F477002

General Info

Members Datasets Scaffolds Average Seq Length
715 406 630 128

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0042508|Ga0436365_0042508_23747_24190
Length 147
Sequence LYALAKPSRDSFLFGDLVMSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVAAGDDCAVAESVKAASDIYAPISGEIVAVNEALGDAPEQVNSAPYGEGWIFKIKASDESEVAALLDATAYEALLEDE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231020 Pseudomonas sp. GM74 Isolate Nodule
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
5 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
6 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
7 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
8 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
9 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
10 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
11 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
12 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
13 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
14 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
15 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
16 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
17 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
18 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
19 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
20 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
23 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
24 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
25 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
26 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
27 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
28 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
29 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
30 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
31 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
32 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
33 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
34 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
35 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
36 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
37 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
38 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
39 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
40 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
41 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
42 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
43 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
44 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
45 2636415599 Klebsiella variicola DX120E Isolate Unclassified
46 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
47 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
48 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
49 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
50 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
51 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
52 2751185917 Enterobacter sp. HK169 Isolate Unclassified
53 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
54 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
55 2775507074 Klebsiella sp. D5A Isolate Unclassified
56 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
57 2821118458 Enterobacter asburiae 609 Isolate Unclassified
58 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
59 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
60 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
61 2865014394 Pantoea sp. R-71966 Isolate Unclassified
62 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
63 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
64 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
65 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
66 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
67 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
68 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
69 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
70 2937539931 Pantoea sp. LS15 Isolate Unclassified
71 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
72 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
73 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
74 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
75 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
76 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
77 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
78 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
79 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
80 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
81 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
82 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
83 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
84 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
85 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
86 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
87 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
90 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
93 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
99 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
106 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
107 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
108 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
122 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
123 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
167 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
168 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
169 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
229 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
230 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
231 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
232 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
233 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
234 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
235 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
236 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
239 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
242 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
243 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
244 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
249 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
250 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
254 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
265 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
266 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
283 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
284 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
285 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
289 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
290 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
291 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
292 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
293 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
294 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
295 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
296 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
301 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
302 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
303 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
304 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
305 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
306 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
307 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
308 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
309 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
310 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
311 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
312 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
315 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
316 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
317 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
318 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
322 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
323 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
399 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 8018221730 Enterobacter sp. CM29 Isolate Unclassified
403 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
404 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
405 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
406 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.57
Metatranscriptomes 1.54
Isolates 11.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 1.82
Nodule 1.82
Rhizoplane 10.77
Rhizosphere 75.66
Stem 0
Stem Tuber 0
Unclassified 9.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2081982 2162886007 Bacteria 2260
2 JGI24737J22298_10132570 3300001990 Archaea 736
3 JGI24737J22298_10249692 3300001990 Bacteria 524
4 rootH2_10007961 3300003320 Bacteria 15867
5 rootL2_10005174 3300003322 Bacteria 11301
6 JGI26129J50193_1009732 3300003349 Bacteria 698
7 Ga0006562J51391_1034250 3300003578 Unclassified 1646
8 Ga0065704_10096250 3300005289 Bacteria 2439
9 Ga0065704_10447131 3300005289 Bacteria 708
10 Ga0065704_10589533 3300005289 Bacteria 601
11 Ga0070676_10637699 3300005328 Bacteria 772
12 Ga0070676_10989659 3300005328 Bacteria 631
13 Ga0070683_100434434 3300005329 Bacteria 1253
14 Ga0070683_100506196 3300005329 Bacteria 1154
15 Ga0070670_100111084 3300005331 Bacteria 2362
16 Ga0070660_100178743 3300005339 Bacteria 1717
17 Ga0070660_100180346 3300005339 Bacteria 1709
18 Ga0070692_10149802 3300005345 Bacteria 1328
19 Ga0070692_10525721 3300005345 Bacteria 771
20 Ga0070668_100005924 3300005347 Bacteria 9059
21 Ga0070674_100096087 3300005356 Bacteria 2149
22 Ga0070674_101547295 3300005356 Bacteria 597
23 Ga0070688_100779640 3300005365 Bacteria 746
24 Ga0070659_100017935 3300005366 Bacteria 5333
25 Ga0070659_100213804 3300005366 Bacteria 1589
26 Ga0070659_100259143 3300005366 Bacteria 1443
27 Ga0070659_100294518 3300005366 Bacteria 1352
28 Ga0070659_100349134 3300005366 Bacteria 1241
