F477510
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 723 | 338 | 695 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300041446|Ga0451794_34338|Ga0451794_34338_21_641 |
| Length | 206 |
| Sequence | VLPNFEERTAYGFKRMDPYTKLFEDRIIFLGVQVDDASADDVMAQLLVLESQDPDRDITLYINSPGGSFTALTAIYDTMQYVKPDIQTVCLGQAASAAAVLLAAGTKGKRLALPNARVLIHQPAMAGGDYGQASDIEIQANEVLRMRTWLEDTIALHSNRSVETVKKDIERDKILTAPMALEYGLVDQVLEGRKANTAVESAPSGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 6 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 7 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 8 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 9 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 10 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 11 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 12 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 13 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 14 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 15 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 16 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 17 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 18 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 19 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 20 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 21 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 22 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 23 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 24 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 25 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 26 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 27 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 28 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 29 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 30 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 102 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 190 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 198 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 202 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 266 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 279 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 292 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 300 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 302 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 313 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 314 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 315 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 316 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 319 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 320 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 321 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 322 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 323 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 328 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 331 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 333 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 334 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 335 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 338 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.3 |
| Metatranscriptomes | 0.83 |
| Isolates | 3.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.94 |
| Nodule | 0.28 |
| Rhizoplane | 6.64 |
| Rhizosphere | 68.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1224202 | 2162886007 | Bacteria | 1165 |
| 2 | SwRhRL2b_contig_1416263 | 2162886007 | Bacteria | 1941 |
| 3 | SwRhRL2b_contig_2569509 | 2162886007 | Bacteria | 2392 |
| 4 | SwRhRL2b_contig_2664059 | 2162886007 | Bacteria | 809 |
| 5 | SwRhRL2b_contig_3522643 | 2162886007 | Bacteria | 45893 |
| 6 | SwRhRL2b_contig_635847 | 2162886007 | Bacteria | 869 |
| 7 | JGI24748J21848_1009287 | 3300002074 | Bacteria | 1159 |
| 8 | JGI24751J29686_10000031 | 3300002459 | Bacteria | 89551 |
| 9 | JGI24751J29686_10000719 | 3300002459 | Bacteria | 8078 |
| 10 | JGI24751J29686_10005318 | 3300002459 | Bacteria | 2620 |
| 11 | JGI24751J29686_10035974 | 3300002459 | Bacteria | 1026 |
| 12 | Ga0055536_1021245 | 3300003781 | Bacteria | 1975 |
| 13 | Ga0055534_1004606 | 3300003784 | Bacteria | 3932 |
| 14 | Ga0055530_10000522 | 3300003791 | Bacteria | 33291 |
| 15 | Ga0055530_10017827 | 3300003791 | Bacteria | 2210 |
| 16 | Ga0055531_10004791 | 3300003794 | Bacteria | 8082 |
| 17 | Ga0055531_10028736 | 3300003794 | Bacteria | 1910 |
| 18 | Ga0055531_10029712 | 3300003794 | Bacteria | 1854 |
| 19 | Ga0065704_10000191 | 3300005289 | Bacteria | 318191 |
| 20 | Ga0065704_10078946 | 3300005289 | Bacteria | 4297 |
| 21 | Ga0065704_10079247 | 3300005289 | Bacteria | 4216 |
| 22 | Ga0065704_10095287 | 3300005289 | Bacteria | 2495 |
| 23 | Ga0065707_10087592 | 3300005295 | Bacteria | 4963 |
| 24 | Ga0065707_10088698 | 3300005295 | Bacteria | 4571 |
| 25 | Ga0065707_10204279 | 3300005295 | Bacteria | 1284 |
| 26 | Ga0065707_10222156 | 3300005295 | Bacteria | 1221 |
| 27 | Ga0070658_10000083 | 3300005327 | Bacteria | 89189 |
| 28 | Ga0070658_10450792 | 3300005327 | Bacteria | 1108 |
| 29 | Ga0070683_100057780 | 3300005329 | Bacteria | 3604 |
| 30 | Ga0070690_100052816 | 3300005330 | Bacteria | 2599 |
| 31 | Ga0070670_100000082 | 3300005331 | Bacteria | 91524 |
| 32 | Ga0070670_100067274 | 3300005331 | Bacteria | 3074 |
| 33 | Ga0070670_100083476 | 3300005331 | Bacteria | 2745 |
| 34 | Ga0070670_100202480 | 3300005331 | Bacteria | 1725 |
| 35 | Ga0070666_10008034 | 3300005335 | Bacteria | 6528 |
| 36 | Ga0070666_10009267 | 3300005335 | Bacteria | 6134 |
| 37 | Ga0070666_10305667 | 3300005335 | Bacteria | 1133 |
| 38 | Ga0070666_10314165 | 3300005335 | Bacteria | 1117 |
| 39 | Ga0070682_100198129 | 3300005337 | Bacteria | 1415 |
| 40 | Ga0070682_100294758 | 3300005337 | Bacteria | 1188 |
| 41 | Ga0068868_100024869 | 3300005338 | Bacteria | 4547 |
| 42 | Ga0070660_100006436 | 3300005339 | Bacteria | 8143 |
| 43 | Ga0070689_100326494 | 3300005340 | Bacteria | 1283 |
| 44 | Ga0070689_100539569 | 3300005340 | Bacteria | 1004 |
| 45 | Ga0070661_100020806 | 3300005344 | Bacteria | 4681 |
| 46 | Ga0070692_10095011 | 3300005345 | Bacteria | 1626 |
| 47 | Ga0070668_100002681 | 3300005347 | Bacteria | 13086 |
| 48 | Ga0070668_100024005 | 3300005347 | Bacteria | 4617 |
| 49 | Ga0070668_100034733 | 3300005347 | Bacteria | 3843 |
| 50 | Ga0070668_100276260 | 3300005347 | Bacteria | 1402 |
| 51 | Ga0070669_100000015 | 3300005353 | Bacteria | 197597 |
| 52 | Ga0070669_100000068 | 3300005353 | Bacteria | 103282 |
| 53 | Ga0070669_100000302 | 3300005353 | Bacteria | 38805 |
| 54 | Ga0070669_100000981 | 3300005353 | Bacteria | 20797 |
| 55 | Ga0070669_100097466 | 3300005353 | Bacteria | 2213 |
| 56 | Ga0070669_100168004 | 3300005353 | Bacteria | 1709 |
| 57 | Ga0070669_100168729 | 3300005353 | Bacteria | 1705 |
| 58 | Ga0070675_100467551 | 3300005354 | Bacteria | 1133 |
| 59 | Ga0070671_100000089 | 3300005355 | Bacteria | 58283 |
| 60 | Ga0070671_100000134 | 3300005355 | Bacteria | 47424 |
| 61 | Ga0070671_100001395 | 3300005355 | Bacteria | 18046 |
| 62 | Ga0070671_100003720 | 3300005355 | Bacteria | 11966 |
| 63 | Ga0070673_100046966 | 3300005364 | Bacteria | 3357 |
| 64 | Ga0070659_100725902 | 3300005366 | Bacteria | 860 |
| 65 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 66 | Ga0070667_100000079 | 3300005367 | Bacteria | 119348 |
| 67 | Ga0070667_100000596 | 3300005367 | Bacteria | 35305 |
| 68 | Ga0070667_100001189 | 3300005367 | Bacteria | 23666 |
| 69 | Ga0070667_100002832 | 3300005367 | Bacteria | 14969 |
| 70 | Ga0070667_100010600 | 3300005367 | Bacteria | 7610 |
| 71 | Ga0070667_100010961 | 3300005367 | Bacteria | 7495 |
| 72 | Ga0070663_100232029 | 3300005455 | Bacteria | 1454 |
| 73 | Ga0070678_100461791 | 3300005456 | Bacteria | 1114 |
| 74 | Ga0070662_100030704 | 3300005457 | Bacteria | 3764 |
| 75 | Ga0070662_100113008 | 3300005457 | Bacteria | 2071 |
| 76 | Ga0070681_10024323 | 3300005458 | Bacteria | 6097 |
| 77 | Ga0070681_10057594 | 3300005458 | Bacteria | 3866 |
| 78 | Ga0070685_10019365 | 3300005466 | Bacteria | 3670 |
| 79 | Ga0070679_100479771 | 3300005530 | Bacteria | 1188 |
| 80 | Ga0070679_100570115 | 3300005530 | Bacteria | 1076 |
| 81 | Ga0070679_100756616 | 3300005530 | Bacteria | 914 |
| 82 | Ga0068853_100005144 | 3300005539 | Bacteria | 10223 |
| 83 | Ga0068853_100011368 | 3300005539 | Bacteria | 7230 |
| 84 | Ga0068853_100384275 | 3300005539 | Bacteria | 1311 |
| 85 | Ga0068853_100471584 | 3300005539 | Bacteria | 1182 |
| 86 | Ga0070665_100000269 | 3300005548 | Bacteria | 85401 |
| 87 | Ga0070665_100079605 | 3300005548 | Bacteria | 3282 |
| 88 | Ga0070665_100132020 | 3300005548 | Bacteria | 2499 |
| 89 | Ga0068855_100002272 | 3300005563 | Bacteria | 23733 |
| 90 | Ga0068855_100007914 | 3300005563 | Bacteria | 12842 |
| 91 | Ga0068855_100013433 | 3300005563 | Bacteria | 9873 |
| 92 | Ga0068855_100024810 | 3300005563 | Bacteria | 7173 |
| 93 | Ga0068855_100044725 | 3300005563 | Bacteria | 5240 |
| 94 | Ga0068855_100074599 | 3300005563 | Bacteria | 3939 |
| 95 | Ga0068855_100157527 | 3300005563 | Bacteria | 2579 |
| 96 | Ga0070664_100002256 | 3300005564 | Bacteria | 15513 |
| 97 | Ga0068857_100070421 | 3300005577 | Bacteria | 3115 |
| 98 | Ga0068857_100244826 | 3300005577 | Bacteria | 1642 |
| 99 | Ga0068854_100154451 | 3300005578 | Bacteria | 1772 |
| 100 | Ga0068854_100215145 | 3300005578 | Bacteria | 1518 |
| 101 | Ga0068854_100338230 | 3300005578 | Bacteria | 1229 |
| 102 | Ga0068856_100016862 | 3300005614 | Bacteria | 7079 |
| 103 | Ga0068856_100298666 | 3300005614 | Bacteria | 1628 |
| 104 | Ga0068852_100001919 | 3300005616 | Bacteria | 14168 |
| 105 | Ga0068852_100318541 | 3300005616 | Bacteria | 1510 |
| 106 | Ga0068852_100330095 | 3300005616 | Bacteria | 1484 |
| 107 | Ga0068859_100009721 | 3300005617 | Bacteria | 9712 |
| 108 | Ga0068859_100028521 | 3300005617 | Bacteria | 5597 |
| 109 | Ga0068859_100061966 | 3300005617 | Bacteria | 3769 |
| 110 | Ga0068859_100153303 | 3300005617 | Bacteria | 2380 |
| 111 | Ga0068859_100622143 | 3300005617 | Bacteria | 1172 |
| 112 | Ga0068864_100000177 | 3300005618 | Bacteria | 58504 |
| 113 | Ga0068864_100039916 | 3300005618 | Bacteria | 4013 |
| 114 | Ga0068864_100083152 | 3300005618 | Bacteria | 2811 |
| 115 | Ga0068851_10013626 | 3300005834 | Bacteria | 3850 |
| 116 | Ga0068863_100000072 | 3300005841 | Bacteria | 113996 |
| 117 | Ga0068863_100009914 | 3300005841 | Bacteria | 9276 |
| 118 | Ga0068863_100019937 | 3300005841 | Bacteria | 6415 |
| 119 | Ga0068863_100025665 | 3300005841 | Bacteria | 5620 |
| 120 | Ga0068863_100057842 | 3300005841 | Bacteria | 3669 |
| 121 | Ga0068863_100067756 | 3300005841 | Bacteria | 3376 |
| 122 | Ga0068863_100121456 | 3300005841 | Bacteria | 2491 |
| 123 | Ga0068863_100296307 | 3300005841 | Bacteria | 1568 |
| 124 | Ga0068858_100000629 | 3300005842 | Bacteria | 36674 |
| 125 | Ga0068858_100002239 | 3300005842 | Bacteria | 19548 |
| 126 | Ga0068858_100006270 | 3300005842 | Bacteria | 11591 |
| 127 | Ga0068858_100035655 | 3300005842 | Bacteria | 4613 |
| 128 | Ga0068858_100572951 | 3300005842 | Bacteria | 1094 |
| 129 | Ga0068860_100000068 | 3300005843 | Bacteria | 179208 |
| 130 | Ga0068860_100000247 | 3300005843 | Bacteria | 81527 |
| 131 | Ga0068860_100010439 | 3300005843 | Bacteria | 9181 |
| 132 | Ga0068860_100016506 | 3300005843 | Bacteria | 7202 |
| 133 | Ga0068860_100052638 | 3300005843 | Bacteria | 3872 |
| 134 | Ga0068860_100113915 | 3300005843 | Bacteria | 2586 |
| 135 | Ga0068860_100180451 | 3300005843 | Bacteria | 2040 |
| 136 | Ga0068862_100000006 | 3300005844 | Bacteria | 346828 |
| 137 | Ga0068862_100001068 | 3300005844 | Bacteria | 26256 |
| 138 | Ga0068862_100014472 | 3300005844 | Bacteria | 6546 |
| 139 | Ga0068862_100028292 | 3300005844 | Bacteria | 4718 |
| 140 | Ga0068862_100040797 | 3300005844 | Bacteria | 3946 |
| 141 | Ga0075368_10000037 | 3300006042 | Bacteria | 31007 |
| 142 | Ga0075368_10000105 | 3300006042 | Bacteria | 21597 |
| 143 | Ga0075363_100008472 | 3300006048 | Bacteria | 4790 |
| 144 | Ga0075363_100008959 | 3300006048 | Bacteria | 4686 |
| 145 | Ga0075364_10080877 | 3300006051 | Bacteria | 2148 |
| 146 | Ga0075364_10083270 | 3300006051 | Bacteria | 2117 |
| 147 | Ga0075364_10117366 | 3300006051 | Bacteria | 1779 |
| 148 | Ga0075364_10138467 | 3300006051 | Bacteria | 1636 |
