0045181 3300046660 Bacteria 3186
495 Ga0495625_0131051 3300046660 Bacteria 1698
496 Ga0495625_0209164 3300046660 Bacteria 1283
497 Ga0495588_0039766 3300046674 Bacteria 2397
498 Ga0495599_0341859 3300046678 Bacteria 898
499 Ga0495646_0278540 3300046680 Bacteria 889
500 Ga0495658_0191175 3300046683 Bacteria 1273
501 Ga0495613_0235183 3300046689 Bacteria 1282
502 Ga0495624_0017329 3300046690 Bacteria 4838
503 Ga0495670_0137867 3300046691 Bacteria 1274
504 Ga0495670_0340179 3300046691 Bacteria 807
505 Ga0495671_0000038 3300046692 Bacteria 173693
506 Ga0495671_0013917 3300046692 Bacteria 4340
507 Ga0495671_0015368 3300046692 Bacteria 4103
508 Ga0495649_0332095 3300046694 Bacteria 770
509 Ga0495581_0001065 3300047315 Bacteria 14886
510 Ga0495581_0100468 3300047315 Bacteria 1680
511 Ga0495674_0103376 3300047319 Bacteria 2422
512 Ga0495676_0189371 3300047321 Bacteria 1436
513 Ga0495675_0064124 3300047444 Bacteria 2324
514 Ga0495679_016873 3300047446 Bacteria 2629
515 Ga0495681_0001474 3300047470 Bacteria 17572
516 Ga0495686_0063113 3300047472 Bacteria 2296
517 Ga0495614_0025746 3300048089 Bacteria 2537
518 Ga0495615_0000267 3300048090 Bacteria 9871
519 Ga0495626_0006288 3300048091 Bacteria 6779
520 Ga0496100_0045960 3300048903 Bacteria 2804
521 Ga0496100_0369263 3300048903 Bacteria 1087
522 Ga0496101_0062363 3300048904 Bacteria 2710
523 Ga0496101_0157300 3300048904 Bacteria 1741
524 Ga0496102_0007356 3300048905 Bacteria 9406
525 Ga0496102_0040281 3300048905 Bacteria 4225
526 Ga0496102_0123984 3300048905 Bacteria 2414
527 Ga0496102_0586123 3300048905 Bacteria 1038
528 Ga0496102_0681090 3300048905 Bacteria 951
529 Ga0496103_0000289 3300048906 Bacteria 47033
530 Ga0496103_0003521 3300048906 Bacteria 9565
531 Ga0496104_0002529 3300048907 Bacteria 15756
532 Ga0496104_0008321 3300048907 Bacteria 9212
533 Ga0496104_0034031 3300048907 Bacteria 4749
534 Ga0496105_0004036 3300048908 Bacteria 10984
535 Ga0496105_0008999 3300048908 Bacteria 7789
536 Ga0496105_0023629 3300048908 Bacteria 4988
537 Ga0496105_0027299 3300048908 Bacteria 4662
538 Ga0496105_0036533 3300048908 Bacteria 4047
539 Ga0496105_0276746 3300048908 Bacteria 1354
540 Ga0496106_0080568 3300048909 Bacteria 2500
541 Ga0496106_0094663 3300048909 Bacteria 2310
542 Ga0496107_0026728 3300048910 Bacteria 4094
543 Ga0496107_0062193 3300048910 Bacteria 2704
544 Ga0496107_0212975 3300048910 Bacteria 1437
545 Ga0496108_0024686 3300048911 Bacteria 4951
546 Ga0496108_0149032 3300048911 Bacteria 2018
547 Ga0496109_0146015 3300048912 Bacteria 2213
548 Ga0496109_0301809 3300048912 Bacteria 1510
549 Ga0496110_0002075 3300048913 Bacteria 14933
550 Ga0496110_0188020 3300048913 Bacteria 1875
551 Ga0496110_0189159 3300048913 Bacteria 1869
552 Ga0496111_0004248 3300048914 Bacteria 9027
553 Ga0496111_0392086 3300048914 Bacteria 1026
554 Ga0496111_0501573 3300048914 Bacteria 893
555 Ga0496112_0324684 3300048915 Bacteria 1483
556 Ga0496112_0769744 3300048915 Bacteria 888
557 Ga0496113_0057000 3300048916 Bacteria 2934
558 Ga0496113_0518854 3300048916 Bacteria 956
559 Ga0496114_0002211 3300048917 Bacteria 14813
560 Ga0496114_0021180 3300048917 Bacteria 5287
561 Ga0496114_0094079 3300048917 Bacteria 2549
562 Ga0496114_0132124 3300048917 Bacteria 2156
563 Ga0496115_0104706 3300048918 Bacteria 2322
564 Ga0496116_0000017 3300048919 Bacteria 554463
565 Ga0496116_0067918 3300048919 Bacteria 2274
566 Ga0496116_0154869 3300048919 Bacteria 1266
567 Ga0496116_0344750 3300048919 Bacteria 685
568 Ga0496117_0005177 3300048920 Bacteria 13905
569 Ga0496117_0046495 3300048920 Bacteria 3121
570 Ga0496117_0056392 3300048920 Bacteria 2736
571 Ga0496117_0082213 3300048920 Bacteria 2110
572 Ga0496118_0010426 3300048921 Bacteria 9205
573 Ga0496118_0025636 3300048921 Bacteria 5047
574 Ga0496118_0124788 3300048921 Bacteria 1669
575 Ga0496119_0015252 3300048922 Bacteria 5935
576 Ga0496119_0145337 3300048922 Bacteria 1276
577 Ga0496120_0038515 3300048923 Bacteria 2827
578 Ga0496120_0166564 3300048923 Bacteria 1094
579 Ga0496121_0000022 3300048924 Bacteria 472849
580 Ga0496121_0003524 3300048924 Bacteria 22206
581 Ga0496121_0007492 3300048924 Bacteria 13178
582 Ga0496121_0060403 3300048924 Bacteria 3117
583 Ga0496121_0133249 3300048924 Bacteria 1855
584 Ga0496122_0000927 3300048925 Bacteria 53530
585 Ga0496122_0016481 3300048925 Bacteria 6986
586 Ga0496122_0051830 3300048925 Bacteria 3113
587 Ga0496123_0000278 3300048926 Bacteria 100746
588 Ga0496123_0001559 3300048926 Bacteria 31386
589 Ga0496123_0002247 3300048926 Bacteria 24430
590 Ga0496123_0045177 3300048926 Bacteria 3003
591 Ga0496123_0094923 3300048926 Bacteria 1756
592 Ga0496124_0011768 3300048927 Bacteria 8723
593 Ga0496124_0023962 3300048927 Bacteria 5558
594 Ga0496124_0047414 3300048927 Bacteria 3676
595 Ga0496124_0298372 3300048927 Bacteria 1165
596 Ga0496125_0002203 3300048928 Bacteria 25991
597 Ga0496125_0008773 3300048928 Bacteria 10514
598 Ga0496125_0015399 3300048928 Bacteria 7401
599 Ga0496125_0071804 3300048928 Bacteria 2702
600 Ga0496125_0254048 3300048928 Bacteria 1107
601 Ga0496126_0000661 3300048929 Bacteria 63847
602 Ga0496126_0018782 3300048929 Bacteria 6836
603 Ga0496126_0121534 3300048929 Bacteria 2264
604 Ga0501307_023140 3300049162 Bacteria 821
605 Ga0495682_0065214 3300049460 Bacteria 1313
606 Ga0501300_010361 3300049523 Bacteria 1359
607 Ga0501335_000731 3300049551 Bacteria 2255
608 Ga0501338_02973 3300049554 Bacteria 985
609 Ga0501031_0158644 3300049568 Bacteria 1479
610 Ga0501036_0283879 3300049572 Bacteria 1385
611 Ga0501039_0098928 3300049575 Bacteria 2276
612 Ga0501046_0169124 3300049580 Bacteria 1641
613 Ga0501047_0001720 3300049581 Bacteria 21287
614 Ga0501047_0350443 3300049581 Bacteria 1313
615 Ga0501069_0181740 3300049585 Bacteria 1216
616 Ga0501074_0228179 3300049590 Bacteria 1326
617 Ga0501077_0109485 3300049593 Bacteria 1750
618 Ga0501223_000012 3300049663 Bacteria 75953
619 Ga0501235_003444 3300049669 Bacteria 3423
620 Ga0501235_014329 3300049669 Bacteria 1748
621 Ga0501246_001750 3300049676 Bacteria 1681
622 Ga0501249_000043 3300049679 Bacteria 52821
623 Ga0501225_0000264 3300049705 Bacteria 16586
624 Ga0501225_0003322 3300049705 Bacteria 4901
625 Ga0501225_0103574 3300049705 Bacteria 833
626 Ga0501245_010046 3300049708 Bacteria 1365
627 Ga0501080_0080815 3300049742 Bacteria 3021
628 Ga0501083_0255418 3300049744 Bacteria 1141
629 Ga0501035_0126826 3300049822 Bacteria 2228
630 Ga0501044_0001652 3300049823 Bacteria 26175
631 Ga0501044_0292723 3300049823 Bacteria 1559
632 Ga0501204_004333 3300049850 Bacteria 1526
633 nmdc:mga03683_113_c1 3300050489 Bacteria 27805
634 nmdc:mga03683_162_c1 3300050489 Bacteria 22492
635 nmdc:mga03683_26924_c1 3300050489 Bacteria 1537
636 nmdc:mga03683_7936_c1 3300050489 Bacteria 3709
637 nmdc:mga03n38_11272_c1 3300050490 Bacteria 3324
638 nmdc:mga03n38_76008_c1 3300050490 Bacteria 1566
639 nmdc:mga00v17_101410_c1 3300050491 Bacteria 1817
