F477137

General Info

Members Datasets Scaffolds Average Seq Length
718 360 1436 364

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10013987|Ga0065704_100139872
Length 391
Sequence MNLCQKAHIEKNSNVCSTDNMVGNMIGERFVALSFGESHGKCIGMVVDGCPAGLALTESDIQLQLDLRKPGQSIITTQRKEQDKVEIISGVFEGFSTGAPICMVIWNEDSDSRPYELIRTIPRPGHSDYPAMIKYAGFADYRGSGRFXXXLTATLVMAGAIAQKLLEKCLRIQTTAYTVEIGGFRAKKLTLEEIKKNRYTNEVRCPDLQIAEYMKSAIMDARKEGDSLGGVIECVTAGLPVGLGEPIFGSIESDLSKALFSIPAVKAIEFGSGFDGSKRRGSENNDLYTKVDDKIVTKTNNSGGILGGLSTGMPIVIRIAFKPAASIAKTQKTIDISNGSEIGLNVPGRHDPCVVPRAPPIVEAAVSMVLADHAIRAGFIPPVLKRDMINE

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
10 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
16 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
17 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
19 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
20 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
21 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
22 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
23 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
24 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
25 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
26 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
29 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
116 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
117 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
118 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
119 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
120 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
121 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
122 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
123 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
124 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
125 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
126 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
127 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
128 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
129 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
130 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
131 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
132 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
133 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
134 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
135 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
208 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
209 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
210 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
215 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
241 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
242 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
247 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
248 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
249 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
250 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
251 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
252 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
255 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
256 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
276 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
277 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
278 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
279 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
280 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
306 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
307 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
308 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
309 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
310 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
311 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
312 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
313 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
314 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
317 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
318 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
319 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
320 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
321 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
322 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
323 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
324 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
325 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
326 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
327 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
328 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
329 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
330 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
331 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
336 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
337 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
338 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
339 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
340 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
341 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.09
Rhizosphere 97.49
Stem 0
Stem Tuber 0
Unclassified 11.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10013987 3300005289 Archaea 2762
2 SwRhRL2b_contig_630783 2162886007 Archaea 1459
3 MRS1b_contig_2594727 2162886011 Archaea 2563
4 MBSR1b_contig_8111004 2162886012 Archaea 2614
5 2214745214 2209111006 Archaea 14726
6 ARcpr5oldR_c000032 3300000041 Archaea 27787
7 ARSoilYngRDRAFT_c00033 3300000042 Archaea 21812
8 ARcpr5yngRDRAFT_c000074 3300000043 Archaea 16747
9 ARSoilOldRDRAFT_c000120 3300000044 Archaea 13897
10 ARCol0oldRDRAFT_c00011 3300000045 Archaea 14187
11 ARCol0yngRDRAFT_1000065 3300000652 Archaea 19213
12 JGI24739J22299_10001981 3300001989 Archaea 7842
13 JGI24739J22299_10022240 3300001989 Archaea 2251
14 rootH1_10175946 3300003316 Unclassified 1987
15 rootH2_10078343 3300003320 Bacteria 8498
16 rootH2_10312698 3300003320 Unclassified 1736
17 JGI26129J50193_1000137 3300003349 Archaea 4546
18 JGI26145J50221_1000018 3300003371 Archaea 12006
19 JGI25407J50210_10003164 3300003373 Archaea 3917
20 JGI26144J50225_100006 3300003380 Archaea 13352
21 JGI26139J50223_100027 3300003382 Archaea 7284
22 JGI26140J50224_100057 3300003383 Archaea 6605
23 JGI26137J50245_100125 3300003396 Archaea 3625
24 JGI26130J50248_100014 3300003398 Archaea 11072
25 JGI26136J50244_100107 3300003399 Archaea 3376
26 JGI26131J50246_100077 3300003400 Archaea 4861
27 JGI26143J51219_1000091 3300003502 Archaea 3932
28 JGI26138J51218_100060 3300003504 Archaea 4800
29 JGI25405J52794_10000005 3300003911 Archaea 32830
30 Ga0065717_1000053 3300005276 Archaea 7931
31 Ga0065716_1000031 3300005277 Archaea 10515
32 Ga0065704_10001921 3300005289 Archaea 8759
33 Ga0065704_10010308 3300005289 Archaea 4814
34 Ga0065704_10014920 3300005289 Bacteria 1388
35 Ga0065712_10000184 3300005290 Archaea 26879
36 Ga0065715_10000262 3300005293 Archaea 57184
37 Ga0065715_10000273 3300005293 Archaea 29813
38 Ga0065707_10000748 3300005295 Archaea 11952
39 Ga0065707_10005808 3300005295 Archaea 5133