| 149 | Ga0075432_10000520 | 3300006058 | Bacteria | 11566 |
| 150 | Ga0075432_10136357 | 3300006058 | Bacteria | 933 |
| 151 | Ga0070712_100650330 | 3300006175 | Bacteria | 896 |
| 152 | Ga0075362_10000064 | 3300006177 | Bacteria | 30699 |
| 153 | Ga0075362_10006427 | 3300006177 | Bacteria | 4380 |
| 154 | Ga0075362_10036123 | 3300006177 | Bacteria | 2160 |
| 155 | Ga0075362_10042089 | 3300006177 | Bacteria | 2017 |
| 156 | Ga0075367_10000128 | 3300006178 | Bacteria | 22259 |
| 157 | Ga0075367_10030964 | 3300006178 | Bacteria | 3071 |
| 158 | Ga0075369_10000970 | 3300006186 | Bacteria | 9559 |
| 159 | Ga0075369_10004039 | 3300006186 | Bacteria | 5391 |
| 160 | Ga0075366_10008535 | 3300006195 | Bacteria | 5700 |
| 161 | Ga0075366_10224807 | 3300006195 | Bacteria | 1144 |
| 162 | Ga0075366_10253919 | 3300006195 | Bacteria | 1073 |
| 163 | Ga0097621_100014154 | 3300006237 | Bacteria | 5965 |
| 164 | Ga0075370_10000015 | 3300006353 | Bacteria | 62164 |
| 165 | Ga0075370_10005064 | 3300006353 | Bacteria | 6494 |
| 166 | Ga0075370_10026108 | 3300006353 | Bacteria | 3233 |
| 167 | Ga0075370_10051552 | 3300006353 | Bacteria | 2334 |
| 168 | Ga0075370_10070644 | 3300006353 | Bacteria | 1997 |
| 169 | Ga0075370_10071592 | 3300006353 | Bacteria | 1984 |
| 170 | Ga0075370_10137017 | 3300006353 | Bacteria | 1430 |
| 171 | Ga0075370_10151338 | 3300006353 | Bacteria | 1360 |
| 172 | Ga0068871_100041847 | 3300006358 | Bacteria | 3675 |
| 173 | Ga0068865_100117514 | 3300006881 | Bacteria | 1971 |
| 174 | Ga0097620_100009721 | 3300006931 | Bacteria | 9712 |
| 175 | Ga0097620_100028521 | 3300006931 | Bacteria | 5597 |
| 176 | Ga0097620_100061965 | 3300006931 | Bacteria | 3769 |
| 177 | Ga0097620_100153306 | 3300006931 | Bacteria | 2380 |
| 178 | Ga0097620_100622132 | 3300006931 | Bacteria | 1172 |
| 179 | Ga0079104_1018187 | 3300006946 | Bacteria | 1999 |
| 180 | Ga0099795_10000004 | 3300007788 | Bacteria | 108633 |
| 181 | Ga0105251_10005048 | 3300009011 | Bacteria | 8752 |
| 182 | Ga0105250_10005410 | 3300009092 | Bacteria | 5732 |
| 183 | Ga0105240_10000353 | 3300009093 | Bacteria | 86068 |
| 184 | Ga0105240_10009142 | 3300009093 | Bacteria | 14064 |
| 185 | Ga0105240_10011684 | 3300009093 | Bacteria | 12201 |
| 186 | Ga0105245_10001970 | 3300009098 | Bacteria | 18634 |
| 187 | Ga0105245_10155936 | 3300009098 | Bacteria | 2162 |
| 188 | Ga0105247_10072080 | 3300009101 | Bacteria | 2162 |
| 189 | Ga0105247_10140211 | 3300009101 | Bacteria | 1583 |
| 190 | Ga0105241_10293156 | 3300009174 | Bacteria | 1394 |
| 191 | Ga0105241_10369037 | 3300009174 | Bacteria | 1251 |
| 192 | Ga0105242_10010167 | 3300009176 | Bacteria | 7207 |
| 193 | Ga0105248_10008931 | 3300009177 | Bacteria | 11020 |
| 194 | Ga0105248_10014154 | 3300009177 | Bacteria | 8782 |
| 195 | Ga0105248_10041442 | 3300009177 | Bacteria | 5162 |
| 196 | Ga0105248_10064851 | 3300009177 | Bacteria | 4100 |
| 197 | Ga0105248_10356343 | 3300009177 | Bacteria | 1647 |
| 198 | Ga0105249_10054869 | 3300009553 | Bacteria | 3644 |
| 199 | Ga0105249_10133867 | 3300009553 | Bacteria | 2369 |
| 200 | Ga0105249_10258778 | 3300009553 | Bacteria | 1728 |
| 201 | Ga0105249_10430744 | 3300009553 | Bacteria | 1355 |
| 202 | Ga0105148_100116 | 3300009978 | Bacteria | 12323 |
| 203 | Ga0105147_102108 | 3300009982 | Bacteria | 1637 |
| 204 | Ga0099796_10000006 | 3300010159 | Bacteria | 66689 |
| 205 | Ga0105246_10000087 | 3300011119 | Bacteria | 39160 |
| 206 | Ga0157373_10008651 | 3300013100 | Bacteria | 7552 |
| 207 | Ga0157373_10041584 | 3300013100 | Bacteria | 3287 |
| 208 | Ga0157371_10009506 | 3300013102 | Bacteria | 7647 |
| 209 | Ga0157371_10016337 | 3300013102 | Bacteria | 5544 |
| 210 | Ga0157371_10026448 | 3300013102 | Bacteria | 4218 |
| 211 | Ga0157371_10254931 | 3300013102 | Bacteria | 1264 |
| 212 | Ga0157370_10005931 | 3300013104 | Bacteria | 13613 |
| 213 | Ga0157370_10675602 | 3300013104 | Bacteria | 943 |
| 214 | Ga0157369_10001820 | 3300013105 | Bacteria | 25807 |
| 215 | Ga0163162_10079818 | 3300013306 | Bacteria | 3338 |
| 216 | Ga0163162_10300672 | 3300013306 | Bacteria | 1737 |
| 217 | Ga0163162_10349642 | 3300013306 | Bacteria | 1611 |
| 218 | Ga0157372_10448838 | 3300013307 | Bacteria | 1503 |
| 219 | Ga0157372_11556998 | 3300013307 | Bacteria | 761 |
| 220 | Ga0157375_10020343 | 3300013308 | Bacteria | 6060 |
| 221 | Ga0157375_10042154 | 3300013308 | Bacteria | 4415 |
| 222 | Ga0157375_10587825 | 3300013308 | Bacteria | 1273 |
| 223 | Ga0157380_10000114 | 3300014326 | Bacteria | 44326 |
| 224 | Ga0157380_10069482 | 3300014326 | Bacteria | 2842 |
| 225 | Ga0157377_10207225 | 3300014745 | Bacteria | 1248 |
| 226 | Ga0157379_10005229 | 3300014968 | Bacteria | 11145 |
| 227 | Ga0157379_10177370 | 3300014968 | Bacteria | 1924 |
| 228 | Ga0157376_10004074 | 3300014969 | Bacteria | 10113 |
| 229 | Ga0163161_10001464 | 3300017792 | Bacteria | 17451 |
| 230 | Ga0163161_10098148 | 3300017792 | Bacteria | 2177 |
| 231 | Ga0163161_10244060 | 3300017792 | Bacteria | 1398 |
| 232 | Ga0209565_1029745 | 3300025263 | Bacteria | 1071 |
| 233 | Ga0209675_1001006 | 3300025291 | Bacteria | 17716 |
| 234 | Ga0209676_1000557 | 3300025292 | Bacteria | 56440 |
| 235 | Ga0209676_1002559 | 3300025292 | Bacteria | 12585 |
| 236 | Ga0209676_1019878 | 3300025292 | Bacteria | 2298 |
| 237 | Ga0209025_1022462 | 3300025294 | Bacteria | 3341 |
| 238 | Ga0209025_1060056 | 3300025294 | Bacteria | 1430 |
| 239 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 240 | Ga0209050_1000279 | 3300025298 | Bacteria | 109034 |
| 241 | Ga0209050_1013681 | 3300025298 | Bacteria | 3577 |
| 242 | Ga0209050_1040295 | 3300025298 | Bacteria | 1303 |
| 243 | Ga0209257_1001118 | 3300025304 | Bacteria | 34674 |
| 244 | Ga0209257_1001176 | 3300025304 | Bacteria | 33109 |
| 245 | Ga0209257_1001719 | 3300025304 | Bacteria | 24483 |
| 246 | Ga0209257_1020289 | 3300025304 | Bacteria | 2463 |
| 247 | Ga0207697_10031958 | 3300025315 | Bacteria | 2153 |
| 248 | Ga0207697_10062846 | 3300025315 | Bacteria | 1547 |
| 249 | Ga0207697_10126261 | 3300025315 | Bacteria | 1103 |
| 250 | Ga0207696_1002487 | 3300025711 | Bacteria | 9005 |
| 251 | Ga0207713_1004184 | 3300025735 | Bacteria | 9465 |
| 252 | Ga0207713_1035091 | 3300025735 | Bacteria | 2169 |
| 253 | Ga0207710_10072197 | 3300025900 | Bacteria | 1584 |
| 254 | Ga0207710_10110281 | 3300025900 | Bacteria | 1306 |
| 255 | Ga0207680_10024028 | 3300025903 | Bacteria | 3338 |
| 256 | Ga0207680_10032272 | 3300025903 | Bacteria | 2975 |
| 257 | Ga0207680_10066969 | 3300025903 | Bacteria | 2210 |
| 258 | Ga0207680_10237526 | 3300025903 | Bacteria | 1255 |
| 259 | Ga0207680_10367909 | 3300025903 | Bacteria | 1012 |
| 260 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 261 | Ga0207705_10001354 | 3300025909 | Bacteria | 19563 |
| 262 | Ga0207705_10005547 | 3300025909 | Bacteria | 9434 |
| 263 | Ga0207705_10011717 | 3300025909 | Bacteria | 6335 |
| 264 | Ga0207705_10397501 | 3300025909 | Bacteria | 1066 |
| 265 | Ga0207705_10400742 | 3300025909 | Bacteria | 1061 |
| 266 | Ga0207654_10151618 | 3300025911 | Bacteria | 1488 |
| 267 | Ga0207707_10072692 | 3300025912 | Bacteria | 2998 |
| 268 | Ga0207707_10092771 | 3300025912 | Bacteria | 2638 |
| 269 | Ga0207707_10108767 | 3300025912 | Bacteria | 2424 |
| 270 | Ga0207707_10428571 | 3300025912 | Bacteria | 1133 |
| 271 | Ga0207695_10002735 | 3300025913 | Bacteria | 25716 |
| 272 | Ga0207695_10008077 | 3300025913 | Bacteria | 13239 |
| 273 | Ga0207695_10012520 | 3300025913 | Bacteria | 10172 |
| 274 | Ga0207657_10001362 | 3300025919 | Bacteria | 26044 |
| 275 | Ga0207649_10018161 | 3300025920 | Bacteria | 3994 |
| 276 | Ga0207652_10012713 | 3300025921 | Bacteria | 6807 |
| 277 | Ga0207652_10106091 | 3300025921 | Bacteria | 2486 |
| 278 | Ga0207652_10131554 | 3300025921 | Bacteria | 2232 |
| 279 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 280 | Ga0207681_10000105 | 3300025923 | Bacteria | 71882 |
| 281 | Ga0207681_10000313 | 3300025923 | Bacteria | 35417 |
| 282 | Ga0207681_10003146 | 3300025923 | Bacteria | 10373 |
| 283 | Ga0207681_10044921 | 3300025923 | Bacteria | 2963 |
| 284 | Ga0207681_10067170 | 3300025923 | Bacteria | 2485 |
| 285 | Ga0207681_10146749 | 3300025923 | Bacteria | 1763 |
| 286 | Ga0207681_10149537 | 3300025923 | Bacteria | 1748 |
| 287 | Ga0207681_10423043 | 3300025923 | Bacteria | 1079 |
| 288 | Ga0207694_10025058 | 3300025924 | Bacteria | 4533 |
| 289 | Ga0207650_10000050 | 3300025925 | Bacteria | 169589 |
| 290 | Ga0207650_10039490 | 3300025925 | Bacteria | 3449 |
| 291 | Ga0207650_10071376 | 3300025925 | Bacteria | 2612 |
| 292 | Ga0207650_10092278 | 3300025925 | Bacteria | 2316 |
| 293 | Ga0207650_10145132 | 3300025925 | Bacteria | 1868 |
| 294 | Ga0207659_10213193 | 3300025926 | Bacteria | 1549 |
| 295 | Ga0207687_10026260 | 3300025927 | Bacteria | 3898 |
| 296 | Ga0207687_10069633 | 3300025927 | Bacteria | 2510 |
| 297 | Ga0207664_10843554 | 3300025929 | Bacteria | 824 |
| 298 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 299 | Ga0207644_10000160 | 3300025931 | Bacteria | 49009 |
| 300 | Ga0207644_10000276 | 3300025931 | Bacteria | 34060 |
| 301 | Ga0207644_10005221 | 3300025931 | Bacteria | 8480 |
| 302 | Ga0207644_10139843 | 3300025931 | Bacteria | 1863 |
| 303 | Ga0207644_10205454 | 3300025931 | Bacteria | 1555 |
| 304 | Ga0207690_10090933 | 3300025932 | Bacteria | 2156 |
| 305 | Ga0207690_10160664 | 3300025932 | Bacteria | 1674 |
| 306 | Ga0207706_10000264 | 3300025933 | Bacteria | 57037 |
| 307 | Ga0207706_10005923 | 3300025933 | Bacteria | 11369 |
| 308 | Ga0207706_10015282 | 3300025933 | Bacteria | 6942 |
| 309 | Ga0207704_10081223 | 3300025938 | Bacteria | 2096 |
| 310 | Ga0207711_10002611 | 3300025941 | Bacteria | 15995 |
| 311 | Ga0207711_10002631 | 3300025941 | Bacteria | 15903 |
| 312 | Ga0207711_10157593 | 3300025941 | Bacteria | 2053 |
| 313 | Ga0207711_10179752 | 3300025941 | Bacteria | 1923 |
| 314 | Ga0207689_10219317 | 3300025942 | Bacteria | 1571 |
| 315 | Ga0207667_10001954 | 3300025949 | Bacteria | 25835 |
| 316 | Ga0207667_10005167 | 3300025949 | Bacteria | 15946 |
| 317 | Ga0207667_10027172 | 3300025949 | Bacteria | 6236 |
| 318 | Ga0207667_10031548 | 3300025949 | Bacteria | 5720 |
| 319 | Ga0207667_10048740 | 3300025949 | Bacteria | 4478 |
| 320 | Ga0207651_10048862 | 3300025960 | Bacteria | 2863 |
| 321 | Ga0207712_10153623 | 3300025961 | Bacteria | 1780 |
| 322 | Ga0207668_10000045 | 3300025972 | Bacteria | 103160 |
| 323 | Ga0207668_10012461 | 3300025972 | Bacteria | 5205 |
| 324 | Ga0207668_10016913 | 3300025972 | Bacteria | 4563 |
| 325 | Ga0207668_10087069 | 3300025972 | Bacteria | 2283 |
| 326 | Ga0207668_10218981 | 3300025972 | Bacteria | 1527 |
| 327 | Ga0207668_10781698 | 3300025972 | Bacteria | 844 |
| 328 | Ga0207640_10131617 | 3300025981 | Bacteria | 1809 |
| 329 | Ga0207640_10138693 | 3300025981 | Bacteria | 1769 |
| 330 | Ga0207640_10232176 | 3300025981 | Bacteria | 1420 |
| 331 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 332 | Ga0207658_10002247 | 3300025986 | Bacteria | 14307 |
| 333 | Ga0207658_10004812 | 3300025986 | Bacteria | 9338 |
| 334 | Ga0207658_10006902 | 3300025986 | Bacteria | 7731 |
| 335 | Ga0207658_10017257 | 3300025986 | Bacteria | 4973 |
| 336 | Ga0207658_10039180 | 3300025986 | Bacteria | 3418 |
| 337 | Ga0207658_10096249 | 3300025986 | Bacteria | 2308 |
| 338 | Ga0207677_10065767 | 3300026023 | Bacteria | 2531 |
| 339 | Ga0207703_10000862 | 3300026035 | Bacteria | 29697 |
| 340 | Ga0207703_10005238 | 3300026035 | Bacteria | 10464 |
| 341 | Ga0207703_10017314 | 3300026035 | Bacteria | 5625 |
| 342 | Ga0207703_10096203 | 3300026035 | Bacteria | 2499 |
| 343 | Ga0207639_10000652 | 3300026041 | Bacteria | 23918 |
| 344 | Ga0207639_10013955 | 3300026041 | Bacteria | 5637 |
| 345 | Ga0207639_10086936 | 3300026041 | Bacteria | 2491 |
| 346 | Ga0207678_10010061 | 3300026067 | Bacteria | 8299 |
| 347 | Ga0207641_10000084 | 3300026088 | Bacteria | 133555 |
| 348 | Ga0207641_10004253 | 3300026088 | Bacteria | 12470 |
| 349 | Ga0207641_10014418 | 3300026088 | Bacteria | 6476 |
| 350 | Ga0207641_10074389 | 3300026088 | Bacteria | 2930 |
| 351 | Ga0207641_10084699 | 3300026088 | Bacteria | 2760 |
| 352 | Ga0207641_10162128 | 3300026088 | Bacteria | 2033 |
| 353 | Ga0207641_10594574 | 3300026088 | Bacteria | 1083 |
| 354 | Ga0207648_10202867 | 3300026089 | Bacteria | 1759 |