29 Ga0070659_101024490 3300005366 Bacteria 725
30 Ga0070714_100029705 3300005435 Bacteria 4546
31 Ga0070711_100040404 3300005439 Bacteria 3146
32 Ga0070711_101406719 3300005439 Unclassified 607
33 Ga0070700_100211893 3300005441 Bacteria 1367
34 Ga0070678_100649993 3300005456 Bacteria 946
35 Ga0070662_100019920 3300005457 Bacteria 4565
36 Ga0070662_100737629 3300005457 Bacteria 835
37 Ga0070681_10679253 3300005458 Bacteria 945
38 Ga0068867_100094504 3300005459 Bacteria 2273
39 Ga0068867_100557801 3300005459 Bacteria 993
40 Ga0070706_100788510 3300005467 Bacteria 880
41 Ga0070698_100589616 3300005471 Bacteria 1052
42 Ga0070679_100535681 3300005530 Bacteria 1115
43 Ga0070684_100156192 3300005535 Bacteria 2069
44 Ga0070697_100067397 3300005536 Bacteria 2928
45 Ga0068853_102129852 3300005539 Unclassified 544
46 Ga0068853_102215244 3300005539 Bacteria 533
47 Ga0070665_100000033 3300005548 Bacteria 332530
48 Ga0070665_100155742 3300005548 Bacteria 2287
49 Ga0070665_100528192 3300005548 Bacteria 1192
50 Ga0070704_101118305 3300005549 Bacteria 716
51 Ga0070704_101716838 3300005549 Bacteria 580
52 Ga0070664_100677286 3300005564 Bacteria 960
53 Ga0068857_100000005 3300005577 Bacteria 170248
54 Ga0068857_100552569 3300005577 Bacteria 1085
55 Ga0068854_100367615 3300005578 Bacteria 1182
56 Ga0068856_100865745 3300005614 Bacteria 923
57 Ga0068856_101011039 3300005614 Bacteria 850
58 Ga0070702_100421497 3300005615 Bacteria 961
59 Ga0068852_100309410 3300005616 Bacteria 1531
60 Ga0068852_100802136 3300005616 Bacteria 956
61 Ga0068852_101740695 3300005616 Bacteria 646
62 Ga0068859_100654263 3300005617 Bacteria 1143
63 Ga0068864_100348964 3300005618 Bacteria 1396
64 Ga0068866_10058288 3300005718 Bacteria 1994
65 Ga0068866_10147682 3300005718 Bacteria 1358
66 Ga0068861_100148538 3300005719 Bacteria 1921
67 Ga0068861_100751999 3300005719 Bacteria 911
68 Ga0068861_100870025 3300005719 Bacteria 851
69 Ga0068851_10025488 3300005834 Bacteria 2901
70 Ga0068870_10068796 3300005840 Bacteria 1925
71 Ga0068870_10113589 3300005840 Bacteria 1550
72 Ga0068862_101169748 3300005844 Bacteria 767
73 Ga0068862_102067149 3300005844 Bacteria 581
74 Ga0081538_10153090 3300005981 Bacteria 1040
75 Ga0075365_10202724 3300006038 Bacteria 1390
76 Ga0075365_10534960 3300006038 Bacteria 829
77 Ga0075365_10568514 3300006038 Bacteria 802
78 Ga0075364_10008988 3300006051 Bacteria 5982
79 Ga0075364_10378596 3300006051 Bacteria 965
80 Ga0075366_10003394 3300006195 Bacteria 8397
81 Ga0097621_101487504 3300006237 Unclassified 642
82 Ga0075428_100520963 3300006844 Bacteria 1272
83 Ga0075428_100946318 3300006844 Bacteria 913
84 Ga0075431_101912686 3300006847 Bacteria 549
85 Ga0068865_100498683 3300006881 Bacteria 1015
86 Ga0097620_100654301 3300006931 Bacteria 1143
87 Ga0079104_1000046 3300006946 Bacteria 183396
88 Ga0079104_1000249 3300006946 Bacteria 72153
89 Ga0079104_1001023 3300006946 Bacteria 21533
90 Ga0079104_1001675 3300006946 Bacteria 14227
91 Ga0079104_1078148 3300006946 Bacteria 684
92 Ga0105251_10000576 3300009011 Bacteria 34073
93 Ga0105251_10006603 3300009011 Bacteria 7350
94 Ga0105251_10025485 3300009011 Bacteria 3025
95 Ga0105251_10063250 3300009011 Bacteria 1736
96 Ga0105251_10126148 3300009011 Bacteria 1162
97 Ga0105244_10000091 3300009036 Bacteria 96351
98 Ga0105244_10039783 3300009036 Bacteria 2445
99 Ga0105244_10411907 3300009036 Bacteria 622
100 Ga0105244_10586162 3300009036 Bacteria 512
101 Ga0105250_10000095 3300009092 Bacteria 78639
102 Ga0105250_10044506 3300009092 Bacteria 1780
103 Ga0105240_10044693 3300009093 Bacteria 5625
104 Ga0105240_10693579 3300009093 Bacteria 1112
105 Ga0111539_10980384 3300009094 Bacteria 983
106 Ga0111539_11394265 3300009094 Bacteria 813
107 Ga0111539_12373636 3300009094 Bacteria 615
108 Ga0105245_10228854 3300009098 Bacteria 1797
109 Ga0105245_10369589 3300009098 Bacteria 1425
110 Ga0105247_10269596 3300009101 Bacteria 1170
111 Ga0105247_10324318 3300009101 Bacteria 1075
112 Ga0105247_11110806 3300009101 Bacteria 624
113 Ga0114129_10432163 3300009147 Bacteria 1730
114 Ga0114129_11562474 3300009147 Bacteria 809
115 Ga0114129_11836492 3300009147 Bacteria 736
116 Ga0114129_11947353 3300009147 Bacteria 712
117 Ga0105243_10155174 3300009148 Bacteria 1968
118 Ga0105243_10336668 3300009148 Bacteria 1381
119 Ga0105243_11058440 3300009148 Bacteria 817
120 Ga0105243_11219786 3300009148 Bacteria 766
121 Ga0105242_10890407 3300009176 Bacteria 889
122 Ga0105242_11471207 3300009176 Bacteria 711
123 Ga0105242_13273943 3300009176 Unclassified 503
124 Ga0105248_10596542 3300009177 Bacteria 1246
125 Ga0105248_11513262 3300009177 Bacteria 760
126 Ga0105248_12053276 3300009177 Bacteria 650
127 Ga0105237_10141798 3300009545 Bacteria 2397
128 Ga0105237_10300312 3300009545 Bacteria 1609
129 Ga0105238_10451230 3300009551 Bacteria 1283
130 Ga0105249_10422390 3300009553 Bacteria 1367
131 Ga0105249_11551703 3300009553 Bacteria 735
132 Ga0105239_11620257 3300010375 Unclassified 749
133 Ga0105239_12144592 3300010375 Unclassified 650
134 Ga0105239_12274270 3300010375 Bacteria 631
135 Ga0105239_13096906 3300010375 Bacteria 542
136 Ga0105246_10140776 3300011119 Bacteria 1814
137 Ga0157373_10031197 3300013100 Bacteria 3835
138 Ga0157373_10215033 3300013100 Bacteria 1356
139 Ga0157371_10749179 3300013102 Bacteria 733
140 Ga0157371_10971181 3300013102 Bacteria 647
141 Ga0157370_10002672 3300013104 Bacteria 21370
142 Ga0157370_10003046 3300013104 Bacteria 19875
143 Ga0157370_11299817 3300013104 Bacteria 655
144 Ga0157370_12048284 3300013104 Bacteria 513
145 Ga0157374_10274843 3300013296 Bacteria 1662
146 Ga0157374_11789826 3300013296 Unclassified 639
147 Ga0157378_10446043 3300013297 Bacteria 1283
148 Ga0163162_10043027 3300013306 Bacteria 4521
149 Ga0157372_10045700 3300013307 Bacteria 4859
150 Ga0157372_10532628 3300013307 Bacteria 1369
151 Ga0157372_10729583 3300013307 Bacteria 1152
152 Ga0157375_11311746 3300013308 Bacteria 851
153 Ga0157375_12523485 3300013308 Bacteria 614
154 Ga0163163_10332564 3300014325 Bacteria 1574
155 Ga0157380_10159165 3300014326 Bacteria 1961
156 Ga0157380_11637400 3300014326 Archaea 700
157 Ga0182008_10060110 3300014497 Bacteria 1874
158 Ga0157377_10126535 3300014745 Bacteria 1555
159 Ga0157377_10184610 3300014745 Bacteria 1314
160 Ga0157377_11337333 3300014745 Unclassified 562
161 Ga0157376_10001159 3300014969 Bacteria 17345
162 Ga0157376_10119524 3300014969 Bacteria 2333
163 Ga0157376_10637206 3300014969 Bacteria 1065
164 Ga0182006_1000013 3300015261 Bacteria 363224
165 Ga0182006_1003907 3300015261 Bacteria 7465
166 Ga0182007_10030055 3300015262 Bacteria 1858
167 Ga0183366_1002 3300015679 Bacteria 791639
168 Ga0183370_1002 3300015680 Bacteria 791639
169 Ga0183369_1002 3300015685 Bacteria 791621
170 Ga0183368_1005 3300015687 Bacteria 791621
171 Ga0163161_10010793 3300017792 Bacteria 6329
172 Ga0163161_10125620 3300017792 Bacteria 1931
173 Ga0163161_10430225 3300017792 Bacteria 1063
174 Ga0163161_10433543 3300017792 Bacteria 1059
175 Ga0213872_10207204 3300021361 Bacteria 838
176 Ga0213876_10000329 3300021384 Bacteria 41529
177 Ga0207426_1027655 3300025302 Bacteria 1887
178 Ga0207656_10008020 3300025321 Bacteria 3872
179 Ga0207696_1000024 3300025711 Bacteria 420123
180 Ga0207696_1000361 3300025711 Bacteria 45553
181 Ga0207655_1000044 3300025728 Bacteria 327511
182 Ga0207655_1000047 3300025728 Bacteria 302548
183 Ga0207655_1000050 3300025728 Bacteria 294923
184 Ga0207655_1000079 3300025728 Bacteria 219036
185 Ga0207655_1007857 3300025728 Bacteria 6860
186 Ga0207655_1041194 3300025728 Bacteria 1982
187 Ga0207713_1000033 3300025735 Bacteria 273751
188 Ga0207713_1000134 3300025735 Bacteria 112419
189 Ga0207713_1004277 3300025735 Bacteria 9311
190 Ga0207713_1017199 3300025735 Bacteria 3638
191 Ga0207713_1082750 3300025735 Bacteria 1149
192 Ga0207713_1087163 3300025735 Bacteria 1107
193 Ga0207682_10204939 3300025893 Bacteria 908
194 Ga0207692_11197741 3300025898 Bacteria 504
195 Ga0207642_10109118 3300025899 Bacteria 1405
196 Ga0207710_10358912 3300025900 Bacteria 743
197 Ga0207688_10046036 3300025901 Bacteria 2435
198 Ga0207688_10187403 3300025901 Bacteria 1236
199 Ga0207688_10369966 3300025901 Bacteria 885
200 Ga0207645_10388259 3300025907 Bacteria 938
201 Ga0207643_10053083 3300025908 Bacteria 2302
202 Ga0207695_10200142 3300025913 Bacteria 1912
203 Ga0207671_10357320 3300025914 Bacteria 1159
204 Ga0207660_11334596 3300025917 Bacteria 582
205 Ga0207657_10183351 3300025919 Bacteria 1691
206 Ga0207652_10633734 3300025921 Bacteria 957
207 Ga0207694_10080587 3300025924 Bacteria 2555
208 Ga0207694_11556586 3300025924 Bacteria 558
209 Ga0207650_10673351 3300025925 Bacteria 873
210 Ga0207659_10453149 3300025926 Bacteria 1081
211 Ga0207687_10245907 3300025927 Bacteria 1420
212 Ga0207690_10041333 3300025932 Bacteria 3020
213 Ga0207690_10088511 3300025932 Bacteria 2181
214 Ga0207706_10055572 3300025933 Bacteria 3490
215 Ga0207706_10088631 3300025933 Bacteria 2720
216 Ga0207706_10199910 3300025933 Bacteria 1753
217 Ga0207706_10537879 3300025933 Bacteria 1007
218 Ga0207706_10661425 3300025933 Unclassified 894
219 Ga0207706_10816548 3300025933 Bacteria 791
220 Ga0207709_10133988 3300025935 Bacteria 1693
221 Ga0207709_10152812 3300025935 Bacteria 1601
222 Ga0207669_10070251 3300025937 Bacteria 2195
223 Ga0207669_10138728 3300025937 Bacteria 1684
224 Ga0207669_10360127 3300025937 Bacteria 1127
225 Ga0207704_11106452 3300025938 Bacteria 673
226 Ga0207704_11111826 3300025938 Bacteria 672
227 Ga0207691_10468239 3300025940 Bacteria 1071
228 Ga0207691_11475306 3300025940 Bacteria 557
229 Ga0207689_11110740 3300025942 Bacteria 666
230 Ga0207661_10990869 3300025944 Bacteria 774
231 Ga0207661_11486073 3300025944 Bacteria 621
232 Ga0207679_10642409 3300025945 Bacteria 959
233 Ga0207712_10296010 3300025961 Bacteria 1326
234 Ga0207668_10221869 3300025972 Bacteria 1519
235 Ga0207668_10338908 3300025972 Bacteria 1253
236 Ga0207668_11223816 3300025972 Bacteria 675
237 Ga0207677_10268898 3300026023 Bacteria 1393
238 Ga0207677_10603165 3300026023 Bacteria 964
239 Ga0207639_10809457 3300026041 Bacteria 873
240 Ga0207639_11197370 3300026041 Bacteria 713
241 Ga0207678_10992686 3300026067 Bacteria 743
242 Ga0207708_10008968 3300026075 Bacteria 7401
243 Ga0207708_10185692 3300026075 Bacteria 1652
244 Ga0207648_10085237 3300026089 Bacteria 2756
245 Ga0207648_10826533 3300026089 Bacteria 863