40 Ga0070676_10000292 3300005328 Archaea 22249
41 Ga0070676_10001576 3300005328 Archaea 11584
42 Ga0070676_10013850 3300005328 Archaea 4424
43 Ga0070676_10026101 3300005328 Unclassified 3307
44 Ga0070683_100031445 3300005329 Archaea 4826
45 Ga0070683_100045916 3300005329 Archaea 4033
46 Ga0070683_100071966 3300005329 Archaea 3227
47 Ga0070670_100012024 3300005331 Archaea 7405
48 Ga0070670_100288204 3300005331 Archaea 1434
49 Ga0070677_10005058 3300005333 Archaea 4331
50 Ga0068869_100000470 3300005334 Archaea 22288
51 Ga0068869_100003589 3300005334 Archaea 9518
52 Ga0068869_100014852 3300005334 Archaea 5206
53 Ga0070680_100006098 3300005336 Archaea 9134
54 Ga0070680_100006679 3300005336 Archaea 8780
55 Ga0070680_100009571 3300005336 Archaea 7446
56 Ga0070680_100010823 3300005336 Archaea 7042
57 Ga0070682_100005976 3300005337 Archaea 6813
58 Ga0070682_100039891 3300005337 Archaea 2887
59 Ga0068868_100003397 3300005338 Archaea 11079
60 Ga0068868_100025758 3300005338 Unclassified 4477
61 Ga0070691_10012147 3300005341 Archaea 3943
62 Ga0070687_100000331 3300005343 Archaea 16065
63 Ga0070661_100009447 3300005344 Archaea 6750
64 Ga0070661_100139696 3300005344 Unclassified 1825
65 Ga0070692_10040018 3300005345 Archaea 2395
66 Ga0070668_100018314 3300005347 Archaea 5256
67 Ga0070668_100034457 3300005347 Archaea 3857
68 Ga0070669_100005022 3300005353 Archaea 9562
69 Ga0070675_100002519 3300005354 Archaea 13712
70 Ga0070674_100134858 3300005356 Archaea 1845
71 Ga0070673_100001498 3300005364 Archaea 13710
72 Ga0070673_100093351 3300005364 Archaea 2464
73 Ga0070667_100005540 3300005367 Archaea 10534
74 Ga0070709_10001347 3300005434 Bacteria 13395
75 Ga0070714_100005888 3300005435 Archaea 9408
76 Ga0070713_100078333 3300005436 Archaea 2813
77 Ga0070713_100473252 3300005436 Archaea 1179
78 Ga0070710_10037522 3300005437 Archaea 2657
79 Ga0070711_100001320 3300005439 Archaea 13519
80 Ga0070711_100001531 3300005439 Archaea 12731
81 Ga0070711_100071371 3300005439 Archaea 2447
82 Ga0070711_100073978 3300005439 Archaea 2409
83 Ga0070705_100007661 3300005440 Archaea 5326
84 Ga0070700_100000423 3300005441 Archaea 21523
85 Ga0070700_100104386 3300005441 Archaea 1872
86 Ga0070694_100000026 3300005444 Bacteria 68351
87 Ga0070694_100000074 3300005444 Archaea 48065
88 Ga0070694_100004008 3300005444 Archaea 8821
89 Ga0070694_100013504 3300005444 Archaea 5101
90 Ga0070694_100017806 3300005444 Archaea 4494
91 Ga0070694_100033172 3300005444 Archaea 3395
92 Ga0070708_100067147 3300005445 Archaea 3220
93 Ga0070708_100086019 3300005445 Archaea 2855
94 Ga0070662_100000584 3300005457 Archaea 22183
95 Ga0070662_100021541 3300005457 Archaea 4402
96 Ga0070681_10074382 3300005458 Unclassified 3358
97 Ga0070681_10161672 3300005458 Archaea 2163
98 Ga0068867_100003908 3300005459 Archaea 10481
99 Ga0068867_100004926 3300005459 Archaea 9408
100 Ga0068867_100012326 3300005459 Archaea 6048
101 Ga0070685_10114208 3300005466 Archaea 1668
102 Ga0070706_100017146 3300005467 Archaea 6690
103 Ga0070707_100026181 3300005468 Archaea 5536
104 Ga0070707_100161665 3300005468 Archaea 2182
105 Ga0070698_100011072 3300005471 Archaea 9584
106 Ga0070698_100053005 3300005471 Archaea 4124
107 Ga0070699_100097396 3300005518 Unclassified 2577
108 Ga0070699_100216983 3300005518 Archaea 1704
109 Ga0070679_100058309 3300005530 Archaea 3847
110 Ga0070684_100016267 3300005535 Archaea 6077
111 Ga0070684_100017708 3300005535 Bacteria 5855
112 Ga0070697_100014222 3300005536 Archaea 6252
113 Ga0070697_100019408 3300005536 Archaea 5370
114 Ga0070697_100034977 3300005536 Archaea 4052
115 Ga0070672_100001770 3300005543 Archaea 13497
116 Ga0070672_100014003 3300005543 Archaea 5673
117 Ga0070672_100046792 3300005543 Archaea 3353
118 Ga0070695_100009776 3300005545 Archaea 5712
119 Ga0070695_100014105 3300005545 Archaea 4812
120 Ga0070695_100054487 3300005545 Archaea 2574
121 Ga0070696_100012562 3300005546 Archaea 5686
122 Ga0070696_100026939 3300005546 Archaea 3913
123 Ga0070696_100073758 3300005546 Archaea 2405
124 Ga0070693_100039020 3300005547 Archaea 2658
125 Ga0070693_100119060 3300005547 Unclassified 1635
126 Ga0070704_100026472 3300005549 Archaea 3832
127 Ga0070704_100091364 3300005549 Archaea 2270
128 Ga0070664_100046111 3300005564 Archaea 3681
129 Ga0070664_100332194 3300005564 Bacteria 1379
130 Ga0068854_100048647 3300005578 Archaea 3026
131 Ga0068854_100171767 3300005578 Bacteria 1687
132 Ga0068856_100035972 3300005614 Bacteria 4855
133 Ga0070702_100000260 3300005615 Archaea 17976
134 Ga0070702_100071795 3300005615 Unclassified 2047
135 Ga0070702_100127931 3300005615 Archaea 1600
136 Ga0068852_100036144 3300005616 Unclassified 4130
137 Ga0068852_100096244 3300005616 Archaea 2661
138 Ga0068859_100212896 3300005617 Archaea 2019
139 Ga0068864_100002610 3300005618 Archaea 14885
140 Ga0068864_100070161 3300005618 Archaea 3048
141 Ga0068870_10002122 3300005840 Archaea 8212
142 Ga0068870_10018306 3300005840 Archaea 3380
143 Ga0068870_10066152 3300005840 Bacteria 1957
144 Ga0068860_100015085 3300005843 Archaea 7551
145 Ga0068860_100060276 3300005843 Archaea 3607
146 Ga0068860_100143436 3300005843 Archaea 2296
147 Ga0068862_100000942 3300005844 Archaea 28052
148 Ga0068862_100087179 3300005844 Archaea 2715
149 Ga0081455_10000421 3300005937 Archaea 55455
150 Ga0081455_10001206 3300005937 Archaea 32370
151 Ga0081455_10036690 3300005937 Archaea 4360
152 Ga0081538_10000106 3300005981 Archaea 82517
153 Ga0081538_10003003 3300005981 Archaea 16064
154 Ga0081538_10005651 3300005981 Archaea 11206
155 Ga0081538_10024596 3300005981 Unclassified 4285
156 Ga0081538_10032757 3300005981 Archaea 3474
157 Ga0081538_10032773 3300005981 Archaea 3473
158 Ga0070717_10053200 3300006028 Archaea 3337
159 Ga0075432_10003085 3300006058 Archaea 5618
160 Ga0070715_10036437 3300006163 Archaea 2029
161 Ga0070716_100000074 3300006173 Archaea 38377
162 Ga0070716_100013079 3300006173 Unclassified 4221
163 Ga0070712_100000254 3300006175 Archaea 29974
164 Ga0070712_100096802 3300006175 Archaea 2173
165 Ga0070712_100338990 3300006175 Bacteria 1227
166 Ga0075427_10002154 3300006194 Archaea 2614
167 Ga0075427_10004092 3300006194 Archaea 2036
168 Ga0097621_100033803 3300006237 Unclassified 4075
169 Ga0097621_100187095 3300006237 Unclassified 1792
170 Ga0068871_100348048 3300006358 Archaea 1310
171 Ga0068871_100391377 3300006358 Unclassified 1236
172 Ga0075428_100000038 3300006844 Archaea 105049
173 Ga0075428_100012450 3300006844 Archaea 9461
174 Ga0075428_100043502 3300006844 Bacteria 4937
175 Ga0075428_100053078 3300006844 Archaea 4441
176 Ga0075428_100093998 3300006844 Archaea 3269
177 Ga0075430_100000004 3300006846 Archaea 118608
178 Ga0075430_100004325 3300006846 Archaea 11995
179 Ga0075431_100000007 3300006847 Archaea 102015
180 Ga0075431_100045988 3300006847 Archaea 4500
181 Ga0075431_100061486 3300006847 Archaea 3875
182 Ga0075431_100112914 3300006847 Archaea 2804
183 Ga0075431_100153993 3300006847 Archaea 2366
184 Ga0075433_10016900 3300006852 Archaea 6030
185 Ga0075433_10052520 3300006852 Archaea 3551
186 Ga0075434_100002613 3300006871 Archaea 15885
187 Ga0075434_100016629 3300006871 Archaea 7074
188 Ga0075434_100020061 3300006871 Archaea 6475
189 Ga0075434_100069792 3300006871 Archaea 3503
190 Ga0075434_100151619 3300006871 Archaea 2338