| 355 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 356 | Ga0207676_10003660 | 3300026095 | Bacteria | 10868 |
| 357 | Ga0207676_10041001 | 3300026095 | Bacteria | 3551 |
| 358 | Ga0207674_10016614 | 3300026116 | Bacteria | 8047 |
| 359 | Ga0207674_10036217 | 3300026116 | Bacteria | 5144 |
| 360 | Ga0207674_10156519 | 3300026116 | Bacteria | 2234 |
| 361 | Ga0207674_10321678 | 3300026116 | Bacteria | 1496 |
| 362 | Ga0207674_10352766 | 3300026116 | Bacteria | 1422 |
| 363 | Ga0207674_10495110 | 3300026116 | Bacteria | 1181 |
| 364 | Ga0207675_100000295 | 3300026118 | Bacteria | 48065 |
| 365 | Ga0207683_10227364 | 3300026121 | Bacteria | 1701 |
| 366 | Ga0207698_10000084 | 3300026142 | Bacteria | 62453 |
| 367 | Ga0207698_10096807 | 3300026142 | Bacteria | 2433 |
| 368 | Ga0207698_10296588 | 3300026142 | Bacteria | 1503 |
| 369 | Ga0207698_10653695 | 3300026142 | Bacteria | 1042 |
| 370 | Ga0209281_1036510 | 3300027111 | Bacteria | 849 |
| 371 | Ga0209179_1000009 | 3300027512 | Bacteria | 76604 |
| 372 | Ga0209813_10000030 | 3300027866 | Bacteria | 65385 |
| 373 | Ga0209813_10000086 | 3300027866 | Bacteria | 34481 |
| 374 | Ga0209974_10012619 | 3300027876 | Bacteria | 2822 |
| 375 | Ga0268266_10000334 | 3300028379 | Bacteria | 73724 |
| 376 | Ga0268266_10064439 | 3300028379 | Bacteria | 3166 |
| 377 | Ga0268266_10113198 | 3300028379 | Bacteria | 2406 |
| 378 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 379 | Ga0268265_10000946 | 3300028380 | Bacteria | 26688 |
| 380 | Ga0268265_10009588 | 3300028380 | Bacteria | 6539 |
| 381 | Ga0268265_10019703 | 3300028380 | Bacteria | 4696 |
| 382 | Ga0268265_10052298 | 3300028380 | Bacteria | 3088 |
| 383 | Ga0268265_10334085 | 3300028380 | Bacteria | 1377 |
| 384 | Ga0268265_10673199 | 3300028380 | Bacteria | 997 |
| 385 | Ga0268264_10000103 | 3300028381 | Bacteria | 222439 |
| 386 | Ga0268264_10000253 | 3300028381 | Bacteria | 98587 |
| 387 | Ga0268264_10009442 | 3300028381 | Bacteria | 8079 |
| 388 | Ga0268264_10039602 | 3300028381 | Bacteria | 3894 |
| 389 | Ga0268264_10051702 | 3300028381 | Bacteria | 3425 |
| 390 | Ga0268264_10085974 | 3300028381 | Bacteria | 2701 |
| 391 | Ga0268264_10089499 | 3300028381 | Bacteria | 2650 |
| 392 | Ga0268264_10102485 | 3300028381 | Bacteria | 2491 |
| 393 | Ga0265338_10222996 | 3300028800 | Bacteria | 1407 |
| 394 | Ga0265340_10115545 | 3300031247 | Bacteria | 1237 |
| 395 | Ga0307513_10001613 | 3300031456 | Bacteria | 32387 |
| 396 | Ga0307513_10208649 | 3300031456 | Bacteria | 1787 |
| 397 | Ga0307408_100252426 | 3300031548 | Bacteria | 1455 |
| 398 | Ga0307408_100545711 | 3300031548 | Bacteria | 1022 |
| 399 | Ga0307508_10032618 | 3300031616 | Bacteria | 4705 |
| 400 | Ga0307405_10003498 | 3300031731 | Bacteria | 7227 |
| 401 | Ga0307405_10272346 | 3300031731 | Bacteria | 1270 |
| 402 | Ga0307405_10436721 | 3300031731 | Bacteria | 1034 |
| 403 | Ga0307413_10012334 | 3300031824 | Bacteria | 4250 |
| 404 | Ga0307413_10189132 | 3300031824 | Bacteria | 1476 |
| 405 | Ga0307413_10868285 | 3300031824 | Bacteria | 764 |
| 406 | Ga0307413_10876693 | 3300031824 | Bacteria | 760 |
| 407 | Ga0307410_10194546 | 3300031852 | Bacteria | 1544 |
| 408 | Ga0307406_10571546 | 3300031901 | Bacteria | 928 |
| 409 | Ga0307412_10001508 | 3300031911 | Bacteria | 12930 |
| 410 | Ga0307412_10024702 | 3300031911 | Bacteria | 3712 |
| 411 | Ga0307412_10175744 | 3300031911 | Bacteria | 1605 |
| 412 | Ga0307412_10242702 | 3300031911 | Bacteria | 1394 |
| 413 | Ga0307412_10547447 | 3300031911 | Bacteria | 971 |
| 414 | Ga0307409_100030100 | 3300031995 | Bacteria | 3895 |
| 415 | Ga0307416_100049825 | 3300032002 | Bacteria | 3333 |
| 416 | Ga0307414_10000705 | 3300032004 | Bacteria | 17072 |
| 417 | Ga0307414_10001084 | 3300032004 | Bacteria | 13916 |
| 418 | Ga0307414_10029850 | 3300032004 | Bacteria | 3554 |
| 419 | Ga0307414_10037742 | 3300032004 | Bacteria | 3237 |
| 420 | Ga0307414_10056773 | 3300032004 | Bacteria | 2748 |
| 421 | Ga0307414_10134263 | 3300032004 | Bacteria | 1926 |
| 422 | Ga0307414_10219753 | 3300032004 | Bacteria | 1559 |
| 423 | Ga0307414_10248363 | 3300032004 | Bacteria | 1477 |
| 424 | Ga0307414_10423646 | 3300032004 | Bacteria | 1161 |
| 425 | Ga0307414_10491403 | 3300032004 | Bacteria | 1084 |
| 426 | Ga0307414_10623916 | 3300032004 | Bacteria | 969 |
| 427 | Ga0307411_10104385 | 3300032005 | Bacteria | 2012 |
| 428 | Ga0307411_10775929 | 3300032005 | Bacteria | 842 |
| 429 | Ga0307415_100076393 | 3300032126 | Bacteria | 2374 |
| 430 | Ga0316593_10207597 | 3300032168 | Bacteria | 725 |
| 431 | Ga0373938_0090870 | 3300034957 | Bacteria | 755 |
| 432 | Ga0373937_0589995 | 3300036401 | Bacteria | 1055 |
| 433 | Ga0316582_0002953 | 3300036647 | Bacteria | 8188 |
| 434 | Ga0316584_0360708 | 3300036712 | Bacteria | 1042 |
| 435 | Ga0373925_0135830 | 3300037068 | Bacteria | 1922 |
| 436 | Ga0395900_0680055 | 3300037418 | Bacteria | 964 |
| 437 | Ga0395905_0588016 | 3300037471 | Bacteria | 1015 |
| 438 | Ga0436365_0809192 | 3300039437 | Bacteria | 1880 |
| 439 | Ga0436365_1004127 | 3300039437 | Bacteria | 910 |
| 440 | Ga0436361_0795199 | 3300039447 | Bacteria | 71391 |
| 441 | Ga0436362_0652764 | 3300039453 | Bacteria | 11891 |
| 442 | Ga0451794_34338 | 3300041446 | Bacteria | 880 |
| 443 | Ga0451793_1178553 | 3300041452 | Bacteria | 1835 |
| 444 | Ga0451795_0306834 | 3300041456 | Bacteria | 2576 |
| 445 | Ga0451798_0275487 | 3300041458 | Bacteria | 1568 |
| 446 | Ga0451837_1228643 | 3300041494 | Bacteria | 1442 |
| 447 | Ga0451839_1432329 | 3300041496 | Bacteria | 867 |
| 448 | Ga0453684_0305197 | 3300044712 | Bacteria | 1808 |
| 449 | Ga0453684_0840433 | 3300044712 | Bacteria | 987 |
| 450 | Ga0451576_0000393 | 3300045051 | Bacteria | 101814 |
| 451 | Ga0451576_0233962 | 3300045051 | Bacteria | 1919 |
| 452 | Ga0451576_0745474 | 3300045051 | Bacteria | 1029 |
| 453 | Ga0495627_001098 | 3300046453 | Bacteria | 17664 |
| 454 | Ga0495629_0000146 | 3300046459 | Bacteria | 61760 |
| 455 | Ga0495638_0073995 | 3300046460 | Bacteria | 2078 |
| 456 | Ga0495650_0002319 | 3300046471 | Bacteria | 15764 |
| 457 | Ga0495650_0003325 | 3300046471 | Bacteria | 11850 |
| 458 | Ga0495580_0003640 | 3300046472 | Bacteria | 13053 |
| 459 | Ga0495639_0101109 | 3300046475 | Bacteria | 1361 |
| 460 | Ga0495596_0001173 | 3300046500 | Bacteria | 15369 |
| 461 | Ga0495596_0004200 | 3300046500 | Bacteria | 7076 |
| 462 | Ga0495607_0016080 | 3300046501 | Bacteria | 4834 |
| 463 | Ga0495583_0023741 | 3300046506 | Bacteria | 3095 |
| 464 | Ga0495583_0042264 | 3300046506 | Bacteria | 2130 |
| 465 | Ga0495606_0055232 | 3300046507 | Bacteria | 2569 |
| 466 | Ga0495610_0000061 | 3300046512 | Bacteria | 130986 |
| 467 | Ga0495610_0000419 | 3300046512 | Bacteria | 43586 |
| 468 | Ga0495610_0000439 | 3300046512 | Bacteria | 42869 |
| 469 | Ga0495610_0072290 | 3300046512 | Bacteria | 1606 |
| 470 | Ga0495620_0213274 | 3300046515 | Bacteria | 740 |
| 471 | Ga0495628_0109223 | 3300046516 | Bacteria | 2129 |
| 472 | Ga0495632_0000105 | 3300046519 | Bacteria | 85761 |
| 473 | Ga0495632_0090193 | 3300046519 | Bacteria | 1454 |
| 474 | Ga0495643_0000047 | 3300046522 | Bacteria | 217914 |
| 475 | Ga0495643_0000292 | 3300046522 | Bacteria | 70858 |
| 476 | Ga0495643_0011234 | 3300046522 | Bacteria | 5468 |
| 477 | Ga0495643_0094972 | 3300046522 | Bacteria | 1534 |
| 478 | Ga0495648_0100538 | 3300046524 | Bacteria | 1597 |
| 479 | Ga0495663_0000009 | 3300046525 | Bacteria | 256308 |
| 480 | Ga0495642_0012505 | 3300046528 | Bacteria | 3272 |
| 481 | Ga0495654_0093743 | 3300046530 | Bacteria | 1390 |
| 482 | Ga0495654_0155411 | 3300046530 | Bacteria | 1008 |
| 483 | Ga0495654_0178414 | 3300046530 | Bacteria | 921 |
| 484 | Ga0495609_0009392 | 3300046538 | Bacteria | 4733 |
| 485 | Ga0495645_0000664 | 3300046543 | Bacteria | 23737 |
| 486 | Ga0495633_0000178 | 3300046558 | Bacteria | 82451 |
| 487 | Ga0495633_0027054 | 3300046558 | Bacteria | 2807 |
| 488 | Ga0495633_0069624 | 3300046558 | Bacteria | 1642 |
| 489 | Ga0495667_0010947 | 3300046559 | Bacteria | 6130 |
| 490 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 491 | Ga0495668_0149714 | 3300046616 | Bacteria | 1278 |
| 492 | Ga0495668_0354815 | 3300046616 | Bacteria | 805 |
| 493 | Ga0495625_0000553 | 3300046660 | Bacteria | 54796 |
| 494 | Ga0495625_0045181 | 3300046660 | Bacteria | 3186 |
| 495 | Ga0495625_0131051 | 3300046660 | Bacteria | 1698 |
| 496 | Ga0495625_0209164 | 3300046660 | Bacteria | 1283 |
| 497 | Ga0495588_0039766 | 3300046674 | Bacteria | 2397 |
| 498 | Ga0495599_0341859 | 3300046678 | Bacteria | 898 |
| 499 | Ga0495646_0278540 | 3300046680 | Bacteria | 889 |
| 500 | Ga0495658_0191175 | 3300046683 | Bacteria | 1273 |
| 501 | Ga0495613_0235183 | 3300046689 | Bacteria | 1282 |
| 502 | Ga0495624_0017329 | 3300046690 | Bacteria | 4838 |
| 503 | Ga0495670_0137867 | 3300046691 | Bacteria | 1274 |
| 504 | Ga0495670_0340179 | 3300046691 | Bacteria | 807 |
| 505 | Ga0495671_0000038 | 3300046692 | Bacteria | 173693 |
| 506 | Ga0495671_0013917 | 3300046692 | Bacteria | 4340 |
| 507 | Ga0495671_0015368 | 3300046692 | Bacteria | 4103 |
| 508 | Ga0495649_0332095 | 3300046694 | Bacteria | 770 |
| 509 | Ga0495581_0001065 | 3300047315 | Bacteria | 14886 |
| 510 | Ga0495581_0100468 | 3300047315 | Bacteria | 1680 |
| 511 | Ga0495674_0103376 | 3300047319 | Bacteria | 2422 |
| 512 | Ga0495676_0189371 | 3300047321 | Bacteria | 1436 |
| 513 | Ga0495675_0064124 | 3300047444 | Bacteria | 2324 |
| 514 | Ga0495679_016873 | 3300047446 | Bacteria | 2629 |
| 515 | Ga0495681_0001474 | 3300047470 | Bacteria | 17572 |
| 516 | Ga0495686_0063113 | 3300047472 | Bacteria | 2296 |
| 517 | Ga0495614_0025746 | 3300048089 | Bacteria | 2537 |
| 518 | Ga0495615_0000267 | 3300048090 | Bacteria | 9871 |
| 519 | Ga0495626_0006288 | 3300048091 | Bacteria | 6779 |
| 520 | Ga0496100_0045960 | 3300048903 | Bacteria | 2804 |
| 521 | Ga0496100_0369263 | 3300048903 | Bacteria | 1087 |
| 522 | Ga0496101_0062363 | 3300048904 | Bacteria | 2710 |
| 523 | Ga0496101_0157300 | 3300048904 | Bacteria | 1741 |
| 524 | Ga0496102_0007356 | 3300048905 | Bacteria | 9406 |
| 525 | Ga0496102_0040281 | 3300048905 | Bacteria | 4225 |
| 526 | Ga0496102_0123984 | 3300048905 | Bacteria | 2414 |
| 527 | Ga0496102_0586123 | 3300048905 | Bacteria | 1038 |
| 528 | Ga0496102_0681090 | 3300048905 | Bacteria | 951 |
| 529 | Ga0496103_0000289 | 3300048906 | Bacteria | 47033 |
| 530 | Ga0496103_0003521 | 3300048906 | Bacteria | 9565 |
| 531 | Ga0496104_0002529 | 3300048907 | Bacteria | 15756 |
| 532 | Ga0496104_0008321 | 3300048907 | Bacteria | 9212 |
| 533 | Ga0496104_0034031 | 3300048907 | Bacteria | 4749 |
| 534 | Ga0496105_0004036 | 3300048908 | Bacteria | 10984 |
| 535 | Ga0496105_0008999 | 3300048908 | Bacteria | 7789 |
| 536 | Ga0496105_0023629 | 3300048908 | Bacteria | 4988 |
| 537 | Ga0496105_0027299 | 3300048908 | Bacteria | 4662 |
| 538 | Ga0496105_0036533 | 3300048908 | Bacteria | 4047 |
| 539 | Ga0496105_0276746 | 3300048908 | Bacteria | 1354 |
| 540 | Ga0496106_0080568 | 3300048909 | Bacteria | 2500 |
| 541 | Ga0496106_0094663 | 3300048909 | Bacteria | 2310 |
| 542 | Ga0496107_0026728 | 3300048910 | Bacteria | 4094 |
| 543 | Ga0496107_0062193 | 3300048910 | Bacteria | 2704 |
| 544 | Ga0496107_0212975 | 3300048910 | Bacteria | 1437 |
| 545 | Ga0496108_0024686 | 3300048911 | Bacteria | 4951 |
| 546 | Ga0496108_0149032 | 3300048911 | Bacteria | 2018 |
| 547 | Ga0496109_0146015 | 3300048912 | Bacteria | 2213 |
| 548 | Ga0496109_0301809 | 3300048912 | Bacteria | 1510 |
| 549 | Ga0496110_0002075 | 3300048913 | Bacteria | 14933 |
| 550 | Ga0496110_0188020 | 3300048913 | Bacteria | 1875 |
| 551 | Ga0496110_0189159 | 3300048913 | Bacteria | 1869 |
| 552 | Ga0496111_0004248 | 3300048914 | Bacteria | 9027 |
| 553 | Ga0496111_0392086 | 3300048914 | Bacteria | 1026 |
| 554 | Ga0496111_0501573 | 3300048914 | Bacteria | 893 |
| 555 | Ga0496112_0324684 | 3300048915 | Bacteria | 1483 |
| 556 | Ga0496112_0769744 | 3300048915 | Bacteria | 888 |
| 557 | Ga0496113_0057000 | 3300048916 | Bacteria | 2934 |
| 558 | Ga0496113_0518854 | 3300048916 | Bacteria | 956 |
| 559 | Ga0496114_0002211 | 3300048917 | Bacteria | 14813 |
| 560 | Ga0496114_0021180 | 3300048917 | Bacteria | 5287 |
| 561 | Ga0496114_0094079 | 3300048917 | Bacteria | 2549 |
| 562 | Ga0496114_0132124 | 3300048917 | Bacteria | 2156 |
| 563 | Ga0496115_0104706 | 3300048918 | Bacteria | 2322 |
| 564 | Ga0496116_0000017 | 3300048919 | Bacteria | 554463 |