640 nmdc:mga00v17_1860_c2 3300050491 Bacteria 8856
641 nmdc:mga00v17_74187_c1 3300050491 Bacteria 2114
642 nmdc:mga0k408_118710_c1 3300050493 Bacteria 1566
643 nmdc:mga0k408_23049_c1 3300050493 Bacteria 3509
644 nmdc:mga0k408_9_c2 3300050493 Bacteria 64937
645 nmdc:mga06z11_211_c1 3300050494 Bacteria 23476
646 nmdc:mga06z11_2260_c1 3300050494 Bacteria 7328
647 nmdc:mga04h51_117_c1 3300050495 Bacteria 23249
648 nmdc:mga04h51_802_c1 3300050495 Bacteria 7297
649 nmdc:mga07m45_13_c1 3300050496 Bacteria 65600
650 nmdc:mga07m45_160939_c1 3300050496 Bacteria 1303
651 nmdc:mga07m45_226805_c1 3300050496 Bacteria 1087
652 nmdc:mga07m45_27084_c1 3300050496 Bacteria 3155
653 nmdc:mga07m45_32_c1 3300050496 Bacteria 78063
654 nmdc:mga07m45_96539_c1 3300050496 Bacteria 1696
655 nmdc:mga0qj67_93735_c1 3300050509 Bacteria 2415
656 nmdc:mga06r32_73625_c1 3300050510 Bacteria 3310
657 nmdc:mga08y16_69568_c1 3300050511 Bacteria 3670
658 nmdc:mga0sz30_1711_c1 3300050516 Bacteria 7791
659 nmdc:mga0sz30_532_c1 3300050516 Bacteria 14177
660 Ga0500643_000001 3300053087 Bacteria 1440111
661 Ga0500643_015584 3300053087 Bacteria 2602
662 Ga0500646_0035843 3300053090 Bacteria 1380
663 Ga0500651_0019570 3300053093 Bacteria 4207
664 Ga0500650_0082230 3300053098 Bacteria 1506
665 Ga0500569_030913 3300053109 Bacteria 1502
666 Ga0500592_010955 3300053116 Bacteria 1448
667 Ga0500594_0013935 3300053118 Bacteria 1919
668 Ga0500607_000007 3300053121 Bacteria 134097
669 Ga0500607_013728 3300053121 Bacteria 4723
670 Ga0500608_000153 3300053122 Bacteria 28720
671 Ga0500614_012464 3300053123 Bacteria 1856
672 Ga0500642_0003221 3300053130 Bacteria 4902
673 Ga0500652_000262 3300053131 Bacteria 19666
674 Ga0500559_0001283 3300053136 Bacteria 14595
675 Ga0500564_032278 3300053138 Bacteria 2414
676 Ga0500568_0003830 3300053139 Bacteria 8217
677 Ga0500568_0123340 3300053139 Bacteria 965
678 Ga0500577_0038792 3300053142 Bacteria 1722
679 Ga0500590_001101 3300053148 Bacteria 10620
680 Ga0500604_0067657 3300053151 Bacteria 1134
681 Ga0500616_0001386 3300053153 Bacteria 23416
682 Ga0500622_0000167 3300053156 Bacteria 70349
683 Ga0500622_0000264 3300053156 Bacteria 53598
684 Ga0500622_0001913 3300053156 Bacteria 15706
685 Ga0500622_0050628 3300053156 Bacteria 2139
686 Ga0500622_0083606 3300053156 Bacteria 1594
687 Ga0500627_0000049 3300053158 Bacteria 58947
688 Ga0500627_0123233 3300053158 Bacteria 1170
689 Ga0500567_001107 3300053723 Bacteria 10515
690 Ga0500625_000005 3300053729 Bacteria 209509
691 Ga0500645_002593 3300053730 Bacteria 7949
692 Ga0500645_013341 3300053730 Bacteria 2639
693 Ga0587101_001104 3300059623 Bacteria 2212
694 Ga0501082_0374578 3300060353 Bacteria 1242
695 Ga0530510_0059269 3300061734 Bacteria 2769

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_0306834 Ga0451795_0306834_1990_2565 187
2 3300005340 Ga0070689_100539569 Ga0070689_1005395692 194
3 3300046516 Ga0495628_0109223 Ga0495628_0109223_1492_2115 195
4 3300046678 Ga0495599_0341859 Ga0495599_0341859_19_642 195
5 3300046690 Ga0495624_0017329 Ga0495624_0017329_1999_2622 195
6 3300047315 Ga0495581_0100468 Ga0495581_0100468_515_1138 195
7 3300047319 Ga0495674_0103376 Ga0495674_0103376_844_1467 195
8 3300047321 Ga0495676_0189371 Ga0495676_0189371_613_1236 195
9 3300009098 Ga0105245_10155936 Ga0105245_101559362 199
10 3300025927 Ga0207687_10069633 Ga0207687_100696332 199
11 3300025942 Ga0207689_10219317 Ga0207689_102193172 199
12 3300048905 Ga0496102_0123984 Ga0496102_0123984_970_1677 199
13 3300046691 Ga0495670_0340179 Ga0495670_0340179_110_736 200
14 3300049590 Ga0501074_0228179 Ga0501074_0228179_501_1127 200
15 3300049575 Ga0501039_0098928 Ga0501039_0098928_1399_2028 201
16 3300041446 Ga0451794_34338 Ga0451794_34338_21_641 202
17 3300041452 Ga0451793_1178553 Ga0451793_1178553_417_1037 202
18 3300041494 Ga0451837_1228643 Ga0451837_1228643_173_793 202
19 3300046459 Ga0495629_0000146 Ga0495629_0000146_45661_46278 202
20 3300046471 Ga0495650_0002319 Ga0495650_0002319_14918_15535 202
21 3300046472 Ga0495580_0003640 Ga0495580_0003640_3863_4480 202
22 3300046506 Ga0495583_0042264 Ga0495583_0042264_30_647 202
23 3300046528 Ga0495642_0012505 Ga0495642_0012505_698_1315 202
24 3300046530 Ga0495654_0155411 Ga0495654_0155411_22_639 202
25 3300046543 Ga0495645_0000664 Ga0495645_0000664_7958_8575 202
26 3300046559 Ga0495667_0010947 Ga0495667_0010947_1955_2572 202
27 3300046616 Ga0495668_0354815 Ga0495668_0354815_39_656 202
28 3300046674 Ga0495588_0039766 Ga0495588_0039766_1684_2301 202
29 3300046680 Ga0495646_0278540 Ga0495646_0278540_26_643 202
30 3300047315 Ga0495581_0001065 Ga0495581_0001065_14175_14792 202
31 3300047444 Ga0495675_0064124 Ga0495675_0064124_1653_2270 202
32 3300047446 Ga0495679_016873 Ga0495679_016873_761_1378 202
33 3300048089 Ga0495614_0025746 Ga0495614_0025746_1076_1693 202
34 3300048908 Ga0496105_0027299 Ga0496105_0027299_292_909 202
35 3300048910 Ga0496107_0026728 Ga0496107_0026728_2936_3553 202
36 3300048917 Ga0496114_0002211 Ga0496114_0002211_4349_4966 202
37 3300048918 Ga0496115_0104706 Ga0496115_0104706_66_683 202
38 3300049593 Ga0501077_0109485 Ga0501077_0109485_76_693 202
39 iso_pu_bacteria 2643221560 2643820527 202
40 iso_pu_bacteria 2643221563 2643836342 202
41 iso_pu_bacteria 2643221608 2644052818 202
42 iso_pu_bacteria 2852653556 2852653953 202
43 iso_pu_bacteria 2897803580 2897803811 202
44 3300025304 Ga0209257_1020289 Ga0209257_10202893 203
45 3300031456 Ga0307513_10208649 Ga0307513_102086492 203
46 3300037471 Ga0395905_0588016 Ga0395905_0588016_231_854 203
47 3300041458 Ga0451798_0275487 Ga0451798_0275487_613_1236 203
48 3300046512 Ga0495610_0072290 Ga0495610_0072290_350_973 203
49 3300046515 Ga0495620_0213274 Ga0495620_0213274_22_645 203
50 3300050489 nmdc:mga03683_26924_c1 nmdc:mga03683_26924_c1_357_980 203
51 3300050490 nmdc:mga03n38_76008_c1 nmdc:mga03n38_76008_c1_694_1317 203
52 3300050496 nmdc:mga07m45_27084_c1 nmdc:mga07m45_27084_c1_2160_2783 203
53 3300053090 Ga0500646_0035843 Ga0500646_0035843_667_1290 203
54 3300053093 Ga0500651_0019570 Ga0500651_0019570_622_1245 203
55 3300053098 Ga0500650_0082230 Ga0500650_0082230_541_1164 203
56 3300053109 Ga0500569_030913 Ga0500569_030913_221_844 203
57 3300053130 Ga0500642_0003221 Ga0500642_0003221_2908_3531 203
58 3300053131 Ga0500652_000262 Ga0500652_000262_2594_3217 203
59 3300053142 Ga0500577_0038792 Ga0500577_0038792_434_1057 203
60 3300053156 Ga0500622_0000264 Ga0500622_0000264_35308_35931 203
61 3300053156 Ga0500622_0050628 Ga0500622_0050628_874_1497 203
62 iso_pu_bacteria 2597490356 2599101453 203
63 iso_pu_bacteria 2846952575 2846953823 203
64 3300003781 Ga0055536_1021245 Ga0055536_10212453 204
65 3300003784 Ga0055534_1004606 Ga0055534_10046063 204
66 3300003791 Ga0055530_10000522 Ga0055530_1000052212 204
67 3300003794 Ga0055531_10004791 Ga0055531_100047919 204
68 3300003794 Ga0055531_10028736 Ga0055531_100287362 204
69 3300003794 Ga0055531_10029712 Ga0055531_100297123 204