191 Ga0075429_100000109 3300006880 Archaea 46980
192 Ga0075429_100006919 3300006880 Bacteria 9852
193 Ga0075429_100031083 3300006880 Archaea 4641
194 Ga0075429_100040018 3300006880 Archaea 4080
195 Ga0068865_100000521 3300006881 Archaea 21501
196 Ga0068865_100012115 3300006881 Archaea 5421
197 Ga0068865_100031119 3300006881 Archaea 3556
198 Ga0075436_100000163 3300006914 Archaea 41596
199 Ga0075436_100144463 3300006914 Archaea 1672
200 Ga0097620_100212897 3300006931 Archaea 2019
201 Ga0075435_100002874 3300007076 Archaea 11547
202 Ga0075435_100010932 3300007076 Archaea 6652
203 Ga0075435_100018951 3300007076 Archaea 5245
204 Ga0075435_100032970 3300007076 Unclassified 4093
205 Ga0075435_100098220 3300007076 Archaea 2424
206 Ga0105240_10008943 3300009093 Archaea 14241
207 Ga0111539_10000046 3300009094 Archaea 121790
208 Ga0111539_10003703 3300009094 Archaea 20100
209 Ga0111539_10025844 3300009094 Archaea 7189
210 Ga0111539_10031721 3300009094 Archaea 6419
211 Ga0111539_10149171 3300009094 Archaea 2737
212 Ga0111539_10191857 3300009094 Archaea 2384
213 Ga0105245_10041246 3300009098 Archaea 4114
214 Ga0114129_10000021 3300009147 Archaea 120003
215 Ga0114129_10003844 3300009147 Archaea 21168
216 Ga0114129_10003848 3300009147 Archaea 21165
217 Ga0114129_10007562 3300009147 Archaea 15476
218 Ga0114129_10017995 3300009147 Archaea 10062
219 Ga0114129_10023278 3300009147 Archaea 8786
220 Ga0114129_10079889 3300009147 Unclassified 4547
221 Ga0114129_10197712 3300009147 Archaea 2725
222 Ga0105242_10154918 3300009176 Archaea 2001
223 Ga0105242_10246157 3300009176 Archaea 1609
224 Ga0105242_10249668 3300009176 Archaea 1598
225 Ga0105237_10057684 3300009545 Archaea 3885
226 Ga0105237_10109554 3300009545 Archaea 2753
227 Ga0105237_10109739 3300009545 Unclassified 2751
228 Ga0105249_10001956 3300009553 Archaea 17866
229 Ga0105249_10023744 3300009553 Archaea 5506
230 Ga0105249_10149767 3300009553 Archaea 2245
231 Ga0105239_10005667 3300010375 Archaea 14591
232 Ga0105239_10013638 3300010375 Archaea 9022
233 Ga0105246_10000379 3300011119 Archaea 23735
234 Ga0105246_10012816 3300011119 Archaea 5242
235 Ga0105246_10012847 3300011119 Archaea 5237
236 Ga0105246_10098534 3300011119 Archaea 2124
237 Ga0105246_10099216 3300011119 Archaea 2117
238 Ga0157317_1000048 3300012475 Archaea 2929
239 Ga0157328_1000390 3300012478 Archaea 1625
240 Ga0157346_1000033 3300012480 Archaea 5025
241 Ga0157320_1000133 3300012481 Archaea 2298
242 Ga0157337_1000099 3300012483 Unclassified 3781
243 Ga0157325_1000010 3300012485 Archaea 8218
244 Ga0157321_1000022 3300012487 Archaea 6765
245 Ga0157343_1000002 3300012488 Archaea 6097
246 Ga0157335_1000013 3300012492 Archaea 6717
247 Ga0157341_1000006 3300012494 Archaea 9520
248 Ga0157323_1000001 3300012495 Archaea 15232
249 Ga0157345_1000118 3300012498 Archaea 15364
250 Ga0157314_1000104 3300012500 Archaea 8982
251 Ga0157347_1000319 3300012502 Archaea 2942
252 Ga0157313_1000002 3300012503 Archaea 12279
253 Ga0157339_1000101 3300012505 Unclassified 3762
254 Ga0157324_1000102 3300012506 Archaea 3928
255 Ga0157316_1000027 3300012510 Archaea 5928
256 Ga0157327_1000005 3300012512 Archaea 9974
257 Ga0157326_1000074 3300012513 Archaea 9722
258 Ga0157338_1000982 3300012515 Archaea 1919
259 Ga0157371_10002226 3300013102 Archaea 18778
260 Ga0157374_10000939 3300013296 Archaea 25377
261 Ga0157374_10002905 3300013296 Archaea 14360
262 Ga0157374_10047742 3300013296 Archaea 3971
263 Ga0157378_10000583 3300013297 Archaea 34326
264 Ga0157378_10000658 3300013297 Archaea 32539
265 Ga0157378_10029611 3300013297 Archaea 4835
266 Ga0157378_10351010 3300013297 Bacteria 1441
267 Ga0157372_10025241 3300013307 Archaea 6460
268 Ga0157372_10032102 3300013307 Archaea 5755
269 Ga0157375_10000693 3300013308 Archaea 29797
270 Ga0157375_10190446 3300013308 Archaea 2206
271 Ga0157375_10225261 3300013308 Archaea 2034
272 Ga0157380_10166211 3300014326 Archaea 1923
273 Ga0182008_10004878 3300014497 Archaea 7747
274 Ga0182008_10011920 3300014497 Unclassified 4607
275 Ga0182008_10014386 3300014497 Archaea 4144
276 Ga0157377_10000782 3300014745 Archaea 13157
277 Ga0157377_10003310 3300014745 Archaea 7280
278 Ga0157377_10020589 3300014745 Archaea 3458
279 Ga0157377_10144358 3300014745 Archaea 1465
280 Ga0157377_10145562 3300014745 Bacteria 1460
281 Ga0182007_10010485 3300015262 Unclassified 3657
282 Ga0163161_10003055 3300017792 Archaea 11804
283 Ga0197907_10528078 3300020069 Archaea 1381
284 Ga0206351_10752619 3300020077 Archaea 2520
285 Ga0206352_10608338 3300020078 Archaea 1375
286 Ga0206350_10158881 3300020080 Archaea 2785
287 Ga0206354_11364067 3300020081 Archaea 3116
288 Ga0224712_10003971 3300022467 Archaea 3928
289 Ga0207697_10000193 3300025315 Archaea 32160
290 Ga0207682_10004991 3300025893 Archaea 5444
291 Ga0207692_10011124 3300025898 Archaea 3814
292 Ga0207692_10087201 3300025898 Archaea 1684
293 Ga0207688_10000154 3300025901 Archaea 29632
294 Ga0207647_10000254 3300025904 Archaea 43745
295 Ga0207647_10002653 3300025904 Archaea 13510
296 Ga0207699_10017664 3300025906 Archaea 3762
297 Ga0207699_10066448 3300025906 Archaea 2189
298 Ga0207699_10087790 3300025906 Archaea 1945
299 Ga0207645_10001900 3300025907 Archaea 16858
300 Ga0207645_10002732 3300025907 Archaea 13740
301 Ga0207645_10005739 3300025907 Archaea 8956
302 Ga0207643_10000060 3300025908 Archaea 73359
303 Ga0207643_10000151 3300025908 Archaea 47592
304 Ga0207643_10001293 3300025908 Archaea 14600
305 Ga0207707_10052627 3300025912 Archaea 3544
306 Ga0207707_10055791 3300025912 Unclassified 3437
307 Ga0207707_10068151 3300025912 Archaea 3100
308 Ga0207695_10274035 3300025913 Archaea 1582
309 Ga0207693_10000720 3300025915 Archaea 29801
310 Ga0207693_10001983 3300025915 Archaea 17957
311 Ga0207693_10021229 3300025915 Archaea 5161
312 Ga0207663_10000285 3300025916 Archaea 22181
313 Ga0207663_10001773 3300025916 Archaea 10175
314 Ga0207663_10005591 3300025916 Archaea 6347
315 Ga0207663_10015625 3300025916 Archaea 4192
316 Ga0207663_10054024 3300025916 Archaea 2513
317 Ga0207660_10020480 3300025917 Archaea 4439
318 Ga0207660_10023560 3300025917 Archaea 4159
319 Ga0207662_10000338 3300025918 Archaea 21203
320 Ga0207662_10033270 3300025918 Archaea 3004
321 Ga0207649_10108749 3300025920 Archaea 1848
322 Ga0207652_10059853 3300025921 Archaea 3284
323 Ga0207652_10081447 3300025921 Archaea 2831
324 Ga0207681_10000226 3300025923 Archaea 44465
325 Ga0207650_10005991 3300025925 Archaea 8296
326 Ga0207650_10089275 3300025925 Unclassified 2352
327 Ga0207659_10000622 3300025926 Archaea 21045
328 Ga0207687_10025621 3300025927 Archaea 3946
329 Ga0207664_10003766 3300025929 Archaea 10187
330 Ga0207664_10047070 3300025929 Archaea 3387
331 Ga0207664_10099463 3300025929 Archaea 2400
332 Ga0207706_10001548 3300025933 Archaea 22776
333 Ga0207706_10016406 3300025933 Archaea 6688
334 Ga0207704_10003834 3300025938 Archaea 6841
335 Ga0207665_10000396 3300025939 Archaea 29936
336 Ga0207665_10004781 3300025939 Archaea 9012
337 Ga0207665_10038673 3300025939 Archaea 3178
338 Ga0207691_10001251 3300025940 Archaea 25405
339 Ga0207691_10017996 3300025940 Archaea 6691
340 Ga0207691_10040018 3300025940 Archaea 4334
341 Ga0207691_10220930 3300025940 Unclassified 1643
342 Ga0207689_10000099 3300025942 Archaea 69619
343 Ga0207689_10002265 3300025942 Archaea 18039
344 Ga0207661_10067266 3300025944 Archaea 2914