| 565 | Ga0496116_0067918 | 3300048919 | Bacteria | 2274 |
| 566 | Ga0496116_0154869 | 3300048919 | Bacteria | 1266 |
| 567 | Ga0496116_0344750 | 3300048919 | Bacteria | 685 |
| 568 | Ga0496117_0005177 | 3300048920 | Bacteria | 13905 |
| 569 | Ga0496117_0046495 | 3300048920 | Bacteria | 3121 |
| 570 | Ga0496117_0056392 | 3300048920 | Bacteria | 2736 |
| 571 | Ga0496117_0082213 | 3300048920 | Bacteria | 2110 |
| 572 | Ga0496118_0010426 | 3300048921 | Bacteria | 9205 |
| 573 | Ga0496118_0025636 | 3300048921 | Bacteria | 5047 |
| 574 | Ga0496118_0124788 | 3300048921 | Bacteria | 1669 |
| 575 | Ga0496119_0015252 | 3300048922 | Bacteria | 5935 |
| 576 | Ga0496119_0145337 | 3300048922 | Bacteria | 1276 |
| 577 | Ga0496120_0038515 | 3300048923 | Bacteria | 2827 |
| 578 | Ga0496120_0166564 | 3300048923 | Bacteria | 1094 |
| 579 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 580 | Ga0496121_0003524 | 3300048924 | Bacteria | 22206 |
| 581 | Ga0496121_0007492 | 3300048924 | Bacteria | 13178 |
| 582 | Ga0496121_0060403 | 3300048924 | Bacteria | 3117 |
| 583 | Ga0496121_0133249 | 3300048924 | Bacteria | 1855 |
| 584 | Ga0496122_0000927 | 3300048925 | Bacteria | 53530 |
| 585 | Ga0496122_0016481 | 3300048925 | Bacteria | 6986 |
| 586 | Ga0496122_0051830 | 3300048925 | Bacteria | 3113 |
| 587 | Ga0496123_0000278 | 3300048926 | Bacteria | 100746 |
| 588 | Ga0496123_0001559 | 3300048926 | Bacteria | 31386 |
| 589 | Ga0496123_0002247 | 3300048926 | Bacteria | 24430 |
| 590 | Ga0496123_0045177 | 3300048926 | Bacteria | 3003 |
| 591 | Ga0496123_0094923 | 3300048926 | Bacteria | 1756 |
| 592 | Ga0496124_0011768 | 3300048927 | Bacteria | 8723 |
| 593 | Ga0496124_0023962 | 3300048927 | Bacteria | 5558 |
| 594 | Ga0496124_0047414 | 3300048927 | Bacteria | 3676 |
| 595 | Ga0496124_0298372 | 3300048927 | Bacteria | 1165 |
| 596 | Ga0496125_0002203 | 3300048928 | Bacteria | 25991 |
| 597 | Ga0496125_0008773 | 3300048928 | Bacteria | 10514 |
| 598 | Ga0496125_0015399 | 3300048928 | Bacteria | 7401 |
| 599 | Ga0496125_0071804 | 3300048928 | Bacteria | 2702 |
| 600 | Ga0496125_0254048 | 3300048928 | Bacteria | 1107 |
| 601 | Ga0496126_0000661 | 3300048929 | Bacteria | 63847 |
| 602 | Ga0496126_0018782 | 3300048929 | Bacteria | 6836 |
| 603 | Ga0496126_0121534 | 3300048929 | Bacteria | 2264 |
| 604 | Ga0501307_023140 | 3300049162 | Bacteria | 821 |
| 605 | Ga0495682_0065214 | 3300049460 | Bacteria | 1313 |
| 606 | Ga0501300_010361 | 3300049523 | Bacteria | 1359 |
| 607 | Ga0501335_000731 | 3300049551 | Bacteria | 2255 |
| 608 | Ga0501338_02973 | 3300049554 | Bacteria | 985 |
| 609 | Ga0501031_0158644 | 3300049568 | Bacteria | 1479 |
| 610 | Ga0501036_0283879 | 3300049572 | Bacteria | 1385 |
| 611 | Ga0501039_0098928 | 3300049575 | Bacteria | 2276 |
| 612 | Ga0501046_0169124 | 3300049580 | Bacteria | 1641 |
| 613 | Ga0501047_0001720 | 3300049581 | Bacteria | 21287 |
| 614 | Ga0501047_0350443 | 3300049581 | Bacteria | 1313 |
| 615 | Ga0501069_0181740 | 3300049585 | Bacteria | 1216 |
| 616 | Ga0501074_0228179 | 3300049590 | Bacteria | 1326 |
| 617 | Ga0501077_0109485 | 3300049593 | Bacteria | 1750 |
| 618 | Ga0501223_000012 | 3300049663 | Bacteria | 75953 |
| 619 | Ga0501235_003444 | 3300049669 | Bacteria | 3423 |
| 620 | Ga0501235_014329 | 3300049669 | Bacteria | 1748 |
| 621 | Ga0501246_001750 | 3300049676 | Bacteria | 1681 |
| 622 | Ga0501249_000043 | 3300049679 | Bacteria | 52821 |
| 623 | Ga0501225_0000264 | 3300049705 | Bacteria | 16586 |
| 624 | Ga0501225_0003322 | 3300049705 | Bacteria | 4901 |
| 625 | Ga0501225_0103574 | 3300049705 | Bacteria | 833 |
| 626 | Ga0501245_010046 | 3300049708 | Bacteria | 1365 |
| 627 | Ga0501080_0080815 | 3300049742 | Bacteria | 3021 |
| 628 | Ga0501083_0255418 | 3300049744 | Bacteria | 1141 |
| 629 | Ga0501035_0126826 | 3300049822 | Bacteria | 2228 |
| 630 | Ga0501044_0001652 | 3300049823 | Bacteria | 26175 |
| 631 | Ga0501044_0292723 | 3300049823 | Bacteria | 1559 |
| 632 | Ga0501204_004333 | 3300049850 | Bacteria | 1526 |
| 633 | nmdc:mga03683_113_c1 | 3300050489 | Bacteria | 27805 |
| 634 | nmdc:mga03683_162_c1 | 3300050489 | Bacteria | 22492 |
| 635 | nmdc:mga03683_26924_c1 | 3300050489 | Bacteria | 1537 |
| 636 | nmdc:mga03683_7936_c1 | 3300050489 | Bacteria | 3709 |
| 637 | nmdc:mga03n38_11272_c1 | 3300050490 | Bacteria | 3324 |
| 638 | nmdc:mga03n38_76008_c1 | 3300050490 | Bacteria | 1566 |
| 639 | nmdc:mga00v17_101410_c1 | 3300050491 | Bacteria | 1817 |
| 640 | nmdc:mga00v17_1860_c2 | 3300050491 | Bacteria | 8856 |
| 641 | nmdc:mga00v17_74187_c1 | 3300050491 | Bacteria | 2114 |
| 642 | nmdc:mga0k408_118710_c1 | 3300050493 | Bacteria | 1566 |
| 643 | nmdc:mga0k408_23049_c1 | 3300050493 | Bacteria | 3509 |
| 644 | nmdc:mga0k408_9_c2 | 3300050493 | Bacteria | 64937 |
| 645 | nmdc:mga06z11_211_c1 | 3300050494 | Bacteria | 23476 |
| 646 | nmdc:mga06z11_2260_c1 | 3300050494 | Bacteria | 7328 |
| 647 | nmdc:mga04h51_117_c1 | 3300050495 | Bacteria | 23249 |
| 648 | nmdc:mga04h51_802_c1 | 3300050495 | Bacteria | 7297 |
| 649 | nmdc:mga07m45_13_c1 | 3300050496 | Bacteria | 65600 |
| 650 | nmdc:mga07m45_160939_c1 | 3300050496 | Bacteria | 1303 |
| 651 | nmdc:mga07m45_226805_c1 | 3300050496 | Bacteria | 1087 |
| 652 | nmdc:mga07m45_27084_c1 | 3300050496 | Bacteria | 3155 |
| 653 | nmdc:mga07m45_32_c1 | 3300050496 | Bacteria | 78063 |
| 654 | nmdc:mga07m45_96539_c1 | 3300050496 | Bacteria | 1696 |
| 655 | nmdc:mga0qj67_93735_c1 | 3300050509 | Bacteria | 2415 |
| 656 | nmdc:mga06r32_73625_c1 | 3300050510 | Bacteria | 3310 |
| 657 | nmdc:mga08y16_69568_c1 | 3300050511 | Bacteria | 3670 |
| 658 | nmdc:mga0sz30_1711_c1 | 3300050516 | Bacteria | 7791 |
| 659 | nmdc:mga0sz30_532_c1 | 3300050516 | Bacteria | 14177 |
| 660 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 661 | Ga0500643_015584 | 3300053087 | Bacteria | 2602 |
| 662 | Ga0500646_0035843 | 3300053090 | Bacteria | 1380 |
| 663 | Ga0500651_0019570 | 3300053093 | Bacteria | 4207 |
| 664 | Ga0500650_0082230 | 3300053098 | Bacteria | 1506 |
| 665 | Ga0500569_030913 | 3300053109 | Bacteria | 1502 |
| 666 | Ga0500592_010955 | 3300053116 | Bacteria | 1448 |
| 667 | Ga0500594_0013935 | 3300053118 | Bacteria | 1919 |
| 668 | Ga0500607_000007 | 3300053121 | Bacteria | 134097 |
| 669 | Ga0500607_013728 | 3300053121 | Bacteria | 4723 |
| 670 | Ga0500608_000153 | 3300053122 | Bacteria | 28720 |
| 671 | Ga0500614_012464 | 3300053123 | Bacteria | 1856 |
| 672 | Ga0500642_0003221 | 3300053130 | Bacteria | 4902 |
| 673 | Ga0500652_000262 | 3300053131 | Bacteria | 19666 |
| 674 | Ga0500559_0001283 | 3300053136 | Bacteria | 14595 |
| 675 | Ga0500564_032278 | 3300053138 | Bacteria | 2414 |
| 676 | Ga0500568_0003830 | 3300053139 | Bacteria | 8217 |
| 677 | Ga0500568_0123340 | 3300053139 | Bacteria | 965 |
| 678 | Ga0500577_0038792 | 3300053142 | Bacteria | 1722 |
| 679 | Ga0500590_001101 | 3300053148 | Bacteria | 10620 |
| 680 | Ga0500604_0067657 | 3300053151 | Bacteria | 1134 |
| 681 | Ga0500616_0001386 | 3300053153 | Bacteria | 23416 |
| 682 | Ga0500622_0000167 | 3300053156 | Bacteria | 70349 |
| 683 | Ga0500622_0000264 | 3300053156 | Bacteria | 53598 |
| 684 | Ga0500622_0001913 | 3300053156 | Bacteria | 15706 |
| 685 | Ga0500622_0050628 | 3300053156 | Bacteria | 2139 |
| 686 | Ga0500622_0083606 | 3300053156 | Bacteria | 1594 |
| 687 | Ga0500627_0000049 | 3300053158 | Bacteria | 58947 |
| 688 | Ga0500627_0123233 | 3300053158 | Bacteria | 1170 |
| 689 | Ga0500567_001107 | 3300053723 | Bacteria | 10515 |
| 690 | Ga0500625_000005 | 3300053729 | Bacteria | 209509 |
| 691 | Ga0500645_002593 | 3300053730 | Bacteria | 7949 |
| 692 | Ga0500645_013341 | 3300053730 | Bacteria | 2639 |
| 693 | Ga0587101_001104 | 3300059623 | Bacteria | 2212 |
| 694 | Ga0501082_0374578 | 3300060353 | Bacteria | 1242 |
| 695 | Ga0530510_0059269 | 3300061734 | Bacteria | 2769 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041456 | Ga0451795_0306834 | Ga0451795_0306834_1990_2565 | 187 |
| 2 | 3300005340 | Ga0070689_100539569 | Ga0070689_1005395692 | 194 |
| 3 | 3300046516 | Ga0495628_0109223 | Ga0495628_0109223_1492_2115 | 195 |
| 4 | 3300046678 | Ga0495599_0341859 | Ga0495599_0341859_19_642 | 195 |
| 5 | 3300046690 | Ga0495624_0017329 | Ga0495624_0017329_1999_2622 | 195 |
| 6 | 3300047315 | Ga0495581_0100468 | Ga0495581_0100468_515_1138 | 195 |
| 7 | 3300047319 | Ga0495674_0103376 | Ga0495674_0103376_844_1467 | 195 |
| 8 | 3300047321 | Ga0495676_0189371 | Ga0495676_0189371_613_1236 | 195 |
| 9 | 3300009098 | Ga0105245_10155936 | Ga0105245_101559362 | 199 |
| 10 | 3300025927 | Ga0207687_10069633 | Ga0207687_100696332 | 199 |
| 11 | 3300025942 | Ga0207689_10219317 | Ga0207689_102193172 | 199 |
| 12 | 3300048905 | Ga0496102_0123984 | Ga0496102_0123984_970_1677 | 199 |
| 13 | 3300046691 | Ga0495670_0340179 | Ga0495670_0340179_110_736 | 200 |
| 14 | 3300049590 | Ga0501074_0228179 | Ga0501074_0228179_501_1127 | 200 |
| 15 | 3300049575 | Ga0501039_0098928 | Ga0501039_0098928_1399_2028 | 201 |
| 16 | 3300041446 | Ga0451794_34338 | Ga0451794_34338_21_641 | 202 |
| 17 | 3300041452 | Ga0451793_1178553 | Ga0451793_1178553_417_1037 | 202 |
| 18 | 3300041494 | Ga0451837_1228643 | Ga0451837_1228643_173_793 | 202 |
| 19 | 3300046459 | Ga0495629_0000146 | Ga0495629_0000146_45661_46278 | 202 |
| 20 | 3300046471 | Ga0495650_0002319 | Ga0495650_0002319_14918_15535 | 202 |
| 21 | 3300046472 | Ga0495580_0003640 | Ga0495580_0003640_3863_4480 | 202 |
| 22 | 3300046506 | Ga0495583_0042264 | Ga0495583_0042264_30_647 | 202 |
| 23 | 3300046528 | Ga0495642_0012505 | Ga0495642_0012505_698_1315 | 202 |
| 24 | 3300046530 | Ga0495654_0155411 | Ga0495654_0155411_22_639 | 202 |
| 25 | 3300046543 | Ga0495645_0000664 | Ga0495645_0000664_7958_8575 | 202 |
| 26 | 3300046559 | Ga0495667_0010947 | Ga0495667_0010947_1955_2572 | 202 |
| 27 | 3300046616 | Ga0495668_0354815 | Ga0495668_0354815_39_656 | 202 |
| 28 | 3300046674 | Ga0495588_0039766 | Ga0495588_0039766_1684_2301 | 202 |
| 29 | 3300046680 | Ga0495646_0278540 | Ga0495646_0278540_26_643 | 202 |
| 30 | 3300047315 | Ga0495581_0001065 | Ga0495581_0001065_14175_14792 | 202 |
| 31 | 3300047444 | Ga0495675_0064124 | Ga0495675_0064124_1653_2270 | 202 |
| 32 | 3300047446 | Ga0495679_016873 | Ga0495679_016873_761_1378 | 202 |
| 33 | 3300048089 | Ga0495614_0025746 | Ga0495614_0025746_1076_1693 | 202 |
| 34 | 3300048908 | Ga0496105_0027299 | Ga0496105_0027299_292_909 | 202 |
| 35 | 3300048910 | Ga0496107_0026728 | Ga0496107_0026728_2936_3553 | 202 |
| 36 | 3300048917 | Ga0496114_0002211 | Ga0496114_0002211_4349_4966 | 202 |
| 37 | 3300048918 | Ga0496115_0104706 | Ga0496115_0104706_66_683 | 202 |
| 38 | 3300049593 | Ga0501077_0109485 | Ga0501077_0109485_76_693 | 202 |
| 39 | iso_pu_bacteria | 2643221560 | 2643820527 | 202 |
| 40 | iso_pu_bacteria | 2643221563 | 2643836342 | 202 |
| 41 | iso_pu_bacteria | 2643221608 | 2644052818 | 202 |
| 42 | iso_pu_bacteria | 2852653556 | 2852653953 | 202 |
| 43 | iso_pu_bacteria | 2897803580 | 2897803811 | 202 |
| 44 | 3300025304 | Ga0209257_1020289 | Ga0209257_10202893 | 203 |
| 45 | 3300031456 | Ga0307513_10208649 | Ga0307513_102086492 | 203 |
| 46 | 3300037471 | Ga0395905_0588016 | Ga0395905_0588016_231_854 | 203 |
| 47 | 3300041458 | Ga0451798_0275487 | Ga0451798_0275487_613_1236 | 203 |
| 48 | 3300046512 | Ga0495610_0072290 | Ga0495610_0072290_350_973 | 203 |
| 49 | 3300046515 | Ga0495620_0213274 | Ga0495620_0213274_22_645 | 203 |
| 50 | 3300050489 | nmdc:mga03683_26924_c1 | nmdc:mga03683_26924_c1_357_980 | 203 |
| 51 | 3300050490 | nmdc:mga03n38_76008_c1 | nmdc:mga03n38_76008_c1_694_1317 | 203 |
| 52 | 3300050496 | nmdc:mga07m45_27084_c1 | nmdc:mga07m45_27084_c1_2160_2783 | 203 |
| 53 | 3300053090 | Ga0500646_0035843 | Ga0500646_0035843_667_1290 | 203 |
| 54 | 3300053093 | Ga0500651_0019570 | Ga0500651_0019570_622_1245 | 203 |
| 55 | 3300053098 | Ga0500650_0082230 | Ga0500650_0082230_541_1164 | 203 |
| 56 | 3300053109 | Ga0500569_030913 | Ga0500569_030913_221_844 | 203 |
| 57 | 3300053130 | Ga0500642_0003221 | Ga0500642_0003221_2908_3531 | 203 |
| 58 | 3300053131 | Ga0500652_000262 | Ga0500652_000262_2594_3217 | 203 |
| 59 | 3300053142 | Ga0500577_0038792 | Ga0500577_0038792_434_1057 | 203 |
| 60 | 3300053156 | Ga0500622_0000264 | Ga0500622_0000264_35308_35931 | 203 |
| 61 | 3300053156 | Ga0500622_0050628 | Ga0500622_0050628_874_1497 | 203 |
| 62 | iso_pu_bacteria | 2597490356 | 2599101453 | 203 |