70 3300025263 Ga0209565_1029745 Ga0209565_10297451 204
71 3300025291 Ga0209675_1001006 Ga0209675_100100614 204
72 3300025292 Ga0209676_1000557 Ga0209676_100055723 204
73 3300025292 Ga0209676_1002559 Ga0209676_10025595 204
74 3300025292 Ga0209676_1019878 Ga0209676_10198782 204
75 3300025294 Ga0209025_1022462 Ga0209025_10224623 204
76 3300025294 Ga0209025_1060056 Ga0209025_10600561 204
77 3300025298 Ga0209050_1000017 Ga0209050_100001753 204
78 3300025298 Ga0209050_1013681 Ga0209050_10136812 204
79 3300025304 Ga0209257_1001118 Ga0209257_100111815 204
80 3300025304 Ga0209257_1001176 Ga0209257_100117627 204
81 3300025304 Ga0209257_1001719 Ga0209257_10017199 204
82 3300028800 Ga0265338_10222996 Ga0265338_102229962 204
83 3300031824 Ga0307413_10876693 Ga0307413_108766931 204
84 3300031901 Ga0307406_10571546 Ga0307406_105715461 204
85 3300031911 Ga0307412_10001508 Ga0307412_100015084 204
86 3300031911 Ga0307412_10547447 Ga0307412_105474471 204
87 3300032004 Ga0307414_10000705 Ga0307414_100007054 204
88 3300032004 Ga0307414_10001084 Ga0307414_100010843 204
89 3300032004 Ga0307414_10029850 Ga0307414_100298502 204
90 3300032004 Ga0307414_10219753 Ga0307414_102197532 204
91 3300032004 Ga0307414_10248363 Ga0307414_102483632 204
92 3300032004 Ga0307414_10491403 Ga0307414_104914032 204
93 3300032004 Ga0307414_10623916 Ga0307414_106239161 204
94 3300046519 Ga0495632_0090193 Ga0495632_0090193_578_1201 204
95 3300046522 Ga0495643_0094972 Ga0495643_0094972_644_1294 204
96 3300046530 Ga0495654_0093743 Ga0495654_0093743_590_1240 204
97 3300046660 Ga0495625_0000553 Ga0495625_0000553_53429_54079 204
98 3300049523 Ga0501300_010361 Ga0501300_010361_55_705 204
99 3300049554 Ga0501338_02973 Ga0501338_02973_238_888 204
100 3300053139 Ga0500568_0003830 Ga0500568_0003830_6830_7480 204
101 3300053151 Ga0500604_0067657 Ga0500604_0067657_354_1004 204
102 3300053158 Ga0500627_0000049 Ga0500627_0000049_15189_15839 204
103 3300053158 Ga0500627_0123233 Ga0500627_0123233_47_697 204
104 3300059623 Ga0587101_001104 Ga0587101_001104_503_1129 204
105 iso_pu_bacteria 2848858292 2848859994 204
106 3300005340 Ga0070689_100326494 Ga0070689_1003264941 205
107 3300005458 Ga0070681_10024323 Ga0070681_100243236 205
108 3300005614 Ga0068856_100298666 Ga0068856_1002986663 205
109 3300005842 Ga0068858_100572951 Ga0068858_1005729512 205
110 3300006175 Ga0070712_100650330 Ga0070712_1006503301 205
111 3300009553 Ga0105249_10054869 Ga0105249_100548694 205
112 3300013307 Ga0157372_11556998 Ga0157372_115569981 205
113 3300014745 Ga0157377_10207225 Ga0157377_102072252 205
114 3300025912 Ga0207707_10072692 Ga0207707_100726924 205
115 3300025929 Ga0207664_10843554 Ga0207664_108435541 205
116 3300031824 Ga0307413_10868285 Ga0307413_108682851 205
117 3300032005 Ga0307411_10775929 Ga0307411_107759291 205
118 3300034957 Ga0373938_0090870 Ga0373938_0090870_15_635 205
119 3300036401 Ga0373937_0589995 Ga0373937_0589995_295_921 205
120 3300039437 Ga0436365_0809192 Ga0436365_0809192_828_1460 205
121 3300039453 Ga0436362_0652764 Ga0436362_0652764_2780_3412 205
122 3300045051 Ga0451576_0745474 Ga0451576_0745474_373_1002 205
123 3300046558 Ga0495633_0000178 Ga0495633_0000178_7810_8433 205
124 3300048920 Ga0496117_0082213 Ga0496117_0082213_533_1156 205
125 3300048922 Ga0496119_0145337 Ga0496119_0145337_155_778 205
126 3300048925 Ga0496122_0000927 Ga0496122_0000927_28910_29533 205
127 3300048926 Ga0496123_0000278 Ga0496123_0000278_71067_71690 205
128 3300050511 nmdc:mga08y16_69568_c1 nmdc:mga08y16_69568_c1_2613_3233 205
129 iso_pu_bacteria 2643221541 2643727520 205
130 iso_pu_bacteria 2643221606 2644041320 205
131 iso_pu_bacteria 2643221671 2644394860 205
132 iso_pu_bacteria 2852680915 2852682652 205
133 3300005563 Ga0068855_100024810 Ga0068855_1000248103 206
134 3300007788 Ga0099795_10000004 Ga0099795_1000000457 206
135 3300009093 Ga0105240_10000353 Ga0105240_1000035314 206
136 3300009093 Ga0105240_10009142 Ga0105240_100091423 206
137 3300010159 Ga0099796_10000006 Ga0099796_100000064 206
138 3300025913 Ga0207695_10002735 Ga0207695_1000273514 206
139 3300025913 Ga0207695_10012520 Ga0207695_100125208 206
140 3300025949 Ga0207667_10027172 Ga0207667_100271725 206
141 3300027512 Ga0209179_1000009 Ga0209179_100000935 206
142 3300046683 Ga0495658_0191175 Ga0495658_0191175_375_1004 206
143 3300046689 Ga0495613_0235183 Ga0495613_0235183_160_789 206
144 3300048927 Ga0496124_0023962 Ga0496124_0023962_4756_5382 206
145 3300050509 nmdc:mga0qj67_93735_c1 nmdc:mga0qj67_93735_c1_789_1412 206
146 3300050510 nmdc:mga06r32_73625_c1 nmdc:mga06r32_73625_c1_2371_2994 206
147 2162886007 SwRhRL2b_contig_635847 SwRhRL2b_0804.00004740 207
148 3300002459 JGI24751J29686_10000031 JGI24751J29686_1000003114 207
149 3300002459 JGI24751J29686_10005318 JGI24751J29686_100053181 207
150 3300005295 Ga0065707_10088698 Ga0065707_100886983 207
151 3300005331 Ga0070670_100000082 Ga0070670_10000008235 207
152 3300005335 Ga0070666_10305667 Ga0070666_103056672 207
153 3300005353 Ga0070669_100000015 Ga0070669_10000001535 207
154 3300005353 Ga0070669_100097466 Ga0070669_1000974662 207
155 3300005355 Ga0070671_100000134 Ga0070671_1000001341 207
156 3300005367 Ga0070667_100000003 Ga0070667_10000000327 207
157 3300005367 Ga0070667_100001189 Ga0070667_10000118918 207
158 3300005617 Ga0068859_100061966 Ga0068859_1000619661 207
159 3300005617 Ga0068859_100622143 Ga0068859_1006221432 207
160 3300005618 Ga0068864_100000177 Ga0068864_10000017757 207
161 3300005841 Ga0068863_100019937 Ga0068863_1000199373 207
162 3300005841 Ga0068863_100025665 Ga0068863_1000256656 207
163 3300005841 Ga0068863_100296307 Ga0068863_1002963072 207
164 3300005842 Ga0068858_100000629 Ga0068858_10000062918 207
165 3300005843 Ga0068860_100000068 Ga0068860_100000068159 207
166 3300005844 Ga0068862_100000006 Ga0068862_10000000685 207
167 3300005844 Ga0068862_100001068 Ga0068862_10000106826 207
168 3300006931 Ga0097620_100061965 Ga0097620_1000619651 207
169 3300006931 Ga0097620_100622132 Ga0097620_1006221322 207
170 3300009553 Ga0105249_10258778 Ga0105249_102587782 207
171 3300013306 Ga0163162_10300672 Ga0163162_103006721 207
172 3300014326 Ga0157380_10000114 Ga0157380_1000011427 207
173 3300017792 Ga0163161_10098148 Ga0163161_100981482 207
174 3300025903 Ga0207680_10024028 Ga0207680_100240281 207
175 3300025923 Ga0207681_10000001 Ga0207681_10000001759 207
176 3300025923 Ga0207681_10146749 Ga0207681_101467492 207
177 3300025925 Ga0207650_10000050 Ga0207650_10000050102 207
178 3300025925 Ga0207650_10145132 Ga0207650_101451322 207
179 3300025931 Ga0207644_10000160 Ga0207644_1000016049 207
180 3300025941 Ga0207711_10002611 Ga0207711_100026117 207
181 3300025961 Ga0207712_10153623 Ga0207712_101536231 207
182 3300025972 Ga0207668_10000045 Ga0207668_1000004540 207
183 3300025972 Ga0207668_10218981 Ga0207668_102189812 207
184 3300025986 Ga0207658_10000002 Ga0207658_10000002928 207
185 3300025986 Ga0207658_10004812 Ga0207658_100048125 207
186 3300026035 Ga0207703_10000862 Ga0207703_1000086224 207
187 3300026088 Ga0207641_10004253 Ga0207641_1000425310 207
188 3300026088 Ga0207641_10084699 Ga0207641_100846992 207
189 3300026088 Ga0207641_10162128 Ga0207641_101621282 207
190 3300026095 Ga0207676_10000004 Ga0207676_10000004241 207
191 3300026095 Ga0207676_10003660 Ga0207676_100036607 207
192 3300026116 Ga0207674_10156519 Ga0207674_101565192 207
193 3300026118 Ga0207675_100000295 Ga0207675_10000029533 207
194 3300028380 Ga0268265_10000002 Ga0268265_10000002812 207
195 3300028380 Ga0268265_10000946 Ga0268265_100009465 207
196 3300028381 Ga0268264_10000103 Ga0268264_10000103204 207
197 3300031548 Ga0307408_100545711 Ga0307408_1005457112 207
198 3300049162 Ga0501307_023140 Ga0501307_023140_22_678 207
199 3300049580 Ga0501046_0169124 Ga0501046_0169124_405_1061 207
200 3300049581 Ga0501047_0001720 Ga0501047_0001720_423_1079 207
201 3300049679 Ga0501249_000043 Ga0501249_000043_310_966 207
202 3300049850 Ga0501204_004333 Ga0501204_004333_467_1123 207
203 3300050491 nmdc:mga00v17_101410_c1 nmdc:mga00v17_101410_c1_301_945 207
204 3300053139 Ga0500568_0123340 Ga0500568_0123340_70_699 207
205 3300053156 Ga0500622_0001913 Ga0500622_0001913_13509_14138 207
206 3300005330 Ga0070690_100052816 Ga0070690_1000528163 208
207 3300005335 Ga0070666_10008034 Ga0070666_100080344 208
208 3300005338 Ga0068868_100024869 Ga0068868_1000248694 208
209 3300005364 Ga0070673_100046966 Ga0070673_1000469664 208
210 3300005367 Ga0070667_100002832 Ga0070667_1000028326 208
211 3300005548 Ga0070665_100079605 Ga0070665_1000796054 208
212 3300005617 Ga0068859_100028521 Ga0068859_1000285214 208
213 3300005618 Ga0068864_100083152 Ga0068864_1000831524 208
214 3300005841 Ga0068863_100009914 Ga0068863_1000099142 208
215 3300005842 Ga0068858_100002239 Ga0068858_1000022392 208
216 3300005843 Ga0068860_100016506 Ga0068860_1000165064 208
217 3300006237 Ga0097621_100014154 Ga0097621_1000141543 208
218 3300006358 Ga0068871_100041847 Ga0068871_1000418472 208
219 3300006881 Ga0068865_100117514 Ga0068865_1001175142 208
220 3300006931 Ga0097620_100028521 Ga0097620_1000285214 208
221 3300009098 Ga0105245_10001970 Ga0105245_1000197016 208
222 3300009176 Ga0105242_10010167 Ga0105242_100101672 208
223 3300009177 Ga0105248_10014154 Ga0105248_100141547 208
224 3300013306 Ga0163162_10079818 Ga0163162_100798182 208
225 3300013308 Ga0157375_10020343 Ga0157375_100203434 208
226 3300014968 Ga0157379_10005229 Ga0157379_1000522910 208
227 3300014969 Ga0157376_10004074 Ga0157376_100040741 208
228 3300017792 Ga0163161_10244060 Ga0163161_102440602 208
229 3300025903 Ga0207680_10032272 Ga0207680_100322724 208
230 3300025912 Ga0207707_10092771 Ga0207707_100927712 208
231 3300025921 Ga0207652_10131554 Ga0207652_101315542 208
232 3300025927 Ga0207687_10026260 Ga0207687_100262603 208
233 3300025931 Ga0207644_10205454 Ga0207644_102054542 208
234 3300025938 Ga0207704_10081223 Ga0207704_100812232 208
235 3300025941 Ga0207711_10002631 Ga0207711_1000263117 208
236 3300025960 Ga0207651_10048862 Ga0207651_100488622 208
237 3300026023 Ga0207677_10065767 Ga0207677_100657672 208
238 3300026035 Ga0207703_10017314 Ga0207703_100173143 208
239 3300026088 Ga0207641_10014418 Ga0207641_100144183 208
240 3300026088 Ga0207641_10594574 Ga0207641_105945742 208
241 3300026089 Ga0207648_10202867 Ga0207648_102028672 208
242 3300026095 Ga0207676_10041001 Ga0207676_100410012 208
243 3300028381 Ga0268264_10089499 Ga0268264_100894992 208
244 3300037068 Ga0373925_0135830 Ga0373925_0135830_450_1085 208
245 3300048905 Ga0496102_0681090 Ga0496102_0681090_230_865 208
246 3300048907 Ga0496104_0008321 Ga0496104_0008321_8261_8896 208
247 3300048908 Ga0496105_0008999 Ga0496105_0008999_4877_5512 208
248 3300048913 Ga0496110_0002075 Ga0496110_0002075_12683_13318 208
249 3300048914 Ga0496111_0004248 Ga0496111_0004248_7866_8501 208
250 3300048917 Ga0496114_0094079 Ga0496114_0094079_815_1450 208
251 3300049742 Ga0501080_0080815 Ga0501080_0080815_1388_2029 208
252 3300060353 Ga0501082_0374578 Ga0501082_0374578_76_717 208
253 3300061734 Ga0530510_0059269 Ga0530510_0059269_1938_2579 208
254 2162886007 SwRhRL2b_contig_2664059 SwRhRL2b_0598.00001450 209
255 3300005295 Ga0065707_10204279 Ga0065707_102042792 209
256 3300005466 Ga0070685_10019365 Ga0070685_100193652 209
257 3300005539 Ga0068853_100011368 Ga0068853_1000113684 209
258 3300005577 Ga0068857_100070421 Ga0068857_1000704213 209
259 3300005834 Ga0068851_10013626 Ga0068851_100136263 209
260 3300006042 Ga0075368_10000105 Ga0075368_1000010525 209
261 3300006178 Ga0075367_10000128 Ga0075367_1000012812 209
262 3300009174 Ga0105241_10293156 Ga0105241_102931562 209
263 3300009978 Ga0105148_100116 Ga0105148_1001162 209
264 3300009982 Ga0105147_102108 Ga0105147_1021082 209
265 3300025298 Ga0209050_1040295 Ga0209050_10402952 209
266 3300025923 Ga0207681_10044921 Ga0207681_100449212 209
267 3300025925 Ga0207650_10071376 Ga0207650_100713762 209
268 3300025972 Ga0207668_10781698 Ga0207668_107816981 209
269 3300026041 Ga0207639_10013955 Ga0207639_100139553 209
270 3300026116 Ga0207674_10016614 Ga0207674_100166144 209
271 3300027866 Ga0209813_10000086 Ga0209813_1000008611 209
272 3300036712 Ga0316584_0360708 Ga0316584_0360708_385_1023 209
273 3300046519 Ga0495632_0000105 Ga0495632_0000105_510_1145 209
274 3300046522 Ga0495643_0000047 Ga0495643_0000047_135822_136457 209
275 3300046524 Ga0495648_0100538 Ga0495648_0100538_613_1248 209
276 3300046525 Ga0495663_0000009 Ga0495663_0000009_213006_213641 209
277 3300046558 Ga0495633_0027054 Ga0495633_0027054_509_1144 209
278 3300046616 Ga0495668_0000004 Ga0495668_0000004_416665_417381 209
279 3300046616 Ga0495668_0149714 Ga0495668_0149714_15_653 209
280 3300046692 Ga0495671_0000038 Ga0495671_0000038_37237_37872 209
281 3300046692 Ga0495671_0013917 Ga0495671_0013917_3276_3911 209
282 3300047472 Ga0495686_0063113 Ga0495686_0063113_503_1138 209
283 3300048905 Ga0496102_0586123 Ga0496102_0586123_282_917 209
284 3300048911 Ga0496108_0024686 Ga0496108_0024686_378_1013 209
285 3300048912 Ga0496109_0301809 Ga0496109_0301809_298_933 209
286 3300048914 Ga0496111_0392086 Ga0496111_0392086_339_974 209
287 3300048915 Ga0496112_0769744 Ga0496112_0769744_132_767 209
288 3300048916 Ga0496113_0518854 Ga0496113_0518854_71_706 209
289 3300048919 Ga0496116_0344750 Ga0496116_0344750_36_671 209
290 3300048927 Ga0496124_0298372 Ga0496124_0298372_488_1123 209
291 3300048928 Ga0496125_0015399 Ga0496125_0015399_537_1172 209
292 3300048929 Ga0496126_0121534 Ga0496126_0121534_810_1475 209
293 3300049551 Ga0501335_000731 Ga0501335_000731_834_1469 209
294 3300049663 Ga0501223_000012 Ga0501223_000012_6710_7345 209
295 3300049669 Ga0501235_003444 Ga0501235_003444_243_878 209
296 3300049669 Ga0501235_014329 Ga0501235_014329_594_1229 209
297 3300049676 Ga0501246_001750 Ga0501246_001750_783_1418 209
298 3300049705 Ga0501225_0000264 Ga0501225_0000264_9212_9847 209