345 Ga0207661_10070270 3300025944 Archaea 2858
346 Ga0207679_10010972 3300025945 Archaea 5846
347 Ga0207679_10058708 3300025945 Archaea 2852
348 Ga0207651_10064594 3300025960 Archaea 2562
349 Ga0207651_10065749 3300025960 Archaea 2545
350 Ga0207712_10010076 3300025961 Archaea 5991
351 Ga0207712_10010216 3300025961 Archaea 5953
352 Ga0207712_10092074 3300025961 Archaea 2234
353 Ga0207668_10129770 3300025972 Archaea 1923
354 Ga0207677_10000930 3300026023 Archaea 16367
355 Ga0207708_10000211 3300026075 Archaea 46235
356 Ga0207708_10001205 3300026075 Archaea 19505
357 Ga0207708_10013258 3300026075 Archaea 6154
358 Ga0207702_10030233 3300026078 Unclassified 4513
359 Ga0207648_10001089 3300026089 Archaea 30442
360 Ga0207648_10001854 3300026089 Archaea 23105
361 Ga0207648_10005788 3300026089 Archaea 12382
362 Ga0207676_10023324 3300026095 Unclassified 4564
363 Ga0207676_10023575 3300026095 Archaea 4543
364 Ga0207676_10028411 3300026095 Archaea 4177
365 Ga0207674_10001511 3300026116 Archaea 30011
366 Ga0209973_1000405 3300027252 Unclassified 3210
367 Ga0209969_1000715 3300027360 Archaea 4448
368 Ga0209969_1004286 3300027360 Archaea 1997
369 Ga0209981_1000005 3300027378 Archaea 22900
370 Ga0209996_1000100 3300027395 Archaea 11530
371 Ga0210000_1002199 3300027462 Archaea 2765
372 Ga0209995_1000053 3300027471 Archaea 17783
373 Ga0209968_1000053 3300027526 Archaea 20477
374 Ga0209999_1000038 3300027543 Archaea 14516
375 Ga0209982_1000159 3300027552 Archaea 7555
376 Ga0209970_1000146 3300027614 Archaea 10788
377 Ga0209970_1001966 3300027614 Unclassified 3541
378 Ga0210002_1000906 3300027617 Archaea 4079
379 Ga0209983_1001537 3300027665 Archaea 5129
380 Ga0209983_1005529 3300027665 Unclassified 2614
381 Ga0209966_1000240 3300027695 Archaea 20363
382 Ga0209998_10000446 3300027717 Archaea 11483
383 Ga0209998_10002294 3300027717 Archaea 4426
384 Ga0209974_10000180 3300027876 Archaea 19812
385 Ga0209974_10054692 3300027876 Archaea 1345
386 Ga0207428_10000170 3300027907 Archaea 90470
387 Ga0207428_10000232 3300027907 Archaea 76920
388 Ga0207428_10000434 3300027907 Archaea 51396
389 Ga0207428_10006209 3300027907 Archaea 11041
390 Ga0207428_10009746 3300027907 Archaea 8608
391 Ga0268265_10008044 3300028380 Archaea 7121
392 Ga0268264_10011773 3300028381 Archaea 7212
393 Ga0265326_10000160 3300028558 Archaea 35797
394 Ga0265326_10000185 3300028558 Archaea 31622
395 Ga0265334_10008960 3300028573 Bacteria 4244
396 Ga0265334_10012118 3300028573 Archaea 3623
397 Ga0265322_10000323 3300028654 Archaea 20028
398 Ga0265336_10000080 3300028666 Archaea 77754
399 Ga0265336_10000155 3300028666 Archaea 48629
400 Ga0265338_10000026 3300028800 Archaea 296089
401 Ga0265338_10000472 3300028800 Archaea 71874
402 Ga0265338_10045260 3300028800 Bacteria 4049
403 Ga0265324_10000314 3300029957 Archaea 35601
404 Ga0265324_10000380 3300029957 Archaea 32087
405 Ga0265332_10000429 3300031238 Archaea 29631
406 Ga0265332_10013799 3300031238 Archaea 3576
407 Ga0265328_10005191 3300031239 Archaea 5599
408 Ga0265320_10048846 3300031240 Archaea 2063
409 Ga0265325_10000348 3300031241 Archaea 32684
410 Ga0265329_10006120 3300031242 Archaea 4800
411 Ga0265340_10000041 3300031247 Archaea 58102
412 Ga0265340_10000487 3300031247 Archaea 21672
413 Ga0265339_10000015 3300031249 Archaea 185846
414 Ga0265339_10001355 3300031249 Archaea 18305
415 Ga0265331_10000202 3300031250 Archaea 72307
416 Ga0265331_10000203 3300031250 Archaea 71874
417 Ga0307408_100038002 3300031548 Archaea 3395
418 Ga0307408_100050520 3300031548 Archaea 2991
419 Ga0307408_100216015 3300031548 Archaea 1562
420 Ga0265314_10002566 3300031711 Archaea 18426
421 Ga0265342_10052253 3300031712 Archaea 2436
422 Ga0307405_10061116 3300031731 Archaea 2380
423 Ga0307413_10000838 3300031824 Archaea 10802
424 Ga0307410_10007831 3300031852 Archaea 5880
425 Ga0307410_10055161 3300031852 Archaea 2697
426 Ga0307410_10107593 3300031852 Unclassified 2012
427 Ga0307406_10019020 3300031901 Archaea 4025
428 Ga0307407_10003712 3300031903 Archaea 6331
429 Ga0307407_10033198 3300031903 Archaea 2814
430 Ga0307407_10124502 3300031903 Archaea 1640
431 Ga0307409_100000715 3300031995 Archaea 14814
432 Ga0307409_100133226 3300031995 Archaea 2128
433 Ga0307416_100226431 3300032002 Unclassified 1798
434 Ga0307416_100422769 3300032002 Archaea 1377
435 Ga0307414_10015545 3300032004 Archaea 4595
436 Ga0307415_100024980 3300032126 Archaea 3742
437 Ga0307415_100092900 3300032126 Unclassified 2189
438 Ga0373959_0014712 3300034820 Archaea 1427
439 Ga0373938_0018818 3300034957 Archaea 1375
440 Ga0373949_0002432 3300035090 Archaea 4793
441 Ga0373952_0001854 3300035092 Unclassified 3840
442 Ga0373932_0004181 3300035112 Archaea 3429
443 Ga0373939_0002056 3300035114 Archaea 4801
444 Ga0373960_0000965 3300035121 Archaea 6185
445 Ga0373942_0002651 3300035207 Archaea 4302
446 Ga0373961_0002156 3300035241 Archaea 5223
447 Ga0373961_0002455 3300035241 Archaea 4803
448 Ga0373961_0037151 3300035241 Archaea 1390
449 Ga0373962_0005781 3300035242 Archaea 2986
450 Ga0373931_0001047 3300035691 Archaea 11703
451 Ga0242420_000019 3300038996 Archaea 22473
452 Ga0242420_002745 3300038996 Archaea 2546
453 Ga0436362_0412333 3300039453 Archaea 5194
454 Ga0439461_0016587 3300041410 Unclassified 1423
455 Ga0439441_000076 3300042001 Archaea 7593
456 Ga0439443_001796 3300042003 Archaea 2456
457 Ga0439451_001557 3300042009 Bacteria 4532
458 Ga0439451_007255 3300042009 Archaea 2262
459 Ga0439454_000115 3300042011 Archaea 5431
460 Ga0439463_000375 3300042016 Archaea 12354
461 Ga0450923_006082 3300042125 Archaea 1982
462 Ga0450923_010347 3300042125 Archaea 1653
463 Ga0439446_0016112 3300042156 Unclassified 2079
464 Ga0439464_0007763 3300042439 Archaea 2807
465 Ga0439460_0018140 3300042461 Archaea 1892
466 Ga0439460_0059963 3300042461 Archaea 1159
467 Ga0450893_0001441 3300042532 Unclassified 3643
468 Ga0451577_0102174 3300042876 Bacteria 2561
469 Ga0451577_0308855 3300042876 Archaea 1433
470 Ga0453683_0079672 3300044673 Archaea 2051
471 Ga0451576_0002545 3300045051 Archaea 26953
472 Ga0495584_0027998 3300046491 Archaea 2855
473 Ga0495607_0059690 3300046501 Archaea 2175
474 Ga0495635_0017573 3300046663 Archaea 4995
475 Ga0495659_0006500 3300046664 Archaea 3692
476 Ga0495670_0012212 3300046691 Archaea 4223
477 Ga0496100_0018435 3300048903 Unclassified 4139
478 Ga0496100_0112590 3300048903 Archaea 1893
479 Ga0496102_0004087 3300048905 Archaea 12366
480 Ga0496102_0029503 3300048905 Archaea 4908
481 Ga0496103_0036253 3300048906 Archaea 3020
482 Ga0496104_0059348 3300048907 Archaea 3622
483 Ga0496106_0002207 3300048909 Archaea 14525
484 Ga0496106_0002798 3300048909 Archaea 12933
485 Ga0496106_0011151 3300048909 Archaea 6649
486 Ga0496107_0023222 3300048910 Archaea 4384
487 Ga0496107_0053783 3300048910 Archaea 2904
488 Ga0496109_0097517 3300048912 Bacteria 2725
489 Ga0496110_0018448 3300048913 Archaea 5851
490 Ga0496110_0403459 3300048913 Archaea 1246
491 Ga0496112_0161490 3300048915 Archaea 2207
492 Ga0501306_000908 3300049127 Archaea 2550
493 Ga0501291_001124 3300049514 Archaea 3078
494 Ga0501291_001915 3300049514 Archaea 2444
495 Ga0501295_000368 3300049518 Unclassified 4234
496 Ga0501297_001717 3300049520 Archaea 2046
497 Ga0501298_003085 3300049521 Archaea 2568
498 Ga0501300_007060 3300049523 Archaea 1646
499 Ga0501311_002280 3300049527 Archaea 1815
500 Ga0501323_001625 3300049539 Archaea 2044
501 Ga0501031_0035723 3300049568 Archaea 3242
502 Ga0501031_0087691 3300049568 Unclassified 2029
503 Ga0501032_0077458 3300049569 Archaea 2213
504 Ga0501033_0027779 3300049570 Unclassified 4253
505 Ga0501033_0033380 3300049570 Unclassified 3864
506 Ga0501033_0227839 3300049570 Archaea 1325
507 Ga0501034_0096411 3300049571 Archaea 2954
508 Ga0501036_0002393 3300049572 Archaea 14670
509 Ga0501036_0003189 3300049572 Archaea 13094
510 Ga0501036_0052970 3300049572 Archaea 3436
511 Ga0501036_0148619 3300049572 Archaea 1976
512 Ga0501036_0335693 3300049572 Unclassified 1262
513 Ga0501037_0080656 3300049573 Archaea 2360
514 Ga0501037_0115745 3300049573 Unclassified 1930
515 Ga0501038_0011197 3300049574 Archaea 8190
516 Ga0501038_0012202 3300049574 Archaea 7845
517 Ga0501038_0028658 3300049574 Archaea 4946
518 Ga0501038_0119786 3300049574 Unclassified 2172
519 Ga0501038_0309901 3300049574 Unclassified 1237
520 Ga0501039_0000962 3300049575 Archaea 20983
521 Ga0501039_0001282 3300049575 Archaea 18376
522 Ga0501039_0049589 3300049575 Unclassified 3246
523 Ga0501039_0056609 3300049575 Archaea 3038
524 Ga0501039_0062168 3300049575 Archaea 2893
525 Ga0501039_0085403 3300049575 Unclassified 2458
526 Ga0501040_0002111 3300049576 Archaea 12808
527 Ga0501040_0007247 3300049576 Bacteria 7186
528 Ga0501040_0031154 3300049576 Archaea 3602
529 Ga0501040_0034584 3300049576 Archaea 3423
530 Ga0501040_0067628 3300049576 Unclassified 2462
531 Ga0501040_0078804 3300049576 Archaea 2280
532 Ga0501041_0002516 3300049577 Archaea 10442
533 Ga0501041_0008111 3300049577 Archaea 6184
534 Ga0501041_0019055 3300049577 Archaea 4091
535 Ga0501042_0000534 3300049578 Bacteria 19894
536 Ga0501042_0000639 3300049578 Archaea 18729
537 Ga0501042_0008185 3300049578 Archaea 6888
538 Ga0501042_0008281 3300049578 Archaea 6853
539 Ga0501042_0010157 3300049578 Archaea 6299
540 Ga0501042_0025187 3300049578 Archaea 4178
541 Ga0501042_0114055 3300049578 Archaea 1946
542 Ga0501042_0247160 3300049578 Archaea 1287
543 Ga0501043_0046253 3300049579 Archaea 3422
544 Ga0501043_0061859 3300049579 Archaea 2939
545 Ga0501043_0124737 3300049579 Archaea 2019
546 Ga0501046_0001612 3300049580 Bacteria 21588
547 Ga0501046_0034086 3300049580 Archaea 4111
548 Ga0501046_0041920 3300049580 Archaea 3650
549 Ga0501046_0048840 3300049580 Unclassified 3349
550 Ga0501048_0011481 3300049582 Archaea 6607
551 Ga0501048_0018943 3300049582 Bacteria 5058
552 Ga0501048_0041663 3300049582 Unclassified 3288
553 Ga0501048_0058391 3300049582 Archaea 2735
554 Ga0501048_0060249 3300049582 Archaea 2690
555 Ga0501048_0194226 3300049582 Unclassified 1439
556 Ga0501068_0002315 3300049584 Archaea 10154
557 Ga0501068_0023679 3300049584 Unclassified 3601
558 Ga0501069_0057182 3300049585 Archaea 2174
559 Ga0501069_0096057 3300049585 Archaea 1679
560 Ga0501070_0297255 3300049586 Archaea 1316
561 Ga0501071_0000039 3300049587 Archaea 44026
562 Ga0501071_0000134 3300049587 Archaea 30027
563 Ga0501071_0003115 3300049587 Archaea 10293
564 Ga0501071_0007720 3300049587 Archaea 7091
565 Ga0501071_0028939 3300049587 Archaea 3907
566 Ga0501072_0000093 3300049588 Archaea 65665
567 Ga0501072_0000103 3300049588 Archaea 62498
568 Ga0501072_0001137 3300049588 Archaea 19751
569 Ga0501072_0007823 3300049588 Archaea 8118
570 Ga0501072_0354421 3300049588 Bacteria 1165
571 Ga0501074_0002649 3300049590 Archaea 12542
572 Ga0501074_0032373 3300049590 Unclassified 3788
573 Ga0501075_0002122 3300049591 Archaea 13121
574 Ga0501075_0005974 3300049591 Archaea 8337
575 Ga0501075_0009947 3300049591 Archaea 6668
576 Ga0501075_0015329 3300049591 Archaea 5498
577 Ga0501075_0029356 3300049591 Unclassified 4067
578 Ga0501075_0058088 3300049591 Unclassified 2913
579 Ga0501075_0068675 3300049591 Archaea 2678
580 Ga0501075_0117970 3300049591 Unclassified 2018
581 Ga0501075_0121032 3300049591 Unclassified 1992
582 Ga0501076_0000705 3300049592 Archaea 21544
583 Ga0501076_0008620 3300049592 Archaea 7479
584 Ga0501076_0021038 3300049592 Archaea 4999
585 Ga0501076_0037654 3300049592 Unclassified 3794
586 Ga0501076_0086973 3300049592 Unclassified 2512
587 Ga0501077_0000966 3300049593 Archaea 17322
588 Ga0501077_0047427 3300049593 Archaea 2730
589 Ga0501077_0048694 3300049593 Archaea 2693
590 Ga0501077_0056059 3300049593 Archaea 2502
591 Ga0501198_002114 3300049649 Archaea 2647
592 Ga0501199_000056 3300049650 Archaea 7399
593 Ga0501202_012604 3300049652 Archaea 1598
594 Ga0501206_000511 3300049653 Unclassified 4682
595 Ga0501207_009041 3300049654 Archaea 1449
596 Ga0501208_003122 3300049655 Unclassified 1819
597 Ga0501209_000201 3300049656 Archaea 6972
598 Ga0501209_009093 3300049656 Archaea 1990
599 Ga0501214_001193 3300049659 Archaea 1986
600 Ga0501216_002132 3300049660 Archaea 2776
601 Ga0501217_011891 3300049661 Archaea 1931
602 Ga0501223_002574 3300049663 Unclassified 4003
603 Ga0501230_014899 3300049667 Archaea 1283
604 Ga0501233_003423 3300049668 Archaea 2852
605 Ga0501235_000075 3300049669 Archaea 15577
606 Ga0501243_003795 3300049675 Archaea 2255
607 Ga0501246_002437 3300049676 Archaea 1465
608 Ga0501249_005414 3300049679 Archaea 2610
609 Ga0501251_000102 3300049681 Archaea 6707
610 Ga0501253_014909 3300049683 Archaea 1267
611 Ga0501256_001163 3300049685 Archaea 1882
612 Ga0501257_008418 3300049686 Archaea 2317
613 Ga0501261_002827 3300049690 Archaea 2133
614 Ga0501221_001765 3300049704 Unclassified 3606
615 Ga0501225_0003005 3300049705 Archaea 5150
616 Ga0501229_001460 3300049706 Unclassified 2768
617 Ga0501234_000438 3300049707 Archaea 6250
618 Ga0501245_002823 3300049708 Archaea 2334
619 Ga0501079_0002169 3300049741 Archaea 14149
620 Ga0501079_0021681 3300049741 Archaea 4916
621 Ga0501079_0022355 3300049741 Archaea 4848
622 Ga0501079_0030369 3300049741 Archaea 4152
623 Ga0501079_0110557 3300049741 Archaea 2135
624 Ga0501079_0157653 3300049741 Unclassified 1769
625 Ga0501080_0139857 3300049742 Unclassified 2238
626 Ga0501080_0196757 3300049742 Archaea 1851
627 Ga0501081_0001494 3300049743 Archaea 14330
628 Ga0501081_0013271 3300049743 Archaea 5419
629 Ga0501081_0088975 3300049743 Archaea 2169
630 Ga0501232_000092 3300049757 Unclassified 4617
631 Ga0501265_001263 3300049762 Archaea 2847
632 Ga0501269_002741 3300049766 Archaea 2149
633 Ga0501271_001724 3300049768 Unclassified 1897
634 Ga0501275_000792 3300049772 Unclassified 3429
635 Ga0501276_000419 3300049773 Archaea 2580
636 Ga0501278_000518 3300049774 Unclassified 2985
637 Ga0501035_0063322 3300049822 Archaea 3289
638 Ga0501035_0081376 3300049822 Archaea 2858
639 Ga0501035_0133982 3300049822 Unclassified 2158
640 Ga0501035_0231408 3300049822 Archaea 1575
641 Ga0501035_0302549 3300049822 Unclassified 1347
642 Ga0501044_0037203 3300049823 Archaea 5088
643 Ga0501044_0124135 3300049823 Archaea 2580
644 Ga0501044_0166719 3300049823 Archaea 2177
645 Ga0501044_0192269 3300049823 Bacteria 2003
646 Ga0501045_0002701 3300049824 Archaea 12111
647 Ga0501045_0006154 3300049824 Archaea 8314
648 Ga0501045_0018805 3300049824 Unclassified 4917
649 Ga0501045_0037392 3300049824 Archaea 3528
650 Ga0501045_0039700 3300049824 Unclassified 3425
651 Ga0501212_000515 3300049851 Unclassified 3802
652 nmdc:mga05p37_15024_c1 3300050507 Archaea 9294
653 nmdc:mga05p37_15447_c1 3300050507 Archaea 9173