| 63 | iso_pu_bacteria | 2846952575 | 2846953823 | 203 |
| 64 | 3300003781 | Ga0055536_1021245 | Ga0055536_10212453 | 204 |
| 65 | 3300003784 | Ga0055534_1004606 | Ga0055534_10046063 | 204 |
| 66 | 3300003791 | Ga0055530_10000522 | Ga0055530_1000052212 | 204 |
| 67 | 3300003794 | Ga0055531_10004791 | Ga0055531_100047919 | 204 |
| 68 | 3300003794 | Ga0055531_10028736 | Ga0055531_100287362 | 204 |
| 69 | 3300003794 | Ga0055531_10029712 | Ga0055531_100297123 | 204 |
| 70 | 3300025263 | Ga0209565_1029745 | Ga0209565_10297451 | 204 |
| 71 | 3300025291 | Ga0209675_1001006 | Ga0209675_100100614 | 204 |
| 72 | 3300025292 | Ga0209676_1000557 | Ga0209676_100055723 | 204 |
| 73 | 3300025292 | Ga0209676_1002559 | Ga0209676_10025595 | 204 |
| 74 | 3300025292 | Ga0209676_1019878 | Ga0209676_10198782 | 204 |
| 75 | 3300025294 | Ga0209025_1022462 | Ga0209025_10224623 | 204 |
| 76 | 3300025294 | Ga0209025_1060056 | Ga0209025_10600561 | 204 |
| 77 | 3300025298 | Ga0209050_1000017 | Ga0209050_100001753 | 204 |
| 78 | 3300025298 | Ga0209050_1013681 | Ga0209050_10136812 | 204 |
| 79 | 3300025304 | Ga0209257_1001118 | Ga0209257_100111815 | 204 |
| 80 | 3300025304 | Ga0209257_1001176 | Ga0209257_100117627 | 204 |
| 81 | 3300025304 | Ga0209257_1001719 | Ga0209257_10017199 | 204 |
| 82 | 3300028800 | Ga0265338_10222996 | Ga0265338_102229962 | 204 |
| 83 | 3300031824 | Ga0307413_10876693 | Ga0307413_108766931 | 204 |
| 84 | 3300031901 | Ga0307406_10571546 | Ga0307406_105715461 | 204 |
| 85 | 3300031911 | Ga0307412_10001508 | Ga0307412_100015084 | 204 |
| 86 | 3300031911 | Ga0307412_10547447 | Ga0307412_105474471 | 204 |
| 87 | 3300032004 | Ga0307414_10000705 | Ga0307414_100007054 | 204 |
| 88 | 3300032004 | Ga0307414_10001084 | Ga0307414_100010843 | 204 |
| 89 | 3300032004 | Ga0307414_10029850 | Ga0307414_100298502 | 204 |
| 90 | 3300032004 | Ga0307414_10219753 | Ga0307414_102197532 | 204 |
| 91 | 3300032004 | Ga0307414_10248363 | Ga0307414_102483632 | 204 |
| 92 | 3300032004 | Ga0307414_10491403 | Ga0307414_104914032 | 204 |
| 93 | 3300032004 | Ga0307414_10623916 | Ga0307414_106239161 | 204 |
| 94 | 3300046519 | Ga0495632_0090193 | Ga0495632_0090193_578_1201 | 204 |
| 95 | 3300046522 | Ga0495643_0094972 | Ga0495643_0094972_644_1294 | 204 |
| 96 | 3300046530 | Ga0495654_0093743 | Ga0495654_0093743_590_1240 | 204 |
| 97 | 3300046660 | Ga0495625_0000553 | Ga0495625_0000553_53429_54079 | 204 |
| 98 | 3300049523 | Ga0501300_010361 | Ga0501300_010361_55_705 | 204 |
| 99 | 3300049554 | Ga0501338_02973 | Ga0501338_02973_238_888 | 204 |
| 100 | 3300053139 | Ga0500568_0003830 | Ga0500568_0003830_6830_7480 | 204 |
| 101 | 3300053151 | Ga0500604_0067657 | Ga0500604_0067657_354_1004 | 204 |
| 102 | 3300053158 | Ga0500627_0000049 | Ga0500627_0000049_15189_15839 | 204 |
| 103 | 3300053158 | Ga0500627_0123233 | Ga0500627_0123233_47_697 | 204 |
| 104 | 3300059623 | Ga0587101_001104 | Ga0587101_001104_503_1129 | 204 |
| 105 | iso_pu_bacteria | 2848858292 | 2848859994 | 204 |
| 106 | 3300005340 | Ga0070689_100326494 | Ga0070689_1003264941 | 205 |
| 107 | 3300005458 | Ga0070681_10024323 | Ga0070681_100243236 | 205 |
| 108 | 3300005614 | Ga0068856_100298666 | Ga0068856_1002986663 | 205 |
| 109 | 3300005842 | Ga0068858_100572951 | Ga0068858_1005729512 | 205 |
| 110 | 3300006175 | Ga0070712_100650330 | Ga0070712_1006503301 | 205 |
| 111 | 3300009553 | Ga0105249_10054869 | Ga0105249_100548694 | 205 |
| 112 | 3300013307 | Ga0157372_11556998 | Ga0157372_115569981 | 205 |
| 113 | 3300014745 | Ga0157377_10207225 | Ga0157377_102072252 | 205 |
| 114 | 3300025912 | Ga0207707_10072692 | Ga0207707_100726924 | 205 |
| 115 | 3300025929 | Ga0207664_10843554 | Ga0207664_108435541 | 205 |
| 116 | 3300031824 | Ga0307413_10868285 | Ga0307413_108682851 | 205 |
| 117 | 3300032005 | Ga0307411_10775929 | Ga0307411_107759291 | 205 |
| 118 | 3300034957 | Ga0373938_0090870 | Ga0373938_0090870_15_635 | 205 |
| 119 | 3300036401 | Ga0373937_0589995 | Ga0373937_0589995_295_921 | 205 |
| 120 | 3300039437 | Ga0436365_0809192 | Ga0436365_0809192_828_1460 | 205 |
| 121 | 3300039453 | Ga0436362_0652764 | Ga0436362_0652764_2780_3412 | 205 |
| 122 | 3300045051 | Ga0451576_0745474 | Ga0451576_0745474_373_1002 | 205 |
| 123 | 3300046558 | Ga0495633_0000178 | Ga0495633_0000178_7810_8433 | 205 |
| 124 | 3300048920 | Ga0496117_0082213 | Ga0496117_0082213_533_1156 | 205 |
| 125 | 3300048922 | Ga0496119_0145337 | Ga0496119_0145337_155_778 | 205 |
| 126 | 3300048925 | Ga0496122_0000927 | Ga0496122_0000927_28910_29533 | 205 |
| 127 | 3300048926 | Ga0496123_0000278 | Ga0496123_0000278_71067_71690 | 205 |
| 128 | 3300050511 | nmdc:mga08y16_69568_c1 | nmdc:mga08y16_69568_c1_2613_3233 | 205 |
| 129 | iso_pu_bacteria | 2643221541 | 2643727520 | 205 |
| 130 | iso_pu_bacteria | 2643221606 | 2644041320 | 205 |
| 131 | iso_pu_bacteria | 2643221671 | 2644394860 | 205 |
| 132 | iso_pu_bacteria | 2852680915 | 2852682652 | 205 |
| 133 | 3300005563 | Ga0068855_100024810 | Ga0068855_1000248103 | 206 |
| 134 | 3300007788 | Ga0099795_10000004 | Ga0099795_1000000457 | 206 |
| 135 | 3300009093 | Ga0105240_10000353 | Ga0105240_1000035314 | 206 |
| 136 | 3300009093 | Ga0105240_10009142 | Ga0105240_100091423 | 206 |
| 137 | 3300010159 | Ga0099796_10000006 | Ga0099796_100000064 | 206 |
| 138 | 3300025913 | Ga0207695_10002735 | Ga0207695_1000273514 | 206 |
| 139 | 3300025913 | Ga0207695_10012520 | Ga0207695_100125208 | 206 |
| 140 | 3300025949 | Ga0207667_10027172 | Ga0207667_100271725 | 206 |
| 141 | 3300027512 | Ga0209179_1000009 | Ga0209179_100000935 | 206 |
| 142 | 3300046683 | Ga0495658_0191175 | Ga0495658_0191175_375_1004 | 206 |
| 143 | 3300046689 | Ga0495613_0235183 | Ga0495613_0235183_160_789 | 206 |
| 144 | 3300048927 | Ga0496124_0023962 | Ga0496124_0023962_4756_5382 | 206 |
| 145 | 3300050509 | nmdc:mga0qj67_93735_c1 | nmdc:mga0qj67_93735_c1_789_1412 | 206 |
| 146 | 3300050510 | nmdc:mga06r32_73625_c1 | nmdc:mga06r32_73625_c1_2371_2994 | 206 |
| 147 | 2162886007 | SwRhRL2b_contig_635847 | SwRhRL2b_0804.00004740 | 207 |
| 148 | 3300002459 | JGI24751J29686_10000031 | JGI24751J29686_1000003114 | 207 |
| 149 | 3300002459 | JGI24751J29686_10005318 | JGI24751J29686_100053181 | 207 |
| 150 | 3300005295 | Ga0065707_10088698 | Ga0065707_100886983 | 207 |
| 151 | 3300005331 | Ga0070670_100000082 | Ga0070670_10000008235 | 207 |
| 152 | 3300005335 | Ga0070666_10305667 | Ga0070666_103056672 | 207 |
| 153 | 3300005353 | Ga0070669_100000015 | Ga0070669_10000001535 | 207 |
| 154 | 3300005353 | Ga0070669_100097466 | Ga0070669_1000974662 | 207 |
| 155 | 3300005355 | Ga0070671_100000134 | Ga0070671_1000001341 | 207 |
| 156 | 3300005367 | Ga0070667_100000003 | Ga0070667_10000000327 | 207 |
| 157 | 3300005367 | Ga0070667_100001189 | Ga0070667_10000118918 | 207 |
| 158 | 3300005617 | Ga0068859_100061966 | Ga0068859_1000619661 | 207 |
| 159 | 3300005617 | Ga0068859_100622143 | Ga0068859_1006221432 | 207 |
| 160 | 3300005618 | Ga0068864_100000177 | Ga0068864_10000017757 | 207 |
| 161 | 3300005841 | Ga0068863_100019937 | Ga0068863_1000199373 | 207 |
| 162 | 3300005841 | Ga0068863_100025665 | Ga0068863_1000256656 | 207 |
| 163 | 3300005841 | Ga0068863_100296307 | Ga0068863_1002963072 | 207 |
| 164 | 3300005842 | Ga0068858_100000629 | Ga0068858_10000062918 | 207 |
| 165 | 3300005843 | Ga0068860_100000068 | Ga0068860_100000068159 | 207 |
| 166 | 3300005844 | Ga0068862_100000006 | Ga0068862_10000000685 | 207 |
| 167 | 3300005844 | Ga0068862_100001068 | Ga0068862_10000106826 | 207 |
| 168 | 3300006931 | Ga0097620_100061965 | Ga0097620_1000619651 | 207 |
| 169 | 3300006931 | Ga0097620_100622132 | Ga0097620_1006221322 | 207 |
| 170 | 3300009553 | Ga0105249_10258778 | Ga0105249_102587782 | 207 |
| 171 | 3300013306 | Ga0163162_10300672 | Ga0163162_103006721 | 207 |
| 172 | 3300014326 | Ga0157380_10000114 | Ga0157380_1000011427 | 207 |
| 173 | 3300017792 | Ga0163161_10098148 | Ga0163161_100981482 | 207 |
| 174 | 3300025903 | Ga0207680_10024028 | Ga0207680_100240281 | 207 |
| 175 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001759 | 207 |
| 176 | 3300025923 | Ga0207681_10146749 | Ga0207681_101467492 | 207 |
| 177 | 3300025925 | Ga0207650_10000050 | Ga0207650_10000050102 | 207 |
| 178 | 3300025925 | Ga0207650_10145132 | Ga0207650_101451322 | 207 |
| 179 | 3300025931 | Ga0207644_10000160 | Ga0207644_1000016049 | 207 |
| 180 | 3300025941 | Ga0207711_10002611 | Ga0207711_100026117 | 207 |
| 181 | 3300025961 | Ga0207712_10153623 | Ga0207712_101536231 | 207 |
| 182 | 3300025972 | Ga0207668_10000045 | Ga0207668_1000004540 | 207 |
| 183 | 3300025972 | Ga0207668_10218981 | Ga0207668_102189812 | 207 |
| 184 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002928 | 207 |
| 185 | 3300025986 | Ga0207658_10004812 | Ga0207658_100048125 | 207 |
| 186 | 3300026035 | Ga0207703_10000862 | Ga0207703_1000086224 | 207 |
| 187 | 3300026088 | Ga0207641_10004253 | Ga0207641_1000425310 | 207 |
| 188 | 3300026088 | Ga0207641_10084699 | Ga0207641_100846992 | 207 |
| 189 | 3300026088 | Ga0207641_10162128 | Ga0207641_101621282 | 207 |
| 190 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004241 | 207 |
| 191 | 3300026095 | Ga0207676_10003660 | Ga0207676_100036607 | 207 |
| 192 | 3300026116 | Ga0207674_10156519 | Ga0207674_101565192 | 207 |
| 193 | 3300026118 | Ga0207675_100000295 | Ga0207675_10000029533 | 207 |
| 194 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002812 | 207 |
| 195 | 3300028380 | Ga0268265_10000946 | Ga0268265_100009465 | 207 |
| 196 | 3300028381 | Ga0268264_10000103 | Ga0268264_10000103204 | 207 |
| 197 | 3300031548 | Ga0307408_100545711 | Ga0307408_1005457112 | 207 |
| 198 | 3300049162 | Ga0501307_023140 | Ga0501307_023140_22_678 | 207 |
| 199 | 3300049580 | Ga0501046_0169124 | Ga0501046_0169124_405_1061 | 207 |
| 200 | 3300049581 | Ga0501047_0001720 | Ga0501047_0001720_423_1079 | 207 |
| 201 | 3300049679 | Ga0501249_000043 | Ga0501249_000043_310_966 | 207 |
| 202 | 3300049850 | Ga0501204_004333 | Ga0501204_004333_467_1123 | 207 |
| 203 | 3300050491 | nmdc:mga00v17_101410_c1 | nmdc:mga00v17_101410_c1_301_945 | 207 |
| 204 | 3300053139 | Ga0500568_0123340 | Ga0500568_0123340_70_699 | 207 |
| 205 | 3300053156 | Ga0500622_0001913 | Ga0500622_0001913_13509_14138 | 207 |
| 206 | 3300005330 | Ga0070690_100052816 | Ga0070690_1000528163 | 208 |
| 207 | 3300005335 | Ga0070666_10008034 | Ga0070666_100080344 | 208 |
| 208 | 3300005338 | Ga0068868_100024869 | Ga0068868_1000248694 | 208 |
| 209 | 3300005364 | Ga0070673_100046966 | Ga0070673_1000469664 | 208 |
| 210 | 3300005367 | Ga0070667_100002832 | Ga0070667_1000028326 | 208 |
| 211 | 3300005548 | Ga0070665_100079605 | Ga0070665_1000796054 | 208 |
| 212 | 3300005617 | Ga0068859_100028521 | Ga0068859_1000285214 | 208 |
| 213 | 3300005618 | Ga0068864_100083152 | Ga0068864_1000831524 | 208 |
| 214 | 3300005841 | Ga0068863_100009914 | Ga0068863_1000099142 | 208 |
| 215 | 3300005842 | Ga0068858_100002239 | Ga0068858_1000022392 | 208 |
| 216 | 3300005843 | Ga0068860_100016506 | Ga0068860_1000165064 | 208 |
| 217 | 3300006237 | Ga0097621_100014154 | Ga0097621_1000141543 | 208 |
| 218 | 3300006358 | Ga0068871_100041847 | Ga0068871_1000418472 | 208 |
| 219 | 3300006881 | Ga0068865_100117514 | Ga0068865_1001175142 | 208 |
| 220 | 3300006931 | Ga0097620_100028521 | Ga0097620_1000285214 | 208 |
| 221 | 3300009098 | Ga0105245_10001970 | Ga0105245_1000197016 | 208 |
| 222 | 3300009176 | Ga0105242_10010167 | Ga0105242_100101672 | 208 |
| 223 | 3300009177 | Ga0105248_10014154 | Ga0105248_100141547 | 208 |
| 224 | 3300013306 | Ga0163162_10079818 | Ga0163162_100798182 | 208 |
| 225 | 3300013308 | Ga0157375_10020343 | Ga0157375_100203434 | 208 |
| 226 | 3300014968 | Ga0157379_10005229 | Ga0157379_1000522910 | 208 |
| 227 | 3300014969 | Ga0157376_10004074 | Ga0157376_100040741 | 208 |
| 228 | 3300017792 | Ga0163161_10244060 | Ga0163161_102440602 | 208 |
| 229 | 3300025903 | Ga0207680_10032272 | Ga0207680_100322724 | 208 |
| 230 | 3300025912 | Ga0207707_10092771 | Ga0207707_100927712 | 208 |
| 231 | 3300025921 | Ga0207652_10131554 | Ga0207652_101315542 | 208 |
| 232 | 3300025927 | Ga0207687_10026260 | Ga0207687_100262603 | 208 |
| 233 | 3300025931 | Ga0207644_10205454 | Ga0207644_102054542 | 208 |
| 234 | 3300025938 | Ga0207704_10081223 | Ga0207704_100812232 | 208 |
| 235 | 3300025941 | Ga0207711_10002631 | Ga0207711_1000263117 | 208 |
| 236 | 3300025960 | Ga0207651_10048862 | Ga0207651_100488622 | 208 |