246 Ga0207648_10867424 3300026089 Bacteria 842
247 Ga0207676_10258186 3300026095 Bacteria 1572
248 Ga0207676_10452977 3300026095 Bacteria 1210
249 Ga0207674_10000523 3300026116 Bacteria 50444
250 Ga0207674_10370381 3300026116 Bacteria 1385
251 Ga0207675_100068996 3300026118 Bacteria 3304
252 Ga0207683_10063390 3300026121 Bacteria 3256
253 Ga0207683_11905155 3300026121 Bacteria 543
254 Ga0207698_10513908 3300026142 Bacteria 1168
255 Ga0207698_11076101 3300026142 Bacteria 816
256 Ga0209281_1000022 3300027111 Bacteria 522913
257 Ga0209281_1000048 3300027111 Bacteria 322698
258 Ga0209281_1000056 3300027111 Bacteria 307619
259 Ga0209281_1000120 3300027111 Bacteria 206692
260 Ga0209281_1000243 3300027111 Bacteria 110012
261 Ga0209281_1000422 3300027111 Bacteria 63149
262 Ga0209371_1000013 3300027312 Bacteria 691516
263 Ga0209371_1000427 3300027312 Bacteria 43271
264 Ga0209371_1001124 3300027312 Bacteria 19718
265 Ga0209371_1023428 3300027312 Bacteria 1454
266 Ga0209371_1032708 3300027312 Bacteria 1116
267 Ga0209981_1013521 3300027378 Bacteria 1135
268 Ga0210000_1011901 3300027462 Bacteria 1291
269 Ga0209995_1020402 3300027471 Bacteria 1096
270 Ga0209968_1004519 3300027526 Bacteria 2088
271 Ga0209970_1035438 3300027614 Bacteria 877
272 Ga0209970_1118694 3300027614 Unclassified 511
273 Ga0210002_1052775 3300027617 Bacteria 702
274 Ga0209971_1010608 3300027682 Bacteria 2183
275 Ga0209998_10004283 3300027717 Bacteria 3039
276 Ga0209998_10092432 3300027717 Bacteria 743
277 Ga0209974_10005674 3300027876 Bacteria 4380
278 Ga0207428_10037489 3300027907 Bacteria 3944
279 Ga0207428_10411638 3300027907 Bacteria 989
280 Ga0268266_10000041 3300028379 Bacteria 322311
281 Ga0268266_10272578 3300028379 Bacteria 1571
282 Ga0268266_11374800 3300028379 Bacteria 682
283 Ga0265337_1000006 3300028556 Bacteria 99562
284 Ga0265326_10000066 3300028558 Bacteria 59893
285 Ga0265318_10109340 3300028577 Bacteria 1016
286 Ga0265322_10000001 3300028654 Bacteria 543854
287 Ga0265336_10001086 3300028666 Bacteria 13158
288 Ga0265336_10010847 3300028666 Bacteria 3110
289 Ga0265338_10059611 3300028800 Bacteria 3362
290 Ga0265324_10000090 3300029957 Bacteria 70577
291 Ga0265324_10000373 3300029957 Bacteria 32392
292 Ga0265324_10000563 3300029957 Bacteria 25385
293 Ga0265324_10007205 3300029957 Bacteria 4540
294 Ga0265324_10012755 3300029957 Bacteria 3158
295 Ga0268256_1000014 3300030500 Bacteria 691435
296 Ga0268256_1000363 3300030500 Bacteria 43271
297 Ga0268256_1021499 3300030500 Bacteria 1714
298 Ga0268256_1026531 3300030500 Bacteria 1454
299 Ga0316183_1179590 3300030742 Bacteria 619
300 Ga0265330_10002315 3300031235 Bacteria 10458
301 Ga0265332_10084963 3300031238 Bacteria 1341
302 Ga0265332_10100953 3300031238 Bacteria 1217
303 Ga0265320_10000002 3300031240 Bacteria 542875
304 Ga0265320_10014802 3300031240 Bacteria 4425
305 Ga0265325_10000153 3300031241 Bacteria 48971
306 Ga0265329_10009135 3300031242 Bacteria 3716
307 Ga0265329_10030273 3300031242 Bacteria 1764
308 Ga0265340_10406738 3300031247 Bacteria 600
309 Ga0265339_10008744 3300031249 Bacteria 6418
310 Ga0265339_10011323 3300031249 Bacteria 5499
311 Ga0265331_10002086 3300031250 Bacteria 13821
312 Ga0265331_10002830 3300031250 Bacteria 11505
313 Ga0265331_10029077 3300031250 Bacteria 2760
314 Ga0265331_10085731 3300031250 Bacteria 1459
315 Ga0265331_10092484 3300031250 Bacteria 1397
316 Ga0265331_10116328 3300031250 Bacteria 1224
317 Ga0265327_10000011 3300031251 Bacteria 543807
318 Ga0265327_10000557 3300031251 Bacteria 63857
319 Ga0265316_10053913 3300031344 Bacteria 3149
320 Ga0265316_10141965 3300031344 Bacteria 1803
321 Ga0265316_10635904 3300031344 Bacteria 755
322 Ga0307408_101130955 3300031548 Bacteria 728
323 Ga0265313_10009558 3300031595 Bacteria 6278
324 Ga0316575_10000218 3300031665 Bacteria 15311
325 Ga0316579_10079102 3300031691 Bacteria 1564
326 Ga0316579_10162879 3300031691 Unclassified 1078
327 Ga0265314_10000706 3300031711 Bacteria 40494
328 Ga0265314_10000726 3300031711 Bacteria 39827
329 Ga0265314_10009867 3300031711 Bacteria 8013
330 Ga0265314_10014960 3300031711 Bacteria 6179
331 Ga0265314_10030366 3300031711 Bacteria 4001
332 Ga0265342_10161542 3300031712 Bacteria 1238
333 Ga0265342_10605518 3300031712 Bacteria 552
334 Ga0316576_10208429 3300031727 Bacteria 1471
335 Ga0316576_10346584 3300031727 Bacteria 1105
336 Ga0316576_10936803 3300031727 Bacteria 619
337 Ga0316576_11103248 3300031727 Bacteria 563
338 Ga0316578_10006169 3300031728 Bacteria 5889
339 Ga0316578_10015116 3300031728 Bacteria 4143
340 Ga0307405_10172546 3300031731 Bacteria 1544
341 Ga0307405_12037849 3300031731 Bacteria 514
342 Ga0316577_10019864 3300031733 Bacteria 3722
343 Ga0307410_10305007 3300031852 Bacteria 1258
344 Ga0307410_11239125 3300031852 Bacteria 651
345 Ga0307406_10311375 3300031901 Bacteria 1214
346 Ga0307406_10443369 3300031901 Bacteria 1040
347 Ga0307406_10617996 3300031901 Bacteria 895
348 Ga0307409_100318026 3300031995 Bacteria 1456
349 Ga0307409_100337262 3300031995 Bacteria 1417
350 Ga0307409_100835000 3300031995 Bacteria 931
351 Ga0307409_100867404 3300031995 Bacteria 914
352 Ga0307409_101252014 3300031995 Bacteria 766
353 Ga0307409_101589845 3300031995 Bacteria 682
354 Ga0307416_100355281 3300032002 Bacteria 1485
355 Ga0307416_100590156 3300032002 Bacteria 1189
356 Ga0307416_100761242 3300032002 Bacteria 1062
357 Ga0307414_10520077 3300032004 Bacteria 1056
358 Ga0307411_10131892 3300032005 Bacteria 1828
359 Ga0307415_100017705 3300032126 Bacteria 4278
360 Ga0307415_100256525 3300032126 Bacteria 1424
361 Ga0307415_100375335 3300032126 Bacteria 1206
362 Ga0307415_101812081 3300032126 Bacteria 591
363 Ga0316585_10016316 3300032137 Bacteria 2236
364 Ga0316580_10002910 3300032139 Bacteria 4796
365 Ga0316580_10011437 3300032139 Bacteria 2694
366 Ga0316593_10005031 3300032168 Bacteria 3451
367 Ga0316593_10062511 3300032168 Bacteria 1275
368 Ga0316592_1000666 3300033524 Bacteria 5018
369 Ga0316592_1011089 3300033524 Bacteria 1827
370 Ga0316588_1000764 3300033528 Bacteria 4783
371 Ga0316588_1002158 3300033528 Unclassified 3387
372 Ga0316588_1005250 3300033528 Bacteria 2510
373 Ga0316596_1023746 3300033541 Bacteria 1572
374 Ga0316596_1039709 3300033541 Bacteria 1235
375 Ga0373923_0099501 3300035111 Bacteria 1281
376 Ga0373939_0256780 3300035114 Bacteria 682
377 Ga0373943_0016826 3300035170 Bacteria 3341
378 Ga0316574_0004273 3300035398 Bacteria 7462
379 Ga0316574_0267348 3300035398 Bacteria 1091
380 Ga0373937_0322391 3300036401 Bacteria 1462
381 Ga0373937_0472246 3300036401 Bacteria 1191
382 Ga0316582_0024850 3300036647 Bacteria 3590
383 Ga0316582_0048224 3300036647 Bacteria 2692
384 Ga0316584_0010338 3300036712 Bacteria 6517
385 Ga0316584_0025194 3300036712 Bacteria 4360
386 Ga0373925_0185656 3300037068 Bacteria 1648
387 Ga0395900_0497810 3300037418 Bacteria 1169
388 Ga0395900_1013836 3300037418 Bacteria 750
389 Ga0395898_0404186 3300037466 Bacteria 1302
390 Ga0316581_0065812 3300037588 Bacteria 1113
391 Ga0395901_1652744 3300038443 Bacteria 593
392 Ga0400490_40590 3300038726 Bacteria 7008
393 Ga0400488_62682 3300038741 Bacteria 2177
394 Ga0400483_220832 3300039062 Unclassified 1415
395 Ga0400487_14017 3300039110 Bacteria 10114
396 Ga0436365_0042508 3300039437 Bacteria 41569
397 Ga0436361_0333442 3300039447 Bacteria 1496
398 Ga0436361_0883668 3300039447 Bacteria 1638
399 Ga0436361_0989063 3300039447 Bacteria 4557
400 Ga0439438_003218 3300041405 Bacteria 6678
401 Ga0439438_012978 3300041405 Bacteria 2532
402 Ga0439447_017639 3300041407 Bacteria 1941
403 Ga0439466_0000004 3300041411 Bacteria 462654
404 Ga0439465_0363704 3300041413 Bacteria 548
405 Ga0451795_0594414 3300041456 Bacteria 1103
406 Ga0451802_0235268 3300041460 Bacteria 1307
407 Ga0451807_0974327 3300041486 Bacteria 884
408 Ga0451841_0791043 3300041498 Bacteria 1534
409 Ga0451843_0406932 3300041509 Bacteria 1310
410 Ga0451853_0823009 3300041512 Bacteria 2312
411 Ga0451853_2427319 3300041512 Bacteria 7107
412 Ga0439448_0049540 3300042005 Bacteria 1373
413 Ga0439432_019605 3300042006 Bacteria 2252
414 Ga0439432_027215 3300042006 Bacteria 1868
415 Ga0439450_033216 3300042008 Bacteria 1169
416 Ga0439452_000011 3300042010 Bacteria 428451
417 Ga0439452_000344 3300042010 Bacteria 28832
418 Ga0439452_002524 3300042010 Bacteria 6730
419 Ga0439452_028288 3300042010 Bacteria 1400
420 Ga0439463_001507 3300042016 Bacteria 6145
421 Ga0450902_052006 3300042137 Bacteria 704
422 Ga0450907_000221 3300042146 Bacteria 19992
423 Ga0439458_0012813 3300042157 Bacteria 1884
424 Ga0439459_0026302 3300042438 Bacteria 1155
425 Ga0439464_0001655 3300042439 Bacteria 5323
426 Ga0439464_0010134 3300042439 Bacteria 2488
427 Ga0439460_0067812 3300042461 Bacteria 1100
428 Ga0451577_0000085 3300042876 Bacteria 211141
429 Ga0451577_0003720 3300042876 Bacteria 16669
430 Ga0451577_0089801 3300042876 Bacteria 2742
431 Ga0451577_0117305 3300042876 Bacteria 2384
432 Ga0451577_0129463 3300042876 Bacteria 2264
433 Ga0439440_0042499 3300042993 Bacteria 1112
434 Ga0466981_0000001 3300044669 Bacteria 367980
435 Ga0453683_0000047 3300044673 Bacteria 207763
436 Ga0466966_0074125 3300044684 Bacteria 2128
437 Ga0466963_0047730 3300044694 Bacteria 2827
438 Ga0466964_0169087 3300044706 Bacteria 1028
439 Ga0453684_0000273 3300044712 Bacteria 222658
440 Ga0453684_0000302 3300044712 Bacteria 207763
441 Ga0453684_0012535 3300044712 Bacteria 13956
442 Ga0453684_0173338 3300044712 Bacteria 2540
443 Ga0453684_0431915 3300044712 Bacteria 1469
444 Ga0466970_0704601 3300044765 Bacteria 589
445 Ga0466960_0054641 3300044901 Bacteria 1940
446 Ga0466960_0183222 3300044901 Bacteria 1136
447 Ga0466959_0522741 3300045049 Bacteria 801
448 Ga0451576_0000006 3300045051 Bacteria 949698
449 Ga0451576_0000116 3300045051 Bacteria 207763
450 Ga0451576_0000652 3300045051 Bacteria 71674
451 Ga0451576_0000868 3300045051 Bacteria 58132
452 Ga0451576_1271666 3300045051 Bacteria 767
453 Ga0451576_1905486 3300045051 Bacteria 613
454 Ga0466967_0170697 3300045976 Bacteria 2046
455 Ga0466967_0214795 3300045976 Bacteria 1825
456 Ga0466967_0499940 3300045976 Bacteria 1193
457 Ga0466967_1509989 3300045976 Bacteria 669
458 Ga0495603_0000258 3300046455 Bacteria 27900
459 Ga0495591_013966 3300046458 Bacteria 2910
460 Ga0495641_0274632 3300046461 Bacteria 758
461 Ga0495650_0000059 3300046471 Bacteria 296253