654 nmdc:mga05p37_16004_c1 3300050507 Archaea 9025
655 nmdc:mga05p37_181684_c1 3300050507 Archaea 2559
656 nmdc:mga05p37_188398_c1 3300050507 Bacteria 2507
657 nmdc:mga05p37_39908_c1 3300050507 Archaea 5764
658 nmdc:mga05p37_4908_c1 3300050507 Archaea 15661
659 nmdc:mga05p37_56388_c1 3300050507 Archaea 4838
660 nmdc:mga05p37_67001_c1 3300050507 Archaea 4417
661 nmdc:mga05p37_86878_c1 3300050507 Archaea 3855
662 nmdc:mga09592_11807_c1 3300050508 Archaea 7105
663 nmdc:mga09592_29_c1 3300050508 Archaea 81207
664 nmdc:mga09592_3968_c1 3300050508 Archaea 11918
665 nmdc:mga09592_92685_c1 3300050508 Archaea 2583
666 nmdc:mga09592_98275_c1 3300050508 Archaea 2506
667 nmdc:mga0qj67_1174_c1 3300050509 Archaea 18146
668 nmdc:mga0qj67_24486_c1 3300050509 Archaea 4653
669 nmdc:mga0qj67_424_c1 3300050509 Archaea 28894
670 nmdc:mga0qj67_76588_c1 3300050509 Unclassified 2676
671 nmdc:mga06r32_140647_c1 3300050510 Archaea 2390
672 nmdc:mga06r32_167682_c1 3300050510 Archaea 2179
673 nmdc:mga06r32_29408_c1 3300050510 Archaea 5149
674 nmdc:mga06r32_330_c1 3300050510 Archaea 39315
675 nmdc:mga08y16_247_c1 3300050511 Archaea 48634
676 nmdc:mga08y16_45628_c1 3300050511 Archaea 4592
677 nmdc:mga08y16_5932_c1 3300050511 Archaea 12806
678 nmdc:mga0n895_26914_c1 3300050512 Archaea 5456
679 nmdc:mga0n895_53713_c1 3300050512 Archaea 3960
680 nmdc:mga0n895_65185_c1 3300050512 Archaea 3605
681 nmdc:mga0n895_85_c1 3300050512 Archaea 54204
682 nmdc:mga0rr50_1103_c1 3300050513 Archaea 14657
683 nmdc:mga0rr50_19376_c1 3300050513 Archaea 4591
684 nmdc:mga0rr50_2280_c1 3300050513 Archaea 10756
685 nmdc:mga0rr50_28404_c1 3300050513 Archaea 3932
686 nmdc:mga0rr50_47376_c1 3300050513 Archaea 3170
687 nmdc:mga08x19_35779_c1 3300050514 Archaea 3143
688 nmdc:mga08x19_4805_c1 3300050514 Archaea 8008
689 nmdc:mga08x19_49820_c1 3300050514 Archaea 2687
690 nmdc:mga0a205_12688_c1 3300050515 Archaea 7806
691 nmdc:mga0a205_204193_c1 3300050515 Archaea 1866
692 nmdc:mga0a205_2391_c1 3300050515 Archaea 16548
693 nmdc:mga0a205_355809_c1 3300050515 Archaea 1331
694 nmdc:mga0a205_374455_c1 3300050515 Archaea 1290
695 nmdc:mga0a205_95245_c1 3300050515 Archaea 2876
696 Ga0501084_0000450 3300054114 Bacteria 31706
697 Ga0501084_0001797 3300054114 Archaea 17096
698 Ga0501084_0022778 3300054114 Archaea 5228
699 Ga0501084_0031979 3300054114 Unclassified 4401
700 Ga0501084_0037612 3300054114 Archaea 4045
701 Ga0501084_0105800 3300054114 Archaea 2363
702 Ga0501084_0176171 3300054114 Unclassified 1805
703 Ga0590071_002909 3300059421 Unclassified 4262
704 Ga0590075_003771 3300059424 Bacteria 3595
705 Ga0590075_004968 3300059424 Unclassified 3144
706 Ga0590077_001132 3300059426 Archaea 6527
707 Ga0501082_0000364 3300060353 Archaea 40052
708 Ga0501082_0000911 3300060353 Archaea 26045
709 Ga0501082_0009614 3300060353 Archaea 8324
710 Ga0501082_0026594 3300060353 Archaea 4988
711 Ga0501082_0119225 3300060353 Archaea 2286
712 Ga0501082_0204173 3300060353 Bacteria 1719
713 Ga0530510_0000043 3300061734 Archaea 57552
714 Ga0530510_0000704 3300061734 Archaea 21696
715 Ga0530510_0002917 3300061734 Archaea 11727
716 Ga0530510_0003904 3300061734 Archaea 10280
717 Ga0530510_0030774 3300061734 Archaea 3857
718 Ga0530510_0080046 3300061734 Unclassified 2377
719 Ga0065704_10013987
720 SwRhRL2b_contig_630783
721 MRS1b_contig_2594727
722 MBSR1b_contig_8111004
723 2214745214
724 ARcpr5oldR_c000032
725 ARSoilYngRDRAFT_c00033
726 ARcpr5yngRDRAFT_c000074
727 ARSoilOldRDRAFT_c000120
728 ARCol0oldRDRAFT_c00011
729 ARCol0yngRDRAFT_1000065
730 JGI24739J22299_10001981
731 JGI24739J22299_10022240
732 rootH1_10175946
733 rootH2_10078343
734 rootH2_10312698
735 JGI26129J50193_1000137
736 JGI26145J50221_1000018
737 JGI25407J50210_10003164
738 JGI26144J50225_100006
739 JGI26139J50223_100027
740 JGI26140J50224_100057
741 JGI26137J50245_100125
742 JGI26130J50248_100014
743 JGI26136J50244_100107
744 JGI26131J50246_100077
745 JGI26143J51219_1000091
746 JGI26138J51218_100060
747 JGI25405J52794_10000005
748 Ga0065717_1000053
749 Ga0065716_1000031
750 Ga0065704_10001921
751 Ga0065704_10010308
752 Ga0065704_10014920
753 Ga0065712_10000184
754 Ga0065715_10000262
755 Ga0065715_10000273
756 Ga0065707_10000748
757 Ga0065707_10005808
758 Ga0070676_10000292
759 Ga0070676_10001576
760 Ga0070676_10013850
761 Ga0070676_10026101
762 Ga0070683_100031445
763 Ga0070683_100045916
764 Ga0070683_100071966
765 Ga0070670_100012024
766 Ga0070670_100288204
767 Ga0070677_10005058
768 Ga0068869_100000470
769 Ga0068869_100003589
770 Ga0068869_100014852
771 Ga0070680_100006098
772 Ga0070680_100006679
773 Ga0070680_100009571
774 Ga0070680_100010823
775 Ga0070682_100005976
776 Ga0070682_100039891
777 Ga0068868_100003397
778 Ga0068868_100025758
779 Ga0070691_10012147
780 Ga0070687_100000331
781 Ga0070661_100009447
782 Ga0070661_100139696
783 Ga0070692_10040018
784 Ga0070668_100018314
785 Ga0070668_100034457
786 Ga0070669_100005022
787 Ga0070675_100002519
788 Ga0070674_100134858
789 Ga0070673_100001498
790 Ga0070673_100093351
791 Ga0070667_100005540
792 Ga0070709_10001347
793 Ga0070714_100005888
794 Ga0070713_100078333
795 Ga0070713_100473252
796 Ga0070710_10037522
797 Ga0070711_100001320
798 Ga0070711_100001531
799 Ga0070711_100071371
800 Ga0070711_100073978
801 Ga0070705_100007661
802 Ga0070700_100000423
803 Ga0070700_100104386
804 Ga0070694_100000026
805 Ga0070694_100000074
806 Ga0070694_100004008
807 Ga0070694_100013504
808 Ga0070694_100017806
809 Ga0070694_100033172
810 Ga0070708_100067147
811 Ga0070708_100086019
812 Ga0070662_100000584
813 Ga0070662_100021541
814 Ga0070681_10074382
815 Ga0070681_10161672
816 Ga0068867_100003908
817 Ga0068867_100004926
818 Ga0068867_100012326
819 Ga0070685_10114208
820 Ga0070706_100017146
821 Ga0070707_100026181
822 Ga0070707_100161665
823 Ga0070698_100011072
824 Ga0070698_100053005
825 Ga0070699_100097396
826 Ga0070699_100216983
827 Ga0070679_100058309
828 Ga0070684_100016267
829 Ga0070684_100017708
830 Ga0070697_100014222
831 Ga0070697_100019408
832 Ga0070697_100034977
833 Ga0070672_100001770
834 Ga0070672_100014003
835 Ga0070672_100046792
836 Ga0070695_100009776
837 Ga0070695_100014105
838 Ga0070695_100054487
839 Ga0070696_100012562
840 Ga0070696_100026939
841 Ga0070696_100073758
842 Ga0070693_100039020
843 Ga0070693_100119060
844 Ga0070704_100026472
845 Ga0070704_100091364
846 Ga0070664_100046111
847 Ga0070664_100332194
848 Ga0068854_100048647
849 Ga0068854_100171767
850 Ga0068856_100035972
851 Ga0070702_100000260
852 Ga0070702_100071795
853 Ga0070702_100127931
854 Ga0068852_100036144
855 Ga0068852_100096244
856 Ga0068859_100212896
857 Ga0068864_100002610
858 Ga0068864_100070161
859 Ga0068870_10002122
860 Ga0068870_10018306
861 Ga0068870_10066152
862 Ga0068860_100015085
863 Ga0068860_100060276
864 Ga0068860_100143436
865 Ga0068862_100000942
866 Ga0068862_100087179
867 Ga0081455_10000421
868 Ga0081455_10001206
869 Ga0081455_10036690
870 Ga0081538_10000106
871 Ga0081538_10003003
872 Ga0081538_10005651
873 Ga0081538_10024596
874 Ga0081538_10032757
875 Ga0081538_10032773
876 Ga0070717_10053200
877 Ga0075432_10003085
878 Ga0070715_10036437
879 Ga0070716_100000074
880 Ga0070716_100013079
881 Ga0070712_100000254
882 Ga0070712_100096802
883 Ga0070712_100338990
884 Ga0075427_10002154
885 Ga0075427_10004092
886 Ga0097621_100033803