| 237 | 3300026023 | Ga0207677_10065767 | Ga0207677_100657672 | 208 |
| 238 | 3300026035 | Ga0207703_10017314 | Ga0207703_100173143 | 208 |
| 239 | 3300026088 | Ga0207641_10014418 | Ga0207641_100144183 | 208 |
| 240 | 3300026088 | Ga0207641_10594574 | Ga0207641_105945742 | 208 |
| 241 | 3300026089 | Ga0207648_10202867 | Ga0207648_102028672 | 208 |
| 242 | 3300026095 | Ga0207676_10041001 | Ga0207676_100410012 | 208 |
| 243 | 3300028381 | Ga0268264_10089499 | Ga0268264_100894992 | 208 |
| 244 | 3300037068 | Ga0373925_0135830 | Ga0373925_0135830_450_1085 | 208 |
| 245 | 3300048905 | Ga0496102_0681090 | Ga0496102_0681090_230_865 | 208 |
| 246 | 3300048907 | Ga0496104_0008321 | Ga0496104_0008321_8261_8896 | 208 |
| 247 | 3300048908 | Ga0496105_0008999 | Ga0496105_0008999_4877_5512 | 208 |
| 248 | 3300048913 | Ga0496110_0002075 | Ga0496110_0002075_12683_13318 | 208 |
| 249 | 3300048914 | Ga0496111_0004248 | Ga0496111_0004248_7866_8501 | 208 |
| 250 | 3300048917 | Ga0496114_0094079 | Ga0496114_0094079_815_1450 | 208 |
| 251 | 3300049742 | Ga0501080_0080815 | Ga0501080_0080815_1388_2029 | 208 |
| 252 | 3300060353 | Ga0501082_0374578 | Ga0501082_0374578_76_717 | 208 |
| 253 | 3300061734 | Ga0530510_0059269 | Ga0530510_0059269_1938_2579 | 208 |
| 254 | 2162886007 | SwRhRL2b_contig_2664059 | SwRhRL2b_0598.00001450 | 209 |
| 255 | 3300005295 | Ga0065707_10204279 | Ga0065707_102042792 | 209 |
| 256 | 3300005466 | Ga0070685_10019365 | Ga0070685_100193652 | 209 |
| 257 | 3300005539 | Ga0068853_100011368 | Ga0068853_1000113684 | 209 |
| 258 | 3300005577 | Ga0068857_100070421 | Ga0068857_1000704213 | 209 |
| 259 | 3300005834 | Ga0068851_10013626 | Ga0068851_100136263 | 209 |
| 260 | 3300006042 | Ga0075368_10000105 | Ga0075368_1000010525 | 209 |
| 261 | 3300006178 | Ga0075367_10000128 | Ga0075367_1000012812 | 209 |
| 262 | 3300009174 | Ga0105241_10293156 | Ga0105241_102931562 | 209 |
| 263 | 3300009978 | Ga0105148_100116 | Ga0105148_1001162 | 209 |
| 264 | 3300009982 | Ga0105147_102108 | Ga0105147_1021082 | 209 |
| 265 | 3300025298 | Ga0209050_1040295 | Ga0209050_10402952 | 209 |
| 266 | 3300025923 | Ga0207681_10044921 | Ga0207681_100449212 | 209 |
| 267 | 3300025925 | Ga0207650_10071376 | Ga0207650_100713762 | 209 |
| 268 | 3300025972 | Ga0207668_10781698 | Ga0207668_107816981 | 209 |
| 269 | 3300026041 | Ga0207639_10013955 | Ga0207639_100139553 | 209 |
| 270 | 3300026116 | Ga0207674_10016614 | Ga0207674_100166144 | 209 |
| 271 | 3300027866 | Ga0209813_10000086 | Ga0209813_1000008611 | 209 |
| 272 | 3300036712 | Ga0316584_0360708 | Ga0316584_0360708_385_1023 | 209 |
| 273 | 3300046519 | Ga0495632_0000105 | Ga0495632_0000105_510_1145 | 209 |
| 274 | 3300046522 | Ga0495643_0000047 | Ga0495643_0000047_135822_136457 | 209 |
| 275 | 3300046524 | Ga0495648_0100538 | Ga0495648_0100538_613_1248 | 209 |
| 276 | 3300046525 | Ga0495663_0000009 | Ga0495663_0000009_213006_213641 | 209 |
| 277 | 3300046558 | Ga0495633_0027054 | Ga0495633_0027054_509_1144 | 209 |
| 278 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_416665_417381 | 209 |
| 279 | 3300046616 | Ga0495668_0149714 | Ga0495668_0149714_15_653 | 209 |
| 280 | 3300046692 | Ga0495671_0000038 | Ga0495671_0000038_37237_37872 | 209 |
| 281 | 3300046692 | Ga0495671_0013917 | Ga0495671_0013917_3276_3911 | 209 |
| 282 | 3300047472 | Ga0495686_0063113 | Ga0495686_0063113_503_1138 | 209 |
| 283 | 3300048905 | Ga0496102_0586123 | Ga0496102_0586123_282_917 | 209 |
| 284 | 3300048911 | Ga0496108_0024686 | Ga0496108_0024686_378_1013 | 209 |
| 285 | 3300048912 | Ga0496109_0301809 | Ga0496109_0301809_298_933 | 209 |
| 286 | 3300048914 | Ga0496111_0392086 | Ga0496111_0392086_339_974 | 209 |
| 287 | 3300048915 | Ga0496112_0769744 | Ga0496112_0769744_132_767 | 209 |
| 288 | 3300048916 | Ga0496113_0518854 | Ga0496113_0518854_71_706 | 209 |
| 289 | 3300048919 | Ga0496116_0344750 | Ga0496116_0344750_36_671 | 209 |
| 290 | 3300048927 | Ga0496124_0298372 | Ga0496124_0298372_488_1123 | 209 |
| 291 | 3300048928 | Ga0496125_0015399 | Ga0496125_0015399_537_1172 | 209 |
| 292 | 3300048929 | Ga0496126_0121534 | Ga0496126_0121534_810_1475 | 209 |
| 293 | 3300049551 | Ga0501335_000731 | Ga0501335_000731_834_1469 | 209 |
| 294 | 3300049663 | Ga0501223_000012 | Ga0501223_000012_6710_7345 | 209 |
| 295 | 3300049669 | Ga0501235_003444 | Ga0501235_003444_243_878 | 209 |
| 296 | 3300049669 | Ga0501235_014329 | Ga0501235_014329_594_1229 | 209 |
| 297 | 3300049676 | Ga0501246_001750 | Ga0501246_001750_783_1418 | 209 |
| 298 | 3300049705 | Ga0501225_0000264 | Ga0501225_0000264_9212_9847 | 209 |
| 299 | 3300049705 | Ga0501225_0003322 | Ga0501225_0003322_2803_3438 | 209 |
| 300 | 3300049705 | Ga0501225_0103574 | Ga0501225_0103574_134_769 | 209 |
| 301 | 3300049708 | Ga0501245_010046 | Ga0501245_010046_274_909 | 209 |
| 302 | 3300050494 | nmdc:mga06z11_211_c1 | nmdc:mga06z11_211_c1_22261_22896 | 209 |
| 303 | 3300050495 | nmdc:mga04h51_117_c1 | nmdc:mga04h51_117_c1_359_994 | 209 |
| 304 | 3300053118 | Ga0500594_0013935 | Ga0500594_0013935_731_1366 | 209 |
| 305 | 3300053156 | Ga0500622_0083606 | Ga0500622_0083606_413_1048 | 209 |
| 306 | 3300031247 | Ga0265340_10115545 | Ga0265340_101155452 | 210 |
| 307 | 3300039447 | Ga0436361_0795199 | Ga0436361_0795199_46120_46767 | 210 |
| 308 | 3300048928 | Ga0496125_0071804 | Ga0496125_0071804_552_1190 | 210 |
| 309 | 3300053116 | Ga0500592_010955 | Ga0500592_010955_345_1058 | 210 |
| 310 | 3300026116 | Ga0207674_10495110 | Ga0207674_104951101 | 212 |
| 311 | 3300050496 | nmdc:mga07m45_226805_c1 | nmdc:mga07m45_226805_c1_137_784 | 212 |
| 312 | 3300049822 | Ga0501035_0126826 | Ga0501035_0126826_29_682 | 214 |
| 313 | 3300037418 | Ga0395900_0680055 | Ga0395900_0680055_195_854 | 215 |
| 314 | 3300041496 | Ga0451839_1432329 | Ga0451839_1432329_175_834 | 217 |
| 315 | iso_pu_bacteria | 2510917021 | 2511127631 | 217 |
| 316 | iso_pu_bacteria | 2919138771 | 2919141373 | 217 |
| 317 | iso_pu_bacteria | 8054302542 | 8054304823 | 217 |
| 318 | 3300048908 | Ga0496105_0023629 | Ga0496105_0023629_3721_4410 | 218 |
| 319 | iso_pu_bacteria | 2818991438 | 2819550902 | 218 |
| 320 | 3300005295 | Ga0065707_10087592 | Ga0065707_100875924 | 220 |
| 321 | 3300005843 | Ga0068860_100052638 | Ga0068860_1000526383 | 220 |
| 322 | 3300028381 | Ga0268264_10039602 | Ga0268264_100396023 | 220 |
| 323 | 3300006353 | Ga0075370_10071592 | Ga0075370_100715922 | 221 |
| 324 | 3300046453 | Ga0495627_001098 | Ga0495627_001098_6511_7176 | 221 |
| 325 | 3300046471 | Ga0495650_0003325 | Ga0495650_0003325_10382_11047 | 221 |
| 326 | 3300046500 | Ga0495596_0004200 | Ga0495596_0004200_5699_6364 | 221 |
| 327 | 3300046501 | Ga0495607_0016080 | Ga0495607_0016080_37_702 | 221 |
| 328 | 3300046506 | Ga0495583_0023741 | Ga0495583_0023741_1600_2265 | 221 |
| 329 | 3300046512 | Ga0495610_0000061 | Ga0495610_0000061_80198_80863 | 221 |
| 330 | 3300046512 | Ga0495610_0000439 | Ga0495610_0000439_23034_23699 | 221 |
| 331 | 3300046522 | Ga0495643_0000292 | Ga0495643_0000292_20364_21029 | 221 |
| 332 | 3300046522 | Ga0495643_0011234 | Ga0495643_0011234_2352_3017 | 221 |
| 333 | 3300046538 | Ga0495609_0009392 | Ga0495609_0009392_2587_3252 | 221 |
| 334 | 3300046558 | Ga0495633_0069624 | Ga0495633_0069624_542_1207 | 221 |
| 335 | 3300046660 | Ga0495625_0131051 | Ga0495625_0131051_607_1272 | 221 |
| 336 | 3300046691 | Ga0495670_0137867 | Ga0495670_0137867_499_1164 | 221 |
| 337 | 3300046692 | Ga0495671_0015368 | Ga0495671_0015368_2369_3034 | 221 |
| 338 | 3300047470 | Ga0495681_0001474 | Ga0495681_0001474_10406_11071 | 221 |
| 339 | 2162886007 | SwRhRL2b_contig_3522643 | SwRhRL2b_0315.00005330 | 222 |
| 340 | 3300003791 | Ga0055530_10017827 | Ga0055530_100178271 | 222 |
| 341 | 3300005289 | Ga0065704_10000191 | Ga0065704_1000019173 | 222 |
| 342 | 3300005367 | Ga0070667_100000079 | Ga0070667_10000007967 | 222 |
| 343 | 3300005841 | Ga0068863_100057842 | Ga0068863_1000578423 | 222 |
| 344 | 3300005843 | Ga0068860_100113915 | Ga0068860_1001139152 | 222 |
| 345 | 3300013102 | Ga0157371_10016337 | Ga0157371_100163375 | 222 |
| 346 | 3300025298 | Ga0209050_1000279 | Ga0209050_100027955 | 222 |
| 347 | 3300025931 | Ga0207644_10139843 | Ga0207644_101398432 | 222 |
| 348 | 3300025986 | Ga0207658_10017257 | Ga0207658_100172574 | 222 |
| 349 | 3300026088 | Ga0207641_10074389 | Ga0207641_100743893 | 222 |
| 350 | 3300028381 | Ga0268264_10085974 | Ga0268264_100859742 | 222 |
| 351 | 3300031731 | Ga0307405_10272346 | Ga0307405_102723461 | 222 |
| 352 | 3300031911 | Ga0307412_10175744 | Ga0307412_101757442 | 222 |
| 353 | 3300044712 | Ga0453684_0305197 | Ga0453684_0305197_705_1394 | 222 |
| 354 | 3300045051 | Ga0451576_0233962 | Ga0451576_0233962_1036_1725 | 222 |
| 355 | 3300046500 | Ga0495596_0001173 | Ga0495596_0001173_728_1396 | 222 |
| 356 | 3300046507 | Ga0495606_0055232 | Ga0495606_0055232_289_957 | 222 |
| 357 | 3300046512 | Ga0495610_0000419 | Ga0495610_0000419_19051_19719 | 222 |
| 358 | 3300048090 | Ga0495615_0000267 | Ga0495615_0000267_3615_4283 | 222 |
| 359 | 3300048091 | Ga0495626_0006288 | Ga0495626_0006288_749_1417 | 222 |
| 360 | 3300048919 | Ga0496116_0000017 | Ga0496116_0000017_192193_192861 | 222 |
| 361 | 3300048920 | Ga0496117_0046495 | Ga0496117_0046495_1668_2336 | 222 |
| 362 | 3300048924 | Ga0496121_0133249 | Ga0496121_0133249_361_1029 | 222 |
| 363 | 3300048925 | Ga0496122_0016481 | Ga0496122_0016481_984_1652 | 222 |
| 364 | 3300048925 | Ga0496122_0051830 | Ga0496122_0051830_1703_2371 | 222 |
| 365 | 3300048926 | Ga0496123_0001559 | Ga0496123_0001559_5561_6229 | 222 |
| 366 | 3300048926 | Ga0496123_0002247 | Ga0496123_0002247_6142_6810 | 222 |
| 367 | 3300048927 | Ga0496124_0047414 | Ga0496124_0047414_1923_2591 | 222 |
| 368 | 3300048928 | Ga0496125_0002203 | Ga0496125_0002203_2333_3001 | 222 |
| 369 | 3300048929 | Ga0496126_0018782 | Ga0496126_0018782_388_1056 | 222 |
| 370 | 3300009101 | Ga0105247_10140211 | Ga0105247_101402112 | 223 |
| 371 | 3300025900 | Ga0207710_10072197 | Ga0207710_100721972 | 223 |
| 372 | 3300028380 | Ga0268265_10009588 | Ga0268265_100095883 | 223 |
| 373 | 3300046694 | Ga0495649_0332095 | Ga0495649_0332095_67_738 | 223 |
| 374 | iso_pu_bacteria | 2738541275 | 2738711232 | 223 |
| 375 | iso_pu_bacteria | 2738541301 | 2738849657 | 223 |
| 376 | iso_pu_bacteria | 2738541304 | 2738865386 | 223 |
| 377 | iso_pu_bacteria | 2738543022 | 2739297904 | 223 |
| 378 | iso_pu_bacteria | 2738543033 | 2739359582 | 223 |
| 379 | iso_pu_bacteria | 2928959182 | 2928961480 | 223 |
| 380 | 3300039437 | Ga0436365_1004127 | Ga0436365_1004127_189_863 | 224 |
| 381 | 3300049460 | Ga0495682_0065214 | Ga0495682_0065214_526_1200 | 224 |
| 382 | 3300002459 | JGI24751J29686_10000719 | JGI24751J29686_100007193 | 225 |
| 383 | 3300005335 | Ga0070666_10009267 | Ga0070666_100092675 | 225 |
| 384 | 3300005347 | Ga0070668_100276260 | Ga0070668_1002762602 | 225 |
| 385 | 3300005353 | Ga0070669_100000302 | Ga0070669_10000030221 | 225 |
| 386 | 3300005355 | Ga0070671_100000089 | Ga0070671_10000008916 | 225 |
| 387 | 3300005367 | Ga0070667_100010961 | Ga0070667_1000109617 | 225 |
| 388 | 3300005548 | Ga0070665_100132020 | Ga0070665_1001320202 | 225 |
| 389 | 3300005563 | Ga0068855_100002272 | Ga0068855_10000227215 | 225 |
| 390 | 3300005616 | Ga0068852_100318541 | Ga0068852_1003185412 | 225 |
| 391 | 3300005617 | Ga0068859_100153303 | Ga0068859_1001533032 | 225 |
| 392 | 3300005618 | Ga0068864_100039916 | Ga0068864_1000399162 | 225 |
| 393 | 3300005841 | Ga0068863_100000072 | Ga0068863_10000007245 | 225 |
| 394 | 3300005841 | Ga0068863_100067756 | Ga0068863_1000677562 | 225 |
| 395 | 3300005842 | Ga0068858_100035655 | Ga0068858_1000356552 | 225 |
| 396 | 3300005843 | Ga0068860_100000247 | Ga0068860_10000024753 | 225 |
| 397 | 3300005843 | Ga0068860_100010439 | Ga0068860_1000104397 | 225 |
| 398 | 3300005844 | Ga0068862_100028292 | Ga0068862_1000282925 | 225 |
| 399 | 3300006051 | Ga0075364_10083270 | Ga0075364_100832702 | 225 |
| 400 | 3300006931 | Ga0097620_100153306 | Ga0097620_1001533062 | 225 |
| 401 | 3300009177 | Ga0105248_10041442 | Ga0105248_100414422 | 225 |
| 402 | 3300014326 | Ga0157380_10069482 | Ga0157380_100694822 | 225 |
| 403 | 3300014968 | Ga0157379_10177370 | Ga0157379_101773702 | 225 |
| 404 | 3300017792 | Ga0163161_10001464 | Ga0163161_100014647 | 225 |
| 405 | 3300025315 | Ga0207697_10062846 | Ga0207697_100628462 | 225 |
| 406 | 3300025903 | Ga0207680_10066969 | Ga0207680_100669692 | 225 |