462 Ga0495596_0230626 3300046500 Bacteria 719
463 Ga0495643_0075647 3300046522 Bacteria 1761
464 Ga0495648_0006032 3300046524 Bacteria 9948
465 Ga0495667_0000047 3300046559 Bacteria 117718
466 Ga0495668_0645974 3300046616 Bacteria 585
467 Ga0495660_0008440 3300046810 Bacteria 6032
468 Ga0495672_0000025 3300047320 Bacteria 365425
469 Ga0495680_0003506 3300047322 Bacteria 15387
470 Ga0495679_002550 3300047446 Bacteria 9194
471 Ga0495684_0127354 3300047471 Bacteria 1915
472 Ga0496100_0046797 3300048903 Bacteria 2784
473 Ga0496100_0220279 3300048903 Bacteria 1392
474 Ga0496100_0306909 3300048903 Bacteria 1189
475 Ga0496100_1008716 3300048903 Bacteria 655
476 Ga0496101_0132458 3300048904 Bacteria 1894
477 Ga0496101_0672143 3300048904 Bacteria 818
478 Ga0496101_1058770 3300048904 Bacteria 637
479 Ga0496102_0473250 3300048905 Bacteria 1174
480 Ga0496102_0800989 3300048905 Bacteria 864
481 Ga0496103_0333341 3300048906 Bacteria 976
482 Ga0496104_0000680 3300048907 Bacteria 29268
483 Ga0496104_0811525 3300048907 Unclassified 842
484 Ga0496105_0006095 3300048908 Bacteria 9228
485 Ga0496105_0009823 3300048908 Bacteria 7498
486 Ga0496107_0313840 3300048910 Bacteria 1167
487 Ga0496108_0050129 3300048911 Bacteria 3494
488 Ga0496108_0215378 3300048911 Bacteria 1668
489 Ga0496109_0046553 3300048912 Bacteria 3940
490 Ga0496109_1859070 3300048912 Bacteria 535
491 Ga0496110_0453927 3300048913 Bacteria 1168
492 Ga0496110_0460644 3300048913 Bacteria 1159
493 Ga0496110_1058572 3300048913 Archaea 719
494 Ga0496110_1531880 3300048913 Bacteria 577
495 Ga0496110_1812624 3300048913 Bacteria 520
496 Ga0496113_0462794 3300048916 Bacteria 1019
497 Ga0496113_0559873 3300048916 Bacteria 917
498 Ga0496114_0004317 3300048917 Bacteria 10999
499 Ga0496114_0007017 3300048917 Bacteria 8886
500 Ga0496115_1344821 3300048918 Unclassified 530
501 Ga0496116_0002364 3300048919 Bacteria 19954
502 Ga0496116_0067587 3300048919 Bacteria 2281
503 Ga0496116_0105035 3300048919 Bacteria 1676
504 Ga0496117_0000168 3300048920 Bacteria 137886
505 Ga0496118_0000075 3300048921 Bacteria 196228
506 Ga0496118_0000304 3300048921 Bacteria 85277
507 Ga0496118_0000996 3300048921 Bacteria 44151
508 Ga0496119_0000281 3300048922 Bacteria 71482
509 Ga0496119_0017781 3300048922 Bacteria 5329
510 Ga0496120_0000363 3300048923 Bacteria 73708
511 Ga0496120_0013938 3300048923 Bacteria 5379
512 Ga0496120_0147265 3300048923 Bacteria 1187
513 Ga0496121_0000057 3300048924 Bacteria 294291
514 Ga0496121_0020822 3300048924 Bacteria 6462
515 Ga0496121_0669107 3300048924 Bacteria 629
516 Ga0496122_0002021 3300048925 Bacteria 30149
517 Ga0496122_0002096 3300048925 Bacteria 29548
518 Ga0496122_0043786 3300048925 Bacteria 3502
519 Ga0496122_0069982 3300048925 Bacteria 2510
520 Ga0496123_0000605 3300048926 Bacteria 60923
521 Ga0496123_0002325 3300048926 Bacteria 23867
522 Ga0496123_0031853 3300048926 Bacteria 3827
523 Ga0496123_0472030 3300048926 Bacteria 554
524 Ga0496124_0001851 3300048927 Bacteria 29214
525 Ga0496124_0133469 3300048927 Bacteria 1969
526 Ga0496124_0177748 3300048927 Bacteria 1641
527 Ga0496125_0000081 3300048928 Bacteria 228069
528 Ga0496125_0003562 3300048928 Bacteria 18755
529 Ga0496125_0007362 3300048928 Bacteria 11720
530 Ga0496125_0022828 3300048928 Bacteria 5797
531 Ga0496126_0001662 3300048929 Bacteria 33392
532 Ga0496126_0005302 3300048929 Bacteria 14797
533 Ga0496126_0155487 3300048929 Bacteria 1957
534 Ga0496126_0394059 3300048929 Bacteria 1124
535 Ga0496126_0408706 3300048929 Bacteria 1099
536 Ga0501031_0004039 3300049568 Bacteria 9468
537 Ga0501031_0008281 3300049568 Bacteria 6764
538 Ga0501031_0058685 3300049568 Bacteria 2508
539 Ga0501031_0110192 3300049568 Bacteria 1797
540 Ga0501032_0001373 3300049569 Bacteria 19318
541 Ga0501032_0007089 3300049569 Bacteria 8214
542 Ga0501032_0059099 3300049569 Bacteria 2573
543 Ga0501033_0000949 3300049570 Bacteria 26319
544 Ga0501033_0001864 3300049570 Bacteria 18331
545 Ga0501033_0059974 3300049570 Bacteria 2808
546 Ga0501033_0699024 3300049570 Bacteria 690
547 Ga0501034_0024559 3300049571 Bacteria 6130
548 Ga0501034_0047437 3300049571 Bacteria 4337
549 Ga0501034_0173483 3300049571 Bacteria 2123
550 Ga0501034_0541825 3300049571 Bacteria 1074
551 Ga0501036_0000382 3300049572 Bacteria 31346
552 Ga0501036_0001661 3300049572 Bacteria 17238
553 Ga0501036_0035605 3300049572 Bacteria 4211
554 Ga0501037_0000474 3300049573 Bacteria 32555
555 Ga0501037_0051116 3300049573 Bacteria 3023
556 Ga0501037_0193442 3300049573 Bacteria 1440
557 Ga0501037_0358177 3300049573 Bacteria 1005
558 Ga0501037_0711826 3300049573 Bacteria 667
559 Ga0501038_0008209 3300049574 Bacteria 9604
560 Ga0501038_0019437 3300049574 Bacteria 6122
561 Ga0501038_0023864 3300049574 Bacteria 5461
562 Ga0501038_0076883 3300049574 Bacteria 2819
563 Ga0501038_0130565 3300049574 Bacteria 2063
564 Ga0501038_0137944 3300049574 Bacteria 1997
565 Ga0501038_0336957 3300049574 Bacteria 1177
566 Ga0501039_0002238 3300049575 Bacteria 14325
567 Ga0501039_0037165 3300049575 Bacteria 3758
568 Ga0501039_0043176 3300049575 Bacteria 3483
569 Ga0501039_0044783 3300049575 Bacteria 3418
570 Ga0501040_0003365 3300049576 Bacteria 10322
571 Ga0501040_0076944 3300049576 Bacteria 2308
572 Ga0501041_1016395 3300049577 Bacteria 533
573 Ga0501042_0084446 3300049578 Bacteria 2276
574 Ga0501042_0825969 3300049578 Bacteria 675
575 Ga0501043_0007578 3300049579 Bacteria 8603
576 Ga0501043_0008971 3300049579 Bacteria 7869
577 Ga0501043_0083051 3300049579 Bacteria 2518
578 Ga0501046_0002898 3300049580 Bacteria 15906
579 Ga0501046_0011564 3300049580 Bacteria 7548
580 Ga0501046_0700086 3300049580 Bacteria 714
581 Ga0501047_0005810 3300049581 Bacteria 11613
582 Ga0501047_0108224 3300049581 Bacteria 2662
583 Ga0501048_0059590 3300049582 Bacteria 2705
584 Ga0501048_0400031 3300049582 Bacteria 982
585 Ga0501068_0002905 3300049584 Bacteria 9121
586 Ga0501068_0172686 3300049584 Bacteria 1365
587 Ga0501070_0429924 3300049586 Bacteria 1066
588 Ga0501071_0472784 3300049587 Bacteria 960
589 Ga0501071_0757423 3300049587 Bacteria 748
590 Ga0501072_0034667 3300049588 Bacteria 3956
591 Ga0501073_0642907 3300049589 Bacteria 732
592 Ga0501074_0313318 3300049590 Bacteria 1115
593 Ga0501075_0444772 3300049591 Bacteria 988
594 Ga0501076_0630063 3300049592 Bacteria 885
595 Ga0501077_0128707 3300049593 Bacteria 1605
596 Ga0501201_031051 3300049651 Bacteria 609
597 Ga0501079_0183796 3300049741 Bacteria 1632
598 Ga0501080_1065275 3300049742 Bacteria 699
599 Ga0501080_1151802 3300049742 Bacteria 668
600 Ga0501035_0001429 3300049822 Bacteria 24468
601 Ga0501035_0001968 3300049822 Bacteria 20568
602 Ga0501035_0009680 3300049822 Bacteria 8963
603 Ga0501035_0076193 3300049822 Bacteria 2966
604 Ga0501035_0651072 3300049822 Bacteria 854
605 Ga0501044_0000111 3300049823 Bacteria 100080
606 Ga0501044_0018048 3300049823 Bacteria 7567
607 Ga0501044_0025482 3300049823 Bacteria 6269
608 Ga0501044_0053451 3300049823 Bacteria 4155
609 Ga0501044_0259856 3300049823 Bacteria 1675
610 Ga0501044_0278379 3300049823 Bacteria 1607
611 Ga0501045_0003419 3300049824 Bacteria 10863
612 Ga0501045_0271813 3300049824 Bacteria 1262
613 nmdc:mga00v17_6047_c1 3300050491 Bacteria 6404
614 nmdc:mga0yw44_478990_c1 3300050492 Bacteria 844
615 nmdc:mga0yw44_651572_c1 3300050492 Bacteria 716
616 nmdc:mga0k408_4578_c1 3300050493 Bacteria 7341
617 nmdc:mga05p37_1595478_c1 3300050507 Bacteria 643
618 nmdc:mga05p37_899665_c1 3300050507 Bacteria 954
619 nmdc:mga05p37_907138_c1 3300050507 Bacteria 949
620 nmdc:mga09592_404646_c1 3300050508 Bacteria 1179
621 nmdc:mga0qj67_405998_c1 3300050509 Bacteria 1099
622 nmdc:mga0qj67_686457_c1 3300050509 Bacteria 815
623 nmdc:mga06r32_1649980_c1 3300050510 Bacteria 579
624 nmdc:mga06r32_970495_c1 3300050510 Bacteria 803
625 nmdc:mga08y16_342400_c1 3300050511 Bacteria 1537
626 nmdc:mga08y16_775092_c1 3300050511 Bacteria 954
627 Ga0500604_0143311 3300053151 Bacteria 809
628 Ga0500633_0251248 3300053160 Bacteria 657
629 Ga0501084_0324607 3300054114 Bacteria 1300
630 Ga0587067_160100 3300059640 Bacteria 572

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0704601 Ga0466970_0704601_216_536 103
2 3300037418 Ga0395900_1013836 Ga0395900_1013836_233_619 107
3 3300005549 Ga0070704_101716838 Ga0070704_1017168381 112
4 3300005467 Ga0070706_100788510 Ga0070706_1007885102 115
5 3300005471 Ga0070698_100589616 Ga0070698_1005896162 115
6 3300009147 Ga0114129_10432163 Ga0114129_104321632 115
7 3300035111 Ga0373923_0099501 Ga0373923_0099501_630_995 121
8 3300036401 Ga0373937_0472246 Ga0373937_0472246_745_1110 121
9 3300014969 Ga0157376_10001159 Ga0157376_100011595 122
10 iso_pu_bacteria 2734482258 2735816257 122
11 iso_pu_bacteria 2511231020 2511349542 123
12 iso_pu_bacteria 2511231021 2511359274 123
13 iso_pu_bacteria 2904550169 2904551378 123
14 iso_pu_bacteria 2990196909 2990197159 123
15 3300005844 Ga0068862_102067149 Ga0068862_1020671492 124
16 3300005981 Ga0081538_10153090 Ga0081538_101530902 124
17 3300006038 Ga0075365_10202724 Ga0075365_102027242 124
18 3300006038 Ga0075365_10534960 Ga0075365_105349602 124
19 3300009147 Ga0114129_11947353 Ga0114129_119473531 124
20 3300025924 Ga0207694_11556586 Ga0207694_115565861 124
21 3300031901 Ga0307406_10617996 Ga0307406_106179962 124
22 3300049587 Ga0501071_0472784 Ga0501071_0472784_525_908 124
23 3300050492 nmdc:mga0yw44_478990_c1 nmdc:mga0yw44_478990_c1_73_456 124
24 3300050492 nmdc:mga0yw44_651572_c1 nmdc:mga0yw44_651572_c1_20_403 124
25 3300050507 nmdc:mga05p37_907138_c1 nmdc:mga05p37_907138_c1_22_405 124
26 3300050510 nmdc:mga06r32_970495_c1 nmdc:mga06r32_970495_c1_25_417 124
27 iso_pu_bacteria 2844528606 2844530260 124
28 iso_pu_bacteria 2865014394 2865016384 124
29 iso_pu_bacteria 2919534386 2919535366 124
30 iso_pu_bacteria 2945951305 2945951685 124
31 3300001990 JGI24737J22298_10132570 JGI24737J22298_101325702 125
32 3300001990 JGI24737J22298_10249692 JGI24737J22298_102496922 125
33 3300005328 Ga0070676_10989659 Ga0070676_109896591 125
34 3300005329 Ga0070683_100434434 Ga0070683_1004344341 125
35 3300005329 Ga0070683_100506196 Ga0070683_1005061962 125
36 3300005331 Ga0070670_100111084 Ga0070670_1001110842 125
37 3300005339 Ga0070660_100178743 Ga0070660_1001787432 125
38 3300005339 Ga0070660_100180346 Ga0070660_1001803462 125
39 3300005345 Ga0070692_10149802 Ga0070692_101498022 125
40 3300005345 Ga0070692_10525721 Ga0070692_105257212 125