887 Ga0097621_100187095
888 Ga0068871_100348048
889 Ga0068871_100391377
890 Ga0075428_100000038
891 Ga0075428_100012450
892 Ga0075428_100043502
893 Ga0075428_100053078
894 Ga0075428_100093998
895 Ga0075430_100000004
896 Ga0075430_100004325
897 Ga0075431_100000007
898 Ga0075431_100045988
899 Ga0075431_100061486
900 Ga0075431_100112914
901 Ga0075431_100153993
902 Ga0075433_10016900
903 Ga0075433_10052520
904 Ga0075434_100002613
905 Ga0075434_100016629
906 Ga0075434_100020061
907 Ga0075434_100069792
908 Ga0075434_100151619
909 Ga0075429_100000109
910 Ga0075429_100006919
911 Ga0075429_100031083
912 Ga0075429_100040018
913 Ga0068865_100000521
914 Ga0068865_100012115
915 Ga0068865_100031119
916 Ga0075436_100000163
917 Ga0075436_100144463
918 Ga0097620_100212897
919 Ga0075435_100002874
920 Ga0075435_100010932
921 Ga0075435_100018951
922 Ga0075435_100032970
923 Ga0075435_100098220
924 Ga0105240_10008943
925 Ga0111539_10000046
926 Ga0111539_10003703
927 Ga0111539_10025844
928 Ga0111539_10031721
929 Ga0111539_10149171
930 Ga0111539_10191857
931 Ga0105245_10041246
932 Ga0114129_10000021
933 Ga0114129_10003844
934 Ga0114129_10003848
935 Ga0114129_10007562
936 Ga0114129_10017995
937 Ga0114129_10023278
938 Ga0114129_10079889
939 Ga0114129_10197712
940 Ga0105242_10154918
941 Ga0105242_10246157
942 Ga0105242_10249668
943 Ga0105237_10057684
944 Ga0105237_10109554
945 Ga0105237_10109739
946 Ga0105249_10001956
947 Ga0105249_10023744
948 Ga0105249_10149767
949 Ga0105239_10005667
950 Ga0105239_10013638
951 Ga0105246_10000379
952 Ga0105246_10012816
953 Ga0105246_10012847
954 Ga0105246_10098534
955 Ga0105246_10099216
956 Ga0157317_1000048
957 Ga0157328_1000390
958 Ga0157346_1000033
959 Ga0157320_1000133
960 Ga0157337_1000099
961 Ga0157325_1000010
962 Ga0157321_1000022
963 Ga0157343_1000002
964 Ga0157335_1000013
965 Ga0157341_1000006
966 Ga0157323_1000001
967 Ga0157345_1000118
968 Ga0157314_1000104
969 Ga0157347_1000319
970 Ga0157313_1000002
971 Ga0157339_1000101
972 Ga0157324_1000102
973 Ga0157316_1000027
974 Ga0157327_1000005
975 Ga0157326_1000074
976 Ga0157338_1000982
977 Ga0157371_10002226
978 Ga0157374_10000939
979 Ga0157374_10002905
980 Ga0157374_10047742
981 Ga0157378_10000583
982 Ga0157378_10000658
983 Ga0157378_10029611
984 Ga0157378_10351010
985 Ga0157372_10025241
986 Ga0157372_10032102
987 Ga0157375_10000693
988 Ga0157375_10190446
989 Ga0157375_10225261
990 Ga0157380_10166211
991 Ga0182008_10004878
992 Ga0182008_10011920
993 Ga0182008_10014386
994 Ga0157377_10000782
995 Ga0157377_10003310
996 Ga0157377_10020589
997 Ga0157377_10144358
998 Ga0157377_10145562
999 Ga0182007_10010485
1000 Ga0163161_10003055
1001 Ga0197907_10528078
1002 Ga0206351_10752619
1003 Ga0206352_10608338
1004 Ga0206350_10158881
1005 Ga0206354_11364067
1006 Ga0224712_10003971
1007 Ga0207697_10000193
1008 Ga0207682_10004991
1009 Ga0207692_10011124
1010 Ga0207692_10087201
1011 Ga0207688_10000154
1012 Ga0207647_10000254
1013 Ga0207647_10002653
1014 Ga0207699_10017664
1015 Ga0207699_10066448
1016 Ga0207699_10087790
1017 Ga0207645_10001900
1018 Ga0207645_10002732
1019 Ga0207645_10005739
1020 Ga0207643_10000060
1021 Ga0207643_10000151
1022 Ga0207643_10001293
1023 Ga0207707_10052627
1024 Ga0207707_10055791
1025 Ga0207707_10068151
1026 Ga0207695_10274035
1027 Ga0207693_10000720
1028 Ga0207693_10001983
1029 Ga0207693_10021229
1030 Ga0207663_10000285
1031 Ga0207663_10001773
1032 Ga0207663_10005591
1033 Ga0207663_10015625
1034 Ga0207663_10054024
1035 Ga0207660_10020480
1036 Ga0207660_10023560
1037 Ga0207662_10000338
1038 Ga0207662_10033270
1039 Ga0207649_10108749
1040 Ga0207652_10059853
1041 Ga0207652_10081447
1042 Ga0207681_10000226
1043 Ga0207650_10005991
1044 Ga0207650_10089275
1045 Ga0207659_10000622
1046 Ga0207687_10025621
1047 Ga0207664_10003766
1048 Ga0207664_10047070
1049 Ga0207664_10099463
1050 Ga0207706_10001548
1051 Ga0207706_10016406
1052 Ga0207704_10003834
1053 Ga0207665_10000396
1054 Ga0207665_10004781
1055 Ga0207665_10038673
1056 Ga0207691_10001251
1057 Ga0207691_10017996
1058 Ga0207691_10040018
1059 Ga0207691_10220930
1060 Ga0207689_10000099
1061 Ga0207689_10002265
1062 Ga0207661_10067266
1063 Ga0207661_10070270
1064 Ga0207679_10010972
1065 Ga0207679_10058708
1066 Ga0207651_10064594
1067 Ga0207651_10065749
1068 Ga0207712_10010076
1069 Ga0207712_10010216
1070 Ga0207712_10092074
1071 Ga0207668_10129770
1072 Ga0207677_10000930
1073 Ga0207708_10000211
1074 Ga0207708_10001205
1075 Ga0207708_10013258
1076 Ga0207702_10030233
1077 Ga0207648_10001089
1078 Ga0207648_10001854
1079 Ga0207648_10005788
1080 Ga0207676_10023324
1081 Ga0207676_10023575
1082 Ga0207676_10028411
1083 Ga0207674_10001511
1084 Ga0209973_1000405
1085 Ga0209969_1000715
1086 Ga0209969_1004286
1087 Ga0209981_1000005
1088 Ga0209996_1000100
1089 Ga0210000_1002199
1090 Ga0209995_1000053
1091 Ga0209968_1000053
1092 Ga0209999_1000038
1093 Ga0209982_1000159
1094 Ga0209970_1000146
1095 Ga0209970_1001966
1096 Ga0210002_1000906
1097 Ga0209983_1001537
1098 Ga0209983_1005529
1099 Ga0209966_1000240
1100 Ga0209998_10000446
1101 Ga0209998_10002294
1102 Ga0209974_10000180
1103 Ga0209974_10054692
1104 Ga0207428_10000170
1105 Ga0207428_10000232
1106 Ga0207428_10000434
1107 Ga0207428_10006209
1108 Ga0207428_10009746
1109 Ga0268265_10008044
1110 Ga0268264_10011773
1111 Ga0265326_10000160
1112 Ga0265326_10000185
1113 Ga0265334_10008960
1114 Ga0265334_10012118
1115 Ga0265322_10000323
1116 Ga0265336_10000080
1117 Ga0265336_10000155
1118 Ga0265338_10000026
1119 Ga0265338_10000472
1120 Ga0265338_10045260
1121 Ga0265324_10000314
1122 Ga0265324_10000380
1123 Ga0265332_10000429
1124 Ga0265332_10013799
1125 Ga0265328_10005191
1126 Ga0265320_10048846
1127 Ga0265325_10000348
1128 Ga0265329_10006120
1129 Ga0265340_10000041
1130 Ga0265340_10000487
1131 Ga0265339_10000015
1132 Ga0265339_10001355
1133 Ga0265331_10000202
1134 Ga0265331_10000203
1135 Ga0307408_100038002
1136 Ga0307408_100050520
1137 Ga0307408_100216015
1138 Ga0265314_10002566
1139 Ga0265342_10052253
1140 Ga0307405_10061116
1141 Ga0307413_10000838
1142 Ga0307410_10007831
1143 Ga0307410_10055161
1144 Ga0307410_10107593
1145 Ga0307406_10019020
1146 Ga0307407_10003712
1147 Ga0307407_10033198
1148 Ga0307407_10124502
1149 Ga0307409_100000715
1150 Ga0307409_100133226
1151 Ga0307416_100226431
1152 Ga0307416_100422769
1153 Ga0307414_10015545
1154 Ga0307415_100024980
1155 Ga0307415_100092900
1156 Ga0373959_0014712
1157 Ga0373938_0018818
1158 Ga0373949_0002432
1159 Ga0373952_0001854
1160 Ga0373932_0004181
1161 Ga0373939_0002056
1162 Ga0373960_0000965
1163 Ga0373942_0002651
1164 Ga0373961_0002156
1165 Ga0373961_0002455
1166 Ga0373961_0037151
1167 Ga0373962_0005781
1168 Ga0373931_0001047
1169 Ga0242420_000019
1170 Ga0242420_002745
1171 Ga0436362_0412333
1172 Ga0439461_0016587
1173 Ga0439441_000076
1174 Ga0439443_001796
1175 Ga0439451_001557
1176 Ga0439451_007255
1177 Ga0439454_000115
1178 Ga0439463_000375
1179 Ga0450923_006082
1180 Ga0450923_010347
1181 Ga0439446_0016112
1182 Ga0439464_0007763
1183 Ga0439460_0018140
1184 Ga0439460_0059963
1185 Ga0450893_0001441
1186 Ga0451577_0102174
1187 Ga0451577_0308855
1188 Ga0453683_0079672
1189 Ga0451576_0002545
1190 Ga0495584_0027998
1191 Ga0495607_0059690
1192 Ga0495635_0017573
1193 Ga0495659_0006500
1194 Ga0495670_0012212
1195 Ga0496100_0018435
1196 Ga0496100_0112590
1197 Ga0496102_0004087
1198 Ga0496102_0029503
1199 Ga0496103_0036253
1200 Ga0496104_0059348
1201 Ga0496106_0002207
1202 Ga0496106_0002798
1203 Ga0496106_0011151
1204 Ga0496107_0023222
1205 Ga0496107_0053783
1206 Ga0496109_0097517
1207 Ga0496110_0018448
1208 Ga0496110_0403459
1209 Ga0496112_0161490
1210 Ga0501306_000908
1211 Ga0501291_001124
1212 Ga0501291_001915
1213 Ga0501295_000368
1214 Ga0501297_001717
1215 Ga0501298_003085
1216 Ga0501300_007060
1217 Ga0501311_002280
1218 Ga0501323_001625
1219 Ga0501031_0035723
1220 Ga0501031_0087691
1221 Ga0501032_0077458
1222 Ga0501033_0027779
1223 Ga0501033_0033380
1224 Ga0501033_0227839
1225 Ga0501034_0096411
1226 Ga0501036_0002393
1227 Ga0501036_0003189
1228 Ga0501036_0052970
1229 Ga0501036_0148619
1230 Ga0501036_0335693
1231 Ga0501037_0080656
1232 Ga0501037_0115745
1233 Ga0501038_0011197
1234 Ga0501038_0012202
1235 Ga0501038_0028658
1236 Ga0501038_0119786
1237 Ga0501038_0309901
1238 Ga0501039_0000962
1239 Ga0501039_0001282
1240 Ga0501039_0049589
1241 Ga0501039_0056609
1242 Ga0501039_0062168
1243 Ga0501039_0085403
1244 Ga0501040_0002111
1245 Ga0501040_0007247
1246 Ga0501040_0031154
1247 Ga0501040_0034584
1248 Ga0501040_0067628
1249 Ga0501040_0078804
1250 Ga0501041_0002516
1251 Ga0501041_0008111
1252 Ga0501041_0019055
1253 Ga0501042_0000534
1254 Ga0501042_0000639
1255 Ga0501042_0008185
1256 Ga0501042_0008281
1257 Ga0501042_0010157
1258 Ga0501042_0025187
1259 Ga0501042_0114055
1260 Ga0501042_0247160
1261 Ga0501043_0046253
1262 Ga0501043_0061859
1263 Ga0501043_0124737
1264 Ga0501046_0001612
1265 Ga0501046_0034086
1266 Ga0501046_0041920
1267 Ga0501046_0048840
1268 Ga0501048_0011481
1269 Ga0501048_0018943
1270 Ga0501048_0041663
1271 Ga0501048_0058391
1272 Ga0501048_0060249
1273 Ga0501048_0194226
1274 Ga0501068_0002315
1275 Ga0501068_0023679
1276 Ga0501069_0057182
1277 Ga0501069_0096057
1278 Ga0501070_0297255
1279 Ga0501071_0000039
1280 Ga0501071_0000134
1281 Ga0501071_0003115
1282 Ga0501071_0007720
1283 Ga0501071_0028939
1284 Ga0501072_0000093
1285 Ga0501072_0000103
1286 Ga0501072_0001137
1287 Ga0501072_0007823
1288 Ga0501072_0354421
1289 Ga0501074_0002649
1290 Ga0501074_0032373
1291 Ga0501075_0002122
1292 Ga0501075_0005974
1293 Ga0501075_0009947
1294 Ga0501075_0015329
1295 Ga0501075_0029356
1296 Ga0501075_0058088
1297 Ga0501075_0068675
1298 Ga0501075_0117970
1299 Ga0501075_0121032
1300 Ga0501076_0000705
1301 Ga0501076_0008620
1302 Ga0501076_0021038
1303 Ga0501076_0037654
1304 Ga0501076_0086973
1305 Ga0501077_0000966
1306 Ga0501077_0047427
1307 Ga0501077_0048694
1308 Ga0501077_0056059
1309 Ga0501198_002114
1310 Ga0501199_000056
1311 Ga0501202_012604
1312 Ga0501206_000511
1313 Ga0501207_009041
1314 Ga0501208_003122
1315 Ga0501209_000201
1316 Ga0501209_009093
1317 Ga0501214_001193
1318 Ga0501216_002132
1319 Ga0501217_011891
1320 Ga0501223_002574
1321 Ga0501230_014899
1322 Ga0501233_003423
1323 Ga0501235_000075
1324 Ga0501243_003795
1325 Ga0501246_002437
1326 Ga0501249_005414
1327 Ga0501251_000102
1328 Ga0501253_014909
1329 Ga0501256_001163
1330 Ga0501257_008418
1331 Ga0501261_002827
1332 Ga0501221_001765
1333 Ga0501225_0003005
1334 Ga0501229_001460
1335 Ga0501234_000438
1336 Ga0501245_002823
1337 Ga0501079_0002169
1338 Ga0501079_0021681
1339 Ga0501079_0022355
1340 Ga0501079_0030369
1341 Ga0501079_0110557
1342 Ga0501079_0157653
1343 Ga0501080_0139857
1344 Ga0501080_0196757
1345 Ga0501081_0001494
1346 Ga0501081_0013271
1347 Ga0501081_0088975
1348 Ga0501232_000092
1349 Ga0501265_001263
1350 Ga0501269_002741
1351 Ga0501271_001724
1352 Ga0501275_000792
1353 Ga0501276_000419
1354 Ga0501278_000518
1355 Ga0501035_0063322
1356 Ga0501035_0081376
1357 Ga0501035_0133982
1358 Ga0501035_0231408
1359 Ga0501035_0302549
1360 Ga0501044_0037203
1361 Ga0501044_0124135
1362 Ga0501044_0166719
1363 Ga0501044_0192269
1364 Ga0501045_0002701
1365 Ga0501045_0006154
1366 Ga0501045_0018805
1367 Ga0501045_0037392
1368 Ga0501045_0039700
1369 Ga0501212_000515
1370 nmdc:mga05p37_15024_c1
1371 nmdc:mga05p37_15447_c1
1372 nmdc:mga05p37_16004_c1
1373 nmdc:mga05p37_181684_c1
1374 nmdc:mga05p37_188398_c1
1375 nmdc:mga05p37_39908_c1
1376 nmdc:mga05p37_4908_c1
1377 nmdc:mga05p37_56388_c1
1378 nmdc:mga05p37_67001_c1
1379 nmdc:mga05p37_86878_c1
1380 nmdc:mga09592_11807_c1
1381 nmdc:mga09592_29_c1
1382 nmdc:mga09592_3968_c1
1383 nmdc:mga09592_92685_c1
1384 nmdc:mga09592_98275_c1
1385 nmdc:mga0qj67_1174_c1
1386 nmdc:mga0qj67_24486_c1
1387 nmdc:mga0qj67_424_c1
1388 nmdc:mga0qj67_76588_c1
1389 nmdc:mga06r32_140647_c1
1390 nmdc:mga06r32_167682_c1
1391 nmdc:mga06r32_29408_c1
1392 nmdc:mga06r32_330_c1
1393 nmdc:mga08y16_247_c1
1394 nmdc:mga08y16_45628_c1
1395 nmdc:mga08y16_5932_c1
1396 nmdc:mga0n895_26914_c1
1397 nmdc:mga0n895_53713_c1
1398 nmdc:mga0n895_65185_c1
1399 nmdc:mga0n895_85_c1
1400 nmdc:mga0rr50_1103_c1
1401 nmdc:mga0rr50_19376_c1
1402 nmdc:mga0rr50_2280_c1
1403 nmdc:mga0rr50_28404_c1
1404 nmdc:mga0rr50_47376_c1
1405 nmdc:mga08x19_35779_c1
1406 nmdc:mga08x19_4805_c1
1407 nmdc:mga08x19_49820_c1
1408 nmdc:mga0a205_12688_c1
1409 nmdc:mga0a205_204193_c1
1410 nmdc:mga0a205_2391_c1
1411 nmdc:mga0a205_355809_c1
1412 nmdc:mga0a205_374455_c1
1413 nmdc:mga0a205_95245_c1
1414 Ga0501084_0000450
1415 Ga0501084_0001797
1416 Ga0501084_0022778
1417 Ga0501084_0031979
1418 Ga0501084_0037612
1419 Ga0501084_0105800
1420 Ga0501084_0176171
1421 Ga0590071_002909
1422 Ga0590075_003771
1423 Ga0590075_004968
1424 Ga0590077_001132
1425 Ga0501082_0000364
1426 Ga0501082_0000911
1427 Ga0501082_0009614
1428 Ga0501082_0026594
1429 Ga0501082_0119225
1430 Ga0501082_0204173
1431 Ga0530510_0000043
1432 Ga0530510_0000704
1433 Ga0530510_0002917
1434 Ga0530510_0003904
1435 Ga0530510_0030774
1436 Ga0530510_0080046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01264

Chorismate_synt

Chorismate synthase

30

375

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9469 1 355
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9453 1 353
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9357 1 355
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.927 1 353
1sq1-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9203 4 353
ID Description Score Start End Superfamily
af_Q58575_11_372_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9543 10 355 3.60.150.10
af_A0A1D8PTK1_42_412_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9476 10 355 3.60.150.10
5z9aA00 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9469 1 355 3.60.150.10
5z9aA00 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9357 1 355 3.60.150.10
af_P12008_1_360_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9326 1 365 3.60.150.10
ID Description Score Start End GO Terms
AF-R6RAD5-F1-model_v4 Chorismate synthase 0.9843 191 347 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A419JHD1-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.9836 197 354 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A7J4F9D9-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.9818 164 363 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A3C1B1E7-F1-model_v4 chorismate synthase (EC 4.2.3.5) 0.9817 191 355 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A524LJ96-F1-model_v4 Chorismate synthase (CS) (EC 4.2.3.5) (5-enolpyruvylshikimate-3-phosphate phospholyase) 0.9814 5 355 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181

Map