| 407 | 3300025909 | Ga0207705_10400742 | Ga0207705_104007422 | 225 |
| 408 | 3300025923 | Ga0207681_10000313 | Ga0207681_100003131 | 225 |
| 409 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005143 | 225 |
| 410 | 3300025949 | Ga0207667_10001954 | Ga0207667_1000195415 | 225 |
| 411 | 3300025986 | Ga0207658_10006902 | Ga0207658_100069027 | 225 |
| 412 | 3300025986 | Ga0207658_10096249 | Ga0207658_100962492 | 225 |
| 413 | 3300026035 | Ga0207703_10096203 | Ga0207703_100962032 | 225 |
| 414 | 3300026088 | Ga0207641_10000084 | Ga0207641_1000008446 | 225 |
| 415 | 3300026116 | Ga0207674_10321678 | Ga0207674_103216782 | 225 |
| 416 | 3300026142 | Ga0207698_10096807 | Ga0207698_100968072 | 225 |
| 417 | 3300028379 | Ga0268266_10113198 | Ga0268266_101131982 | 225 |
| 418 | 3300028380 | Ga0268265_10052298 | Ga0268265_100522983 | 225 |
| 419 | 3300028380 | Ga0268265_10334085 | Ga0268265_103340852 | 225 |
| 420 | 3300028381 | Ga0268264_10000253 | Ga0268264_1000025367 | 225 |
| 421 | 3300028381 | Ga0268264_10102485 | Ga0268264_101024852 | 225 |
| 422 | 3300031548 | Ga0307408_100252426 | Ga0307408_1002524262 | 225 |
| 423 | 3300031731 | Ga0307405_10436721 | Ga0307405_104367212 | 225 |
| 424 | 3300031824 | Ga0307413_10012334 | Ga0307413_100123343 | 225 |
| 425 | 3300031824 | Ga0307413_10189132 | Ga0307413_101891321 | 225 |
| 426 | 3300031911 | Ga0307412_10242702 | Ga0307412_102427022 | 225 |
| 427 | 3300031995 | Ga0307409_100030100 | Ga0307409_1000301001 | 225 |
| 428 | 3300032002 | Ga0307416_100049825 | Ga0307416_1000498253 | 225 |
| 429 | 3300032005 | Ga0307411_10104385 | Ga0307411_101043852 | 225 |
| 430 | 3300032126 | Ga0307415_100076393 | Ga0307415_1000763932 | 225 |
| 431 | 3300048903 | Ga0496100_0045960 | Ga0496100_0045960_1456_2133 | 225 |
| 432 | 3300048904 | Ga0496101_0062363 | Ga0496101_0062363_566_1243 | 225 |
| 433 | 3300048905 | Ga0496102_0040281 | Ga0496102_0040281_2253_2930 | 225 |
| 434 | 3300048907 | Ga0496104_0034031 | Ga0496104_0034031_3641_4318 | 225 |
| 435 | 3300048908 | Ga0496105_0036533 | Ga0496105_0036533_1345_2022 | 225 |
| 436 | 3300048909 | Ga0496106_0080568 | Ga0496106_0080568_813_1490 | 225 |
| 437 | 3300048910 | Ga0496107_0062193 | Ga0496107_0062193_891_1568 | 225 |
| 438 | 3300048911 | Ga0496108_0149032 | Ga0496108_0149032_795_1472 | 225 |
| 439 | 3300048913 | Ga0496110_0189159 | Ga0496110_0189159_699_1376 | 225 |
| 440 | 3300048916 | Ga0496113_0057000 | Ga0496113_0057000_1721_2398 | 225 |
| 441 | 3300048921 | Ga0496118_0124788 | Ga0496118_0124788_770_1447 | 225 |
| 442 | 3300048924 | Ga0496121_0003524 | Ga0496121_0003524_13071_13748 | 225 |
| 443 | 3300048928 | Ga0496125_0254048 | Ga0496125_0254048_334_1011 | 225 |
| 444 | iso_pu_bacteria | 2882806704 | 2882807091 | 225 |
| 445 | 3300005327 | Ga0070658_10450792 | Ga0070658_104507921 | 226 |
| 446 | 3300005329 | Ga0070683_100057780 | Ga0070683_1000577803 | 226 |
| 447 | 3300005337 | Ga0070682_100198129 | Ga0070682_1001981291 | 226 |
| 448 | 3300005337 | Ga0070682_100294758 | Ga0070682_1002947581 | 226 |
| 449 | 3300005339 | Ga0070660_100006436 | Ga0070660_1000064367 | 226 |
| 450 | 3300005344 | Ga0070661_100020806 | Ga0070661_1000208062 | 226 |
| 451 | 3300005345 | Ga0070692_10095011 | Ga0070692_100950112 | 226 |
| 452 | 3300005354 | Ga0070675_100467551 | Ga0070675_1004675511 | 226 |
| 453 | 3300005366 | Ga0070659_100725902 | Ga0070659_1007259021 | 226 |
| 454 | 3300005455 | Ga0070663_100232029 | Ga0070663_1002320292 | 226 |
| 455 | 3300005456 | Ga0070678_100461791 | Ga0070678_1004617912 | 226 |
| 456 | 3300005457 | Ga0070662_100030704 | Ga0070662_1000307042 | 226 |
| 457 | 3300005457 | Ga0070662_100113008 | Ga0070662_1001130082 | 226 |
| 458 | 3300005458 | Ga0070681_10057594 | Ga0070681_100575944 | 226 |
| 459 | 3300005530 | Ga0070679_100479771 | Ga0070679_1004797711 | 226 |
| 460 | 3300005530 | Ga0070679_100570115 | Ga0070679_1005701151 | 226 |
| 461 | 3300005530 | Ga0070679_100756616 | Ga0070679_1007566161 | 226 |
| 462 | 3300005539 | Ga0068853_100005144 | Ga0068853_1000051448 | 226 |
| 463 | 3300005539 | Ga0068853_100384275 | Ga0068853_1003842752 | 226 |
| 464 | 3300005539 | Ga0068853_100471584 | Ga0068853_1004715841 | 226 |
| 465 | 3300005563 | Ga0068855_100007914 | Ga0068855_1000079143 | 226 |
| 466 | 3300005563 | Ga0068855_100013433 | Ga0068855_1000134332 | 226 |
| 467 | 3300005563 | Ga0068855_100044725 | Ga0068855_1000447252 | 226 |
| 468 | 3300005564 | Ga0070664_100002256 | Ga0070664_10000225616 | 226 |
| 469 | 3300005577 | Ga0068857_100244826 | Ga0068857_1002448262 | 226 |
| 470 | 3300005578 | Ga0068854_100338230 | Ga0068854_1003382302 | 226 |
| 471 | 3300005614 | Ga0068856_100016862 | Ga0068856_1000168625 | 226 |
| 472 | 3300006195 | Ga0075366_10224807 | Ga0075366_102248071 | 226 |
| 473 | 3300006353 | Ga0075370_10005064 | Ga0075370_100050647 | 226 |
| 474 | 3300006353 | Ga0075370_10151338 | Ga0075370_101513382 | 226 |
| 475 | 3300006946 | Ga0079104_1018187 | Ga0079104_10181873 | 226 |
| 476 | 3300009174 | Ga0105241_10369037 | Ga0105241_103690372 | 226 |
| 477 | 3300011119 | Ga0105246_10000087 | Ga0105246_1000008720 | 226 |
| 478 | 3300013100 | Ga0157373_10008651 | Ga0157373_100086517 | 226 |
| 479 | 3300013100 | Ga0157373_10041584 | Ga0157373_100415842 | 226 |
| 480 | 3300013102 | Ga0157371_10009506 | Ga0157371_100095062 | 226 |
| 481 | 3300013102 | Ga0157371_10026448 | Ga0157371_100264482 | 226 |
| 482 | 3300013104 | Ga0157370_10005931 | Ga0157370_100059318 | 226 |
| 483 | 3300013104 | Ga0157370_10675602 | Ga0157370_106756021 | 226 |
| 484 | 3300013105 | Ga0157369_10001820 | Ga0157369_1000182021 | 226 |
| 485 | 3300013307 | Ga0157372_10448838 | Ga0157372_104488381 | 226 |
| 486 | 3300013308 | Ga0157375_10042154 | Ga0157375_100421542 | 226 |
| 487 | 3300013308 | Ga0157375_10587825 | Ga0157375_105878252 | 226 |
| 488 | 3300025909 | Ga0207705_10001354 | Ga0207705_100013548 | 226 |
| 489 | 3300025909 | Ga0207705_10005547 | Ga0207705_100055478 | 226 |
| 490 | 3300025909 | Ga0207705_10011717 | Ga0207705_100117172 | 226 |
| 491 | 3300025909 | Ga0207705_10397501 | Ga0207705_103975011 | 226 |
| 492 | 3300025911 | Ga0207654_10151618 | Ga0207654_101516182 | 226 |
| 493 | 3300025912 | Ga0207707_10108767 | Ga0207707_101087672 | 226 |
| 494 | 3300025912 | Ga0207707_10428571 | Ga0207707_104285711 | 226 |
| 495 | 3300025919 | Ga0207657_10001362 | Ga0207657_1000136221 | 226 |
| 496 | 3300025920 | Ga0207649_10018161 | Ga0207649_100181612 | 226 |
| 497 | 3300025921 | Ga0207652_10012713 | Ga0207652_100127134 | 226 |
| 498 | 3300025921 | Ga0207652_10106091 | Ga0207652_101060913 | 226 |
| 499 | 3300025923 | Ga0207681_10149537 | Ga0207681_101495372 | 226 |
| 500 | 3300025926 | Ga0207659_10213193 | Ga0207659_102131932 | 226 |
| 501 | 3300025932 | Ga0207690_10090933 | Ga0207690_100909332 | 226 |
| 502 | 3300025932 | Ga0207690_10160664 | Ga0207690_101606642 | 226 |
| 503 | 3300025933 | Ga0207706_10000264 | Ga0207706_1000026421 | 226 |
| 504 | 3300025933 | Ga0207706_10005923 | Ga0207706_100059232 | 226 |
| 505 | 3300025933 | Ga0207706_10015282 | Ga0207706_100152822 | 226 |
| 506 | 3300025949 | Ga0207667_10005167 | Ga0207667_100051677 | 226 |
| 507 | 3300025949 | Ga0207667_10048740 | Ga0207667_100487403 | 226 |
| 508 | 3300025981 | Ga0207640_10138693 | Ga0207640_101386931 | 226 |
| 509 | 3300026041 | Ga0207639_10000652 | Ga0207639_1000065221 | 226 |
| 510 | 3300026041 | Ga0207639_10086936 | Ga0207639_100869362 | 226 |
| 511 | 3300026067 | Ga0207678_10010061 | Ga0207678_100100612 | 226 |
| 512 | 3300026116 | Ga0207674_10036217 | Ga0207674_100362171 | 226 |
| 513 | 3300026121 | Ga0207683_10227364 | Ga0207683_102273642 | 226 |
| 514 | 3300026142 | Ga0207698_10653695 | Ga0207698_106536951 | 226 |
| 515 | 3300027111 | Ga0209281_1036510 | Ga0209281_10365101 | 226 |
| 516 | 3300032004 | Ga0307414_10056773 | Ga0307414_100567733 | 226 |
| 517 | 3300032004 | Ga0307414_10423646 | Ga0307414_104236462 | 226 |
| 518 | 3300046460 | Ga0495638_0073995 | Ga0495638_0073995_401_1081 | 226 |
| 519 | 3300046530 | Ga0495654_0178414 | Ga0495654_0178414_170_850 | 226 |
| 520 | 3300046660 | Ga0495625_0045181 | Ga0495625_0045181_1232_1912 | 226 |
| 521 | 3300046660 | Ga0495625_0209164 | Ga0495625_0209164_191_871 | 226 |
| 522 | 3300048908 | Ga0496105_0276746 | Ga0496105_0276746_304_996 | 226 |
| 523 | 3300048917 | Ga0496114_0132124 | Ga0496114_0132124_488_1180 | 226 |
| 524 | 3300049568 | Ga0501031_0158644 | Ga0501031_0158644_105_797 | 226 |
| 525 | 3300049572 | Ga0501036_0283879 | Ga0501036_0283879_631_1323 | 226 |
| 526 | 3300049581 | Ga0501047_0350443 | Ga0501047_0350443_302_994 | 226 |
| 527 | 3300049585 | Ga0501069_0181740 | Ga0501069_0181740_241_933 | 226 |
| 528 | 3300049823 | Ga0501044_0292723 | Ga0501044_0292723_847_1539 | 226 |
| 529 | 3300053087 | Ga0500643_015584 | Ga0500643_015584_1268_1948 | 226 |
| 530 | 3300053121 | Ga0500607_000007 | Ga0500607_000007_78383_79063 | 226 |
| 531 | 3300053136 | Ga0500559_0001283 | Ga0500559_0001283_181_861 | 226 |
| 532 | 3300053148 | Ga0500590_001101 | Ga0500590_001101_6487_7167 | 226 |
| 533 | 3300053156 | Ga0500622_0000167 | Ga0500622_0000167_34074_34754 | 226 |
| 534 | 3300053730 | Ga0500645_002593 | Ga0500645_002593_734_1414 | 226 |
| 535 | 2162886007 | SwRhRL2b_contig_2569509 | SwRhRL2b_0424.00000240 | 227 |
| 536 | 3300002074 | JGI24748J21848_1009287 | JGI24748J21848_10092871 | 227 |
| 537 | 3300002459 | JGI24751J29686_10035974 | JGI24751J29686_100359741 | 227 |
| 538 | 3300005289 | Ga0065704_10095287 | Ga0065704_100952872 | 227 |
| 539 | 3300005295 | Ga0065707_10222156 | Ga0065707_102221562 | 227 |
| 540 | 3300005327 | Ga0070658_10000083 | Ga0070658_100000838 | 227 |
| 541 | 3300005331 | Ga0070670_100202480 | Ga0070670_1002024802 | 227 |
| 542 | 3300005335 | Ga0070666_10314165 | Ga0070666_103141651 | 227 |
| 543 | 3300005347 | Ga0070668_100002681 | Ga0070668_10000268114 | 227 |
| 544 | 3300005353 | Ga0070669_100000068 | Ga0070669_10000006887 | 227 |
| 545 | 3300005353 | Ga0070669_100168004 | Ga0070669_1001680042 | 227 |
| 546 | 3300005355 | Ga0070671_100003720 | Ga0070671_1000037207 | 227 |
| 547 | 3300005367 | Ga0070667_100000596 | Ga0070667_1000005965 | 227 |
| 548 | 3300005563 | Ga0068855_100074599 | Ga0068855_1000745992 | 227 |
| 549 | 3300005563 | Ga0068855_100157527 | Ga0068855_1001575272 | 227 |
| 550 | 3300005578 | Ga0068854_100215145 | Ga0068854_1002151452 | 227 |
| 551 | 3300005616 | Ga0068852_100001919 | Ga0068852_10000191912 | 227 |
| 552 | 3300005616 | Ga0068852_100330095 | Ga0068852_1003300952 | 227 |
| 553 | 3300005844 | Ga0068862_100014472 | Ga0068862_1000144724 | 227 |
| 554 | 3300006042 | Ga0075368_10000037 | Ga0075368_100000377 | 227 |
| 555 | 3300006048 | Ga0075363_100008472 | Ga0075363_1000084722 | 227 |
| 556 | 3300006051 | Ga0075364_10117366 | Ga0075364_101173662 | 227 |
| 557 | 3300006058 | Ga0075432_10000520 | Ga0075432_100005205 | 227 |
| 558 | 3300006177 | Ga0075362_10006427 | Ga0075362_100064272 | 227 |
| 559 | 3300006178 | Ga0075367_10030964 | Ga0075367_100309644 | 227 |
| 560 | 3300006186 | Ga0075369_10004039 | Ga0075369_100040393 | 227 |
| 561 | 3300006195 | Ga0075366_10008535 | Ga0075366_100085351 | 227 |
| 562 | 3300006195 | Ga0075366_10253919 | Ga0075366_102539191 | 227 |
| 563 | 3300006353 | Ga0075370_10026108 | Ga0075370_100261082 | 227 |
| 564 | 3300006353 | Ga0075370_10070644 | Ga0075370_100706443 | 227 |
| 565 | 3300009092 | Ga0105250_10005410 | Ga0105250_100054102 | 227 |
| 566 | 3300009093 | Ga0105240_10011684 | Ga0105240_100116842 | 227 |
| 567 | 3300009101 | Ga0105247_10072080 | Ga0105247_100720803 | 227 |
| 568 | 3300009553 | Ga0105249_10133867 | Ga0105249_101338673 | 227 |
| 569 | 3300013306 | Ga0163162_10349642 | Ga0163162_103496422 | 227 |
| 570 | 3300025315 | Ga0207697_10031958 | Ga0207697_100319581 | 227 |
| 571 | 3300025711 | Ga0207696_1002487 | Ga0207696_10024878 | 227 |
| 572 | 3300025735 | Ga0207713_1035091 | Ga0207713_10350912 | 227 |
| 573 | 3300025900 | Ga0207710_10110281 | Ga0207710_101102812 | 227 |
| 574 | 3300025903 | Ga0207680_10237526 | Ga0207680_102375262 | 227 |
| 575 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009404 | 227 |
| 576 | 3300025913 | Ga0207695_10008077 | Ga0207695_100080776 | 227 |
| 577 | 3300025923 | Ga0207681_10000105 | Ga0207681_1000010516 | 227 |
| 578 | 3300025923 | Ga0207681_10423043 | Ga0207681_104230431 | 227 |
| 579 | 3300025924 | Ga0207694_10025058 | Ga0207694_100250585 | 227 |
| 580 | 3300025931 | Ga0207644_10005221 | Ga0207644_100052213 | 227 |