41 3300005356 Ga0070674_100096087 Ga0070674_1000960872 125
42 3300005366 Ga0070659_100213804 Ga0070659_1002138042 125
43 3300005366 Ga0070659_100294518 Ga0070659_1002945182 125
44 3300005366 Ga0070659_100349134 Ga0070659_1003491341 125
45 3300005441 Ga0070700_100211893 Ga0070700_1002118932 125
46 3300005456 Ga0070678_100649993 Ga0070678_1006499932 125
47 3300005459 Ga0068867_100094504 Ga0068867_1000945042 125
48 3300005535 Ga0070684_100156192 Ga0070684_1001561922 125
49 3300005539 Ga0068853_102215244 Ga0068853_1022152441 125
50 3300005548 Ga0070665_100528192 Ga0070665_1005281922 125
51 3300005549 Ga0070704_101118305 Ga0070704_1011183051 125
52 3300005564 Ga0070664_100677286 Ga0070664_1006772862 125
53 3300005577 Ga0068857_100552569 Ga0068857_1005525692 125
54 3300005578 Ga0068854_100367615 Ga0068854_1003676152 125
55 3300005614 Ga0068856_101011039 Ga0068856_1010110392 125
56 3300005615 Ga0070702_100421497 Ga0070702_1004214972 125
57 3300005616 Ga0068852_100309410 Ga0068852_1003094102 125
58 3300005616 Ga0068852_100802136 Ga0068852_1008021362 125
59 3300005616 Ga0068852_101740695 Ga0068852_1017406952 125
60 3300005617 Ga0068859_100654263 Ga0068859_1006542632 125
61 3300005618 Ga0068864_100348964 Ga0068864_1003489642 125
62 3300005718 Ga0068866_10058288 Ga0068866_100582882 125
63 3300005718 Ga0068866_10147682 Ga0068866_101476822 125
64 3300005719 Ga0068861_100148538 Ga0068861_1001485382 125
65 3300005719 Ga0068861_100751999 Ga0068861_1007519992 125
66 3300005840 Ga0068870_10068796 Ga0068870_100687961 125
67 3300005844 Ga0068862_101169748 Ga0068862_1011697482 125
68 3300006038 Ga0075365_10568514 Ga0075365_105685142 125
69 3300006844 Ga0075428_100520963 Ga0075428_1005209632 125
70 3300006844 Ga0075428_100946318 Ga0075428_1009463182 125
71 3300006847 Ga0075431_101912686 Ga0075431_1019126862 125
72 3300006881 Ga0068865_100498683 Ga0068865_1004986832 125
73 3300006931 Ga0097620_100654301 Ga0097620_1006543012 125
74 3300009094 Ga0111539_10980384 Ga0111539_109803842 125
75 3300009098 Ga0105245_10228854 Ga0105245_102288542 125
76 3300009147 Ga0114129_11562474 Ga0114129_115624742 125
77 3300009147 Ga0114129_11836492 Ga0114129_118364921 125
78 3300009148 Ga0105243_11058440 Ga0105243_110584402 125
79 3300009148 Ga0105243_11219786 Ga0105243_112197862 125
80 3300009176 Ga0105242_10890407 Ga0105242_108904072 125
81 3300009176 Ga0105242_11471207 Ga0105242_114712072 125
82 3300009177 Ga0105248_10596542 Ga0105248_105965422 125
83 3300009177 Ga0105248_12053276 Ga0105248_120532762 125
84 3300009553 Ga0105249_10422390 Ga0105249_104223902 125
85 3300010375 Ga0105239_12274270 Ga0105239_122742702 125
86 3300013102 Ga0157371_10749179 Ga0157371_107491792 125
87 3300013104 Ga0157370_12048284 Ga0157370_120482841 125
88 3300013297 Ga0157378_10446043 Ga0157378_104460432 125
89 3300013307 Ga0157372_10729583 Ga0157372_107295832 125
90 3300013308 Ga0157375_11311746 Ga0157375_113117462 125
91 3300013308 Ga0157375_12523485 Ga0157375_125234852 125
92 3300014325 Ga0163163_10332564 Ga0163163_103325642 125
93 3300014326 Ga0157380_10159165 Ga0157380_101591652 125
94 3300014326 Ga0157380_11637400 Ga0157380_116374001 125
95 3300014745 Ga0157377_10126535 Ga0157377_101265352 125
96 3300014745 Ga0157377_10184610 Ga0157377_101846102 125
97 3300014745 Ga0157377_11337333 Ga0157377_113373332 125
98 3300017792 Ga0163161_10430225 Ga0163161_104302252 125
99 3300017792 Ga0163161_10433543 Ga0163161_104335432 125
100 3300025302 Ga0207426_1027655 Ga0207426_10276554 125
101 3300025893 Ga0207682_10204939 Ga0207682_102049392 125
102 3300025898 Ga0207692_11197741 Ga0207692_111977411 125
103 3300025899 Ga0207642_10109118 Ga0207642_101091182 125
104 3300025901 Ga0207688_10046036 Ga0207688_100460363 125
105 3300025901 Ga0207688_10187403 Ga0207688_101874032 125
106 3300025901 Ga0207688_10369966 Ga0207688_103699662 125
107 3300025908 Ga0207643_10053083 Ga0207643_100530832 125
108 3300025919 Ga0207657_10183351 Ga0207657_101833512 125
109 3300025925 Ga0207650_10673351 Ga0207650_106733512 125
110 3300025926 Ga0207659_10453149 Ga0207659_104531492 125
111 3300025927 Ga0207687_10245907 Ga0207687_102459072 125
112 3300025932 Ga0207690_10088511 Ga0207690_100885113 125
113 3300025933 Ga0207706_10199910 Ga0207706_101999102 125
114 3300025933 Ga0207706_10537879 Ga0207706_105378792 125
115 3300025935 Ga0207709_10133988 Ga0207709_101339882 125
116 3300025937 Ga0207669_10138728 Ga0207669_101387282 125
117 3300025937 Ga0207669_10360127 Ga0207669_103601272 125
118 3300025938 Ga0207704_11106452 Ga0207704_111064521 125
119 3300025938 Ga0207704_11111826 Ga0207704_111118262 125
120 3300025940 Ga0207691_10468239 Ga0207691_104682392 125
121 3300025940 Ga0207691_11475306 Ga0207691_114753061 125
122 3300025942 Ga0207689_11110740 Ga0207689_111107402 125
123 3300025944 Ga0207661_10990869 Ga0207661_109908692 125
124 3300025944 Ga0207661_11486073 Ga0207661_114860732 125
125 3300025945 Ga0207679_10642409 Ga0207679_106424092 125
126 3300025961 Ga0207712_10296010 Ga0207712_102960102 125
127 3300025972 Ga0207668_10221869 Ga0207668_102218692 125
128 3300025972 Ga0207668_11223816 Ga0207668_112238162 125
129 3300026023 Ga0207677_10268898 Ga0207677_102688982 125
130 3300026041 Ga0207639_10809457 Ga0207639_108094572 125
131 3300026041 Ga0207639_11197370 Ga0207639_111973702 125
132 3300026067 Ga0207678_10992686 Ga0207678_109926862 125
133 3300026075 Ga0207708_10008968 Ga0207708_100089685 125
134 3300026075 Ga0207708_10185692 Ga0207708_101856922 125
135 3300026089 Ga0207648_10085237 Ga0207648_100852372 125
136 3300026089 Ga0207648_10867424 Ga0207648_108674241 125
137 3300026095 Ga0207676_10258186 Ga0207676_102581862 125
138 3300026095 Ga0207676_10452977 Ga0207676_104529772 125
139 3300026116 Ga0207674_10370381 Ga0207674_103703812 125
140 3300026118 Ga0207675_100068996 Ga0207675_1000689962 125
141 3300026121 Ga0207683_10063390 Ga0207683_100633902 125
142 3300026142 Ga0207698_10513908 Ga0207698_105139082 125
143 3300026142 Ga0207698_11076101 Ga0207698_110761011 125
144 3300027907 Ga0207428_10411638 Ga0207428_104116382 125
145 3300028379 Ga0268266_11374800 Ga0268266_113748002 125
146 3300031548 Ga0307408_101130955 Ga0307408_1011309551 125
147 3300031731 Ga0307405_10172546 Ga0307405_101725461 125
148 3300031852 Ga0307410_10305007 Ga0307410_103050072 125
149 3300031852 Ga0307410_11239125 Ga0307410_112391252 125
150 3300031901 Ga0307406_10311375 Ga0307406_103113752 125
151 3300031901 Ga0307406_10443369 Ga0307406_104433692 125
152 3300031995 Ga0307409_100318026 Ga0307409_1003180262 125
153 3300031995 Ga0307409_100337262 Ga0307409_1003372622 125
154 3300031995 Ga0307409_100835000 Ga0307409_1008350002 125
155 3300031995 Ga0307409_100867404 Ga0307409_1008674042 125
156 3300031995 Ga0307409_101252014 Ga0307409_1012520141 125
157 3300032002 Ga0307416_100355281 Ga0307416_1003552812 125
158 3300032002 Ga0307416_100590156 Ga0307416_1005901562 125
159 3300032002 Ga0307416_100761242 Ga0307416_1007612422 125
160 3300032004 Ga0307414_10520077 Ga0307414_105200772 125
161 3300032005 Ga0307411_10131892 Ga0307411_101318922 125
162 3300032126 Ga0307415_100256525 Ga0307415_1002565252 125
163 3300032126 Ga0307415_100375335 Ga0307415_1003753352 125
164 3300032126 Ga0307415_101812081 Ga0307415_1018120812 125
165 3300037466 Ga0395898_0404186 Ga0395898_0404186_556_942 125
166 3300038443 Ga0395901_1652744 Ga0395901_1652744_26_412 125
167 3300041413 Ga0439465_0363704 Ga0439465_0363704_118_504 125
168 3300041456 Ga0451795_0594414 Ga0451795_0594414_242_628 125
169 3300041460 Ga0451802_0235268 Ga0451802_0235268_391_777 125
170 3300041498 Ga0451841_0791043 Ga0451841_0791043_187_573 125
171 3300041509 Ga0451843_0406932 Ga0451843_0406932_540_926 125
172 3300041512 Ga0451853_0823009 Ga0451853_0823009_392_778 125
173 3300042005 Ga0439448_0049540 Ga0439448_0049540_720_1103 125
174 3300042008 Ga0439450_033216 Ga0439450_033216_647_1030 125
175 3300042157 Ga0439458_0012813 Ga0439458_0012813_295_678 125
176 3300042438 Ga0439459_0026302 Ga0439459_0026302_459_842 125
177 3300042439 Ga0439464_0010134 Ga0439464_0010134_1043_1426 125
178 3300042461 Ga0439460_0067812 Ga0439460_0067812_419_802 125
179 3300042993 Ga0439440_0042499 Ga0439440_0042499_650_1033 125
180 3300044684 Ga0466966_0074125 Ga0466966_0074125_405_791 125
181 3300044706 Ga0466964_0169087 Ga0466964_0169087_403_789 125
182 3300044901 Ga0466960_0054641 Ga0466960_0054641_251_637 125
183 3300044901 Ga0466960_0183222 Ga0466960_0183222_341_727 125
184 3300045049 Ga0466959_0522741 Ga0466959_0522741_118_504 125
185 3300045976 Ga0466967_0170697 Ga0466967_0170697_156_542 125
186 3300045976 Ga0466967_0499940 Ga0466967_0499940_49_435 125
187 3300045976 Ga0466967_1509989 Ga0466967_1509989_57_443 125
188 3300046461 Ga0495641_0274632 Ga0495641_0274632_299_685 125
189 3300046616 Ga0495668_0645974 Ga0495668_0645974_85_471 125
190 3300048904 Ga0496101_0672143 Ga0496101_0672143_372_758 125
191 3300048905 Ga0496102_0473250 Ga0496102_0473250_352_735 125
192 3300048905 Ga0496102_0800989 Ga0496102_0800989_316_708 125
193 3300048906 Ga0496103_0333341 Ga0496103_0333341_213_599 125
194 3300048913 Ga0496110_1058572 Ga0496110_1058572_215_598 125
195 3300048913 Ga0496110_1531880 Ga0496110_1531880_87_473 125
196 3300048913 Ga0496110_1812624 Ga0496110_1812624_93_479 125
197 3300049568 Ga0501031_0058685 Ga0501031_0058685_35_421 125
198 3300049570 Ga0501033_0699024 Ga0501033_0699024_112_498 125
199 3300049571 Ga0501034_0173483 Ga0501034_0173483_1665_2051 125
200 3300049575 Ga0501039_0037165 Ga0501039_0037165_3270_3656 125
201 3300049576 Ga0501040_0076944 Ga0501040_0076944_1324_1710 125
202 3300049577 Ga0501041_1016395 Ga0501041_1016395_56_442 125
203 3300049578 Ga0501042_0825969 Ga0501042_0825969_192_578 125
204 3300049582 Ga0501048_0400031 Ga0501048_0400031_479_865 125
205 3300049588 Ga0501072_0034667 Ga0501072_0034667_41_427 125
206 3300049592 Ga0501076_0630063 Ga0501076_0630063_406_792 125
207 3300050507 nmdc:mga05p37_1595478_c1 nmdc:mga05p37_1595478_c1_159_545 125
208 3300050508 nmdc:mga09592_404646_c1 nmdc:mga09592_404646_c1_397_780 125
209 3300050509 nmdc:mga0qj67_686457_c1 nmdc:mga0qj67_686457_c1_367_750 125
210 3300050510 nmdc:mga06r32_1649980_c1 nmdc:mga06r32_1649980_c1_98_484 125
211 3300050511 nmdc:mga08y16_342400_c1 nmdc:mga08y16_342400_c1_710_1093 125
212 3300053151 Ga0500604_0143311 Ga0500604_0143311_20_406 125
213 3300053160 Ga0500633_0251248 Ga0500633_0251248_130_516 125
214 3300059640 Ga0587067_160100 Ga0587067_160100_25_411 125
215 iso_pu_bacteria 2547132416 2548648618 125
216 iso_pu_bacteria 2554235234 2555258644 125
217 iso_pu_bacteria 2599185169 2599410062 125
218 iso_pu_bacteria 2600255254 2601523257 125
219 iso_pu_bacteria 2600255255 2601528416 125
220 iso_pu_bacteria 2600255280 2601615249 125
221 iso_pu_bacteria 2600255281 2601619825 125
222 iso_pu_bacteria 2600255287 2601643768 125
223 iso_pu_bacteria 2600255288 2601648230 125
224 iso_pu_bacteria 2600255289 2601653301 125
225 iso_pu_bacteria 2600255290 2601658578 125
226 iso_pu_bacteria 2600255291 2601663593 125
227 iso_pu_bacteria 2600255298 2601696526 125
228 iso_pu_bacteria 2600255299 2601701225 125
229 iso_pu_bacteria 2600255300 2601705956 125
230 iso_pu_bacteria 2600255301 2601711541 125
231 iso_pu_bacteria 2600255302 2601716559 125
232 iso_pu_bacteria 2600255303 2601721550 125
233 iso_pu_bacteria 2600255304 2601726965 125
234 iso_pu_bacteria 2600255305 2601731505 125
235 iso_pu_bacteria 2600255306 2601736517 125
236 iso_pu_bacteria 2600255307 2601740500 125
237 iso_pu_bacteria 2600255309 2601751437 125
238 iso_pu_bacteria 2600255392 2602018703 125
239 iso_pu_bacteria 2602042047 2603644054 125
240 iso_pu_bacteria 2602042052 2603660980 125
241 iso_pu_bacteria 2602042053 2603666254 125
242 iso_pu_bacteria 2602042066 2603700740 125
243 iso_pu_bacteria 2602042067 2603704574 125
244 iso_pu_bacteria 2602042103 2603838899 125
245 iso_pu_bacteria 2602042104 2603843841 125
246 iso_pu_bacteria 2602042105 2603849055 125
247 iso_pu_bacteria 2602042106 2603854126 125
248 iso_pu_bacteria 2602042109 2603865413 125
249 iso_pu_bacteria 2602042110 2603872180 125
250 iso_pu_bacteria 2602042111 2603877067 125
251 iso_pu_bacteria 2603880178 2606049362 125
252 iso_pu_bacteria 2603880184 2606070687 125
253 iso_pu_bacteria 2603880202 2606147045 125
254 iso_pu_bacteria 2603880211 2606176771 125
255 iso_pu_bacteria 2609459761 2609911750 125
256 iso_pu_bacteria 2636415599 2637223389 125
257 iso_pu_bacteria 2667528172 2671104374 125
258 iso_pu_bacteria 2671180115 2671588510 125
259 iso_pu_bacteria 2675903046 2676408432 125
260 iso_pu_bacteria 2681812866 2681997834 125
261 iso_pu_bacteria 2681812869 2682007934 125
262 iso_pu_bacteria 2751185917 2753857468 125
263 iso_pu_bacteria 2765235842 2765590560 125
264 iso_pu_bacteria 2775506706 2775540096 125
265 iso_pu_bacteria 2775507074 2777019705 125
266 iso_pu_bacteria 2791355275 2793404152 125
267 iso_pu_bacteria 2821118458 2821120389 125
268 iso_pu_bacteria 2823373977 2823376224 125
269 iso_pu_bacteria 2844425489 2844428901 125
270 iso_pu_bacteria 2884086401 2884087271 125
271 iso_pu_bacteria 2904513164 2904516666 125
272 iso_pu_bacteria 2919108558 2919110512 125
273 iso_pu_bacteria 2919497567 2919497867 125
274 iso_pu_bacteria 2923634449 2923636436 125
275 iso_pu_bacteria 2927833300 2927837081 125
276 iso_pu_bacteria 2937539931 2937541025 125
277 iso_pu_bacteria 2939573065 2939576293 125
278 iso_pu_bacteria 2939607340 2939610262 125
279 iso_pu_bacteria 2945874760 2945876156 125
280 iso_pu_bacteria 2969079654 2969080418 125
281 iso_pu_bacteria 2971820967 2971821785 125
282 iso_pu_bacteria 2974310843 2974315224 125
283 iso_pu_bacteria 2984559226 2984562858 125
284 iso_pu_bacteria 2984595703 2984600915 125
285 iso_pu_bacteria 3000376612 3000377768 125
286 iso_pu_bacteria 8018221730 8018225418 125
287 iso_pu_bacteria 8018405270 8018406086 125
288 iso_pu_bacteria 8055087960 8055089826 125
289 iso_pu_bacteria 8055092621 8055097214 125
290 iso_pu_bacteria 8055097453 8055098068 125
291 3300005439 Ga0070711_100040404 Ga0070711_1000404043 126
292 3300026121 Ga0207683_11905155 Ga0207683_119051552 126
293 3300027614 Ga0209970_1118694 Ga0209970_11186941 126
294 3300031247 Ga0265340_10406738 Ga0265340_104067381 126
295 3300031727 Ga0316576_11103248 Ga0316576_111032482 126
296 3300031731 Ga0307405_12037849 Ga0307405_120378492 126
297 3300032126 Ga0307415_100017705 Ga0307415_1000177053 126
298 3300033528 Ga0316588_1002158 Ga0316588_10021582 126
299 3300036401 Ga0373937_0322391 Ga0373937_0322391_829_1227 126
300 3300049593 Ga0501077_0128707 Ga0501077_0128707_633_1016 126
301 3300050507 nmdc:mga05p37_899665_c1 nmdc:mga05p37_899665_c1_165_554 126
302 3300003349 JGI26129J50193_1009732 JGI26129J50193_10097322 127
303 3300005328 Ga0070676_10637699 Ga0070676_106376992 127
304 3300005356 Ga0070674_101547295 Ga0070674_1015472951 127
305 3300005365 Ga0070688_100779640 Ga0070688_1007796402 127
306 3300005366 Ga0070659_100259143 Ga0070659_1002591432 127
307 3300005366 Ga0070659_101024490 Ga0070659_1010244902 127
308 3300005435 Ga0070714_100029705 Ga0070714_1000297052 127
309 3300005439 Ga0070711_101406719 Ga0070711_1014067191 127
310 3300005457 Ga0070662_100737629 Ga0070662_1007376291 127
311 3300005458 Ga0070681_10679253 Ga0070681_106792531 127
312 3300005459 Ga0068867_100557801 Ga0068867_1005578012 127
313 3300005530 Ga0070679_100535681 Ga0070679_1005356812 127
314 3300005536 Ga0070697_100067397 Ga0070697_1000673972 127
315 3300005539 Ga0068853_102129852 Ga0068853_1021298521 127
316 3300005614 Ga0068856_100865745 Ga0068856_1008657452 127
317 3300005719 Ga0068861_100870025 Ga0068861_1008700251 127
318 3300005840 Ga0068870_10113589 Ga0068870_101135892 127
319 3300006237 Ga0097621_101487504 Ga0097621_1014875041 127
320 3300009093 Ga0105240_10044693 Ga0105240_100446933 127
321 3300009094 Ga0111539_11394265 Ga0111539_113942652 127
322 3300009094 Ga0111539_12373636 Ga0111539_123736362 127
323 3300009098 Ga0105245_10369589 Ga0105245_103695893 127
324 3300009101 Ga0105247_10324318 Ga0105247_103243182 127
325 3300009176 Ga0105242_13273943 Ga0105242_132739431 127
326 3300009545 Ga0105237_10300312 Ga0105237_103003122 127
327 3300009551 Ga0105238_10451230 Ga0105238_104512302 127
328 3300009553 Ga0105249_11551703 Ga0105249_115517032 127
329 3300010375 Ga0105239_11620257 Ga0105239_116202572 127
330 3300010375 Ga0105239_12144592 Ga0105239_121445921 127
331 3300011119 Ga0105246_10140776 Ga0105246_101407762 127
332 3300013100 Ga0157373_10031197 Ga0157373_100311972 127
333 3300013104 Ga0157370_10003046 Ga0157370_100030467 127
334 3300013296 Ga0157374_10274843 Ga0157374_102748432 127
335 3300013296 Ga0157374_11789826 Ga0157374_117898262 127
336 3300014969 Ga0157376_10119524 Ga0157376_101195242 127
337 3300014969 Ga0157376_10637206 Ga0157376_106372062 127
338 3300017792 Ga0163161_10125620 Ga0163161_101256202 127
339 3300025907 Ga0207645_10388259 Ga0207645_103882591 127
340 3300025913 Ga0207695_10200142 Ga0207695_102001422 127
341 3300025914 Ga0207671_10357320 Ga0207671_103573202 127
342 3300025917 Ga0207660_11334596 Ga0207660_113345961 127
343 3300025921 Ga0207652_10633734 Ga0207652_106337341 127
344 3300025924 Ga0207694_10080587 Ga0207694_100805872 127
345 3300025933 Ga0207706_10055572 Ga0207706_100555725 127
346 3300025933 Ga0207706_10661425 Ga0207706_106614252 127
347 3300025933 Ga0207706_10816548 Ga0207706_108165482 127
348 3300025937 Ga0207669_10070251 Ga0207669_100702513 127
349 3300026023 Ga0207677_10603165 Ga0207677_106031652 127
350 3300026089 Ga0207648_10826533 Ga0207648_108265332 127
351 3300027378 Ga0209981_1013521 Ga0209981_10135212 127
352 3300027462 Ga0210000_1011901 Ga0210000_10119012 127
353 3300027471 Ga0209995_1020402 Ga0209995_10204021 127
354 3300027526 Ga0209968_1004519 Ga0209968_10045191 127
355 3300027614 Ga0209970_1035438 Ga0209970_10354382 127
356 3300027617 Ga0210002_1052775 Ga0210002_10527751 127
357 3300027682 Ga0209971_1010608 Ga0209971_10106083 127
358 3300027717 Ga0209998_10004283 Ga0209998_100042832 127
359 3300027717 Ga0209998_10092432 Ga0209998_100924322 127
360 3300027876 Ga0209974_10005674 Ga0209974_100056744 127
361 3300027907 Ga0207428_10037489 Ga0207428_100374894 127
362 3300028556 Ga0265337_1000006 Ga0265337_100000697 127
363 3300028558 Ga0265326_10000066 Ga0265326_1000006635 127
364 3300028577 Ga0265318_10109340 Ga0265318_101093402 127
365 3300028654 Ga0265322_10000001 Ga0265322_10000001493 127
366 3300028666 Ga0265336_10001086 Ga0265336_100010863 127
367 3300028666 Ga0265336_10010847 Ga0265336_100108472 127
368 3300028800 Ga0265338_10059611 Ga0265338_100596112 127
369 3300029957 Ga0265324_10000090 Ga0265324_100000905 127
370 3300029957 Ga0265324_10000373 Ga0265324_1000037324 127
371 3300029957 Ga0265324_10000563 Ga0265324_100005632 127
372 3300029957 Ga0265324_10007205 Ga0265324_100072055 127
373 3300029957 Ga0265324_10012755 Ga0265324_100127552 127
374 3300031235 Ga0265330_10002315 Ga0265330_100023155 127
375 3300031238 Ga0265332_10084963 Ga0265332_100849632 127
376 3300031238 Ga0265332_10100953 Ga0265332_101009532 127
377 3300031240 Ga0265320_10000002 Ga0265320_10000002492 127
378 3300031240 Ga0265320_10014802 Ga0265320_100148022 127
379 3300031241 Ga0265325_10000153 Ga0265325_100001539 127
380 3300031242 Ga0265329_10009135 Ga0265329_100091356 127
381 3300031242 Ga0265329_10030273 Ga0265329_100302732 127
382 3300031249 Ga0265339_10008744 Ga0265339_100087443 127
383 3300031249 Ga0265339_10011323 Ga0265339_100113236 127
384 3300031250 Ga0265331_10002086 Ga0265331_1000208610 127
385 3300031250 Ga0265331_10002830 Ga0265331_100028304 127
386 3300031250 Ga0265331_10029077 Ga0265331_100290772 127
387 3300031250 Ga0265331_10085731 Ga0265331_100857312 127
388 3300031250 Ga0265331_10092484 Ga0265331_100924842 127
389 3300031250 Ga0265331_10116328 Ga0265331_101163282 127
390 3300031251 Ga0265327_10000011 Ga0265327_10000011492 127
391 3300031251 Ga0265327_10000557 Ga0265327_1000055736 127
392 3300031344 Ga0265316_10053913 Ga0265316_100539133 127
393 3300031344 Ga0265316_10141965 Ga0265316_101419652 127
394 3300031344 Ga0265316_10635904 Ga0265316_106359042 127
395 3300031595 Ga0265313_10009558 Ga0265313_100095584 127
396 3300031665 Ga0316575_10000218 Ga0316575_100002183 127
397 3300031691 Ga0316579_10162879 Ga0316579_101628792 127
398 3300031711 Ga0265314_10000706 Ga0265314_1000070635 127
399 3300031711 Ga0265314_10000726 Ga0265314_1000072619 127
400 3300031711 Ga0265314_10009867 Ga0265314_100098677 127
401 3300031711 Ga0265314_10014960 Ga0265314_100149604 127
402 3300031711 Ga0265314_10030366 Ga0265314_100303662 127
403 3300031712 Ga0265342_10161542 Ga0265342_101615421 127
404 3300031712 Ga0265342_10605518 Ga0265342_106055182 127
405 3300031727 Ga0316576_10936803 Ga0316576_109368031 127
406 3300031995 Ga0307409_101589845 Ga0307409_1015898451 127
407 3300035114 Ga0373939_0256780 Ga0373939_0256780_230_619 127
408 3300035170 Ga0373943_0016826 Ga0373943_0016826_610_993 127
409 3300037068 Ga0373925_0185656 Ga0373925_0185656_931_1314 127
410 3300037418 Ga0395900_0497810 Ga0395900_0497810_237_626 127
411 3300039062 Ga0400483_220832 Ga0400483_220832_410_799 127
412 3300042876 Ga0451577_0000085 Ga0451577_0000085_155606_155995 127
413 3300042876 Ga0451577_0003720 Ga0451577_0003720_10204_10605 127
414 3300042876 Ga0451577_0089801 Ga0451577_0089801_1158_1547 127
415 3300042876 Ga0451577_0117305 Ga0451577_0117305_290_679 127
416 3300042876 Ga0451577_0129463 Ga0451577_0129463_1571_1954 127
417 3300044673 Ga0453683_0000047 Ga0453683_0000047_152228_152617 127
418 3300044694 Ga0466963_0047730 Ga0466963_0047730_1032_1424 127
419 3300044712 Ga0453684_0000273 Ga0453684_0000273_64923_65312 127
420 3300044712 Ga0453684_0000302 Ga0453684_0000302_55147_55536 127
421 3300044712 Ga0453684_0012535 Ga0453684_0012535_3804_4205 127
422 3300044712 Ga0453684_0173338 Ga0453684_0173338_892_1287 127
423 3300044712 Ga0453684_0431915 Ga0453684_0431915_850_1233 127
424 3300045051 Ga0451576_0000006 Ga0451576_0000006_420790_421191 127
425 3300045051 Ga0451576_0000116 Ga0451576_0000116_152228_152617 127
426 3300045051 Ga0451576_0000652 Ga0451576_0000652_57970_58425 127
427 3300045051 Ga0451576_0000868 Ga0451576_0000868_12358_12747 127
428 3300045051 Ga0451576_1271666 Ga0451576_1271666_298_687 127
429 3300045051 Ga0451576_1905486 Ga0451576_1905486_109_504 127
430 3300045976 Ga0466967_0214795 Ga0466967_0214795_851_1243 127
431 3300046455 Ga0495603_0000258 Ga0495603_0000258_3217_3609 127
432 3300046559 Ga0495667_0000047 Ga0495667_0000047_72982_73374 127
433 3300047322 Ga0495680_0003506 Ga0495680_0003506_1183_1575 127
434 3300047471 Ga0495684_0127354 Ga0495684_0127354_755_1147 127
435 3300048903 Ga0496100_0220279 Ga0496100_0220279_404_793 127
436 3300048904 Ga0496101_0132458 Ga0496101_0132458_241_630 127
437 3300048907 Ga0496104_0811525 Ga0496104_0811525_354_743 127
438 3300048910 Ga0496107_0313840 Ga0496107_0313840_754_1143 127
439 3300048911 Ga0496108_0050129 Ga0496108_0050129_242_631 127
440 3300048911 Ga0496108_0215378 Ga0496108_0215378_1227_1616 127
441 3300048912 Ga0496109_0046553 Ga0496109_0046553_1872_2261 127
442 3300048912 Ga0496109_1859070 Ga0496109_1859070_14_403 127
443 3300048913 Ga0496110_0453927 Ga0496110_0453927_94_483 127
444 3300048916 Ga0496113_0559873 Ga0496113_0559873_24_413 127
445 3300048917 Ga0496114_0004317 Ga0496114_0004317_2142_2531 127
446 3300048917 Ga0496114_0007017 Ga0496114_0007017_6212_6601 127
447 3300048918 Ga0496115_1344821 Ga0496115_1344821_118_507 127
448 3300049568 Ga0501031_0004039 Ga0501031_0004039_8597_8983 127
449 3300049568 Ga0501031_0008281 Ga0501031_0008281_93_479 127
450 3300049568 Ga0501031_0110192 Ga0501031_0110192_479_868 127
451 3300049569 Ga0501032_0001373 Ga0501032_0001373_7332_7718 127
452 3300049569 Ga0501032_0007089 Ga0501032_0007089_7284_7670 127
453 3300049569 Ga0501032_0059099 Ga0501032_0059099_1365_1754 127
454 3300049570 Ga0501033_0000949 Ga0501033_0000949_3516_3902 127
455 3300049570 Ga0501033_0001864 Ga0501033_0001864_4408_4794 127
456 3300049570 Ga0501033_0059974 Ga0501033_0059974_446_832 127
457 3300049571 Ga0501034_0024559 Ga0501034_0024559_3799_4185 127
458 3300049571 Ga0501034_0047437 Ga0501034_0047437_1784_2173 127
459 3300049571 Ga0501034_0541825 Ga0501034_0541825_169_558 127
460 3300049572 Ga0501036_0000382 Ga0501036_0000382_1618_2004 127
461 3300049572 Ga0501036_0001661 Ga0501036_0001661_4134_4520 127
462 3300049572 Ga0501036_0035605 Ga0501036_0035605_447_833 127
463 3300049573 Ga0501037_0000474 Ga0501037_0000474_20059_20445 127
464 3300049573 Ga0501037_0051116 Ga0501037_0051116_929_1315 127
465 3300049573 Ga0501037_0193442 Ga0501037_0193442_956_1345 127
466 3300049573 Ga0501037_0358177 Ga0501037_0358177_315_701 127
467 3300049573 Ga0501037_0711826 Ga0501037_0711826_218_604 127
468 3300049574 Ga0501038_0008209 Ga0501038_0008209_1403_1789 127
469 3300049574 Ga0501038_0019437 Ga0501038_0019437_4080_4469 127
470 3300049574 Ga0501038_0023864 Ga0501038_0023864_1454_1840 127
471 3300049574 Ga0501038_0076883 Ga0501038_0076883_1777_2163 127
472 3300049574 Ga0501038_0130565 Ga0501038_0130565_1018_1404 127
473 3300049574 Ga0501038_0137944 Ga0501038_0137944_1106_1492 127
474 3300049574 Ga0501038_0336957 Ga0501038_0336957_552_941 127
475 3300049575 Ga0501039_0002238 Ga0501039_0002238_9349_9735 127
476 3300049575 Ga0501039_0043176 Ga0501039_0043176_2581_2967 127
477 3300049575 Ga0501039_0044783 Ga0501039_0044783_1722_2111 127
478 3300049576 Ga0501040_0003365 Ga0501040_0003365_3452_3838 127
479 3300049578 Ga0501042_0084446 Ga0501042_0084446_485_871 127
480 3300049579 Ga0501043_0007578 Ga0501043_0007578_2284_2670 127
481 3300049579 Ga0501043_0008971 Ga0501043_0008971_1287_1673 127
482 3300049579 Ga0501043_0083051 Ga0501043_0083051_1776_2162 127
483 3300049580 Ga0501046_0002898 Ga0501046_0002898_12083_12469 127
484 3300049580 Ga0501046_0011564 Ga0501046_0011564_3354_3740 127
485 3300049580 Ga0501046_0700086 Ga0501046_0700086_159_554 127
486 3300049581 Ga0501047_0005810 Ga0501047_0005810_9733_10119 127
487 3300049581 Ga0501047_0108224 Ga0501047_0108224_1421_1807 127
488 3300049582 Ga0501048_0059590 Ga0501048_0059590_653_1039 127
489 3300049584 Ga0501068_0002905 Ga0501068_0002905_1278_1664 127
490 3300049584 Ga0501068_0172686 Ga0501068_0172686_922_1308 127
491 3300049586 Ga0501070_0429924 Ga0501070_0429924_424_810 127
492 3300049587 Ga0501071_0757423 Ga0501071_0757423_15_401 127
493 3300049589 Ga0501073_0642907 Ga0501073_0642907_51_437 127
494 3300049590 Ga0501074_0313318 Ga0501074_0313318_628_1011 127
495 3300049591 Ga0501075_0444772 Ga0501075_0444772_161_547 127
496 3300049651 Ga0501201_031051 Ga0501201_031051_140_526 127
497 3300049741 Ga0501079_0183796 Ga0501079_0183796_250_636 127
498 3300049742 Ga0501080_1065275 Ga0501080_1065275_138_524 127
499 3300049742 Ga0501080_1151802 Ga0501080_1151802_121_507 127
500 3300049822 Ga0501035_0001429 Ga0501035_0001429_4317_4703 127
501 3300049822 Ga0501035_0001968 Ga0501035_0001968_7592_7978 127
502 3300049822 Ga0501035_0009680 Ga0501035_0009680_5798_6184 127
503 3300049822 Ga0501035_0076193 Ga0501035_0076193_1784_2173 127
504 3300049822 Ga0501035_0651072 Ga0501035_0651072_20_409 127
505 3300049823 Ga0501044_0000111 Ga0501044_0000111_86044_86430 127
506 3300049823 Ga0501044_0018048 Ga0501044_0018048_2411_2797 127
507 3300049823 Ga0501044_0025482 Ga0501044_0025482_5077_5463 127
508 3300049823 Ga0501044_0053451 Ga0501044_0053451_3452_3838 127
509 3300049823 Ga0501044_0259856 Ga0501044_0259856_779_1180 127
510 3300049823 Ga0501044_0278379 Ga0501044_0278379_1020_1409 127
511 3300049824 Ga0501045_0003419 Ga0501045_0003419_7552_7938 127
512 3300049824 Ga0501045_0271813 Ga0501045_0271813_516_902 127
513 3300050509 nmdc:mga0qj67_405998_c1 nmdc:mga0qj67_405998_c1_285_677 127
514 3300050511 nmdc:mga08y16_775092_c1 nmdc:mga08y16_775092_c1_160_549 127
515 3300054114 Ga0501084_0324607 Ga0501084_0324607_308_694 127
516 3300003322 rootL2_10005174 rootL2_100051741 128
517 3300005347 Ga0070668_100005924 Ga0070668_10000592410 128
518 3300005457 Ga0070662_100019920 Ga0070662_1000199204 128
519 3300005548 Ga0070665_100155742 Ga0070665_1001557422 128
520 3300006051 Ga0075364_10378596 Ga0075364_103785961 128
521 3300009011 Ga0105251_10000576 Ga0105251_1000057631 128
522 3300009011 Ga0105251_10025485 Ga0105251_100254852 128
523 3300009036 Ga0105244_10411907 Ga0105244_104119072 128
524 3300009036 Ga0105244_10586162 Ga0105244_105861621 128
525 3300009101 Ga0105247_10269596 Ga0105247_102695962 128
526 3300009545 Ga0105237_10141798 Ga0105237_101417982 128
527 3300013306 Ga0163162_10043027 Ga0163162_100430274 128
528 3300013307 Ga0157372_10045700 Ga0157372_100457002 128
529 3300013307 Ga0157372_10532628 Ga0157372_105326282 128
530 3300014497 Ga0182008_10060110 Ga0182008_100601102 128
531 3300015261 Ga0182006_1003907 Ga0182006_10039071 128
532 3300015262 Ga0182007_10030055 Ga0182007_100300552 128
533 3300017792 Ga0163161_10010793 Ga0163161_100107933 128
534 3300021361 Ga0213872_10207204 Ga0213872_102072041 128
535 3300025711 Ga0207696_1000361 Ga0207696_10003612 128
536 3300025728 Ga0207655_1000047 Ga0207655_1000047203 128
537 3300025728 Ga0207655_1000079 Ga0207655_100007928 128
538 3300025728 Ga0207655_1041194 Ga0207655_10411941 128
539 3300025735 Ga0207713_1004277 Ga0207713_10042776 128
540 3300025735 Ga0207713_1087163 Ga0207713_10871632 128
541 3300025900 Ga0207710_10358912 Ga0207710_103589122 128
542 3300025933 Ga0207706_10088631 Ga0207706_100886312 128
543 3300025972 Ga0207668_10338908 Ga0207668_103389082 128
544 3300028379 Ga0268266_10272578 Ga0268266_102725782 128
545 3300030742 Ga0316183_1179590 Ga0316183_11795901 128
546 3300039447 Ga0436361_0333442 Ga0436361_0333442_483_869 128
547 3300039447 Ga0436361_0883668 Ga0436361_0883668_550_936 128
548 3300039447 Ga0436361_0989063 Ga0436361_0989063_3606_3995 128
549 3300041405 Ga0439438_012978 Ga0439438_012978_826_1212 128
550 3300041407 Ga0439447_017639 Ga0439447_017639_1457_1843 128
551 3300041411 Ga0439466_0000004 Ga0439466_0000004_145574_145960 128
552 3300042006 Ga0439432_019605 Ga0439432_019605_404_790 128
553 3300042010 Ga0439452_028288 Ga0439452_028288_478_864 128
554 3300042016 Ga0439463_001507 Ga0439463_001507_2779_3165 128
555 3300042146 Ga0450907_000221 Ga0450907_000221_4729_5115 128
556 3300046458 Ga0495591_013966 Ga0495591_013966_415_801 128
557 3300046500 Ga0495596_0230626 Ga0495596_0230626_201_587 128
558 3300046522 Ga0495643_0075647 Ga0495643_0075647_851_1237 128
559 3300046524 Ga0495648_0006032 Ga0495648_0006032_2562_2948 128
560 3300046810 Ga0495660_0008440 Ga0495660_0008440_3666_4052 128
561 3300047320 Ga0495672_0000025 Ga0495672_0000025_218612_218998 128
562 3300047446 Ga0495679_002550 Ga0495679_002550_7334_7720 128
563 3300048903 Ga0496100_0046797 Ga0496100_0046797_1402_1788 128
564 3300048908 Ga0496105_0006095 Ga0496105_0006095_2546_2932 128
565 3300048913 Ga0496110_0460644 Ga0496110_0460644_428_814 128
566 3300048919 Ga0496116_0105035 Ga0496116_0105035_407_793 128
567 3300048921 Ga0496118_0000075 Ga0496118_0000075_145056_145442 128
568 3300048921 Ga0496118_0000996 Ga0496118_0000996_6743_7129 128
569 3300048922 Ga0496119_0000281 Ga0496119_0000281_24286_24672 128
570 3300048923 Ga0496120_0000363 Ga0496120_0000363_9284_9670 128
571 3300048924 Ga0496121_0000057 Ga0496121_0000057_168435_168821 128
572 3300048925 Ga0496122_0043786 Ga0496122_0043786_843_1229 128
573 3300048926 Ga0496123_0031853 Ga0496123_0031853_3364_3750 128
574 3300048927 Ga0496124_0001851 Ga0496124_0001851_2026_2412 128
575 3300048928 Ga0496125_0003562 Ga0496125_0003562_13805_14191 128
576 3300048929 Ga0496126_0408706 Ga0496126_0408706_503_889 128
577 2162886007 SwRhRL2b_contig_2081982 SwRhRL2b_0935.00000970 129
578 3300003320 rootH2_10007961 rootH2_100079612 129
579 3300003578 Ga0006562J51391_1034250 Ga0006562J51391_10342502 129
580 3300005289 Ga0065704_10096250 Ga0065704_100962501 129
581 3300005289 Ga0065704_10447131 Ga0065704_104471311 129
582 3300005289 Ga0065704_10589533 Ga0065704_105895331 129
583 3300005366 Ga0070659_100017935 Ga0070659_1000179353 129
584 3300005548 Ga0070665_100000033 Ga0070665_100000033193 129
585 3300005577 Ga0068857_100000005 Ga0068857_100000005146 129
586 3300005834 Ga0068851_10025488 Ga0068851_100254881 129
587 3300006051 Ga0075364_10008988 Ga0075364_100089882 129
588 3300006195 Ga0075366_10003394 Ga0075366_100033948 129
589 3300006946 Ga0079104_1000046 Ga0079104_100004641 129
590 3300006946 Ga0079104_1000249 Ga0079104_100024934 129
591 3300006946 Ga0079104_1001023 Ga0079104_100102317 129
592 3300006946 Ga0079104_1001675 Ga0079104_10016756 129
593 3300006946 Ga0079104_1078148 Ga0079104_10781481 129
594 3300009011 Ga0105251_10006603 Ga0105251_100066032 129
595 3300009011 Ga0105251_10063250 Ga0105251_100632501 129
596 3300009011 Ga0105251_10126148 Ga0105251_101261482 129
597 3300009036 Ga0105244_10000091 Ga0105244_1000009124 129
598 3300009036 Ga0105244_10039783 Ga0105244_100397832 129
599 3300009092 Ga0105250_10000095 Ga0105250_1000009552 129
600 3300009092 Ga0105250_10044506 Ga0105250_100445062 129
601 3300009093 Ga0105240_10693579 Ga0105240_106935792 129
602 3300009101 Ga0105247_11110806 Ga0105247_111108061 129
603 3300009148 Ga0105243_10155174 Ga0105243_101551742 129
604 3300009148 Ga0105243_10336668 Ga0105243_103366682 129
605 3300009177 Ga0105248_11513262 Ga0105248_115132621 129
606 3300010375 Ga0105239_13096906 Ga0105239_130969061 129
607 3300013100 Ga0157373_10215033 Ga0157373_102150332 129
608 3300013102 Ga0157371_10971181 Ga0157371_109711811 129
609 3300013104 Ga0157370_10002672 Ga0157370_100026727 129
610 3300013104 Ga0157370_11299817 Ga0157370_112998171 129
611 3300015261 Ga0182006_1000013 Ga0182006_1000013160 129
612 3300015679 Ga0183366_1002 Ga0183366_1002339 129
613 3300015680 Ga0183370_1002 Ga0183370_1002339 129
614 3300015685 Ga0183369_1002 Ga0183369_1002339 129
615 3300015687 Ga0183368_1005 Ga0183368_1005339 129
616 3300021384 Ga0213876_10000329 Ga0213876_1000032926 129
617 3300025321 Ga0207656_10008020 Ga0207656_100080204 129
618 3300025711 Ga0207696_1000024 Ga0207696_100002480 129
619 3300025728 Ga0207655_1000044 Ga0207655_100004424 129
620 3300025728 Ga0207655_1000050 Ga0207655_1000050237 129
621 3300025728 Ga0207655_1007857 Ga0207655_10078578 129
622 3300025735 Ga0207713_1000033 Ga0207713_100003377 129
623 3300025735 Ga0207713_1000134 Ga0207713_100013428 129
624 3300025735 Ga0207713_1017199 Ga0207713_10171992 129
625 3300025735 Ga0207713_1082750 Ga0207713_10827502 129
626 3300025932 Ga0207690_10041333 Ga0207690_100413332 129
627 3300025935 Ga0207709_10152812 Ga0207709_101528122 129
628 3300026116 Ga0207674_10000523 Ga0207674_1000052321 129
629 3300027111 Ga0209281_1000022 Ga0209281_100002243 129
630 3300027111 Ga0209281_1000048 Ga0209281_100004892 129
631 3300027111 Ga0209281_1000056 Ga0209281_100005615 129
632 3300027111 Ga0209281_1000120 Ga0209281_1000120194 129
633 3300027111 Ga0209281_1000243 Ga0209281_100024356 129
634 3300027111 Ga0209281_1000422 Ga0209281_10004222 129
635 3300027312 Ga0209371_1000013 Ga0209371_1000013280 129
636 3300027312 Ga0209371_1000427 Ga0209371_100042725 129
637 3300027312 Ga0209371_1001124 Ga0209371_10011246 129
638 3300027312 Ga0209371_1023428 Ga0209371_10234281 129
639 3300027312 Ga0209371_1032708 Ga0209371_10327082 129
640 3300028379 Ga0268266_10000041 Ga0268266_1000004191 129
641 3300030500 Ga0268256_1000014 Ga0268256_1000014398 129
642 3300030500 Ga0268256_1000363 Ga0268256_100036325 129
643 3300030500 Ga0268256_1021499 Ga0268256_10214992 129
644 3300030500 Ga0268256_1026531 Ga0268256_10265311 129
645 3300031691 Ga0316579_10079102 Ga0316579_100791022 129
646 3300031727 Ga0316576_10208429 Ga0316576_102084292 129
647 3300031727 Ga0316576_10346584 Ga0316576_103465842 129
648 3300031728 Ga0316578_10006169 Ga0316578_100061694 129
649 3300031728 Ga0316578_10015116 Ga0316578_100151164 129
650 3300031733 Ga0316577_10019864 Ga0316577_100198642 129
651 3300032137 Ga0316585_10016316 Ga0316585_100163163 129
652 3300032139 Ga0316580_10002910 Ga0316580_100029102 129
653 3300032139 Ga0316580_10011437 Ga0316580_100114372 129
654 3300032168 Ga0316593_10005031 Ga0316593_100050312 129
655 3300032168 Ga0316593_10062511 Ga0316593_100625112 129
656 3300033524 Ga0316592_1000666 Ga0316592_10006664 129
657 3300033524 Ga0316592_1011089 Ga0316592_10110892 129
658 3300033528 Ga0316588_1000764 Ga0316588_10007643 129
659 3300033528 Ga0316588_1005250 Ga0316588_10052502 129
660 3300033541 Ga0316596_1023746 Ga0316596_10237462 129
661 3300033541 Ga0316596_1039709 Ga0316596_10397092 129
662 3300035398 Ga0316574_0004273 Ga0316574_0004273_2967_3359 129
663 3300035398 Ga0316574_0267348 Ga0316574_0267348_339_731 129
664 3300036647 Ga0316582_0024850 Ga0316582_0024850_176_568 129
665 3300036647 Ga0316582_0048224 Ga0316582_0048224_2224_2616 129
666 3300036712 Ga0316584_0010338 Ga0316584_0010338_3918_4310 129
667 3300036712 Ga0316584_0025194 Ga0316584_0025194_1147_1539 129
668 3300037588 Ga0316581_0065812 Ga0316581_0065812_127_519 129
669 3300038726 Ga0400490_40590 Ga0400490_40590_593_988 129
670 3300038741 Ga0400488_62682 Ga0400488_62682_523_918 129
671 3300039110 Ga0400487_14017 Ga0400487_14017_1072_1467 129
672 3300039437 Ga0436365_0042508 Ga0436365_0042508_23747_24190 129
673 3300041405 Ga0439438_003218 Ga0439438_003218_5124_5513 129
674 3300041486 Ga0451807_0974327 Ga0451807_0974327_411_803 129
675 3300041512 Ga0451853_2427319 Ga0451853_2427319_1913_2302 129
676 3300042006 Ga0439432_027215 Ga0439432_027215_1316_1705 129
677 3300042010 Ga0439452_000011 Ga0439452_000011_409900_410295 129
678 3300042010 Ga0439452_000344 Ga0439452_000344_18828_19217 129
679 3300042010 Ga0439452_002524 Ga0439452_002524_5978_6367 129
680 3300042137 Ga0450902_052006 Ga0450902_052006_270_659 129
681 3300042439 Ga0439464_0001655 Ga0439464_0001655_107_496 129
682 3300044669 Ga0466981_0000001 Ga0466981_0000001_118856_119245 129
683 3300046471 Ga0495650_0000059 Ga0495650_0000059_15124_15513 129
684 3300048903 Ga0496100_0306909 Ga0496100_0306909_730_1119 129
685 3300048903 Ga0496100_1008716 Ga0496100_1008716_71_460 129
686 3300048904 Ga0496101_1058770 Ga0496101_1058770_134_523 129
687 3300048907 Ga0496104_0000680 Ga0496104_0000680_20495_20884 129
688 3300048908 Ga0496105_0009823 Ga0496105_0009823_7030_7419 129
689 3300048916 Ga0496113_0462794 Ga0496113_0462794_597_986 129
690 3300048919 Ga0496116_0002364 Ga0496116_0002364_13181_13570 129
691 3300048919 Ga0496116_0067587 Ga0496116_0067587_721_1110 129
692 3300048920 Ga0496117_0000168 Ga0496117_0000168_124060_124449 129
693 3300048921 Ga0496118_0000304 Ga0496118_0000304_18973_19362 129
694 3300048922 Ga0496119_0017781 Ga0496119_0017781_58_447 129
695 3300048923 Ga0496120_0013938 Ga0496120_0013938_108_497 129
696 3300048923 Ga0496120_0147265 Ga0496120_0147265_32_421 129
697 3300048924 Ga0496121_0020822 Ga0496121_0020822_89_478 129
698 3300048924 Ga0496121_0669107 Ga0496121_0669107_38_427 129
699 3300048925 Ga0496122_0002021 Ga0496122_0002021_14978_15421 129
700 3300048925 Ga0496122_0002096 Ga0496122_0002096_11699_12088 129
701 3300048925 Ga0496122_0069982 Ga0496122_0069982_1252_1641 129
702 3300048926 Ga0496123_0000605 Ga0496123_0000605_15264_15653 129
703 3300048926 Ga0496123_0002325 Ga0496123_0002325_6017_6406 129
704 3300048926 Ga0496123_0472030 Ga0496123_0472030_55_450 129
705 3300048927 Ga0496124_0133469 Ga0496124_0133469_813_1205 129
706 3300048927 Ga0496124_0177748 Ga0496124_0177748_301_690 129
707 3300048928 Ga0496125_0000081 Ga0496125_0000081_205989_206378 129
708 3300048928 Ga0496125_0007362 Ga0496125_0007362_6122_6511 129
709 3300048928 Ga0496125_0022828 Ga0496125_0022828_5326_5715 129
710 3300048929 Ga0496126_0001662 Ga0496126_0001662_9752_10141 129
711 3300048929 Ga0496126_0005302 Ga0496126_0005302_5975_6364 129
712 3300048929 Ga0496126_0155487 Ga0496126_0155487_73_462 129
713 3300048929 Ga0496126_0394059 Ga0496126_0394059_710_1099 129
714 3300050491 nmdc:mga00v17_6047_c1 nmdc:mga00v17_6047_c1_3510_3899 129
715 3300050493 nmdc:mga0k408_4578_c1 nmdc:mga0k408_4578_c1_804_1193 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

26

147

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8k-assembly1.cif.gz_E crystal structure of etd97n-ehred complex 0.9901 3 127
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9896 3 129
3a7a-assembly2.cif.gz_D crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9871 3 129
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9845 3 128
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9827 2 128
ID Description Score Start End Superfamily
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9855 2 127 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9835 8 125 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9806 8 128 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9715 38 129 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9701 2 127 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3N5GR25-F1-model_v4 Glycine cleavage system H protein 0.9989 3 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A6I6IGN9-F1-model_v4 deleted 0.9976 1 127
AF-A0A3M0Z9B7-F1-model_v4 Glycine cleavage system H protein 0.9976 3 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A6N9B0N4-F1-model_v4 Glycine cleavage system H protein 0.9975 1 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A6A5KVE9-F1-model_v4 deleted 0.9974 1 117

Feature Viewer

pLDDT pTM Quality
97.32 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map