299 3300049705 Ga0501225_0003322 Ga0501225_0003322_2803_3438 209
300 3300049705 Ga0501225_0103574 Ga0501225_0103574_134_769 209
301 3300049708 Ga0501245_010046 Ga0501245_010046_274_909 209
302 3300050494 nmdc:mga06z11_211_c1 nmdc:mga06z11_211_c1_22261_22896 209
303 3300050495 nmdc:mga04h51_117_c1 nmdc:mga04h51_117_c1_359_994 209
304 3300053118 Ga0500594_0013935 Ga0500594_0013935_731_1366 209
305 3300053156 Ga0500622_0083606 Ga0500622_0083606_413_1048 209
306 3300031247 Ga0265340_10115545 Ga0265340_101155452 210
307 3300039447 Ga0436361_0795199 Ga0436361_0795199_46120_46767 210
308 3300048928 Ga0496125_0071804 Ga0496125_0071804_552_1190 210
309 3300053116 Ga0500592_010955 Ga0500592_010955_345_1058 210
310 3300026116 Ga0207674_10495110 Ga0207674_104951101 212
311 3300050496 nmdc:mga07m45_226805_c1 nmdc:mga07m45_226805_c1_137_784 212
312 3300049822 Ga0501035_0126826 Ga0501035_0126826_29_682 214
313 3300037418 Ga0395900_0680055 Ga0395900_0680055_195_854 215
314 3300041496 Ga0451839_1432329 Ga0451839_1432329_175_834 217
315 iso_pu_bacteria 2510917021 2511127631 217
316 iso_pu_bacteria 2919138771 2919141373 217
317 iso_pu_bacteria 8054302542 8054304823 217
318 3300048908 Ga0496105_0023629 Ga0496105_0023629_3721_4410 218
319 iso_pu_bacteria 2818991438 2819550902 218
320 3300005295 Ga0065707_10087592 Ga0065707_100875924 220
321 3300005843 Ga0068860_100052638 Ga0068860_1000526383 220
322 3300028381 Ga0268264_10039602 Ga0268264_100396023 220
323 3300006353 Ga0075370_10071592 Ga0075370_100715922 221
324 3300046453 Ga0495627_001098 Ga0495627_001098_6511_7176 221
325 3300046471 Ga0495650_0003325 Ga0495650_0003325_10382_11047 221
326 3300046500 Ga0495596_0004200 Ga0495596_0004200_5699_6364 221
327 3300046501 Ga0495607_0016080 Ga0495607_0016080_37_702 221
328 3300046506 Ga0495583_0023741 Ga0495583_0023741_1600_2265 221
329 3300046512 Ga0495610_0000061 Ga0495610_0000061_80198_80863 221
330 3300046512 Ga0495610_0000439 Ga0495610_0000439_23034_23699 221
331 3300046522 Ga0495643_0000292 Ga0495643_0000292_20364_21029 221
332 3300046522 Ga0495643_0011234 Ga0495643_0011234_2352_3017 221
333 3300046538 Ga0495609_0009392 Ga0495609_0009392_2587_3252 221
334 3300046558 Ga0495633_0069624 Ga0495633_0069624_542_1207 221
335 3300046660 Ga0495625_0131051 Ga0495625_0131051_607_1272 221
336 3300046691 Ga0495670_0137867 Ga0495670_0137867_499_1164 221
337 3300046692 Ga0495671_0015368 Ga0495671_0015368_2369_3034 221
338 3300047470 Ga0495681_0001474 Ga0495681_0001474_10406_11071 221
339 2162886007 SwRhRL2b_contig_3522643 SwRhRL2b_0315.00005330 222
340 3300003791 Ga0055530_10017827 Ga0055530_100178271 222
341 3300005289 Ga0065704_10000191 Ga0065704_1000019173 222
342 3300005367 Ga0070667_100000079 Ga0070667_10000007967 222
343 3300005841 Ga0068863_100057842 Ga0068863_1000578423 222
344 3300005843 Ga0068860_100113915 Ga0068860_1001139152 222
345 3300013102 Ga0157371_10016337 Ga0157371_100163375 222
346 3300025298 Ga0209050_1000279 Ga0209050_100027955 222
347 3300025931 Ga0207644_10139843 Ga0207644_101398432 222
348 3300025986 Ga0207658_10017257 Ga0207658_100172574 222
349 3300026088 Ga0207641_10074389 Ga0207641_100743893 222
350 3300028381 Ga0268264_10085974 Ga0268264_100859742 222
351 3300031731 Ga0307405_10272346 Ga0307405_102723461 222
352 3300031911 Ga0307412_10175744 Ga0307412_101757442 222
353 3300044712 Ga0453684_0305197 Ga0453684_0305197_705_1394 222
354 3300045051 Ga0451576_0233962 Ga0451576_0233962_1036_1725 222
355 3300046500 Ga0495596_0001173 Ga0495596_0001173_728_1396 222
356 3300046507 Ga0495606_0055232 Ga0495606_0055232_289_957 222
357 3300046512 Ga0495610_0000419 Ga0495610_0000419_19051_19719 222
358 3300048090 Ga0495615_0000267 Ga0495615_0000267_3615_4283 222
359 3300048091 Ga0495626_0006288 Ga0495626_0006288_749_1417 222
360 3300048919 Ga0496116_0000017 Ga0496116_0000017_192193_192861 222
361 3300048920 Ga0496117_0046495 Ga0496117_0046495_1668_2336 222
362 3300048924 Ga0496121_0133249 Ga0496121_0133249_361_1029 222
363 3300048925 Ga0496122_0016481 Ga0496122_0016481_984_1652 222
364 3300048925 Ga0496122_0051830 Ga0496122_0051830_1703_2371 222
365 3300048926 Ga0496123_0001559 Ga0496123_0001559_5561_6229 222
366 3300048926 Ga0496123_0002247 Ga0496123_0002247_6142_6810 222
367 3300048927 Ga0496124_0047414 Ga0496124_0047414_1923_2591 222
368 3300048928 Ga0496125_0002203 Ga0496125_0002203_2333_3001 222
369 3300048929 Ga0496126_0018782 Ga0496126_0018782_388_1056 222
370 3300009101 Ga0105247_10140211 Ga0105247_101402112 223
371 3300025900 Ga0207710_10072197 Ga0207710_100721972 223
372 3300028380 Ga0268265_10009588 Ga0268265_100095883 223
373 3300046694 Ga0495649_0332095 Ga0495649_0332095_67_738 223
374 iso_pu_bacteria 2738541275 2738711232 223
375 iso_pu_bacteria 2738541301 2738849657 223
376 iso_pu_bacteria 2738541304 2738865386 223
377 iso_pu_bacteria 2738543022 2739297904 223
378 iso_pu_bacteria 2738543033 2739359582 223
379 iso_pu_bacteria 2928959182 2928961480 223
380 3300039437 Ga0436365_1004127 Ga0436365_1004127_189_863 224
381 3300049460 Ga0495682_0065214 Ga0495682_0065214_526_1200 224
382 3300002459 JGI24751J29686_10000719 JGI24751J29686_100007193 225
383 3300005335 Ga0070666_10009267 Ga0070666_100092675 225
384 3300005347 Ga0070668_100276260 Ga0070668_1002762602 225
385 3300005353 Ga0070669_100000302 Ga0070669_10000030221 225
386 3300005355 Ga0070671_100000089 Ga0070671_10000008916 225
387 3300005367 Ga0070667_100010961 Ga0070667_1000109617 225
388 3300005548 Ga0070665_100132020 Ga0070665_1001320202 225
389 3300005563 Ga0068855_100002272 Ga0068855_10000227215 225
390 3300005616 Ga0068852_100318541 Ga0068852_1003185412 225
391 3300005617 Ga0068859_100153303 Ga0068859_1001533032 225
392 3300005618 Ga0068864_100039916 Ga0068864_1000399162 225
393 3300005841 Ga0068863_100000072 Ga0068863_10000007245 225
394 3300005841 Ga0068863_100067756 Ga0068863_1000677562 225
395 3300005842 Ga0068858_100035655 Ga0068858_1000356552 225
396 3300005843 Ga0068860_100000247 Ga0068860_10000024753 225
397 3300005843 Ga0068860_100010439 Ga0068860_1000104397 225
398 3300005844 Ga0068862_100028292 Ga0068862_1000282925 225
399 3300006051 Ga0075364_10083270 Ga0075364_100832702 225
400 3300006931 Ga0097620_100153306 Ga0097620_1001533062 225
401 3300009177 Ga0105248_10041442 Ga0105248_100414422 225
402 3300014326 Ga0157380_10069482 Ga0157380_100694822 225
403 3300014968 Ga0157379_10177370 Ga0157379_101773702 225
404 3300017792 Ga0163161_10001464 Ga0163161_100014647 225
405 3300025315 Ga0207697_10062846 Ga0207697_100628462 225
406 3300025903 Ga0207680_10066969 Ga0207680_100669692 225
407 3300025909 Ga0207705_10400742 Ga0207705_104007422 225
408 3300025923 Ga0207681_10000313 Ga0207681_100003131 225
409 3300025931 Ga0207644_10000005 Ga0207644_10000005143 225
410 3300025949 Ga0207667_10001954 Ga0207667_1000195415 225
411 3300025986 Ga0207658_10006902 Ga0207658_100069027 225
412 3300025986 Ga0207658_10096249 Ga0207658_100962492 225
413 3300026035 Ga0207703_10096203 Ga0207703_100962032 225
414 3300026088 Ga0207641_10000084 Ga0207641_1000008446 225
415 3300026116 Ga0207674_10321678 Ga0207674_103216782 225
416 3300026142 Ga0207698_10096807 Ga0207698_100968072 225
417 3300028379 Ga0268266_10113198 Ga0268266_101131982 225
418 3300028380 Ga0268265_10052298 Ga0268265_100522983 225
419 3300028380 Ga0268265_10334085 Ga0268265_103340852 225
420 3300028381 Ga0268264_10000253 Ga0268264_1000025367 225
421 3300028381 Ga0268264_10102485 Ga0268264_101024852 225
422 3300031548 Ga0307408_100252426 Ga0307408_1002524262 225
423 3300031731 Ga0307405_10436721 Ga0307405_104367212 225
424 3300031824 Ga0307413_10012334 Ga0307413_100123343 225
425 3300031824 Ga0307413_10189132 Ga0307413_101891321 225
426 3300031911 Ga0307412_10242702 Ga0307412_102427022 225
427 3300031995 Ga0307409_100030100 Ga0307409_1000301001 225
428 3300032002 Ga0307416_100049825 Ga0307416_1000498253 225
429 3300032005 Ga0307411_10104385 Ga0307411_101043852 225
430 3300032126 Ga0307415_100076393 Ga0307415_1000763932 225
431 3300048903 Ga0496100_0045960 Ga0496100_0045960_1456_2133 225
432 3300048904 Ga0496101_0062363 Ga0496101_0062363_566_1243 225
433 3300048905 Ga0496102_0040281 Ga0496102_0040281_2253_2930 225
434 3300048907 Ga0496104_0034031 Ga0496104_0034031_3641_4318 225
435 3300048908 Ga0496105_0036533 Ga0496105_0036533_1345_2022 225
436 3300048909 Ga0496106_0080568 Ga0496106_0080568_813_1490 225
437 3300048910 Ga0496107_0062193 Ga0496107_0062193_891_1568 225
438 3300048911 Ga0496108_0149032 Ga0496108_0149032_795_1472 225
439 3300048913 Ga0496110_0189159 Ga0496110_0189159_699_1376 225
440 3300048916 Ga0496113_0057000 Ga0496113_0057000_1721_2398 225
441 3300048921 Ga0496118_0124788 Ga0496118_0124788_770_1447 225
442 3300048924 Ga0496121_0003524 Ga0496121_0003524_13071_13748 225
443 3300048928 Ga0496125_0254048 Ga0496125_0254048_334_1011 225
444 iso_pu_bacteria 2882806704 2882807091 225
445 3300005327 Ga0070658_10450792 Ga0070658_104507921 226
446 3300005329 Ga0070683_100057780 Ga0070683_1000577803 226
447 3300005337 Ga0070682_100198129 Ga0070682_1001981291 226
448 3300005337 Ga0070682_100294758 Ga0070682_1002947581 226
449 3300005339 Ga0070660_100006436 Ga0070660_1000064367 226
450 3300005344 Ga0070661_100020806 Ga0070661_1000208062 226
451 3300005345 Ga0070692_10095011 Ga0070692_100950112 226
452 3300005354 Ga0070675_100467551 Ga0070675_1004675511 226
453 3300005366 Ga0070659_100725902 Ga0070659_1007259021 226
454 3300005455 Ga0070663_100232029 Ga0070663_1002320292 226
455 3300005456 Ga0070678_100461791 Ga0070678_1004617912 226
456 3300005457 Ga0070662_100030704 Ga0070662_1000307042 226
457 3300005457 Ga0070662_100113008 Ga0070662_1001130082 226
458 3300005458 Ga0070681_10057594 Ga0070681_100575944 226
459 3300005530 Ga0070679_100479771 Ga0070679_1004797711 226
460 3300005530 Ga0070679_100570115 Ga0070679_1005701151 226
461 3300005530 Ga0070679_100756616 Ga0070679_1007566161 226
462 3300005539 Ga0068853_100005144 Ga0068853_1000051448 226
463 3300005539 Ga0068853_100384275 Ga0068853_1003842752 226
464 3300005539 Ga0068853_100471584 Ga0068853_1004715841 226
465 3300005563 Ga0068855_100007914 Ga0068855_1000079143 226
466 3300005563 Ga0068855_100013433 Ga0068855_1000134332 226
467 3300005563 Ga0068855_100044725 Ga0068855_1000447252 226
468 3300005564 Ga0070664_100002256 Ga0070664_10000225616 226
469 3300005577 Ga0068857_100244826 Ga0068857_1002448262 226
470 3300005578 Ga0068854_100338230 Ga0068854_1003382302 226
471 3300005614 Ga0068856_100016862 Ga0068856_1000168625 226
472 3300006195 Ga0075366_10224807 Ga0075366_102248071 226
473 3300006353 Ga0075370_10005064 Ga0075370_100050647 226
474 3300006353 Ga0075370_10151338 Ga0075370_101513382 226
475 3300006946 Ga0079104_1018187 Ga0079104_10181873 226
476 3300009174 Ga0105241_10369037 Ga0105241_103690372 226
477 3300011119 Ga0105246_10000087 Ga0105246_1000008720 226
478 3300013100 Ga0157373_10008651 Ga0157373_100086517 226
479 3300013100 Ga0157373_10041584 Ga0157373_100415842 226
480 3300013102 Ga0157371_10009506 Ga0157371_100095062 226
481 3300013102 Ga0157371_10026448 Ga0157371_100264482 226
482 3300013104 Ga0157370_10005931 Ga0157370_100059318 226
483 3300013104 Ga0157370_10675602 Ga0157370_106756021 226
484 3300013105 Ga0157369_10001820 Ga0157369_1000182021 226
485 3300013307 Ga0157372_10448838 Ga0157372_104488381 226
486 3300013308 Ga0157375_10042154 Ga0157375_100421542 226
487 3300013308 Ga0157375_10587825 Ga0157375_105878252 226
488 3300025909 Ga0207705_10001354 Ga0207705_100013548 226
489 3300025909 Ga0207705_10005547 Ga0207705_100055478 226
490 3300025909 Ga0207705_10011717 Ga0207705_100117172 226
491 3300025909 Ga0207705_10397501 Ga0207705_103975011 226
492 3300025911 Ga0207654_10151618 Ga0207654_101516182 226
493 3300025912 Ga0207707_10108767 Ga0207707_101087672 226
494 3300025912 Ga0207707_10428571 Ga0207707_104285711 226
495 3300025919 Ga0207657_10001362 Ga0207657_1000136221 226
496 3300025920 Ga0207649_10018161 Ga0207649_100181612 226
497 3300025921 Ga0207652_10012713 Ga0207652_100127134 226
498 3300025921 Ga0207652_10106091 Ga0207652_101060913 226
499 3300025923 Ga0207681_10149537 Ga0207681_101495372 226
500 3300025926 Ga0207659_10213193 Ga0207659_102131932 226
501 3300025932 Ga0207690_10090933 Ga0207690_100909332 226
502 3300025932 Ga0207690_10160664 Ga0207690_101606642 226
503 3300025933 Ga0207706_10000264 Ga0207706_1000026421 226
504 3300025933 Ga0207706_10005923 Ga0207706_100059232 226
505 3300025933 Ga0207706_10015282 Ga0207706_100152822 226
506 3300025949 Ga0207667_10005167 Ga0207667_100051677 226
507 3300025949 Ga0207667_10048740 Ga0207667_100487403 226
508 3300025981 Ga0207640_10138693 Ga0207640_101386931 226
509 3300026041 Ga0207639_10000652 Ga0207639_1000065221 226
510 3300026041 Ga0207639_10086936 Ga0207639_100869362 226
511 3300026067 Ga0207678_10010061 Ga0207678_100100612 226
512 3300026116 Ga0207674_10036217 Ga0207674_100362171 226
513 3300026121 Ga0207683_10227364 Ga0207683_102273642 226
514 3300026142 Ga0207698_10653695 Ga0207698_106536951 226
515 3300027111 Ga0209281_1036510 Ga0209281_10365101 226
516 3300032004 Ga0307414_10056773 Ga0307414_100567733 226
517 3300032004 Ga0307414_10423646 Ga0307414_104236462 226
518 3300046460 Ga0495638_0073995 Ga0495638_0073995_401_1081 226
519 3300046530 Ga0495654_0178414 Ga0495654_0178414_170_850 226
520 3300046660 Ga0495625_0045181 Ga0495625_0045181_1232_1912 226
521 3300046660 Ga0495625_0209164 Ga0495625_0209164_191_871 226
522 3300048908 Ga0496105_0276746 Ga0496105_0276746_304_996 226
523 3300048917 Ga0496114_0132124 Ga0496114_0132124_488_1180 226
524 3300049568 Ga0501031_0158644 Ga0501031_0158644_105_797 226
525 3300049572 Ga0501036_0283879 Ga0501036_0283879_631_1323 226
526 3300049581 Ga0501047_0350443 Ga0501047_0350443_302_994 226
527 3300049585 Ga0501069_0181740 Ga0501069_0181740_241_933 226
528 3300049823 Ga0501044_0292723 Ga0501044_0292723_847_1539 226
529 3300053087 Ga0500643_015584 Ga0500643_015584_1268_1948 226
530 3300053121 Ga0500607_000007 Ga0500607_000007_78383_79063 226
531 3300053136 Ga0500559_0001283 Ga0500559_0001283_181_861 226
532 3300053148 Ga0500590_001101 Ga0500590_001101_6487_7167 226
533 3300053156 Ga0500622_0000167 Ga0500622_0000167_34074_34754 226
534 3300053730 Ga0500645_002593 Ga0500645_002593_734_1414 226
535 2162886007 SwRhRL2b_contig_2569509 SwRhRL2b_0424.00000240 227
536 3300002074 JGI24748J21848_1009287 JGI24748J21848_10092871 227
537 3300002459 JGI24751J29686_10035974 JGI24751J29686_100359741 227
538 3300005289 Ga0065704_10095287 Ga0065704_100952872 227
539 3300005295 Ga0065707_10222156 Ga0065707_102221562 227
540 3300005327 Ga0070658_10000083 Ga0070658_100000838 227
541 3300005331 Ga0070670_100202480 Ga0070670_1002024802 227
542 3300005335 Ga0070666_10314165 Ga0070666_103141651 227
543 3300005347 Ga0070668_100002681 Ga0070668_10000268114 227
544 3300005353 Ga0070669_100000068 Ga0070669_10000006887 227
545 3300005353 Ga0070669_100168004 Ga0070669_1001680042 227
546 3300005355 Ga0070671_100003720 Ga0070671_1000037207 227
547 3300005367 Ga0070667_100000596 Ga0070667_1000005965 227
548 3300005563 Ga0068855_100074599 Ga0068855_1000745992 227
549 3300005563 Ga0068855_100157527 Ga0068855_1001575272 227
550 3300005578 Ga0068854_100215145 Ga0068854_1002151452 227
551 3300005616 Ga0068852_100001919 Ga0068852_10000191912 227
552 3300005616 Ga0068852_100330095 Ga0068852_1003300952 227
553 3300005844 Ga0068862_100014472 Ga0068862_1000144724 227
554 3300006042 Ga0075368_10000037 Ga0075368_100000377 227
555 3300006048 Ga0075363_100008472 Ga0075363_1000084722 227
556 3300006051 Ga0075364_10117366 Ga0075364_101173662 227
557 3300006058 Ga0075432_10000520 Ga0075432_100005205 227
558 3300006177 Ga0075362_10006427 Ga0075362_100064272 227
559 3300006178 Ga0075367_10030964 Ga0075367_100309644 227
560 3300006186 Ga0075369_10004039 Ga0075369_100040393 227
561 3300006195 Ga0075366_10008535 Ga0075366_100085351 227
562 3300006195 Ga0075366_10253919 Ga0075366_102539191 227
563 3300006353 Ga0075370_10026108 Ga0075370_100261082 227
564 3300006353 Ga0075370_10070644 Ga0075370_100706443 227
565 3300009092 Ga0105250_10005410 Ga0105250_100054102 227
566 3300009093 Ga0105240_10011684 Ga0105240_100116842 227
567 3300009101 Ga0105247_10072080 Ga0105247_100720803 227
568 3300009553 Ga0105249_10133867 Ga0105249_101338673 227
569 3300013306 Ga0163162_10349642 Ga0163162_103496422 227
570 3300025315 Ga0207697_10031958 Ga0207697_100319581 227
571 3300025711 Ga0207696_1002487 Ga0207696_10024878 227
572 3300025735 Ga0207713_1035091 Ga0207713_10350912 227
573 3300025900 Ga0207710_10110281 Ga0207710_101102812 227
574 3300025903 Ga0207680_10237526 Ga0207680_102375262 227
575 3300025909 Ga0207705_10000009 Ga0207705_10000009404 227
576 3300025913 Ga0207695_10008077 Ga0207695_100080776 227
577 3300025923 Ga0207681_10000105 Ga0207681_1000010516 227
578 3300025923 Ga0207681_10423043 Ga0207681_104230431 227
579 3300025924 Ga0207694_10025058 Ga0207694_100250585 227
580 3300025931 Ga0207644_10005221 Ga0207644_100052213 227
581 3300025949 Ga0207667_10031548 Ga0207667_100315483 227
582 3300025972 Ga0207668_10012461 Ga0207668_100124612 227
583 3300025981 Ga0207640_10232176 Ga0207640_102321761 227
584 3300025986 Ga0207658_10002247 Ga0207658_100022478 227
585 3300026116 Ga0207674_10352766 Ga0207674_103527661 227
586 3300026142 Ga0207698_10000084 Ga0207698_1000008427 227
587 3300026142 Ga0207698_10296588 Ga0207698_102965881 227
588 3300027866 Ga0209813_10000030 Ga0209813_1000003043 227
589 3300028379 Ga0268266_10064439 Ga0268266_100644394 227
590 3300028380 Ga0268265_10019703 Ga0268265_100197033 227
591 3300028381 Ga0268264_10051702 Ga0268264_100517023 227
592 3300031616 Ga0307508_10032618 Ga0307508_100326182 227
593 3300032168 Ga0316593_10207597 Ga0316593_102075971 227
594 3300036647 Ga0316582_0002953 Ga0316582_0002953_6788_7480 227
595 3300048903 Ga0496100_0369263 Ga0496100_0369263_366_1061 227
596 3300048904 Ga0496101_0157300 Ga0496101_0157300_815_1510 227
597 3300048905 Ga0496102_0007356 Ga0496102_0007356_679_1374 227
598 3300048906 Ga0496103_0000289 Ga0496103_0000289_25860_26555 227
599 3300048907 Ga0496104_0002529 Ga0496104_0002529_15035_15730 227
600 3300048908 Ga0496105_0004036 Ga0496105_0004036_2709_3404 227
601 3300048909 Ga0496106_0094663 Ga0496106_0094663_1578_2273 227
602 3300048910 Ga0496107_0212975 Ga0496107_0212975_250_945 227
603 3300048914 Ga0496111_0501573 Ga0496111_0501573_161_856 227
604 3300048915 Ga0496112_0324684 Ga0496112_0324684_283_978 227
605 3300048919 Ga0496116_0154869 Ga0496116_0154869_232_927 227
606 3300048920 Ga0496117_0005177 Ga0496117_0005177_7210_7905 227
607 3300048921 Ga0496118_0010426 Ga0496118_0010426_7210_7905 227
608 3300048922 Ga0496119_0015252 Ga0496119_0015252_3171_3866 227
609 3300048923 Ga0496120_0038515 Ga0496120_0038515_1539_2234 227
610 3300048924 Ga0496121_0000022 Ga0496121_0000022_15561_16244 227
611 3300048924 Ga0496121_0060403 Ga0496121_0060403_1462_2157 227
612 3300048926 Ga0496123_0045177 Ga0496123_0045177_27_722 227
613 3300048927 Ga0496124_0011768 Ga0496124_0011768_5892_6587 227
614 3300048929 Ga0496126_0000661 Ga0496126_0000661_6325_7020 227
615 3300049744 Ga0501083_0255418 Ga0501083_0255418_176_871 227
616 3300049823 Ga0501044_0001652 Ga0501044_0001652_24897_25589 227
617 3300050489 nmdc:mga03683_162_c1 nmdc:mga03683_162_c1_2622_3323 227
618 3300050490 nmdc:mga03n38_11272_c1 nmdc:mga03n38_11272_c1_165_866 227
619 3300050491 nmdc:mga00v17_74187_c1 nmdc:mga00v17_74187_c1_281_982 227
620 3300050493 nmdc:mga0k408_118710_c1 nmdc:mga0k408_118710_c1_420_1121 227
621 3300050493 nmdc:mga0k408_23049_c1 nmdc:mga0k408_23049_c1_800_1492 227
622 3300050494 nmdc:mga06z11_2260_c1 nmdc:mga06z11_2260_c1_2517_3218 227
623 3300050495 nmdc:mga04h51_802_c1 nmdc:mga04h51_802_c1_826_1527 227
624 3300050496 nmdc:mga07m45_32_c1 nmdc:mga07m45_32_c1_38967_39668 227
625 3300050496 nmdc:mga07m45_96539_c1 nmdc:mga07m45_96539_c1_238_921 227
626 3300050516 nmdc:mga0sz30_1711_c1 nmdc:mga0sz30_1711_c1_2925_3626 227
627 3300053121 Ga0500607_013728 Ga0500607_013728_654_1355 227
628 3300053730 Ga0500645_013341 Ga0500645_013341_651_1352 227
629 iso_pu_bacteria 2739367664 2739651317 227
630 iso_pu_bacteria 2739367865 2740029790 227
631 iso_pu_bacteria 2895880812 2895884821 227
632 iso_pu_bacteria 2928100450 2928103976 227
633 iso_pu_bacteria 3000865235 3000866680 227
634 3300027876 Ga0209974_10012619 Ga0209974_100126192 228
635 3300031456 Ga0307513_10001613 Ga0307513_100016132 228
636 3300053087 Ga0500643_000001 Ga0500643_000001_467727_468422 228
637 3300053153 Ga0500616_0001386 Ga0500616_0001386_18833_19528 228
638 2162886007 SwRhRL2b_contig_1416263 SwRhRL2b_0387.00007890 229
639 3300005289 Ga0065704_10079247 Ga0065704_100792474 229
640 3300005331 Ga0070670_100067274 Ga0070670_1000672744 229
641 3300005331 Ga0070670_100083476 Ga0070670_1000834762 229
642 3300005347 Ga0070668_100024005 Ga0070668_1000240055 229
643 3300005353 Ga0070669_100000981 Ga0070669_10000098118 229
644 3300005353 Ga0070669_100168729 Ga0070669_1001687292 229
645 3300005355 Ga0070671_100001395 Ga0070671_10000139517 229
646 3300005367 Ga0070667_100010600 Ga0070667_1000106008 229
647 3300005548 Ga0070665_100000269 Ga0070665_10000026957 229
648 3300005578 Ga0068854_100154451 Ga0068854_1001544512 229
649 3300005841 Ga0068863_100121456 Ga0068863_1001214561 229
650 3300005843 Ga0068860_100180451 Ga0068860_1001804512 229
651 3300005844 Ga0068862_100040797 Ga0068862_1000407973 229
652 3300009011 Ga0105251_10005048 Ga0105251_100050487 229
653 3300009177 Ga0105248_10064851 Ga0105248_100648512 229
654 3300009553 Ga0105249_10430744 Ga0105249_104307443 229
655 3300025315 Ga0207697_10126261 Ga0207697_101262611 229
656 3300025735 Ga0207713_1004184 Ga0207713_10041848 229
657 3300025903 Ga0207680_10367909 Ga0207680_103679092 229
658 3300025923 Ga0207681_10003146 Ga0207681_100031468 229
659 3300025923 Ga0207681_10067170 Ga0207681_100671702 229
660 3300025925 Ga0207650_10039490 Ga0207650_100394902 229
661 3300025925 Ga0207650_10092278 Ga0207650_100922782 229
662 3300025931 Ga0207644_10000276 Ga0207644_1000027631 229
663 3300025941 Ga0207711_10179752 Ga0207711_101797522 229
664 3300025972 Ga0207668_10087069 Ga0207668_100870692 229
665 3300025981 Ga0207640_10131617 Ga0207640_101316172 229
666 3300025986 Ga0207658_10039180 Ga0207658_100391802 229
667 3300028379 Ga0268266_10000334 Ga0268266_1000033442 229
668 3300028381 Ga0268264_10009442 Ga0268264_100094424 229
669 3300031731 Ga0307405_10003498 Ga0307405_100034986 229
670 3300048906 Ga0496103_0003521 Ga0496103_0003521_1449_2138 229
671 3300048919 Ga0496116_0067918 Ga0496116_0067918_739_1428 229
672 3300048920 Ga0496117_0056392 Ga0496117_0056392_1226_1915 229
673 3300048921 Ga0496118_0025636 Ga0496118_0025636_2020_2709 229
674 3300048923 Ga0496120_0166564 Ga0496120_0166564_96_785 229
675 3300048924 Ga0496121_0007492 Ga0496121_0007492_5443_6132 229
676 3300048926 Ga0496123_0094923 Ga0496123_0094923_433_1122 229
677 3300048928 Ga0496125_0008773 Ga0496125_0008773_1360_2049 229
678 3300031852 Ga0307410_10194546 Ga0307410_101945462 230
679 3300031911 Ga0307412_10024702 Ga0307412_100247022 230
680 3300032004 Ga0307414_10037742 Ga0307414_100377422 230
681 3300044712 Ga0453684_0840433 Ga0453684_0840433_178_879 230
682 3300006051 Ga0075364_10138467 Ga0075364_101384672 231
683 3300006177 Ga0075362_10042089 Ga0075362_100420892 231
684 3300006353 Ga0075370_10051552 Ga0075370_100515522 231
685 3300006353 Ga0075370_10137017 Ga0075370_101370172 231
686 3300013102 Ga0157371_10254931 Ga0157371_102549312 231
687 3300032004 Ga0307414_10134263 Ga0307414_101342632 231
688 3300045051 Ga0451576_0000393 Ga0451576_0000393_76078_76782 231
689 3300046475 Ga0495639_0101109 Ga0495639_0101109_115_822 231
690 3300050489 nmdc:mga03683_7936_c1 nmdc:mga03683_7936_c1_617_1333 231
691 3300050491 nmdc:mga00v17_1860_c2 nmdc:mga00v17_1860_c2_6518_7234 231
692 3300050496 nmdc:mga07m45_160939_c1 nmdc:mga07m45_160939_c1_112_819 231
693 3300053122 Ga0500608_000153 Ga0500608_000153_8144_8851 231
694 3300053123 Ga0500614_012464 Ga0500614_012464_561_1268 231
695 3300053138 Ga0500564_032278 Ga0500564_032278_1112_1819 231
696 3300053723 Ga0500567_001107 Ga0500567_001107_493_1200 231
697 3300053729 Ga0500625_000005 Ga0500625_000005_105937_106644 231
698 2162886007 SwRhRL2b_contig_1224202 SwRhRL2b_0719.00005850 232
699 3300005289 Ga0065704_10078946 Ga0065704_100789464 232
700 3300005347 Ga0070668_100034733 Ga0070668_1000347332 232
701 3300005617 Ga0068859_100009721 Ga0068859_1000097218 232
702 3300005842 Ga0068858_100006270 Ga0068858_1000062709 232
703 3300006048 Ga0075363_100008959 Ga0075363_1000089595 232
704 3300006051 Ga0075364_10080877 Ga0075364_100808773 232
705 3300006058 Ga0075432_10136357 Ga0075432_101363571 232
706 3300006177 Ga0075362_10000064 Ga0075362_1000006422 232
707 3300006177 Ga0075362_10036123 Ga0075362_100361232 232
708 3300006186 Ga0075369_10000970 Ga0075369_100009705 232
709 3300006353 Ga0075370_10000015 Ga0075370_1000001535 232
710 3300006931 Ga0097620_100009721 Ga0097620_1000097218 232
711 3300009177 Ga0105248_10008931 Ga0105248_1000893110 232
712 3300009177 Ga0105248_10356343 Ga0105248_103563432 232
713 3300025941 Ga0207711_10157593 Ga0207711_101575932 232
714 3300025972 Ga0207668_10016913 Ga0207668_100169132 232
715 3300026035 Ga0207703_10005238 Ga0207703_100052384 232
716 3300028380 Ga0268265_10673199 Ga0268265_106731991 232
717 3300048912 Ga0496109_0146015 Ga0496109_0146015_277_981 232
718 3300048913 Ga0496110_0188020 Ga0496110_0188020_883_1587 232
719 3300048917 Ga0496114_0021180 Ga0496114_0021180_3395_4099 232
720 3300050489 nmdc:mga03683_113_c1 nmdc:mga03683_113_c1_2884_3591 232
721 3300050493 nmdc:mga0k408_9_c2 nmdc:mga0k408_9_c2_37157_37864 232
722 3300050496 nmdc:mga07m45_13_c1 nmdc:mga07m45_13_c1_27239_27946 232
723 3300050516 nmdc:mga0sz30_532_c1 nmdc:mga0sz30_532_c1_4624_5331 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

10

193

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p81-assembly1.cif.gz_K crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.9927 43 215
3hln-assembly2.cif.gz_1 crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9876 44 219
3hln-assembly2.cif.gz_T crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9875 44 219
3hln-assembly2.cif.gz_U crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9873 44 219
8i7x-assembly1.cif.gz_H crystal structure of human clpp in complex with zg36 0.9865 44 218
ID Description Score Start End Superfamily
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9641 43 219 3.90.226.10
4u0hE00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.954 45 219 3.90.226.10
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9484 43 219 3.90.226.10
4jcqA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9416 47 218 3.90.226.10
1y7oA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9379 29 217 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A428VV44-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 1.003 45 142 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-G1C6I0-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9978 48 127 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009507
GO:0051117
AF-C6TL65-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9957 47 145 GO:0004176
GO:0004252
GO:0006508
GO:0009532
AF-A0A843XKD0-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9954 45 119 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009536
GO:0051117
AF-F8TGT4-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9899 48 119 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009532
GO:0051117

Feature Viewer

pLDDT pTM Quality
81.28 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map