| 581 | 3300025949 | Ga0207667_10031548 | Ga0207667_100315483 | 227 |
| 582 | 3300025972 | Ga0207668_10012461 | Ga0207668_100124612 | 227 |
| 583 | 3300025981 | Ga0207640_10232176 | Ga0207640_102321761 | 227 |
| 584 | 3300025986 | Ga0207658_10002247 | Ga0207658_100022478 | 227 |
| 585 | 3300026116 | Ga0207674_10352766 | Ga0207674_103527661 | 227 |
| 586 | 3300026142 | Ga0207698_10000084 | Ga0207698_1000008427 | 227 |
| 587 | 3300026142 | Ga0207698_10296588 | Ga0207698_102965881 | 227 |
| 588 | 3300027866 | Ga0209813_10000030 | Ga0209813_1000003043 | 227 |
| 589 | 3300028379 | Ga0268266_10064439 | Ga0268266_100644394 | 227 |
| 590 | 3300028380 | Ga0268265_10019703 | Ga0268265_100197033 | 227 |
| 591 | 3300028381 | Ga0268264_10051702 | Ga0268264_100517023 | 227 |
| 592 | 3300031616 | Ga0307508_10032618 | Ga0307508_100326182 | 227 |
| 593 | 3300032168 | Ga0316593_10207597 | Ga0316593_102075971 | 227 |
| 594 | 3300036647 | Ga0316582_0002953 | Ga0316582_0002953_6788_7480 | 227 |
| 595 | 3300048903 | Ga0496100_0369263 | Ga0496100_0369263_366_1061 | 227 |
| 596 | 3300048904 | Ga0496101_0157300 | Ga0496101_0157300_815_1510 | 227 |
| 597 | 3300048905 | Ga0496102_0007356 | Ga0496102_0007356_679_1374 | 227 |
| 598 | 3300048906 | Ga0496103_0000289 | Ga0496103_0000289_25860_26555 | 227 |
| 599 | 3300048907 | Ga0496104_0002529 | Ga0496104_0002529_15035_15730 | 227 |
| 600 | 3300048908 | Ga0496105_0004036 | Ga0496105_0004036_2709_3404 | 227 |
| 601 | 3300048909 | Ga0496106_0094663 | Ga0496106_0094663_1578_2273 | 227 |
| 602 | 3300048910 | Ga0496107_0212975 | Ga0496107_0212975_250_945 | 227 |
| 603 | 3300048914 | Ga0496111_0501573 | Ga0496111_0501573_161_856 | 227 |
| 604 | 3300048915 | Ga0496112_0324684 | Ga0496112_0324684_283_978 | 227 |
| 605 | 3300048919 | Ga0496116_0154869 | Ga0496116_0154869_232_927 | 227 |
| 606 | 3300048920 | Ga0496117_0005177 | Ga0496117_0005177_7210_7905 | 227 |
| 607 | 3300048921 | Ga0496118_0010426 | Ga0496118_0010426_7210_7905 | 227 |
| 608 | 3300048922 | Ga0496119_0015252 | Ga0496119_0015252_3171_3866 | 227 |
| 609 | 3300048923 | Ga0496120_0038515 | Ga0496120_0038515_1539_2234 | 227 |
| 610 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_15561_16244 | 227 |
| 611 | 3300048924 | Ga0496121_0060403 | Ga0496121_0060403_1462_2157 | 227 |
| 612 | 3300048926 | Ga0496123_0045177 | Ga0496123_0045177_27_722 | 227 |
| 613 | 3300048927 | Ga0496124_0011768 | Ga0496124_0011768_5892_6587 | 227 |
| 614 | 3300048929 | Ga0496126_0000661 | Ga0496126_0000661_6325_7020 | 227 |
| 615 | 3300049744 | Ga0501083_0255418 | Ga0501083_0255418_176_871 | 227 |
| 616 | 3300049823 | Ga0501044_0001652 | Ga0501044_0001652_24897_25589 | 227 |
| 617 | 3300050489 | nmdc:mga03683_162_c1 | nmdc:mga03683_162_c1_2622_3323 | 227 |
| 618 | 3300050490 | nmdc:mga03n38_11272_c1 | nmdc:mga03n38_11272_c1_165_866 | 227 |
| 619 | 3300050491 | nmdc:mga00v17_74187_c1 | nmdc:mga00v17_74187_c1_281_982 | 227 |
| 620 | 3300050493 | nmdc:mga0k408_118710_c1 | nmdc:mga0k408_118710_c1_420_1121 | 227 |
| 621 | 3300050493 | nmdc:mga0k408_23049_c1 | nmdc:mga0k408_23049_c1_800_1492 | 227 |
| 622 | 3300050494 | nmdc:mga06z11_2260_c1 | nmdc:mga06z11_2260_c1_2517_3218 | 227 |
| 623 | 3300050495 | nmdc:mga04h51_802_c1 | nmdc:mga04h51_802_c1_826_1527 | 227 |
| 624 | 3300050496 | nmdc:mga07m45_32_c1 | nmdc:mga07m45_32_c1_38967_39668 | 227 |
| 625 | 3300050496 | nmdc:mga07m45_96539_c1 | nmdc:mga07m45_96539_c1_238_921 | 227 |
| 626 | 3300050516 | nmdc:mga0sz30_1711_c1 | nmdc:mga0sz30_1711_c1_2925_3626 | 227 |
| 627 | 3300053121 | Ga0500607_013728 | Ga0500607_013728_654_1355 | 227 |
| 628 | 3300053730 | Ga0500645_013341 | Ga0500645_013341_651_1352 | 227 |
| 629 | iso_pu_bacteria | 2739367664 | 2739651317 | 227 |
| 630 | iso_pu_bacteria | 2739367865 | 2740029790 | 227 |
| 631 | iso_pu_bacteria | 2895880812 | 2895884821 | 227 |
| 632 | iso_pu_bacteria | 2928100450 | 2928103976 | 227 |
| 633 | iso_pu_bacteria | 3000865235 | 3000866680 | 227 |
| 634 | 3300027876 | Ga0209974_10012619 | Ga0209974_100126192 | 228 |
| 635 | 3300031456 | Ga0307513_10001613 | Ga0307513_100016132 | 228 |
| 636 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_467727_468422 | 228 |
| 637 | 3300053153 | Ga0500616_0001386 | Ga0500616_0001386_18833_19528 | 228 |
| 638 | 2162886007 | SwRhRL2b_contig_1416263 | SwRhRL2b_0387.00007890 | 229 |
| 639 | 3300005289 | Ga0065704_10079247 | Ga0065704_100792474 | 229 |
| 640 | 3300005331 | Ga0070670_100067274 | Ga0070670_1000672744 | 229 |
| 641 | 3300005331 | Ga0070670_100083476 | Ga0070670_1000834762 | 229 |
| 642 | 3300005347 | Ga0070668_100024005 | Ga0070668_1000240055 | 229 |
| 643 | 3300005353 | Ga0070669_100000981 | Ga0070669_10000098118 | 229 |
| 644 | 3300005353 | Ga0070669_100168729 | Ga0070669_1001687292 | 229 |
| 645 | 3300005355 | Ga0070671_100001395 | Ga0070671_10000139517 | 229 |
| 646 | 3300005367 | Ga0070667_100010600 | Ga0070667_1000106008 | 229 |
| 647 | 3300005548 | Ga0070665_100000269 | Ga0070665_10000026957 | 229 |
| 648 | 3300005578 | Ga0068854_100154451 | Ga0068854_1001544512 | 229 |
| 649 | 3300005841 | Ga0068863_100121456 | Ga0068863_1001214561 | 229 |
| 650 | 3300005843 | Ga0068860_100180451 | Ga0068860_1001804512 | 229 |
| 651 | 3300005844 | Ga0068862_100040797 | Ga0068862_1000407973 | 229 |
| 652 | 3300009011 | Ga0105251_10005048 | Ga0105251_100050487 | 229 |
| 653 | 3300009177 | Ga0105248_10064851 | Ga0105248_100648512 | 229 |
| 654 | 3300009553 | Ga0105249_10430744 | Ga0105249_104307443 | 229 |
| 655 | 3300025315 | Ga0207697_10126261 | Ga0207697_101262611 | 229 |
| 656 | 3300025735 | Ga0207713_1004184 | Ga0207713_10041848 | 229 |
| 657 | 3300025903 | Ga0207680_10367909 | Ga0207680_103679092 | 229 |
| 658 | 3300025923 | Ga0207681_10003146 | Ga0207681_100031468 | 229 |
| 659 | 3300025923 | Ga0207681_10067170 | Ga0207681_100671702 | 229 |
| 660 | 3300025925 | Ga0207650_10039490 | Ga0207650_100394902 | 229 |
| 661 | 3300025925 | Ga0207650_10092278 | Ga0207650_100922782 | 229 |
| 662 | 3300025931 | Ga0207644_10000276 | Ga0207644_1000027631 | 229 |
| 663 | 3300025941 | Ga0207711_10179752 | Ga0207711_101797522 | 229 |
| 664 | 3300025972 | Ga0207668_10087069 | Ga0207668_100870692 | 229 |
| 665 | 3300025981 | Ga0207640_10131617 | Ga0207640_101316172 | 229 |
| 666 | 3300025986 | Ga0207658_10039180 | Ga0207658_100391802 | 229 |
| 667 | 3300028379 | Ga0268266_10000334 | Ga0268266_1000033442 | 229 |
| 668 | 3300028381 | Ga0268264_10009442 | Ga0268264_100094424 | 229 |
| 669 | 3300031731 | Ga0307405_10003498 | Ga0307405_100034986 | 229 |
| 670 | 3300048906 | Ga0496103_0003521 | Ga0496103_0003521_1449_2138 | 229 |
| 671 | 3300048919 | Ga0496116_0067918 | Ga0496116_0067918_739_1428 | 229 |
| 672 | 3300048920 | Ga0496117_0056392 | Ga0496117_0056392_1226_1915 | 229 |
| 673 | 3300048921 | Ga0496118_0025636 | Ga0496118_0025636_2020_2709 | 229 |
| 674 | 3300048923 | Ga0496120_0166564 | Ga0496120_0166564_96_785 | 229 |
| 675 | 3300048924 | Ga0496121_0007492 | Ga0496121_0007492_5443_6132 | 229 |
| 676 | 3300048926 | Ga0496123_0094923 | Ga0496123_0094923_433_1122 | 229 |
| 677 | 3300048928 | Ga0496125_0008773 | Ga0496125_0008773_1360_2049 | 229 |
| 678 | 3300031852 | Ga0307410_10194546 | Ga0307410_101945462 | 230 |
| 679 | 3300031911 | Ga0307412_10024702 | Ga0307412_100247022 | 230 |
| 680 | 3300032004 | Ga0307414_10037742 | Ga0307414_100377422 | 230 |
| 681 | 3300044712 | Ga0453684_0840433 | Ga0453684_0840433_178_879 | 230 |
| 682 | 3300006051 | Ga0075364_10138467 | Ga0075364_101384672 | 231 |
| 683 | 3300006177 | Ga0075362_10042089 | Ga0075362_100420892 | 231 |
| 684 | 3300006353 | Ga0075370_10051552 | Ga0075370_100515522 | 231 |
| 685 | 3300006353 | Ga0075370_10137017 | Ga0075370_101370172 | 231 |
| 686 | 3300013102 | Ga0157371_10254931 | Ga0157371_102549312 | 231 |
| 687 | 3300032004 | Ga0307414_10134263 | Ga0307414_101342632 | 231 |
| 688 | 3300045051 | Ga0451576_0000393 | Ga0451576_0000393_76078_76782 | 231 |
| 689 | 3300046475 | Ga0495639_0101109 | Ga0495639_0101109_115_822 | 231 |
| 690 | 3300050489 | nmdc:mga03683_7936_c1 | nmdc:mga03683_7936_c1_617_1333 | 231 |
| 691 | 3300050491 | nmdc:mga00v17_1860_c2 | nmdc:mga00v17_1860_c2_6518_7234 | 231 |
| 692 | 3300050496 | nmdc:mga07m45_160939_c1 | nmdc:mga07m45_160939_c1_112_819 | 231 |
| 693 | 3300053122 | Ga0500608_000153 | Ga0500608_000153_8144_8851 | 231 |
| 694 | 3300053123 | Ga0500614_012464 | Ga0500614_012464_561_1268 | 231 |
| 695 | 3300053138 | Ga0500564_032278 | Ga0500564_032278_1112_1819 | 231 |
| 696 | 3300053723 | Ga0500567_001107 | Ga0500567_001107_493_1200 | 231 |
| 697 | 3300053729 | Ga0500625_000005 | Ga0500625_000005_105937_106644 | 231 |
| 698 | 2162886007 | SwRhRL2b_contig_1224202 | SwRhRL2b_0719.00005850 | 232 |
| 699 | 3300005289 | Ga0065704_10078946 | Ga0065704_100789464 | 232 |
| 700 | 3300005347 | Ga0070668_100034733 | Ga0070668_1000347332 | 232 |
| 701 | 3300005617 | Ga0068859_100009721 | Ga0068859_1000097218 | 232 |
| 702 | 3300005842 | Ga0068858_100006270 | Ga0068858_1000062709 | 232 |
| 703 | 3300006048 | Ga0075363_100008959 | Ga0075363_1000089595 | 232 |
| 704 | 3300006051 | Ga0075364_10080877 | Ga0075364_100808773 | 232 |
| 705 | 3300006058 | Ga0075432_10136357 | Ga0075432_101363571 | 232 |
| 706 | 3300006177 | Ga0075362_10000064 | Ga0075362_1000006422 | 232 |
| 707 | 3300006177 | Ga0075362_10036123 | Ga0075362_100361232 | 232 |
| 708 | 3300006186 | Ga0075369_10000970 | Ga0075369_100009705 | 232 |
| 709 | 3300006353 | Ga0075370_10000015 | Ga0075370_1000001535 | 232 |
| 710 | 3300006931 | Ga0097620_100009721 | Ga0097620_1000097218 | 232 |
| 711 | 3300009177 | Ga0105248_10008931 | Ga0105248_1000893110 | 232 |
| 712 | 3300009177 | Ga0105248_10356343 | Ga0105248_103563432 | 232 |
| 713 | 3300025941 | Ga0207711_10157593 | Ga0207711_101575932 | 232 |
| 714 | 3300025972 | Ga0207668_10016913 | Ga0207668_100169132 | 232 |
| 715 | 3300026035 | Ga0207703_10005238 | Ga0207703_100052384 | 232 |
| 716 | 3300028380 | Ga0268265_10673199 | Ga0268265_106731991 | 232 |
| 717 | 3300048912 | Ga0496109_0146015 | Ga0496109_0146015_277_981 | 232 |
| 718 | 3300048913 | Ga0496110_0188020 | Ga0496110_0188020_883_1587 | 232 |
| 719 | 3300048917 | Ga0496114_0021180 | Ga0496114_0021180_3395_4099 | 232 |
| 720 | 3300050489 | nmdc:mga03683_113_c1 | nmdc:mga03683_113_c1_2884_3591 | 232 |
| 721 | 3300050493 | nmdc:mga0k408_9_c2 | nmdc:mga0k408_9_c2_37157_37864 | 232 |
| 722 | 3300050496 | nmdc:mga07m45_13_c1 | nmdc:mga07m45_13_c1_27239_27946 | 232 |
| 723 | 3300050516 | nmdc:mga0sz30_532_c1 | nmdc:mga0sz30_532_c1_4624_5331 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p81-assembly1.cif.gz_K | crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) | 0.9927 | 43 | 215 |
| 3hln-assembly2.cif.gz_1 | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.9876 | 44 | 219 |
| 3hln-assembly2.cif.gz_T | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.9875 | 44 | 219 |
| 3hln-assembly2.cif.gz_U | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.9873 | 44 | 219 |
| 8i7x-assembly1.cif.gz_H | crystal structure of human clpp in complex with zg36 | 0.9865 | 44 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yg8S00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9641 | 43 | 219 | 3.90.226.10 |
| 4u0hE00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.954 | 45 | 219 | 3.90.226.10 |
| 1yg8S00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9484 | 43 | 219 | 3.90.226.10 |
| 4jcqA00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9416 | 47 | 218 | 3.90.226.10 |
| 1y7oA00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9379 | 29 | 217 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A428VV44-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 1.003 | 45 | 142 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-G1C6I0-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9978 | 48 | 127 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0009507 GO:0051117 |
| AF-C6TL65-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9957 | 47 | 145 |
GO:0004176
GO:0004252 GO:0006508 GO:0009532 |
| AF-A0A843XKD0-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9954 | 45 | 119 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0009536 GO:0051117 |
| AF-F8TGT4-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9899 | 48 | 119 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0009532 GO:0051117 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar