F477002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 406 | 630 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0042508|Ga0436365_0042508_23747_24190 |
| Length | 147 |
| Sequence | LYALAKPSRDSFLFGDLVMSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVAAGDDCAVAESVKAASDIYAPISGEIVAVNEALGDAPEQVNSAPYGEGWIFKIKASDESEVAALLDATAYEALLEDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 3 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 4 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 5 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 6 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 7 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 8 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 9 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 10 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 11 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 12 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 13 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 14 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 15 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 16 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 17 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 18 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 19 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 20 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 21 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 22 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 23 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 24 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 25 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 26 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 27 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 28 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 29 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 30 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 31 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 32 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 33 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 34 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 35 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 36 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 37 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 38 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 39 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 40 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 41 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 42 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 43 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 44 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 45 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 46 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 47 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 48 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 49 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 50 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 51 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 52 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 53 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 54 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 55 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 56 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 57 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 58 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 59 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 60 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 61 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 62 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 63 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 64 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 65 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 66 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 67 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 68 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 69 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 70 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 71 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 72 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 73 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 74 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 75 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 76 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 77 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 78 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 79 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 80 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 81 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 82 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 83 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 84 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 85 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 86 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 87 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 104 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 121 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 122 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 123 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 126 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 131 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 167 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 168 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 169 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 237 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 248 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 250 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 254 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 265 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 266 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 272 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 283 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 284 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 285 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 286 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 287 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 288 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 289 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 290 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 291 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 292 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 296 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 297 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 300 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 301 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 302 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 303 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 304 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 305 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 306 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 307 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 308 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 309 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 310 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 311 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 312 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 313 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 316 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 317 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 318 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 399 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 400 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 403 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 404 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 405 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 406 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.57 |
| Metatranscriptomes | 1.54 |
| Isolates | 11.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 1.82 |
| Nodule | 1.82 |
| Rhizoplane | 10.77 |
| Rhizosphere | 75.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2081982 | 2162886007 | Bacteria | 2260 |
| 2 | JGI24737J22298_10132570 | 3300001990 | Archaea | 736 |
| 3 | JGI24737J22298_10249692 | 3300001990 | Bacteria | 524 |
| 4 | rootH2_10007961 | 3300003320 | Bacteria | 15867 |
| 5 | rootL2_10005174 | 3300003322 | Bacteria | 11301 |
| 6 | JGI26129J50193_1009732 | 3300003349 | Bacteria | 698 |
| 7 | Ga0006562J51391_1034250 | 3300003578 | Unclassified | 1646 |
| 8 | Ga0065704_10096250 | 3300005289 | Bacteria | 2439 |
| 9 | Ga0065704_10447131 | 3300005289 | Bacteria | 708 |
| 10 | Ga0065704_10589533 | 3300005289 | Bacteria | 601 |
| 11 | Ga0070676_10637699 | 3300005328 | Bacteria | 772 |
| 12 | Ga0070676_10989659 | 3300005328 | Bacteria | 631 |
| 13 | Ga0070683_100434434 | 3300005329 | Bacteria | 1253 |
| 14 | Ga0070683_100506196 | 3300005329 | Bacteria | 1154 |
| 15 | Ga0070670_100111084 | 3300005331 | Bacteria | 2362 |
| 16 | Ga0070660_100178743 | 3300005339 | Bacteria | 1717 |
| 17 | Ga0070660_100180346 | 3300005339 | Bacteria | 1709 |
| 18 | Ga0070692_10149802 | 3300005345 | Bacteria | 1328 |
| 19 | Ga0070692_10525721 | 3300005345 | Bacteria | 771 |
| 20 | Ga0070668_100005924 | 3300005347 | Bacteria | 9059 |
| 21 | Ga0070674_100096087 | 3300005356 | Bacteria | 2149 |
| 22 | Ga0070674_101547295 | 3300005356 | Bacteria | 597 |
| 23 | Ga0070688_100779640 | 3300005365 | Bacteria | 746 |
| 24 | Ga0070659_100017935 | 3300005366 | Bacteria | 5333 |
| 25 | Ga0070659_100213804 | 3300005366 | Bacteria | 1589 |
| 26 | Ga0070659_100259143 | 3300005366 | Bacteria | 1443 |
| 27 | Ga0070659_100294518 | 3300005366 | Bacteria | 1352 |
| 28 | Ga0070659_100349134 | 3300005366 | Bacteria | 1241 |
| 29 | Ga0070659_101024490 | 3300005366 | Bacteria | 725 |
| 30 | Ga0070714_100029705 | 3300005435 | Bacteria | 4546 |
| 31 | Ga0070711_100040404 | 3300005439 | Bacteria | 3146 |
| 32 | Ga0070711_101406719 | 3300005439 | Unclassified | 607 |
| 33 | Ga0070700_100211893 | 3300005441 | Bacteria | 1367 |
| 34 | Ga0070678_100649993 | 3300005456 | Bacteria | 946 |
| 35 | Ga0070662_100019920 | 3300005457 | Bacteria | 4565 |
| 36 | Ga0070662_100737629 | 3300005457 | Bacteria | 835 |
| 37 | Ga0070681_10679253 | 3300005458 | Bacteria | 945 |
| 38 | Ga0068867_100094504 | 3300005459 | Bacteria | 2273 |
| 39 | Ga0068867_100557801 | 3300005459 | Bacteria | 993 |
| 40 | Ga0070706_100788510 | 3300005467 | Bacteria | 880 |
| 41 | Ga0070698_100589616 | 3300005471 | Bacteria | 1052 |
| 42 | Ga0070679_100535681 | 3300005530 | Bacteria | 1115 |
| 43 | Ga0070684_100156192 | 3300005535 | Bacteria | 2069 |
| 44 | Ga0070697_100067397 | 3300005536 | Bacteria | 2928 |
| 45 | Ga0068853_102129852 | 3300005539 | Unclassified | 544 |
| 46 | Ga0068853_102215244 | 3300005539 | Bacteria | 533 |
| 47 | Ga0070665_100000033 | 3300005548 | Bacteria | 332530 |
| 48 | Ga0070665_100155742 | 3300005548 | Bacteria | 2287 |
| 49 | Ga0070665_100528192 | 3300005548 | Bacteria | 1192 |
| 50 | Ga0070704_101118305 | 3300005549 | Bacteria | 716 |
| 51 | Ga0070704_101716838 | 3300005549 | Bacteria | 580 |
| 52 | Ga0070664_100677286 | 3300005564 | Bacteria | 960 |
| 53 | Ga0068857_100000005 | 3300005577 | Bacteria | 170248 |
| 54 | Ga0068857_100552569 | 3300005577 | Bacteria | 1085 |
| 55 | Ga0068854_100367615 | 3300005578 | Bacteria | 1182 |
| 56 | Ga0068856_100865745 | 3300005614 | Bacteria | 923 |
| 57 | Ga0068856_101011039 | 3300005614 | Bacteria | 850 |
| 58 | Ga0070702_100421497 | 3300005615 | Bacteria | 961 |
| 59 | Ga0068852_100309410 | 3300005616 | Bacteria | 1531 |
| 60 | Ga0068852_100802136 | 3300005616 | Bacteria | 956 |
| 61 | Ga0068852_101740695 | 3300005616 | Bacteria | 646 |
| 62 | Ga0068859_100654263 | 3300005617 | Bacteria | 1143 |
| 63 | Ga0068864_100348964 | 3300005618 | Bacteria | 1396 |
| 64 | Ga0068866_10058288 | 3300005718 | Bacteria | 1994 |
| 65 | Ga0068866_10147682 | 3300005718 | Bacteria | 1358 |
| 66 | Ga0068861_100148538 | 3300005719 | Bacteria | 1921 |
| 67 | Ga0068861_100751999 | 3300005719 | Bacteria | 911 |
| 68 | Ga0068861_100870025 | 3300005719 | Bacteria | 851 |
| 69 | Ga0068851_10025488 | 3300005834 | Bacteria | 2901 |
| 70 | Ga0068870_10068796 | 3300005840 | Bacteria | 1925 |
| 71 | Ga0068870_10113589 | 3300005840 | Bacteria | 1550 |
| 72 | Ga0068862_101169748 | 3300005844 | Bacteria | 767 |
| 73 | Ga0068862_102067149 | 3300005844 | Bacteria | 581 |
| 74 | Ga0081538_10153090 | 3300005981 | Bacteria | 1040 |
| 75 | Ga0075365_10202724 | 3300006038 | Bacteria | 1390 |
| 76 | Ga0075365_10534960 | 3300006038 | Bacteria | 829 |
| 77 | Ga0075365_10568514 | 3300006038 | Bacteria | 802 |
| 78 | Ga0075364_10008988 | 3300006051 | Bacteria | 5982 |
| 79 | Ga0075364_10378596 | 3300006051 | Bacteria | 965 |
| 80 | Ga0075366_10003394 | 3300006195 | Bacteria | 8397 |
| 81 | Ga0097621_101487504 | 3300006237 | Unclassified | 642 |
| 82 | Ga0075428_100520963 | 3300006844 | Bacteria | 1272 |
| 83 | Ga0075428_100946318 | 3300006844 | Bacteria | 913 |
| 84 | Ga0075431_101912686 | 3300006847 | Bacteria | 549 |
| 85 | Ga0068865_100498683 | 3300006881 | Bacteria | 1015 |
| 86 | Ga0097620_100654301 | 3300006931 | Bacteria | 1143 |
| 87 | Ga0079104_1000046 | 3300006946 | Bacteria | 183396 |
| 88 | Ga0079104_1000249 | 3300006946 | Bacteria | 72153 |
| 89 | Ga0079104_1001023 | 3300006946 | Bacteria | 21533 |
| 90 | Ga0079104_1001675 | 3300006946 | Bacteria | 14227 |
| 91 | Ga0079104_1078148 | 3300006946 | Bacteria | 684 |
| 92 | Ga0105251_10000576 | 3300009011 | Bacteria | 34073 |
| 93 | Ga0105251_10006603 | 3300009011 | Bacteria | 7350 |
| 94 | Ga0105251_10025485 | 3300009011 | Bacteria | 3025 |
| 95 | Ga0105251_10063250 | 3300009011 | Bacteria | 1736 |
| 96 | Ga0105251_10126148 | 3300009011 | Bacteria | 1162 |
| 97 | Ga0105244_10000091 | 3300009036 | Bacteria | 96351 |
| 98 | Ga0105244_10039783 | 3300009036 | Bacteria | 2445 |
| 99 | Ga0105244_10411907 | 3300009036 | Bacteria | 622 |
| 100 | Ga0105244_10586162 | 3300009036 | Bacteria | 512 |
| 101 | Ga0105250_10000095 | 3300009092 | Bacteria | 78639 |
| 102 | Ga0105250_10044506 | 3300009092 | Bacteria | 1780 |
| 103 | Ga0105240_10044693 | 3300009093 | Bacteria | 5625 |
| 104 | Ga0105240_10693579 | 3300009093 | Bacteria | 1112 |
| 105 | Ga0111539_10980384 | 3300009094 | Bacteria | 983 |
| 106 | Ga0111539_11394265 | 3300009094 | Bacteria | 813 |
| 107 | Ga0111539_12373636 | 3300009094 | Bacteria | 615 |
| 108 | Ga0105245_10228854 | 3300009098 | Bacteria | 1797 |
| 109 | Ga0105245_10369589 | 3300009098 | Bacteria | 1425 |
| 110 | Ga0105247_10269596 | 3300009101 | Bacteria | 1170 |
| 111 | Ga0105247_10324318 | 3300009101 | Bacteria | 1075 |
| 112 | Ga0105247_11110806 | 3300009101 | Bacteria | 624 |
| 113 | Ga0114129_10432163 | 3300009147 | Bacteria | 1730 |
| 114 | Ga0114129_11562474 | 3300009147 | Bacteria | 809 |
| 115 | Ga0114129_11836492 | 3300009147 | Bacteria | 736 |
| 116 | Ga0114129_11947353 | 3300009147 | Bacteria | 712 |
| 117 | Ga0105243_10155174 | 3300009148 | Bacteria | 1968 |
| 118 | Ga0105243_10336668 | 3300009148 | Bacteria | 1381 |
| 119 | Ga0105243_11058440 | 3300009148 | Bacteria | 817 |
| 120 | Ga0105243_11219786 | 3300009148 | Bacteria | 766 |
| 121 | Ga0105242_10890407 | 3300009176 | Bacteria | 889 |
| 122 | Ga0105242_11471207 | 3300009176 | Bacteria | 711 |
| 123 | Ga0105242_13273943 | 3300009176 | Unclassified | 503 |
| 124 | Ga0105248_10596542 | 3300009177 | Bacteria | 1246 |
| 125 | Ga0105248_11513262 | 3300009177 | Bacteria | 760 |
| 126 | Ga0105248_12053276 | 3300009177 | Bacteria | 650 |
| 127 | Ga0105237_10141798 | 3300009545 | Bacteria | 2397 |
| 128 | Ga0105237_10300312 | 3300009545 | Bacteria | 1609 |
| 129 | Ga0105238_10451230 | 3300009551 | Bacteria | 1283 |
| 130 | Ga0105249_10422390 | 3300009553 | Bacteria | 1367 |
| 131 | Ga0105249_11551703 | 3300009553 | Bacteria | 735 |
| 132 | Ga0105239_11620257 | 3300010375 | Unclassified | 749 |
| 133 | Ga0105239_12144592 | 3300010375 | Unclassified | 650 |
| 134 | Ga0105239_12274270 | 3300010375 | Bacteria | 631 |
| 135 | Ga0105239_13096906 | 3300010375 | Bacteria | 542 |
| 136 | Ga0105246_10140776 | 3300011119 | Bacteria | 1814 |
| 137 | Ga0157373_10031197 | 3300013100 | Bacteria | 3835 |
| 138 | Ga0157373_10215033 | 3300013100 | Bacteria | 1356 |
| 139 | Ga0157371_10749179 | 3300013102 | Bacteria | 733 |
| 140 | Ga0157371_10971181 | 3300013102 | Bacteria | 647 |
| 141 | Ga0157370_10002672 | 3300013104 | Bacteria | 21370 |
| 142 | Ga0157370_10003046 | 3300013104 | Bacteria | 19875 |
| 143 | Ga0157370_11299817 | 3300013104 | Bacteria | 655 |
| 144 | Ga0157370_12048284 | 3300013104 | Bacteria | 513 |
| 145 | Ga0157374_10274843 | 3300013296 | Bacteria | 1662 |
| 146 | Ga0157374_11789826 | 3300013296 | Unclassified | 639 |
| 147 | Ga0157378_10446043 | 3300013297 | Bacteria | 1283 |
| 148 | Ga0163162_10043027 | 3300013306 | Bacteria | 4521 |
| 149 | Ga0157372_10045700 | 3300013307 | Bacteria | 4859 |
| 150 | Ga0157372_10532628 | 3300013307 | Bacteria | 1369 |
| 151 | Ga0157372_10729583 | 3300013307 | Bacteria | 1152 |
| 152 | Ga0157375_11311746 | 3300013308 | Bacteria | 851 |
| 153 | Ga0157375_12523485 | 3300013308 | Bacteria | 614 |
| 154 | Ga0163163_10332564 | 3300014325 | Bacteria | 1574 |
| 155 | Ga0157380_10159165 | 3300014326 | Bacteria | 1961 |
| 156 | Ga0157380_11637400 | 3300014326 | Archaea | 700 |
| 157 | Ga0182008_10060110 | 3300014497 | Bacteria | 1874 |
| 158 | Ga0157377_10126535 | 3300014745 | Bacteria | 1555 |
| 159 | Ga0157377_10184610 | 3300014745 | Bacteria | 1314 |
| 160 | Ga0157377_11337333 | 3300014745 | Unclassified | 562 |
| 161 | Ga0157376_10001159 | 3300014969 | Bacteria | 17345 |
| 162 | Ga0157376_10119524 | 3300014969 | Bacteria | 2333 |
| 163 | Ga0157376_10637206 | 3300014969 | Bacteria | 1065 |
| 164 | Ga0182006_1000013 | 3300015261 | Bacteria | 363224 |
| 165 | Ga0182006_1003907 | 3300015261 | Bacteria | 7465 |
| 166 | Ga0182007_10030055 | 3300015262 | Bacteria | 1858 |
| 167 | Ga0183366_1002 | 3300015679 | Bacteria | 791639 |
| 168 | Ga0183370_1002 | 3300015680 | Bacteria | 791639 |
| 169 | Ga0183369_1002 | 3300015685 | Bacteria | 791621 |
| 170 | Ga0183368_1005 | 3300015687 | Bacteria | 791621 |
| 171 | Ga0163161_10010793 | 3300017792 | Bacteria | 6329 |
| 172 | Ga0163161_10125620 | 3300017792 | Bacteria | 1931 |
| 173 | Ga0163161_10430225 | 3300017792 | Bacteria | 1063 |
| 174 | Ga0163161_10433543 | 3300017792 | Bacteria | 1059 |
| 175 | Ga0213872_10207204 | 3300021361 | Bacteria | 838 |
| 176 | Ga0213876_10000329 | 3300021384 | Bacteria | 41529 |
| 177 | Ga0207426_1027655 | 3300025302 | Bacteria | 1887 |
| 178 | Ga0207656_10008020 | 3300025321 | Bacteria | 3872 |
| 179 | Ga0207696_1000024 | 3300025711 | Bacteria | 420123 |
| 180 | Ga0207696_1000361 | 3300025711 | Bacteria | 45553 |
| 181 | Ga0207655_1000044 | 3300025728 | Bacteria | 327511 |
| 182 | Ga0207655_1000047 | 3300025728 | Bacteria | 302548 |
| 183 | Ga0207655_1000050 | 3300025728 | Bacteria | 294923 |
| 184 | Ga0207655_1000079 | 3300025728 | Bacteria | 219036 |
| 185 | Ga0207655_1007857 | 3300025728 | Bacteria | 6860 |
| 186 | Ga0207655_1041194 | 3300025728 | Bacteria | 1982 |
| 187 | Ga0207713_1000033 | 3300025735 | Bacteria | 273751 |
| 188 | Ga0207713_1000134 | 3300025735 | Bacteria | 112419 |
| 189 | Ga0207713_1004277 | 3300025735 | Bacteria | 9311 |
| 190 | Ga0207713_1017199 | 3300025735 | Bacteria | 3638 |
| 191 | Ga0207713_1082750 | 3300025735 | Bacteria | 1149 |
| 192 | Ga0207713_1087163 | 3300025735 | Bacteria | 1107 |
| 193 | Ga0207682_10204939 | 3300025893 | Bacteria | 908 |
| 194 | Ga0207692_11197741 | 3300025898 | Bacteria | 504 |
| 195 | Ga0207642_10109118 | 3300025899 | Bacteria | 1405 |
| 196 | Ga0207710_10358912 | 3300025900 | Bacteria | 743 |
| 197 | Ga0207688_10046036 | 3300025901 | Bacteria | 2435 |
| 198 | Ga0207688_10187403 | 3300025901 | Bacteria | 1236 |
| 199 | Ga0207688_10369966 | 3300025901 | Bacteria | 885 |
| 200 | Ga0207645_10388259 | 3300025907 | Bacteria | 938 |
| 201 | Ga0207643_10053083 | 3300025908 | Bacteria | 2302 |
| 202 | Ga0207695_10200142 | 3300025913 | Bacteria | 1912 |
| 203 | Ga0207671_10357320 | 3300025914 | Bacteria | 1159 |
| 204 | Ga0207660_11334596 | 3300025917 | Bacteria | 582 |
| 205 | Ga0207657_10183351 | 3300025919 | Bacteria | 1691 |
| 206 | Ga0207652_10633734 | 3300025921 | Bacteria | 957 |
| 207 | Ga0207694_10080587 | 3300025924 | Bacteria | 2555 |
| 208 | Ga0207694_11556586 | 3300025924 | Bacteria | 558 |
| 209 | Ga0207650_10673351 | 3300025925 | Bacteria | 873 |
| 210 | Ga0207659_10453149 | 3300025926 | Bacteria | 1081 |
| 211 | Ga0207687_10245907 | 3300025927 | Bacteria | 1420 |
| 212 | Ga0207690_10041333 | 3300025932 | Bacteria | 3020 |
| 213 | Ga0207690_10088511 | 3300025932 | Bacteria | 2181 |
| 214 | Ga0207706_10055572 | 3300025933 | Bacteria | 3490 |
| 215 | Ga0207706_10088631 | 3300025933 | Bacteria | 2720 |
| 216 | Ga0207706_10199910 | 3300025933 | Bacteria | 1753 |
| 217 | Ga0207706_10537879 | 3300025933 | Bacteria | 1007 |
| 218 | Ga0207706_10661425 | 3300025933 | Unclassified | 894 |
| 219 | Ga0207706_10816548 | 3300025933 | Bacteria | 791 |
| 220 | Ga0207709_10133988 | 3300025935 | Bacteria | 1693 |
| 221 | Ga0207709_10152812 | 3300025935 | Bacteria | 1601 |
| 222 | Ga0207669_10070251 | 3300025937 | Bacteria | 2195 |
| 223 | Ga0207669_10138728 | 3300025937 | Bacteria | 1684 |
| 224 | Ga0207669_10360127 | 3300025937 | Bacteria | 1127 |
| 225 | Ga0207704_11106452 | 3300025938 | Bacteria | 673 |
| 226 | Ga0207704_11111826 | 3300025938 | Bacteria | 672 |
| 227 | Ga0207691_10468239 | 3300025940 | Bacteria | 1071 |
| 228 | Ga0207691_11475306 | 3300025940 | Bacteria | 557 |
| 229 | Ga0207689_11110740 | 3300025942 | Bacteria | 666 |
| 230 | Ga0207661_10990869 | 3300025944 | Bacteria | 774 |
| 231 | Ga0207661_11486073 | 3300025944 | Bacteria | 621 |
| 232 | Ga0207679_10642409 | 3300025945 | Bacteria | 959 |
| 233 | Ga0207712_10296010 | 3300025961 | Bacteria | 1326 |
| 234 | Ga0207668_10221869 | 3300025972 | Bacteria | 1519 |
| 235 | Ga0207668_10338908 | 3300025972 | Bacteria | 1253 |
| 236 | Ga0207668_11223816 | 3300025972 | Bacteria | 675 |
| 237 | Ga0207677_10268898 | 3300026023 | Bacteria | 1393 |
| 238 | Ga0207677_10603165 | 3300026023 | Bacteria | 964 |
| 239 | Ga0207639_10809457 | 3300026041 | Bacteria | 873 |
| 240 | Ga0207639_11197370 | 3300026041 | Bacteria | 713 |
| 241 | Ga0207678_10992686 | 3300026067 | Bacteria | 743 |
| 242 | Ga0207708_10008968 | 3300026075 | Bacteria | 7401 |
| 243 | Ga0207708_10185692 | 3300026075 | Bacteria | 1652 |
| 244 | Ga0207648_10085237 | 3300026089 | Bacteria | 2756 |
| 245 | Ga0207648_10826533 | 3300026089 | Bacteria | 863 |
| 246 | Ga0207648_10867424 | 3300026089 | Bacteria | 842 |
| 247 | Ga0207676_10258186 | 3300026095 | Bacteria | 1572 |
| 248 | Ga0207676_10452977 | 3300026095 | Bacteria | 1210 |
| 249 | Ga0207674_10000523 | 3300026116 | Bacteria | 50444 |
| 250 | Ga0207674_10370381 | 3300026116 | Bacteria | 1385 |
| 251 | Ga0207675_100068996 | 3300026118 | Bacteria | 3304 |
| 252 | Ga0207683_10063390 | 3300026121 | Bacteria | 3256 |
| 253 | Ga0207683_11905155 | 3300026121 | Bacteria | 543 |
| 254 | Ga0207698_10513908 | 3300026142 | Bacteria | 1168 |
| 255 | Ga0207698_11076101 | 3300026142 | Bacteria | 816 |
| 256 | Ga0209281_1000022 | 3300027111 | Bacteria | 522913 |
| 257 | Ga0209281_1000048 | 3300027111 | Bacteria | 322698 |
| 258 | Ga0209281_1000056 | 3300027111 | Bacteria | 307619 |
| 259 | Ga0209281_1000120 | 3300027111 | Bacteria | 206692 |
| 260 | Ga0209281_1000243 | 3300027111 | Bacteria | 110012 |
| 261 | Ga0209281_1000422 | 3300027111 | Bacteria | 63149 |
| 262 | Ga0209371_1000013 | 3300027312 | Bacteria | 691516 |
| 263 | Ga0209371_1000427 | 3300027312 | Bacteria | 43271 |
| 264 | Ga0209371_1001124 | 3300027312 | Bacteria | 19718 |
| 265 | Ga0209371_1023428 | 3300027312 | Bacteria | 1454 |
| 266 | Ga0209371_1032708 | 3300027312 | Bacteria | 1116 |
| 267 | Ga0209981_1013521 | 3300027378 | Bacteria | 1135 |
| 268 | Ga0210000_1011901 | 3300027462 | Bacteria | 1291 |
| 269 | Ga0209995_1020402 | 3300027471 | Bacteria | 1096 |
| 270 | Ga0209968_1004519 | 3300027526 | Bacteria | 2088 |
| 271 | Ga0209970_1035438 | 3300027614 | Bacteria | 877 |
| 272 | Ga0209970_1118694 | 3300027614 | Unclassified | 511 |
| 273 | Ga0210002_1052775 | 3300027617 | Bacteria | 702 |
| 274 | Ga0209971_1010608 | 3300027682 | Bacteria | 2183 |
| 275 | Ga0209998_10004283 | 3300027717 | Bacteria | 3039 |
| 276 | Ga0209998_10092432 | 3300027717 | Bacteria | 743 |
| 277 | Ga0209974_10005674 | 3300027876 | Bacteria | 4380 |
| 278 | Ga0207428_10037489 | 3300027907 | Bacteria | 3944 |
| 279 | Ga0207428_10411638 | 3300027907 | Bacteria | 989 |
| 280 | Ga0268266_10000041 | 3300028379 | Bacteria | 322311 |
| 281 | Ga0268266_10272578 | 3300028379 | Bacteria | 1571 |
| 282 | Ga0268266_11374800 | 3300028379 | Bacteria | 682 |
| 283 | Ga0265337_1000006 | 3300028556 | Bacteria | 99562 |
| 284 | Ga0265326_10000066 | 3300028558 | Bacteria | 59893 |
| 285 | Ga0265318_10109340 | 3300028577 | Bacteria | 1016 |
| 286 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 287 | Ga0265336_10001086 | 3300028666 | Bacteria | 13158 |
| 288 | Ga0265336_10010847 | 3300028666 | Bacteria | 3110 |
| 289 | Ga0265338_10059611 | 3300028800 | Bacteria | 3362 |
| 290 | Ga0265324_10000090 | 3300029957 | Bacteria | 70577 |
| 291 | Ga0265324_10000373 | 3300029957 | Bacteria | 32392 |
| 292 | Ga0265324_10000563 | 3300029957 | Bacteria | 25385 |
| 293 | Ga0265324_10007205 | 3300029957 | Bacteria | 4540 |
| 294 | Ga0265324_10012755 | 3300029957 | Bacteria | 3158 |
| 295 | Ga0268256_1000014 | 3300030500 | Bacteria | 691435 |
| 296 | Ga0268256_1000363 | 3300030500 | Bacteria | 43271 |
| 297 | Ga0268256_1021499 | 3300030500 | Bacteria | 1714 |
| 298 | Ga0268256_1026531 | 3300030500 | Bacteria | 1454 |
| 299 | Ga0316183_1179590 | 3300030742 | Bacteria | 619 |
| 300 | Ga0265330_10002315 | 3300031235 | Bacteria | 10458 |
| 301 | Ga0265332_10084963 | 3300031238 | Bacteria | 1341 |
| 302 | Ga0265332_10100953 | 3300031238 | Bacteria | 1217 |
| 303 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 304 | Ga0265320_10014802 | 3300031240 | Bacteria | 4425 |
| 305 | Ga0265325_10000153 | 3300031241 | Bacteria | 48971 |
| 306 | Ga0265329_10009135 | 3300031242 | Bacteria | 3716 |
| 307 | Ga0265329_10030273 | 3300031242 | Bacteria | 1764 |
| 308 | Ga0265340_10406738 | 3300031247 | Bacteria | 600 |
| 309 | Ga0265339_10008744 | 3300031249 | Bacteria | 6418 |
| 310 | Ga0265339_10011323 | 3300031249 | Bacteria | 5499 |
| 311 | Ga0265331_10002086 | 3300031250 | Bacteria | 13821 |
| 312 | Ga0265331_10002830 | 3300031250 | Bacteria | 11505 |
| 313 | Ga0265331_10029077 | 3300031250 | Bacteria | 2760 |
| 314 | Ga0265331_10085731 | 3300031250 | Bacteria | 1459 |
| 315 | Ga0265331_10092484 | 3300031250 | Bacteria | 1397 |
| 316 | Ga0265331_10116328 | 3300031250 | Bacteria | 1224 |
| 317 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 318 | Ga0265327_10000557 | 3300031251 | Bacteria | 63857 |
| 319 | Ga0265316_10053913 | 3300031344 | Bacteria | 3149 |
| 320 | Ga0265316_10141965 | 3300031344 | Bacteria | 1803 |
| 321 | Ga0265316_10635904 | 3300031344 | Bacteria | 755 |
| 322 | Ga0307408_101130955 | 3300031548 | Bacteria | 728 |
| 323 | Ga0265313_10009558 | 3300031595 | Bacteria | 6278 |
| 324 | Ga0316575_10000218 | 3300031665 | Bacteria | 15311 |
| 325 | Ga0316579_10079102 | 3300031691 | Bacteria | 1564 |
| 326 | Ga0316579_10162879 | 3300031691 | Unclassified | 1078 |
| 327 | Ga0265314_10000706 | 3300031711 | Bacteria | 40494 |
| 328 | Ga0265314_10000726 | 3300031711 | Bacteria | 39827 |
| 329 | Ga0265314_10009867 | 3300031711 | Bacteria | 8013 |
| 330 | Ga0265314_10014960 | 3300031711 | Bacteria | 6179 |
| 331 | Ga0265314_10030366 | 3300031711 | Bacteria | 4001 |
| 332 | Ga0265342_10161542 | 3300031712 | Bacteria | 1238 |
| 333 | Ga0265342_10605518 | 3300031712 | Bacteria | 552 |
| 334 | Ga0316576_10208429 | 3300031727 | Bacteria | 1471 |
| 335 | Ga0316576_10346584 | 3300031727 | Bacteria | 1105 |
| 336 | Ga0316576_10936803 | 3300031727 | Bacteria | 619 |
| 337 | Ga0316576_11103248 | 3300031727 | Bacteria | 563 |
| 338 | Ga0316578_10006169 | 3300031728 | Bacteria | 5889 |
| 339 | Ga0316578_10015116 | 3300031728 | Bacteria | 4143 |
| 340 | Ga0307405_10172546 | 3300031731 | Bacteria | 1544 |
| 341 | Ga0307405_12037849 | 3300031731 | Bacteria | 514 |
| 342 | Ga0316577_10019864 | 3300031733 | Bacteria | 3722 |
| 343 | Ga0307410_10305007 | 3300031852 | Bacteria | 1258 |
| 344 | Ga0307410_11239125 | 3300031852 | Bacteria | 651 |
| 345 | Ga0307406_10311375 | 3300031901 | Bacteria | 1214 |
| 346 | Ga0307406_10443369 | 3300031901 | Bacteria | 1040 |
| 347 | Ga0307406_10617996 | 3300031901 | Bacteria | 895 |
| 348 | Ga0307409_100318026 | 3300031995 | Bacteria | 1456 |
| 349 | Ga0307409_100337262 | 3300031995 | Bacteria | 1417 |
| 350 | Ga0307409_100835000 | 3300031995 | Bacteria | 931 |
| 351 | Ga0307409_100867404 | 3300031995 | Bacteria | 914 |
| 352 | Ga0307409_101252014 | 3300031995 | Bacteria | 766 |
| 353 | Ga0307409_101589845 | 3300031995 | Bacteria | 682 |
| 354 | Ga0307416_100355281 | 3300032002 | Bacteria | 1485 |
| 355 | Ga0307416_100590156 | 3300032002 | Bacteria | 1189 |
| 356 | Ga0307416_100761242 | 3300032002 | Bacteria | 1062 |
| 357 | Ga0307414_10520077 | 3300032004 | Bacteria | 1056 |
| 358 | Ga0307411_10131892 | 3300032005 | Bacteria | 1828 |
| 359 | Ga0307415_100017705 | 3300032126 | Bacteria | 4278 |
| 360 | Ga0307415_100256525 | 3300032126 | Bacteria | 1424 |
| 361 | Ga0307415_100375335 | 3300032126 | Bacteria | 1206 |
| 362 | Ga0307415_101812081 | 3300032126 | Bacteria | 591 |
| 363 | Ga0316585_10016316 | 3300032137 | Bacteria | 2236 |
| 364 | Ga0316580_10002910 | 3300032139 | Bacteria | 4796 |
| 365 | Ga0316580_10011437 | 3300032139 | Bacteria | 2694 |
| 366 | Ga0316593_10005031 | 3300032168 | Bacteria | 3451 |
| 367 | Ga0316593_10062511 | 3300032168 | Bacteria | 1275 |
| 368 | Ga0316592_1000666 | 3300033524 | Bacteria | 5018 |
| 369 | Ga0316592_1011089 | 3300033524 | Bacteria | 1827 |
| 370 | Ga0316588_1000764 | 3300033528 | Bacteria | 4783 |
| 371 | Ga0316588_1002158 | 3300033528 | Unclassified | 3387 |
| 372 | Ga0316588_1005250 | 3300033528 | Bacteria | 2510 |
| 373 | Ga0316596_1023746 | 3300033541 | Bacteria | 1572 |
| 374 | Ga0316596_1039709 | 3300033541 | Bacteria | 1235 |
| 375 | Ga0373923_0099501 | 3300035111 | Bacteria | 1281 |
| 376 | Ga0373939_0256780 | 3300035114 | Bacteria | 682 |
| 377 | Ga0373943_0016826 | 3300035170 | Bacteria | 3341 |
| 378 | Ga0316574_0004273 | 3300035398 | Bacteria | 7462 |
| 379 | Ga0316574_0267348 | 3300035398 | Bacteria | 1091 |
| 380 | Ga0373937_0322391 | 3300036401 | Bacteria | 1462 |
| 381 | Ga0373937_0472246 | 3300036401 | Bacteria | 1191 |
| 382 | Ga0316582_0024850 | 3300036647 | Bacteria | 3590 |
| 383 | Ga0316582_0048224 | 3300036647 | Bacteria | 2692 |
| 384 | Ga0316584_0010338 | 3300036712 | Bacteria | 6517 |
| 385 | Ga0316584_0025194 | 3300036712 | Bacteria | 4360 |
| 386 | Ga0373925_0185656 | 3300037068 | Bacteria | 1648 |
| 387 | Ga0395900_0497810 | 3300037418 | Bacteria | 1169 |
| 388 | Ga0395900_1013836 | 3300037418 | Bacteria | 750 |
| 389 | Ga0395898_0404186 | 3300037466 | Bacteria | 1302 |
| 390 | Ga0316581_0065812 | 3300037588 | Bacteria | 1113 |
| 391 | Ga0395901_1652744 | 3300038443 | Bacteria | 593 |
| 392 | Ga0400490_40590 | 3300038726 | Bacteria | 7008 |
| 393 | Ga0400488_62682 | 3300038741 | Bacteria | 2177 |
| 394 | Ga0400483_220832 | 3300039062 | Unclassified | 1415 |
| 395 | Ga0400487_14017 | 3300039110 | Bacteria | 10114 |
| 396 | Ga0436365_0042508 | 3300039437 | Bacteria | 41569 |
| 397 | Ga0436361_0333442 | 3300039447 | Bacteria | 1496 |
| 398 | Ga0436361_0883668 | 3300039447 | Bacteria | 1638 |
| 399 | Ga0436361_0989063 | 3300039447 | Bacteria | 4557 |
| 400 | Ga0439438_003218 | 3300041405 | Bacteria | 6678 |
| 401 | Ga0439438_012978 | 3300041405 | Bacteria | 2532 |
| 402 | Ga0439447_017639 | 3300041407 | Bacteria | 1941 |
| 403 | Ga0439466_0000004 | 3300041411 | Bacteria | 462654 |
| 404 | Ga0439465_0363704 | 3300041413 | Bacteria | 548 |
| 405 | Ga0451795_0594414 | 3300041456 | Bacteria | 1103 |
| 406 | Ga0451802_0235268 | 3300041460 | Bacteria | 1307 |
| 407 | Ga0451807_0974327 | 3300041486 | Bacteria | 884 |
| 408 | Ga0451841_0791043 | 3300041498 | Bacteria | 1534 |
| 409 | Ga0451843_0406932 | 3300041509 | Bacteria | 1310 |
| 410 | Ga0451853_0823009 | 3300041512 | Bacteria | 2312 |
| 411 | Ga0451853_2427319 | 3300041512 | Bacteria | 7107 |
| 412 | Ga0439448_0049540 | 3300042005 | Bacteria | 1373 |
| 413 | Ga0439432_019605 | 3300042006 | Bacteria | 2252 |
| 414 | Ga0439432_027215 | 3300042006 | Bacteria | 1868 |
| 415 | Ga0439450_033216 | 3300042008 | Bacteria | 1169 |
| 416 | Ga0439452_000011 | 3300042010 | Bacteria | 428451 |
| 417 | Ga0439452_000344 | 3300042010 | Bacteria | 28832 |
| 418 | Ga0439452_002524 | 3300042010 | Bacteria | 6730 |
| 419 | Ga0439452_028288 | 3300042010 | Bacteria | 1400 |
| 420 | Ga0439463_001507 | 3300042016 | Bacteria | 6145 |
| 421 | Ga0450902_052006 | 3300042137 | Bacteria | 704 |
| 422 | Ga0450907_000221 | 3300042146 | Bacteria | 19992 |
| 423 | Ga0439458_0012813 | 3300042157 | Bacteria | 1884 |
| 424 | Ga0439459_0026302 | 3300042438 | Bacteria | 1155 |
| 425 | Ga0439464_0001655 | 3300042439 | Bacteria | 5323 |
| 426 | Ga0439464_0010134 | 3300042439 | Bacteria | 2488 |
| 427 | Ga0439460_0067812 | 3300042461 | Bacteria | 1100 |
| 428 | Ga0451577_0000085 | 3300042876 | Bacteria | 211141 |
| 429 | Ga0451577_0003720 | 3300042876 | Bacteria | 16669 |
| 430 | Ga0451577_0089801 | 3300042876 | Bacteria | 2742 |
| 431 | Ga0451577_0117305 | 3300042876 | Bacteria | 2384 |
| 432 | Ga0451577_0129463 | 3300042876 | Bacteria | 2264 |
| 433 | Ga0439440_0042499 | 3300042993 | Bacteria | 1112 |
| 434 | Ga0466981_0000001 | 3300044669 | Bacteria | 367980 |
| 435 | Ga0453683_0000047 | 3300044673 | Bacteria | 207763 |
| 436 | Ga0466966_0074125 | 3300044684 | Bacteria | 2128 |
| 437 | Ga0466963_0047730 | 3300044694 | Bacteria | 2827 |
| 438 | Ga0466964_0169087 | 3300044706 | Bacteria | 1028 |
| 439 | Ga0453684_0000273 | 3300044712 | Bacteria | 222658 |
| 440 | Ga0453684_0000302 | 3300044712 | Bacteria | 207763 |
| 441 | Ga0453684_0012535 | 3300044712 | Bacteria | 13956 |
| 442 | Ga0453684_0173338 | 3300044712 | Bacteria | 2540 |
| 443 | Ga0453684_0431915 | 3300044712 | Bacteria | 1469 |
| 444 | Ga0466970_0704601 | 3300044765 | Bacteria | 589 |
| 445 | Ga0466960_0054641 | 3300044901 | Bacteria | 1940 |
| 446 | Ga0466960_0183222 | 3300044901 | Bacteria | 1136 |
| 447 | Ga0466959_0522741 | 3300045049 | Bacteria | 801 |
| 448 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 449 | Ga0451576_0000116 | 3300045051 | Bacteria | 207763 |
| 450 | Ga0451576_0000652 | 3300045051 | Bacteria | 71674 |
| 451 | Ga0451576_0000868 | 3300045051 | Bacteria | 58132 |
| 452 | Ga0451576_1271666 | 3300045051 | Bacteria | 767 |
| 453 | Ga0451576_1905486 | 3300045051 | Bacteria | 613 |
| 454 | Ga0466967_0170697 | 3300045976 | Bacteria | 2046 |
| 455 | Ga0466967_0214795 | 3300045976 | Bacteria | 1825 |
| 456 | Ga0466967_0499940 | 3300045976 | Bacteria | 1193 |
| 457 | Ga0466967_1509989 | 3300045976 | Bacteria | 669 |
| 458 | Ga0495603_0000258 | 3300046455 | Bacteria | 27900 |
| 459 | Ga0495591_013966 | 3300046458 | Bacteria | 2910 |
| 460 | Ga0495641_0274632 | 3300046461 | Bacteria | 758 |
| 461 | Ga0495650_0000059 | 3300046471 | Bacteria | 296253 |
| 462 | Ga0495596_0230626 | 3300046500 | Bacteria | 719 |
| 463 | Ga0495643_0075647 | 3300046522 | Bacteria | 1761 |
| 464 | Ga0495648_0006032 | 3300046524 | Bacteria | 9948 |
| 465 | Ga0495667_0000047 | 3300046559 | Bacteria | 117718 |
| 466 | Ga0495668_0645974 | 3300046616 | Bacteria | 585 |
| 467 | Ga0495660_0008440 | 3300046810 | Bacteria | 6032 |
| 468 | Ga0495672_0000025 | 3300047320 | Bacteria | 365425 |
| 469 | Ga0495680_0003506 | 3300047322 | Bacteria | 15387 |
| 470 | Ga0495679_002550 | 3300047446 | Bacteria | 9194 |
| 471 | Ga0495684_0127354 | 3300047471 | Bacteria | 1915 |
| 472 | Ga0496100_0046797 | 3300048903 | Bacteria | 2784 |
| 473 | Ga0496100_0220279 | 3300048903 | Bacteria | 1392 |
| 474 | Ga0496100_0306909 | 3300048903 | Bacteria | 1189 |
| 475 | Ga0496100_1008716 | 3300048903 | Bacteria | 655 |
| 476 | Ga0496101_0132458 | 3300048904 | Bacteria | 1894 |
| 477 | Ga0496101_0672143 | 3300048904 | Bacteria | 818 |
| 478 | Ga0496101_1058770 | 3300048904 | Bacteria | 637 |
| 479 | Ga0496102_0473250 | 3300048905 | Bacteria | 1174 |
| 480 | Ga0496102_0800989 | 3300048905 | Bacteria | 864 |
| 481 | Ga0496103_0333341 | 3300048906 | Bacteria | 976 |
| 482 | Ga0496104_0000680 | 3300048907 | Bacteria | 29268 |
| 483 | Ga0496104_0811525 | 3300048907 | Unclassified | 842 |
| 484 | Ga0496105_0006095 | 3300048908 | Bacteria | 9228 |
| 485 | Ga0496105_0009823 | 3300048908 | Bacteria | 7498 |
| 486 | Ga0496107_0313840 | 3300048910 | Bacteria | 1167 |
| 487 | Ga0496108_0050129 | 3300048911 | Bacteria | 3494 |
| 488 | Ga0496108_0215378 | 3300048911 | Bacteria | 1668 |
| 489 | Ga0496109_0046553 | 3300048912 | Bacteria | 3940 |
| 490 | Ga0496109_1859070 | 3300048912 | Bacteria | 535 |
| 491 | Ga0496110_0453927 | 3300048913 | Bacteria | 1168 |
| 492 | Ga0496110_0460644 | 3300048913 | Bacteria | 1159 |
| 493 | Ga0496110_1058572 | 3300048913 | Archaea | 719 |
| 494 | Ga0496110_1531880 | 3300048913 | Bacteria | 577 |
| 495 | Ga0496110_1812624 | 3300048913 | Bacteria | 520 |
| 496 | Ga0496113_0462794 | 3300048916 | Bacteria | 1019 |
| 497 | Ga0496113_0559873 | 3300048916 | Bacteria | 917 |
| 498 | Ga0496114_0004317 | 3300048917 | Bacteria | 10999 |
| 499 | Ga0496114_0007017 | 3300048917 | Bacteria | 8886 |
| 500 | Ga0496115_1344821 | 3300048918 | Unclassified | 530 |
| 501 | Ga0496116_0002364 | 3300048919 | Bacteria | 19954 |
| 502 | Ga0496116_0067587 | 3300048919 | Bacteria | 2281 |
| 503 | Ga0496116_0105035 | 3300048919 | Bacteria | 1676 |
| 504 | Ga0496117_0000168 | 3300048920 | Bacteria | 137886 |
| 505 | Ga0496118_0000075 | 3300048921 | Bacteria | 196228 |
| 506 | Ga0496118_0000304 | 3300048921 | Bacteria | 85277 |
| 507 | Ga0496118_0000996 | 3300048921 | Bacteria | 44151 |
| 508 | Ga0496119_0000281 | 3300048922 | Bacteria | 71482 |
| 509 | Ga0496119_0017781 | 3300048922 | Bacteria | 5329 |
| 510 | Ga0496120_0000363 | 3300048923 | Bacteria | 73708 |
| 511 | Ga0496120_0013938 | 3300048923 | Bacteria | 5379 |
| 512 | Ga0496120_0147265 | 3300048923 | Bacteria | 1187 |
| 513 | Ga0496121_0000057 | 3300048924 | Bacteria | 294291 |
| 514 | Ga0496121_0020822 | 3300048924 | Bacteria | 6462 |
| 515 | Ga0496121_0669107 | 3300048924 | Bacteria | 629 |
| 516 | Ga0496122_0002021 | 3300048925 | Bacteria | 30149 |
| 517 | Ga0496122_0002096 | 3300048925 | Bacteria | 29548 |
| 518 | Ga0496122_0043786 | 3300048925 | Bacteria | 3502 |
| 519 | Ga0496122_0069982 | 3300048925 | Bacteria | 2510 |
| 520 | Ga0496123_0000605 | 3300048926 | Bacteria | 60923 |
| 521 | Ga0496123_0002325 | 3300048926 | Bacteria | 23867 |
| 522 | Ga0496123_0031853 | 3300048926 | Bacteria | 3827 |
| 523 | Ga0496123_0472030 | 3300048926 | Bacteria | 554 |
| 524 | Ga0496124_0001851 | 3300048927 | Bacteria | 29214 |
| 525 | Ga0496124_0133469 | 3300048927 | Bacteria | 1969 |
| 526 | Ga0496124_0177748 | 3300048927 | Bacteria | 1641 |
| 527 | Ga0496125_0000081 | 3300048928 | Bacteria | 228069 |
| 528 | Ga0496125_0003562 | 3300048928 | Bacteria | 18755 |
| 529 | Ga0496125_0007362 | 3300048928 | Bacteria | 11720 |
| 530 | Ga0496125_0022828 | 3300048928 | Bacteria | 5797 |
| 531 | Ga0496126_0001662 | 3300048929 | Bacteria | 33392 |
| 532 | Ga0496126_0005302 | 3300048929 | Bacteria | 14797 |
| 533 | Ga0496126_0155487 | 3300048929 | Bacteria | 1957 |
| 534 | Ga0496126_0394059 | 3300048929 | Bacteria | 1124 |
| 535 | Ga0496126_0408706 | 3300048929 | Bacteria | 1099 |
| 536 | Ga0501031_0004039 | 3300049568 | Bacteria | 9468 |
| 537 | Ga0501031_0008281 | 3300049568 | Bacteria | 6764 |
| 538 | Ga0501031_0058685 | 3300049568 | Bacteria | 2508 |
| 539 | Ga0501031_0110192 | 3300049568 | Bacteria | 1797 |
| 540 | Ga0501032_0001373 | 3300049569 | Bacteria | 19318 |
| 541 | Ga0501032_0007089 | 3300049569 | Bacteria | 8214 |
| 542 | Ga0501032_0059099 | 3300049569 | Bacteria | 2573 |
| 543 | Ga0501033_0000949 | 3300049570 | Bacteria | 26319 |
| 544 | Ga0501033_0001864 | 3300049570 | Bacteria | 18331 |
| 545 | Ga0501033_0059974 | 3300049570 | Bacteria | 2808 |
| 546 | Ga0501033_0699024 | 3300049570 | Bacteria | 690 |
| 547 | Ga0501034_0024559 | 3300049571 | Bacteria | 6130 |
| 548 | Ga0501034_0047437 | 3300049571 | Bacteria | 4337 |
| 549 | Ga0501034_0173483 | 3300049571 | Bacteria | 2123 |
| 550 | Ga0501034_0541825 | 3300049571 | Bacteria | 1074 |
| 551 | Ga0501036_0000382 | 3300049572 | Bacteria | 31346 |
| 552 | Ga0501036_0001661 | 3300049572 | Bacteria | 17238 |
| 553 | Ga0501036_0035605 | 3300049572 | Bacteria | 4211 |
| 554 | Ga0501037_0000474 | 3300049573 | Bacteria | 32555 |
| 555 | Ga0501037_0051116 | 3300049573 | Bacteria | 3023 |
| 556 | Ga0501037_0193442 | 3300049573 | Bacteria | 1440 |
| 557 | Ga0501037_0358177 | 3300049573 | Bacteria | 1005 |
| 558 | Ga0501037_0711826 | 3300049573 | Bacteria | 667 |
| 559 | Ga0501038_0008209 | 3300049574 | Bacteria | 9604 |
| 560 | Ga0501038_0019437 | 3300049574 | Bacteria | 6122 |
| 561 | Ga0501038_0023864 | 3300049574 | Bacteria | 5461 |
| 562 | Ga0501038_0076883 | 3300049574 | Bacteria | 2819 |
| 563 | Ga0501038_0130565 | 3300049574 | Bacteria | 2063 |
| 564 | Ga0501038_0137944 | 3300049574 | Bacteria | 1997 |
| 565 | Ga0501038_0336957 | 3300049574 | Bacteria | 1177 |
| 566 | Ga0501039_0002238 | 3300049575 | Bacteria | 14325 |
| 567 | Ga0501039_0037165 | 3300049575 | Bacteria | 3758 |
| 568 | Ga0501039_0043176 | 3300049575 | Bacteria | 3483 |
| 569 | Ga0501039_0044783 | 3300049575 | Bacteria | 3418 |
| 570 | Ga0501040_0003365 | 3300049576 | Bacteria | 10322 |
| 571 | Ga0501040_0076944 | 3300049576 | Bacteria | 2308 |
| 572 | Ga0501041_1016395 | 3300049577 | Bacteria | 533 |
| 573 | Ga0501042_0084446 | 3300049578 | Bacteria | 2276 |
| 574 | Ga0501042_0825969 | 3300049578 | Bacteria | 675 |
| 575 | Ga0501043_0007578 | 3300049579 | Bacteria | 8603 |
| 576 | Ga0501043_0008971 | 3300049579 | Bacteria | 7869 |
| 577 | Ga0501043_0083051 | 3300049579 | Bacteria | 2518 |
| 578 | Ga0501046_0002898 | 3300049580 | Bacteria | 15906 |
| 579 | Ga0501046_0011564 | 3300049580 | Bacteria | 7548 |
| 580 | Ga0501046_0700086 | 3300049580 | Bacteria | 714 |
| 581 | Ga0501047_0005810 | 3300049581 | Bacteria | 11613 |
| 582 | Ga0501047_0108224 | 3300049581 | Bacteria | 2662 |
| 583 | Ga0501048_0059590 | 3300049582 | Bacteria | 2705 |
| 584 | Ga0501048_0400031 | 3300049582 | Bacteria | 982 |
| 585 | Ga0501068_0002905 | 3300049584 | Bacteria | 9121 |
| 586 | Ga0501068_0172686 | 3300049584 | Bacteria | 1365 |
| 587 | Ga0501070_0429924 | 3300049586 | Bacteria | 1066 |
| 588 | Ga0501071_0472784 | 3300049587 | Bacteria | 960 |
| 589 | Ga0501071_0757423 | 3300049587 | Bacteria | 748 |
| 590 | Ga0501072_0034667 | 3300049588 | Bacteria | 3956 |
| 591 | Ga0501073_0642907 | 3300049589 | Bacteria | 732 |
| 592 | Ga0501074_0313318 | 3300049590 | Bacteria | 1115 |
| 593 | Ga0501075_0444772 | 3300049591 | Bacteria | 988 |
| 594 | Ga0501076_0630063 | 3300049592 | Bacteria | 885 |
| 595 | Ga0501077_0128707 | 3300049593 | Bacteria | 1605 |
| 596 | Ga0501201_031051 | 3300049651 | Bacteria | 609 |
| 597 | Ga0501079_0183796 | 3300049741 | Bacteria | 1632 |
| 598 | Ga0501080_1065275 | 3300049742 | Bacteria | 699 |
| 599 | Ga0501080_1151802 | 3300049742 | Bacteria | 668 |
| 600 | Ga0501035_0001429 | 3300049822 | Bacteria | 24468 |
| 601 | Ga0501035_0001968 | 3300049822 | Bacteria | 20568 |
| 602 | Ga0501035_0009680 | 3300049822 | Bacteria | 8963 |
| 603 | Ga0501035_0076193 | 3300049822 | Bacteria | 2966 |
| 604 | Ga0501035_0651072 | 3300049822 | Bacteria | 854 |
| 605 | Ga0501044_0000111 | 3300049823 | Bacteria | 100080 |
| 606 | Ga0501044_0018048 | 3300049823 | Bacteria | 7567 |
| 607 | Ga0501044_0025482 | 3300049823 | Bacteria | 6269 |
| 608 | Ga0501044_0053451 | 3300049823 | Bacteria | 4155 |
| 609 | Ga0501044_0259856 | 3300049823 | Bacteria | 1675 |
| 610 | Ga0501044_0278379 | 3300049823 | Bacteria | 1607 |
| 611 | Ga0501045_0003419 | 3300049824 | Bacteria | 10863 |
| 612 | Ga0501045_0271813 | 3300049824 | Bacteria | 1262 |
| 613 | nmdc:mga00v17_6047_c1 | 3300050491 | Bacteria | 6404 |
| 614 | nmdc:mga0yw44_478990_c1 | 3300050492 | Bacteria | 844 |
| 615 | nmdc:mga0yw44_651572_c1 | 3300050492 | Bacteria | 716 |
| 616 | nmdc:mga0k408_4578_c1 | 3300050493 | Bacteria | 7341 |
| 617 | nmdc:mga05p37_1595478_c1 | 3300050507 | Bacteria | 643 |
| 618 | nmdc:mga05p37_899665_c1 | 3300050507 | Bacteria | 954 |
| 619 | nmdc:mga05p37_907138_c1 | 3300050507 | Bacteria | 949 |
| 620 | nmdc:mga09592_404646_c1 | 3300050508 | Bacteria | 1179 |
| 621 | nmdc:mga0qj67_405998_c1 | 3300050509 | Bacteria | 1099 |
| 622 | nmdc:mga0qj67_686457_c1 | 3300050509 | Bacteria | 815 |
| 623 | nmdc:mga06r32_1649980_c1 | 3300050510 | Bacteria | 579 |
| 624 | nmdc:mga06r32_970495_c1 | 3300050510 | Bacteria | 803 |
| 625 | nmdc:mga08y16_342400_c1 | 3300050511 | Bacteria | 1537 |
| 626 | nmdc:mga08y16_775092_c1 | 3300050511 | Bacteria | 954 |
| 627 | Ga0500604_0143311 | 3300053151 | Bacteria | 809 |
| 628 | Ga0500633_0251248 | 3300053160 | Bacteria | 657 |
| 629 | Ga0501084_0324607 | 3300054114 | Bacteria | 1300 |
| 630 | Ga0587067_160100 | 3300059640 | Bacteria | 572 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0704601 | Ga0466970_0704601_216_536 | 103 |
| 2 | 3300037418 | Ga0395900_1013836 | Ga0395900_1013836_233_619 | 107 |
| 3 | 3300005549 | Ga0070704_101716838 | Ga0070704_1017168381 | 112 |
| 4 | 3300005467 | Ga0070706_100788510 | Ga0070706_1007885102 | 115 |
| 5 | 3300005471 | Ga0070698_100589616 | Ga0070698_1005896162 | 115 |
| 6 | 3300009147 | Ga0114129_10432163 | Ga0114129_104321632 | 115 |
| 7 | 3300035111 | Ga0373923_0099501 | Ga0373923_0099501_630_995 | 121 |
| 8 | 3300036401 | Ga0373937_0472246 | Ga0373937_0472246_745_1110 | 121 |
| 9 | 3300014969 | Ga0157376_10001159 | Ga0157376_100011595 | 122 |
| 10 | iso_pu_bacteria | 2734482258 | 2735816257 | 122 |
| 11 | iso_pu_bacteria | 2511231020 | 2511349542 | 123 |
| 12 | iso_pu_bacteria | 2511231021 | 2511359274 | 123 |
| 13 | iso_pu_bacteria | 2904550169 | 2904551378 | 123 |
| 14 | iso_pu_bacteria | 2990196909 | 2990197159 | 123 |
| 15 | 3300005844 | Ga0068862_102067149 | Ga0068862_1020671492 | 124 |
| 16 | 3300005981 | Ga0081538_10153090 | Ga0081538_101530902 | 124 |
| 17 | 3300006038 | Ga0075365_10202724 | Ga0075365_102027242 | 124 |
| 18 | 3300006038 | Ga0075365_10534960 | Ga0075365_105349602 | 124 |
| 19 | 3300009147 | Ga0114129_11947353 | Ga0114129_119473531 | 124 |
| 20 | 3300025924 | Ga0207694_11556586 | Ga0207694_115565861 | 124 |
| 21 | 3300031901 | Ga0307406_10617996 | Ga0307406_106179962 | 124 |
| 22 | 3300049587 | Ga0501071_0472784 | Ga0501071_0472784_525_908 | 124 |
| 23 | 3300050492 | nmdc:mga0yw44_478990_c1 | nmdc:mga0yw44_478990_c1_73_456 | 124 |
| 24 | 3300050492 | nmdc:mga0yw44_651572_c1 | nmdc:mga0yw44_651572_c1_20_403 | 124 |
| 25 | 3300050507 | nmdc:mga05p37_907138_c1 | nmdc:mga05p37_907138_c1_22_405 | 124 |
| 26 | 3300050510 | nmdc:mga06r32_970495_c1 | nmdc:mga06r32_970495_c1_25_417 | 124 |
| 27 | iso_pu_bacteria | 2844528606 | 2844530260 | 124 |
| 28 | iso_pu_bacteria | 2865014394 | 2865016384 | 124 |
| 29 | iso_pu_bacteria | 2919534386 | 2919535366 | 124 |
| 30 | iso_pu_bacteria | 2945951305 | 2945951685 | 124 |
| 31 | 3300001990 | JGI24737J22298_10132570 | JGI24737J22298_101325702 | 125 |
| 32 | 3300001990 | JGI24737J22298_10249692 | JGI24737J22298_102496922 | 125 |
| 33 | 3300005328 | Ga0070676_10989659 | Ga0070676_109896591 | 125 |
| 34 | 3300005329 | Ga0070683_100434434 | Ga0070683_1004344341 | 125 |
| 35 | 3300005329 | Ga0070683_100506196 | Ga0070683_1005061962 | 125 |
| 36 | 3300005331 | Ga0070670_100111084 | Ga0070670_1001110842 | 125 |
| 37 | 3300005339 | Ga0070660_100178743 | Ga0070660_1001787432 | 125 |
| 38 | 3300005339 | Ga0070660_100180346 | Ga0070660_1001803462 | 125 |
| 39 | 3300005345 | Ga0070692_10149802 | Ga0070692_101498022 | 125 |
| 40 | 3300005345 | Ga0070692_10525721 | Ga0070692_105257212 | 125 |
| 41 | 3300005356 | Ga0070674_100096087 | Ga0070674_1000960872 | 125 |
| 42 | 3300005366 | Ga0070659_100213804 | Ga0070659_1002138042 | 125 |
| 43 | 3300005366 | Ga0070659_100294518 | Ga0070659_1002945182 | 125 |
| 44 | 3300005366 | Ga0070659_100349134 | Ga0070659_1003491341 | 125 |
| 45 | 3300005441 | Ga0070700_100211893 | Ga0070700_1002118932 | 125 |
| 46 | 3300005456 | Ga0070678_100649993 | Ga0070678_1006499932 | 125 |
| 47 | 3300005459 | Ga0068867_100094504 | Ga0068867_1000945042 | 125 |
| 48 | 3300005535 | Ga0070684_100156192 | Ga0070684_1001561922 | 125 |
| 49 | 3300005539 | Ga0068853_102215244 | Ga0068853_1022152441 | 125 |
| 50 | 3300005548 | Ga0070665_100528192 | Ga0070665_1005281922 | 125 |
| 51 | 3300005549 | Ga0070704_101118305 | Ga0070704_1011183051 | 125 |
| 52 | 3300005564 | Ga0070664_100677286 | Ga0070664_1006772862 | 125 |
| 53 | 3300005577 | Ga0068857_100552569 | Ga0068857_1005525692 | 125 |
| 54 | 3300005578 | Ga0068854_100367615 | Ga0068854_1003676152 | 125 |
| 55 | 3300005614 | Ga0068856_101011039 | Ga0068856_1010110392 | 125 |
| 56 | 3300005615 | Ga0070702_100421497 | Ga0070702_1004214972 | 125 |
| 57 | 3300005616 | Ga0068852_100309410 | Ga0068852_1003094102 | 125 |
| 58 | 3300005616 | Ga0068852_100802136 | Ga0068852_1008021362 | 125 |
| 59 | 3300005616 | Ga0068852_101740695 | Ga0068852_1017406952 | 125 |
| 60 | 3300005617 | Ga0068859_100654263 | Ga0068859_1006542632 | 125 |
| 61 | 3300005618 | Ga0068864_100348964 | Ga0068864_1003489642 | 125 |
| 62 | 3300005718 | Ga0068866_10058288 | Ga0068866_100582882 | 125 |
| 63 | 3300005718 | Ga0068866_10147682 | Ga0068866_101476822 | 125 |
| 64 | 3300005719 | Ga0068861_100148538 | Ga0068861_1001485382 | 125 |
| 65 | 3300005719 | Ga0068861_100751999 | Ga0068861_1007519992 | 125 |
| 66 | 3300005840 | Ga0068870_10068796 | Ga0068870_100687961 | 125 |
| 67 | 3300005844 | Ga0068862_101169748 | Ga0068862_1011697482 | 125 |
| 68 | 3300006038 | Ga0075365_10568514 | Ga0075365_105685142 | 125 |
| 69 | 3300006844 | Ga0075428_100520963 | Ga0075428_1005209632 | 125 |
| 70 | 3300006844 | Ga0075428_100946318 | Ga0075428_1009463182 | 125 |
| 71 | 3300006847 | Ga0075431_101912686 | Ga0075431_1019126862 | 125 |
| 72 | 3300006881 | Ga0068865_100498683 | Ga0068865_1004986832 | 125 |
| 73 | 3300006931 | Ga0097620_100654301 | Ga0097620_1006543012 | 125 |
| 74 | 3300009094 | Ga0111539_10980384 | Ga0111539_109803842 | 125 |
| 75 | 3300009098 | Ga0105245_10228854 | Ga0105245_102288542 | 125 |
| 76 | 3300009147 | Ga0114129_11562474 | Ga0114129_115624742 | 125 |
| 77 | 3300009147 | Ga0114129_11836492 | Ga0114129_118364921 | 125 |
| 78 | 3300009148 | Ga0105243_11058440 | Ga0105243_110584402 | 125 |
| 79 | 3300009148 | Ga0105243_11219786 | Ga0105243_112197862 | 125 |
| 80 | 3300009176 | Ga0105242_10890407 | Ga0105242_108904072 | 125 |
| 81 | 3300009176 | Ga0105242_11471207 | Ga0105242_114712072 | 125 |
| 82 | 3300009177 | Ga0105248_10596542 | Ga0105248_105965422 | 125 |
| 83 | 3300009177 | Ga0105248_12053276 | Ga0105248_120532762 | 125 |
| 84 | 3300009553 | Ga0105249_10422390 | Ga0105249_104223902 | 125 |
| 85 | 3300010375 | Ga0105239_12274270 | Ga0105239_122742702 | 125 |
| 86 | 3300013102 | Ga0157371_10749179 | Ga0157371_107491792 | 125 |
| 87 | 3300013104 | Ga0157370_12048284 | Ga0157370_120482841 | 125 |
| 88 | 3300013297 | Ga0157378_10446043 | Ga0157378_104460432 | 125 |
| 89 | 3300013307 | Ga0157372_10729583 | Ga0157372_107295832 | 125 |
| 90 | 3300013308 | Ga0157375_11311746 | Ga0157375_113117462 | 125 |
| 91 | 3300013308 | Ga0157375_12523485 | Ga0157375_125234852 | 125 |
| 92 | 3300014325 | Ga0163163_10332564 | Ga0163163_103325642 | 125 |
| 93 | 3300014326 | Ga0157380_10159165 | Ga0157380_101591652 | 125 |
| 94 | 3300014326 | Ga0157380_11637400 | Ga0157380_116374001 | 125 |
| 95 | 3300014745 | Ga0157377_10126535 | Ga0157377_101265352 | 125 |
| 96 | 3300014745 | Ga0157377_10184610 | Ga0157377_101846102 | 125 |
| 97 | 3300014745 | Ga0157377_11337333 | Ga0157377_113373332 | 125 |
| 98 | 3300017792 | Ga0163161_10430225 | Ga0163161_104302252 | 125 |
| 99 | 3300017792 | Ga0163161_10433543 | Ga0163161_104335432 | 125 |
| 100 | 3300025302 | Ga0207426_1027655 | Ga0207426_10276554 | 125 |
| 101 | 3300025893 | Ga0207682_10204939 | Ga0207682_102049392 | 125 |
| 102 | 3300025898 | Ga0207692_11197741 | Ga0207692_111977411 | 125 |
| 103 | 3300025899 | Ga0207642_10109118 | Ga0207642_101091182 | 125 |
| 104 | 3300025901 | Ga0207688_10046036 | Ga0207688_100460363 | 125 |
| 105 | 3300025901 | Ga0207688_10187403 | Ga0207688_101874032 | 125 |
| 106 | 3300025901 | Ga0207688_10369966 | Ga0207688_103699662 | 125 |
| 107 | 3300025908 | Ga0207643_10053083 | Ga0207643_100530832 | 125 |
| 108 | 3300025919 | Ga0207657_10183351 | Ga0207657_101833512 | 125 |
| 109 | 3300025925 | Ga0207650_10673351 | Ga0207650_106733512 | 125 |
| 110 | 3300025926 | Ga0207659_10453149 | Ga0207659_104531492 | 125 |
| 111 | 3300025927 | Ga0207687_10245907 | Ga0207687_102459072 | 125 |
| 112 | 3300025932 | Ga0207690_10088511 | Ga0207690_100885113 | 125 |
| 113 | 3300025933 | Ga0207706_10199910 | Ga0207706_101999102 | 125 |
| 114 | 3300025933 | Ga0207706_10537879 | Ga0207706_105378792 | 125 |
| 115 | 3300025935 | Ga0207709_10133988 | Ga0207709_101339882 | 125 |
| 116 | 3300025937 | Ga0207669_10138728 | Ga0207669_101387282 | 125 |
| 117 | 3300025937 | Ga0207669_10360127 | Ga0207669_103601272 | 125 |
| 118 | 3300025938 | Ga0207704_11106452 | Ga0207704_111064521 | 125 |
| 119 | 3300025938 | Ga0207704_11111826 | Ga0207704_111118262 | 125 |
| 120 | 3300025940 | Ga0207691_10468239 | Ga0207691_104682392 | 125 |
| 121 | 3300025940 | Ga0207691_11475306 | Ga0207691_114753061 | 125 |
| 122 | 3300025942 | Ga0207689_11110740 | Ga0207689_111107402 | 125 |
| 123 | 3300025944 | Ga0207661_10990869 | Ga0207661_109908692 | 125 |
| 124 | 3300025944 | Ga0207661_11486073 | Ga0207661_114860732 | 125 |
| 125 | 3300025945 | Ga0207679_10642409 | Ga0207679_106424092 | 125 |
| 126 | 3300025961 | Ga0207712_10296010 | Ga0207712_102960102 | 125 |
| 127 | 3300025972 | Ga0207668_10221869 | Ga0207668_102218692 | 125 |
| 128 | 3300025972 | Ga0207668_11223816 | Ga0207668_112238162 | 125 |
| 129 | 3300026023 | Ga0207677_10268898 | Ga0207677_102688982 | 125 |
| 130 | 3300026041 | Ga0207639_10809457 | Ga0207639_108094572 | 125 |
| 131 | 3300026041 | Ga0207639_11197370 | Ga0207639_111973702 | 125 |
| 132 | 3300026067 | Ga0207678_10992686 | Ga0207678_109926862 | 125 |
| 133 | 3300026075 | Ga0207708_10008968 | Ga0207708_100089685 | 125 |
| 134 | 3300026075 | Ga0207708_10185692 | Ga0207708_101856922 | 125 |
| 135 | 3300026089 | Ga0207648_10085237 | Ga0207648_100852372 | 125 |
| 136 | 3300026089 | Ga0207648_10867424 | Ga0207648_108674241 | 125 |
| 137 | 3300026095 | Ga0207676_10258186 | Ga0207676_102581862 | 125 |
| 138 | 3300026095 | Ga0207676_10452977 | Ga0207676_104529772 | 125 |
| 139 | 3300026116 | Ga0207674_10370381 | Ga0207674_103703812 | 125 |
| 140 | 3300026118 | Ga0207675_100068996 | Ga0207675_1000689962 | 125 |
| 141 | 3300026121 | Ga0207683_10063390 | Ga0207683_100633902 | 125 |
| 142 | 3300026142 | Ga0207698_10513908 | Ga0207698_105139082 | 125 |
| 143 | 3300026142 | Ga0207698_11076101 | Ga0207698_110761011 | 125 |
| 144 | 3300027907 | Ga0207428_10411638 | Ga0207428_104116382 | 125 |
| 145 | 3300028379 | Ga0268266_11374800 | Ga0268266_113748002 | 125 |
| 146 | 3300031548 | Ga0307408_101130955 | Ga0307408_1011309551 | 125 |
| 147 | 3300031731 | Ga0307405_10172546 | Ga0307405_101725461 | 125 |
| 148 | 3300031852 | Ga0307410_10305007 | Ga0307410_103050072 | 125 |
| 149 | 3300031852 | Ga0307410_11239125 | Ga0307410_112391252 | 125 |
| 150 | 3300031901 | Ga0307406_10311375 | Ga0307406_103113752 | 125 |
| 151 | 3300031901 | Ga0307406_10443369 | Ga0307406_104433692 | 125 |
| 152 | 3300031995 | Ga0307409_100318026 | Ga0307409_1003180262 | 125 |
| 153 | 3300031995 | Ga0307409_100337262 | Ga0307409_1003372622 | 125 |
| 154 | 3300031995 | Ga0307409_100835000 | Ga0307409_1008350002 | 125 |
| 155 | 3300031995 | Ga0307409_100867404 | Ga0307409_1008674042 | 125 |
| 156 | 3300031995 | Ga0307409_101252014 | Ga0307409_1012520141 | 125 |
| 157 | 3300032002 | Ga0307416_100355281 | Ga0307416_1003552812 | 125 |
| 158 | 3300032002 | Ga0307416_100590156 | Ga0307416_1005901562 | 125 |
| 159 | 3300032002 | Ga0307416_100761242 | Ga0307416_1007612422 | 125 |
| 160 | 3300032004 | Ga0307414_10520077 | Ga0307414_105200772 | 125 |
| 161 | 3300032005 | Ga0307411_10131892 | Ga0307411_101318922 | 125 |
| 162 | 3300032126 | Ga0307415_100256525 | Ga0307415_1002565252 | 125 |
| 163 | 3300032126 | Ga0307415_100375335 | Ga0307415_1003753352 | 125 |
| 164 | 3300032126 | Ga0307415_101812081 | Ga0307415_1018120812 | 125 |
| 165 | 3300037466 | Ga0395898_0404186 | Ga0395898_0404186_556_942 | 125 |
| 166 | 3300038443 | Ga0395901_1652744 | Ga0395901_1652744_26_412 | 125 |
| 167 | 3300041413 | Ga0439465_0363704 | Ga0439465_0363704_118_504 | 125 |
| 168 | 3300041456 | Ga0451795_0594414 | Ga0451795_0594414_242_628 | 125 |
| 169 | 3300041460 | Ga0451802_0235268 | Ga0451802_0235268_391_777 | 125 |
| 170 | 3300041498 | Ga0451841_0791043 | Ga0451841_0791043_187_573 | 125 |
| 171 | 3300041509 | Ga0451843_0406932 | Ga0451843_0406932_540_926 | 125 |
| 172 | 3300041512 | Ga0451853_0823009 | Ga0451853_0823009_392_778 | 125 |
| 173 | 3300042005 | Ga0439448_0049540 | Ga0439448_0049540_720_1103 | 125 |
| 174 | 3300042008 | Ga0439450_033216 | Ga0439450_033216_647_1030 | 125 |
| 175 | 3300042157 | Ga0439458_0012813 | Ga0439458_0012813_295_678 | 125 |
| 176 | 3300042438 | Ga0439459_0026302 | Ga0439459_0026302_459_842 | 125 |
| 177 | 3300042439 | Ga0439464_0010134 | Ga0439464_0010134_1043_1426 | 125 |
| 178 | 3300042461 | Ga0439460_0067812 | Ga0439460_0067812_419_802 | 125 |
| 179 | 3300042993 | Ga0439440_0042499 | Ga0439440_0042499_650_1033 | 125 |
| 180 | 3300044684 | Ga0466966_0074125 | Ga0466966_0074125_405_791 | 125 |
| 181 | 3300044706 | Ga0466964_0169087 | Ga0466964_0169087_403_789 | 125 |
| 182 | 3300044901 | Ga0466960_0054641 | Ga0466960_0054641_251_637 | 125 |
| 183 | 3300044901 | Ga0466960_0183222 | Ga0466960_0183222_341_727 | 125 |
| 184 | 3300045049 | Ga0466959_0522741 | Ga0466959_0522741_118_504 | 125 |
| 185 | 3300045976 | Ga0466967_0170697 | Ga0466967_0170697_156_542 | 125 |
| 186 | 3300045976 | Ga0466967_0499940 | Ga0466967_0499940_49_435 | 125 |
| 187 | 3300045976 | Ga0466967_1509989 | Ga0466967_1509989_57_443 | 125 |
| 188 | 3300046461 | Ga0495641_0274632 | Ga0495641_0274632_299_685 | 125 |
| 189 | 3300046616 | Ga0495668_0645974 | Ga0495668_0645974_85_471 | 125 |
| 190 | 3300048904 | Ga0496101_0672143 | Ga0496101_0672143_372_758 | 125 |
| 191 | 3300048905 | Ga0496102_0473250 | Ga0496102_0473250_352_735 | 125 |
| 192 | 3300048905 | Ga0496102_0800989 | Ga0496102_0800989_316_708 | 125 |
| 193 | 3300048906 | Ga0496103_0333341 | Ga0496103_0333341_213_599 | 125 |
| 194 | 3300048913 | Ga0496110_1058572 | Ga0496110_1058572_215_598 | 125 |
| 195 | 3300048913 | Ga0496110_1531880 | Ga0496110_1531880_87_473 | 125 |
| 196 | 3300048913 | Ga0496110_1812624 | Ga0496110_1812624_93_479 | 125 |
| 197 | 3300049568 | Ga0501031_0058685 | Ga0501031_0058685_35_421 | 125 |
| 198 | 3300049570 | Ga0501033_0699024 | Ga0501033_0699024_112_498 | 125 |
| 199 | 3300049571 | Ga0501034_0173483 | Ga0501034_0173483_1665_2051 | 125 |
| 200 | 3300049575 | Ga0501039_0037165 | Ga0501039_0037165_3270_3656 | 125 |
| 201 | 3300049576 | Ga0501040_0076944 | Ga0501040_0076944_1324_1710 | 125 |
| 202 | 3300049577 | Ga0501041_1016395 | Ga0501041_1016395_56_442 | 125 |
| 203 | 3300049578 | Ga0501042_0825969 | Ga0501042_0825969_192_578 | 125 |
| 204 | 3300049582 | Ga0501048_0400031 | Ga0501048_0400031_479_865 | 125 |
| 205 | 3300049588 | Ga0501072_0034667 | Ga0501072_0034667_41_427 | 125 |
| 206 | 3300049592 | Ga0501076_0630063 | Ga0501076_0630063_406_792 | 125 |
| 207 | 3300050507 | nmdc:mga05p37_1595478_c1 | nmdc:mga05p37_1595478_c1_159_545 | 125 |
| 208 | 3300050508 | nmdc:mga09592_404646_c1 | nmdc:mga09592_404646_c1_397_780 | 125 |
| 209 | 3300050509 | nmdc:mga0qj67_686457_c1 | nmdc:mga0qj67_686457_c1_367_750 | 125 |
| 210 | 3300050510 | nmdc:mga06r32_1649980_c1 | nmdc:mga06r32_1649980_c1_98_484 | 125 |
| 211 | 3300050511 | nmdc:mga08y16_342400_c1 | nmdc:mga08y16_342400_c1_710_1093 | 125 |
| 212 | 3300053151 | Ga0500604_0143311 | Ga0500604_0143311_20_406 | 125 |
| 213 | 3300053160 | Ga0500633_0251248 | Ga0500633_0251248_130_516 | 125 |
| 214 | 3300059640 | Ga0587067_160100 | Ga0587067_160100_25_411 | 125 |
| 215 | iso_pu_bacteria | 2547132416 | 2548648618 | 125 |
| 216 | iso_pu_bacteria | 2554235234 | 2555258644 | 125 |
| 217 | iso_pu_bacteria | 2599185169 | 2599410062 | 125 |
| 218 | iso_pu_bacteria | 2600255254 | 2601523257 | 125 |
| 219 | iso_pu_bacteria | 2600255255 | 2601528416 | 125 |
| 220 | iso_pu_bacteria | 2600255280 | 2601615249 | 125 |
| 221 | iso_pu_bacteria | 2600255281 | 2601619825 | 125 |
| 222 | iso_pu_bacteria | 2600255287 | 2601643768 | 125 |
| 223 | iso_pu_bacteria | 2600255288 | 2601648230 | 125 |
| 224 | iso_pu_bacteria | 2600255289 | 2601653301 | 125 |
| 225 | iso_pu_bacteria | 2600255290 | 2601658578 | 125 |
| 226 | iso_pu_bacteria | 2600255291 | 2601663593 | 125 |
| 227 | iso_pu_bacteria | 2600255298 | 2601696526 | 125 |
| 228 | iso_pu_bacteria | 2600255299 | 2601701225 | 125 |
| 229 | iso_pu_bacteria | 2600255300 | 2601705956 | 125 |
| 230 | iso_pu_bacteria | 2600255301 | 2601711541 | 125 |
| 231 | iso_pu_bacteria | 2600255302 | 2601716559 | 125 |
| 232 | iso_pu_bacteria | 2600255303 | 2601721550 | 125 |
| 233 | iso_pu_bacteria | 2600255304 | 2601726965 | 125 |
| 234 | iso_pu_bacteria | 2600255305 | 2601731505 | 125 |
| 235 | iso_pu_bacteria | 2600255306 | 2601736517 | 125 |
| 236 | iso_pu_bacteria | 2600255307 | 2601740500 | 125 |
| 237 | iso_pu_bacteria | 2600255309 | 2601751437 | 125 |
| 238 | iso_pu_bacteria | 2600255392 | 2602018703 | 125 |
| 239 | iso_pu_bacteria | 2602042047 | 2603644054 | 125 |
| 240 | iso_pu_bacteria | 2602042052 | 2603660980 | 125 |
| 241 | iso_pu_bacteria | 2602042053 | 2603666254 | 125 |
| 242 | iso_pu_bacteria | 2602042066 | 2603700740 | 125 |
| 243 | iso_pu_bacteria | 2602042067 | 2603704574 | 125 |
| 244 | iso_pu_bacteria | 2602042103 | 2603838899 | 125 |
| 245 | iso_pu_bacteria | 2602042104 | 2603843841 | 125 |
| 246 | iso_pu_bacteria | 2602042105 | 2603849055 | 125 |
| 247 | iso_pu_bacteria | 2602042106 | 2603854126 | 125 |
| 248 | iso_pu_bacteria | 2602042109 | 2603865413 | 125 |
| 249 | iso_pu_bacteria | 2602042110 | 2603872180 | 125 |
| 250 | iso_pu_bacteria | 2602042111 | 2603877067 | 125 |
| 251 | iso_pu_bacteria | 2603880178 | 2606049362 | 125 |
| 252 | iso_pu_bacteria | 2603880184 | 2606070687 | 125 |
| 253 | iso_pu_bacteria | 2603880202 | 2606147045 | 125 |
| 254 | iso_pu_bacteria | 2603880211 | 2606176771 | 125 |
| 255 | iso_pu_bacteria | 2609459761 | 2609911750 | 125 |
| 256 | iso_pu_bacteria | 2636415599 | 2637223389 | 125 |
| 257 | iso_pu_bacteria | 2667528172 | 2671104374 | 125 |
| 258 | iso_pu_bacteria | 2671180115 | 2671588510 | 125 |
| 259 | iso_pu_bacteria | 2675903046 | 2676408432 | 125 |
| 260 | iso_pu_bacteria | 2681812866 | 2681997834 | 125 |
| 261 | iso_pu_bacteria | 2681812869 | 2682007934 | 125 |
| 262 | iso_pu_bacteria | 2751185917 | 2753857468 | 125 |
| 263 | iso_pu_bacteria | 2765235842 | 2765590560 | 125 |
| 264 | iso_pu_bacteria | 2775506706 | 2775540096 | 125 |
| 265 | iso_pu_bacteria | 2775507074 | 2777019705 | 125 |
| 266 | iso_pu_bacteria | 2791355275 | 2793404152 | 125 |
| 267 | iso_pu_bacteria | 2821118458 | 2821120389 | 125 |
| 268 | iso_pu_bacteria | 2823373977 | 2823376224 | 125 |
| 269 | iso_pu_bacteria | 2844425489 | 2844428901 | 125 |
| 270 | iso_pu_bacteria | 2884086401 | 2884087271 | 125 |
| 271 | iso_pu_bacteria | 2904513164 | 2904516666 | 125 |
| 272 | iso_pu_bacteria | 2919108558 | 2919110512 | 125 |
| 273 | iso_pu_bacteria | 2919497567 | 2919497867 | 125 |
| 274 | iso_pu_bacteria | 2923634449 | 2923636436 | 125 |
| 275 | iso_pu_bacteria | 2927833300 | 2927837081 | 125 |
| 276 | iso_pu_bacteria | 2937539931 | 2937541025 | 125 |
| 277 | iso_pu_bacteria | 2939573065 | 2939576293 | 125 |
| 278 | iso_pu_bacteria | 2939607340 | 2939610262 | 125 |
| 279 | iso_pu_bacteria | 2945874760 | 2945876156 | 125 |
| 280 | iso_pu_bacteria | 2969079654 | 2969080418 | 125 |
| 281 | iso_pu_bacteria | 2971820967 | 2971821785 | 125 |
| 282 | iso_pu_bacteria | 2974310843 | 2974315224 | 125 |
| 283 | iso_pu_bacteria | 2984559226 | 2984562858 | 125 |
| 284 | iso_pu_bacteria | 2984595703 | 2984600915 | 125 |
| 285 | iso_pu_bacteria | 3000376612 | 3000377768 | 125 |
| 286 | iso_pu_bacteria | 8018221730 | 8018225418 | 125 |
| 287 | iso_pu_bacteria | 8018405270 | 8018406086 | 125 |
| 288 | iso_pu_bacteria | 8055087960 | 8055089826 | 125 |
| 289 | iso_pu_bacteria | 8055092621 | 8055097214 | 125 |
| 290 | iso_pu_bacteria | 8055097453 | 8055098068 | 125 |
| 291 | 3300005439 | Ga0070711_100040404 | Ga0070711_1000404043 | 126 |
| 292 | 3300026121 | Ga0207683_11905155 | Ga0207683_119051552 | 126 |
| 293 | 3300027614 | Ga0209970_1118694 | Ga0209970_11186941 | 126 |
| 294 | 3300031247 | Ga0265340_10406738 | Ga0265340_104067381 | 126 |
| 295 | 3300031727 | Ga0316576_11103248 | Ga0316576_111032482 | 126 |
| 296 | 3300031731 | Ga0307405_12037849 | Ga0307405_120378492 | 126 |
| 297 | 3300032126 | Ga0307415_100017705 | Ga0307415_1000177053 | 126 |
| 298 | 3300033528 | Ga0316588_1002158 | Ga0316588_10021582 | 126 |
| 299 | 3300036401 | Ga0373937_0322391 | Ga0373937_0322391_829_1227 | 126 |
| 300 | 3300049593 | Ga0501077_0128707 | Ga0501077_0128707_633_1016 | 126 |
| 301 | 3300050507 | nmdc:mga05p37_899665_c1 | nmdc:mga05p37_899665_c1_165_554 | 126 |
| 302 | 3300003349 | JGI26129J50193_1009732 | JGI26129J50193_10097322 | 127 |
| 303 | 3300005328 | Ga0070676_10637699 | Ga0070676_106376992 | 127 |
| 304 | 3300005356 | Ga0070674_101547295 | Ga0070674_1015472951 | 127 |
| 305 | 3300005365 | Ga0070688_100779640 | Ga0070688_1007796402 | 127 |
| 306 | 3300005366 | Ga0070659_100259143 | Ga0070659_1002591432 | 127 |
| 307 | 3300005366 | Ga0070659_101024490 | Ga0070659_1010244902 | 127 |
| 308 | 3300005435 | Ga0070714_100029705 | Ga0070714_1000297052 | 127 |
| 309 | 3300005439 | Ga0070711_101406719 | Ga0070711_1014067191 | 127 |
| 310 | 3300005457 | Ga0070662_100737629 | Ga0070662_1007376291 | 127 |
| 311 | 3300005458 | Ga0070681_10679253 | Ga0070681_106792531 | 127 |
| 312 | 3300005459 | Ga0068867_100557801 | Ga0068867_1005578012 | 127 |
| 313 | 3300005530 | Ga0070679_100535681 | Ga0070679_1005356812 | 127 |
| 314 | 3300005536 | Ga0070697_100067397 | Ga0070697_1000673972 | 127 |
| 315 | 3300005539 | Ga0068853_102129852 | Ga0068853_1021298521 | 127 |
| 316 | 3300005614 | Ga0068856_100865745 | Ga0068856_1008657452 | 127 |
| 317 | 3300005719 | Ga0068861_100870025 | Ga0068861_1008700251 | 127 |
| 318 | 3300005840 | Ga0068870_10113589 | Ga0068870_101135892 | 127 |
| 319 | 3300006237 | Ga0097621_101487504 | Ga0097621_1014875041 | 127 |
| 320 | 3300009093 | Ga0105240_10044693 | Ga0105240_100446933 | 127 |
| 321 | 3300009094 | Ga0111539_11394265 | Ga0111539_113942652 | 127 |
| 322 | 3300009094 | Ga0111539_12373636 | Ga0111539_123736362 | 127 |
| 323 | 3300009098 | Ga0105245_10369589 | Ga0105245_103695893 | 127 |
| 324 | 3300009101 | Ga0105247_10324318 | Ga0105247_103243182 | 127 |
| 325 | 3300009176 | Ga0105242_13273943 | Ga0105242_132739431 | 127 |
| 326 | 3300009545 | Ga0105237_10300312 | Ga0105237_103003122 | 127 |
| 327 | 3300009551 | Ga0105238_10451230 | Ga0105238_104512302 | 127 |
| 328 | 3300009553 | Ga0105249_11551703 | Ga0105249_115517032 | 127 |
| 329 | 3300010375 | Ga0105239_11620257 | Ga0105239_116202572 | 127 |
| 330 | 3300010375 | Ga0105239_12144592 | Ga0105239_121445921 | 127 |
| 331 | 3300011119 | Ga0105246_10140776 | Ga0105246_101407762 | 127 |
| 332 | 3300013100 | Ga0157373_10031197 | Ga0157373_100311972 | 127 |
| 333 | 3300013104 | Ga0157370_10003046 | Ga0157370_100030467 | 127 |
| 334 | 3300013296 | Ga0157374_10274843 | Ga0157374_102748432 | 127 |
| 335 | 3300013296 | Ga0157374_11789826 | Ga0157374_117898262 | 127 |
| 336 | 3300014969 | Ga0157376_10119524 | Ga0157376_101195242 | 127 |
| 337 | 3300014969 | Ga0157376_10637206 | Ga0157376_106372062 | 127 |
| 338 | 3300017792 | Ga0163161_10125620 | Ga0163161_101256202 | 127 |
| 339 | 3300025907 | Ga0207645_10388259 | Ga0207645_103882591 | 127 |
| 340 | 3300025913 | Ga0207695_10200142 | Ga0207695_102001422 | 127 |
| 341 | 3300025914 | Ga0207671_10357320 | Ga0207671_103573202 | 127 |
| 342 | 3300025917 | Ga0207660_11334596 | Ga0207660_113345961 | 127 |
| 343 | 3300025921 | Ga0207652_10633734 | Ga0207652_106337341 | 127 |
| 344 | 3300025924 | Ga0207694_10080587 | Ga0207694_100805872 | 127 |
| 345 | 3300025933 | Ga0207706_10055572 | Ga0207706_100555725 | 127 |
| 346 | 3300025933 | Ga0207706_10661425 | Ga0207706_106614252 | 127 |
| 347 | 3300025933 | Ga0207706_10816548 | Ga0207706_108165482 | 127 |
| 348 | 3300025937 | Ga0207669_10070251 | Ga0207669_100702513 | 127 |
| 349 | 3300026023 | Ga0207677_10603165 | Ga0207677_106031652 | 127 |
| 350 | 3300026089 | Ga0207648_10826533 | Ga0207648_108265332 | 127 |
| 351 | 3300027378 | Ga0209981_1013521 | Ga0209981_10135212 | 127 |
| 352 | 3300027462 | Ga0210000_1011901 | Ga0210000_10119012 | 127 |
| 353 | 3300027471 | Ga0209995_1020402 | Ga0209995_10204021 | 127 |
| 354 | 3300027526 | Ga0209968_1004519 | Ga0209968_10045191 | 127 |
| 355 | 3300027614 | Ga0209970_1035438 | Ga0209970_10354382 | 127 |
| 356 | 3300027617 | Ga0210002_1052775 | Ga0210002_10527751 | 127 |
| 357 | 3300027682 | Ga0209971_1010608 | Ga0209971_10106083 | 127 |
| 358 | 3300027717 | Ga0209998_10004283 | Ga0209998_100042832 | 127 |
| 359 | 3300027717 | Ga0209998_10092432 | Ga0209998_100924322 | 127 |
| 360 | 3300027876 | Ga0209974_10005674 | Ga0209974_100056744 | 127 |
| 361 | 3300027907 | Ga0207428_10037489 | Ga0207428_100374894 | 127 |
| 362 | 3300028556 | Ga0265337_1000006 | Ga0265337_100000697 | 127 |
| 363 | 3300028558 | Ga0265326_10000066 | Ga0265326_1000006635 | 127 |
| 364 | 3300028577 | Ga0265318_10109340 | Ga0265318_101093402 | 127 |
| 365 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001493 | 127 |
| 366 | 3300028666 | Ga0265336_10001086 | Ga0265336_100010863 | 127 |
| 367 | 3300028666 | Ga0265336_10010847 | Ga0265336_100108472 | 127 |
| 368 | 3300028800 | Ga0265338_10059611 | Ga0265338_100596112 | 127 |
| 369 | 3300029957 | Ga0265324_10000090 | Ga0265324_100000905 | 127 |
| 370 | 3300029957 | Ga0265324_10000373 | Ga0265324_1000037324 | 127 |
| 371 | 3300029957 | Ga0265324_10000563 | Ga0265324_100005632 | 127 |
| 372 | 3300029957 | Ga0265324_10007205 | Ga0265324_100072055 | 127 |
| 373 | 3300029957 | Ga0265324_10012755 | Ga0265324_100127552 | 127 |
| 374 | 3300031235 | Ga0265330_10002315 | Ga0265330_100023155 | 127 |
| 375 | 3300031238 | Ga0265332_10084963 | Ga0265332_100849632 | 127 |
| 376 | 3300031238 | Ga0265332_10100953 | Ga0265332_101009532 | 127 |
| 377 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002492 | 127 |
| 378 | 3300031240 | Ga0265320_10014802 | Ga0265320_100148022 | 127 |
| 379 | 3300031241 | Ga0265325_10000153 | Ga0265325_100001539 | 127 |
| 380 | 3300031242 | Ga0265329_10009135 | Ga0265329_100091356 | 127 |
| 381 | 3300031242 | Ga0265329_10030273 | Ga0265329_100302732 | 127 |
| 382 | 3300031249 | Ga0265339_10008744 | Ga0265339_100087443 | 127 |
| 383 | 3300031249 | Ga0265339_10011323 | Ga0265339_100113236 | 127 |
| 384 | 3300031250 | Ga0265331_10002086 | Ga0265331_1000208610 | 127 |
| 385 | 3300031250 | Ga0265331_10002830 | Ga0265331_100028304 | 127 |
| 386 | 3300031250 | Ga0265331_10029077 | Ga0265331_100290772 | 127 |
| 387 | 3300031250 | Ga0265331_10085731 | Ga0265331_100857312 | 127 |
| 388 | 3300031250 | Ga0265331_10092484 | Ga0265331_100924842 | 127 |
| 389 | 3300031250 | Ga0265331_10116328 | Ga0265331_101163282 | 127 |
| 390 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011492 | 127 |
| 391 | 3300031251 | Ga0265327_10000557 | Ga0265327_1000055736 | 127 |
| 392 | 3300031344 | Ga0265316_10053913 | Ga0265316_100539133 | 127 |
| 393 | 3300031344 | Ga0265316_10141965 | Ga0265316_101419652 | 127 |
| 394 | 3300031344 | Ga0265316_10635904 | Ga0265316_106359042 | 127 |
| 395 | 3300031595 | Ga0265313_10009558 | Ga0265313_100095584 | 127 |
| 396 | 3300031665 | Ga0316575_10000218 | Ga0316575_100002183 | 127 |
| 397 | 3300031691 | Ga0316579_10162879 | Ga0316579_101628792 | 127 |
| 398 | 3300031711 | Ga0265314_10000706 | Ga0265314_1000070635 | 127 |
| 399 | 3300031711 | Ga0265314_10000726 | Ga0265314_1000072619 | 127 |
| 400 | 3300031711 | Ga0265314_10009867 | Ga0265314_100098677 | 127 |
| 401 | 3300031711 | Ga0265314_10014960 | Ga0265314_100149604 | 127 |
| 402 | 3300031711 | Ga0265314_10030366 | Ga0265314_100303662 | 127 |
| 403 | 3300031712 | Ga0265342_10161542 | Ga0265342_101615421 | 127 |
| 404 | 3300031712 | Ga0265342_10605518 | Ga0265342_106055182 | 127 |
| 405 | 3300031727 | Ga0316576_10936803 | Ga0316576_109368031 | 127 |
| 406 | 3300031995 | Ga0307409_101589845 | Ga0307409_1015898451 | 127 |
| 407 | 3300035114 | Ga0373939_0256780 | Ga0373939_0256780_230_619 | 127 |
| 408 | 3300035170 | Ga0373943_0016826 | Ga0373943_0016826_610_993 | 127 |
| 409 | 3300037068 | Ga0373925_0185656 | Ga0373925_0185656_931_1314 | 127 |
| 410 | 3300037418 | Ga0395900_0497810 | Ga0395900_0497810_237_626 | 127 |
| 411 | 3300039062 | Ga0400483_220832 | Ga0400483_220832_410_799 | 127 |
| 412 | 3300042876 | Ga0451577_0000085 | Ga0451577_0000085_155606_155995 | 127 |
| 413 | 3300042876 | Ga0451577_0003720 | Ga0451577_0003720_10204_10605 | 127 |
| 414 | 3300042876 | Ga0451577_0089801 | Ga0451577_0089801_1158_1547 | 127 |
| 415 | 3300042876 | Ga0451577_0117305 | Ga0451577_0117305_290_679 | 127 |
| 416 | 3300042876 | Ga0451577_0129463 | Ga0451577_0129463_1571_1954 | 127 |
| 417 | 3300044673 | Ga0453683_0000047 | Ga0453683_0000047_152228_152617 | 127 |
| 418 | 3300044694 | Ga0466963_0047730 | Ga0466963_0047730_1032_1424 | 127 |
| 419 | 3300044712 | Ga0453684_0000273 | Ga0453684_0000273_64923_65312 | 127 |
| 420 | 3300044712 | Ga0453684_0000302 | Ga0453684_0000302_55147_55536 | 127 |
| 421 | 3300044712 | Ga0453684_0012535 | Ga0453684_0012535_3804_4205 | 127 |
| 422 | 3300044712 | Ga0453684_0173338 | Ga0453684_0173338_892_1287 | 127 |
| 423 | 3300044712 | Ga0453684_0431915 | Ga0453684_0431915_850_1233 | 127 |
| 424 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_420790_421191 | 127 |
| 425 | 3300045051 | Ga0451576_0000116 | Ga0451576_0000116_152228_152617 | 127 |
| 426 | 3300045051 | Ga0451576_0000652 | Ga0451576_0000652_57970_58425 | 127 |
| 427 | 3300045051 | Ga0451576_0000868 | Ga0451576_0000868_12358_12747 | 127 |
| 428 | 3300045051 | Ga0451576_1271666 | Ga0451576_1271666_298_687 | 127 |
| 429 | 3300045051 | Ga0451576_1905486 | Ga0451576_1905486_109_504 | 127 |
| 430 | 3300045976 | Ga0466967_0214795 | Ga0466967_0214795_851_1243 | 127 |
| 431 | 3300046455 | Ga0495603_0000258 | Ga0495603_0000258_3217_3609 | 127 |
| 432 | 3300046559 | Ga0495667_0000047 | Ga0495667_0000047_72982_73374 | 127 |
| 433 | 3300047322 | Ga0495680_0003506 | Ga0495680_0003506_1183_1575 | 127 |
| 434 | 3300047471 | Ga0495684_0127354 | Ga0495684_0127354_755_1147 | 127 |
| 435 | 3300048903 | Ga0496100_0220279 | Ga0496100_0220279_404_793 | 127 |
| 436 | 3300048904 | Ga0496101_0132458 | Ga0496101_0132458_241_630 | 127 |
| 437 | 3300048907 | Ga0496104_0811525 | Ga0496104_0811525_354_743 | 127 |
| 438 | 3300048910 | Ga0496107_0313840 | Ga0496107_0313840_754_1143 | 127 |
| 439 | 3300048911 | Ga0496108_0050129 | Ga0496108_0050129_242_631 | 127 |
| 440 | 3300048911 | Ga0496108_0215378 | Ga0496108_0215378_1227_1616 | 127 |
| 441 | 3300048912 | Ga0496109_0046553 | Ga0496109_0046553_1872_2261 | 127 |
| 442 | 3300048912 | Ga0496109_1859070 | Ga0496109_1859070_14_403 | 127 |
| 443 | 3300048913 | Ga0496110_0453927 | Ga0496110_0453927_94_483 | 127 |
| 444 | 3300048916 | Ga0496113_0559873 | Ga0496113_0559873_24_413 | 127 |
| 445 | 3300048917 | Ga0496114_0004317 | Ga0496114_0004317_2142_2531 | 127 |
| 446 | 3300048917 | Ga0496114_0007017 | Ga0496114_0007017_6212_6601 | 127 |
| 447 | 3300048918 | Ga0496115_1344821 | Ga0496115_1344821_118_507 | 127 |
| 448 | 3300049568 | Ga0501031_0004039 | Ga0501031_0004039_8597_8983 | 127 |
| 449 | 3300049568 | Ga0501031_0008281 | Ga0501031_0008281_93_479 | 127 |
| 450 | 3300049568 | Ga0501031_0110192 | Ga0501031_0110192_479_868 | 127 |
| 451 | 3300049569 | Ga0501032_0001373 | Ga0501032_0001373_7332_7718 | 127 |
| 452 | 3300049569 | Ga0501032_0007089 | Ga0501032_0007089_7284_7670 | 127 |
| 453 | 3300049569 | Ga0501032_0059099 | Ga0501032_0059099_1365_1754 | 127 |
| 454 | 3300049570 | Ga0501033_0000949 | Ga0501033_0000949_3516_3902 | 127 |
| 455 | 3300049570 | Ga0501033_0001864 | Ga0501033_0001864_4408_4794 | 127 |
| 456 | 3300049570 | Ga0501033_0059974 | Ga0501033_0059974_446_832 | 127 |
| 457 | 3300049571 | Ga0501034_0024559 | Ga0501034_0024559_3799_4185 | 127 |
| 458 | 3300049571 | Ga0501034_0047437 | Ga0501034_0047437_1784_2173 | 127 |
| 459 | 3300049571 | Ga0501034_0541825 | Ga0501034_0541825_169_558 | 127 |
| 460 | 3300049572 | Ga0501036_0000382 | Ga0501036_0000382_1618_2004 | 127 |
| 461 | 3300049572 | Ga0501036_0001661 | Ga0501036_0001661_4134_4520 | 127 |
| 462 | 3300049572 | Ga0501036_0035605 | Ga0501036_0035605_447_833 | 127 |
| 463 | 3300049573 | Ga0501037_0000474 | Ga0501037_0000474_20059_20445 | 127 |
| 464 | 3300049573 | Ga0501037_0051116 | Ga0501037_0051116_929_1315 | 127 |
| 465 | 3300049573 | Ga0501037_0193442 | Ga0501037_0193442_956_1345 | 127 |
| 466 | 3300049573 | Ga0501037_0358177 | Ga0501037_0358177_315_701 | 127 |
| 467 | 3300049573 | Ga0501037_0711826 | Ga0501037_0711826_218_604 | 127 |
| 468 | 3300049574 | Ga0501038_0008209 | Ga0501038_0008209_1403_1789 | 127 |
| 469 | 3300049574 | Ga0501038_0019437 | Ga0501038_0019437_4080_4469 | 127 |
| 470 | 3300049574 | Ga0501038_0023864 | Ga0501038_0023864_1454_1840 | 127 |
| 471 | 3300049574 | Ga0501038_0076883 | Ga0501038_0076883_1777_2163 | 127 |
| 472 | 3300049574 | Ga0501038_0130565 | Ga0501038_0130565_1018_1404 | 127 |
| 473 | 3300049574 | Ga0501038_0137944 | Ga0501038_0137944_1106_1492 | 127 |
| 474 | 3300049574 | Ga0501038_0336957 | Ga0501038_0336957_552_941 | 127 |
| 475 | 3300049575 | Ga0501039_0002238 | Ga0501039_0002238_9349_9735 | 127 |
| 476 | 3300049575 | Ga0501039_0043176 | Ga0501039_0043176_2581_2967 | 127 |
| 477 | 3300049575 | Ga0501039_0044783 | Ga0501039_0044783_1722_2111 | 127 |
| 478 | 3300049576 | Ga0501040_0003365 | Ga0501040_0003365_3452_3838 | 127 |
| 479 | 3300049578 | Ga0501042_0084446 | Ga0501042_0084446_485_871 | 127 |
| 480 | 3300049579 | Ga0501043_0007578 | Ga0501043_0007578_2284_2670 | 127 |
| 481 | 3300049579 | Ga0501043_0008971 | Ga0501043_0008971_1287_1673 | 127 |
| 482 | 3300049579 | Ga0501043_0083051 | Ga0501043_0083051_1776_2162 | 127 |
| 483 | 3300049580 | Ga0501046_0002898 | Ga0501046_0002898_12083_12469 | 127 |
| 484 | 3300049580 | Ga0501046_0011564 | Ga0501046_0011564_3354_3740 | 127 |
| 485 | 3300049580 | Ga0501046_0700086 | Ga0501046_0700086_159_554 | 127 |
| 486 | 3300049581 | Ga0501047_0005810 | Ga0501047_0005810_9733_10119 | 127 |
| 487 | 3300049581 | Ga0501047_0108224 | Ga0501047_0108224_1421_1807 | 127 |
| 488 | 3300049582 | Ga0501048_0059590 | Ga0501048_0059590_653_1039 | 127 |
| 489 | 3300049584 | Ga0501068_0002905 | Ga0501068_0002905_1278_1664 | 127 |
| 490 | 3300049584 | Ga0501068_0172686 | Ga0501068_0172686_922_1308 | 127 |
| 491 | 3300049586 | Ga0501070_0429924 | Ga0501070_0429924_424_810 | 127 |
| 492 | 3300049587 | Ga0501071_0757423 | Ga0501071_0757423_15_401 | 127 |
| 493 | 3300049589 | Ga0501073_0642907 | Ga0501073_0642907_51_437 | 127 |
| 494 | 3300049590 | Ga0501074_0313318 | Ga0501074_0313318_628_1011 | 127 |
| 495 | 3300049591 | Ga0501075_0444772 | Ga0501075_0444772_161_547 | 127 |
| 496 | 3300049651 | Ga0501201_031051 | Ga0501201_031051_140_526 | 127 |
| 497 | 3300049741 | Ga0501079_0183796 | Ga0501079_0183796_250_636 | 127 |
| 498 | 3300049742 | Ga0501080_1065275 | Ga0501080_1065275_138_524 | 127 |
| 499 | 3300049742 | Ga0501080_1151802 | Ga0501080_1151802_121_507 | 127 |
| 500 | 3300049822 | Ga0501035_0001429 | Ga0501035_0001429_4317_4703 | 127 |
| 501 | 3300049822 | Ga0501035_0001968 | Ga0501035_0001968_7592_7978 | 127 |
| 502 | 3300049822 | Ga0501035_0009680 | Ga0501035_0009680_5798_6184 | 127 |
| 503 | 3300049822 | Ga0501035_0076193 | Ga0501035_0076193_1784_2173 | 127 |
| 504 | 3300049822 | Ga0501035_0651072 | Ga0501035_0651072_20_409 | 127 |
| 505 | 3300049823 | Ga0501044_0000111 | Ga0501044_0000111_86044_86430 | 127 |
| 506 | 3300049823 | Ga0501044_0018048 | Ga0501044_0018048_2411_2797 | 127 |
| 507 | 3300049823 | Ga0501044_0025482 | Ga0501044_0025482_5077_5463 | 127 |
| 508 | 3300049823 | Ga0501044_0053451 | Ga0501044_0053451_3452_3838 | 127 |
| 509 | 3300049823 | Ga0501044_0259856 | Ga0501044_0259856_779_1180 | 127 |
| 510 | 3300049823 | Ga0501044_0278379 | Ga0501044_0278379_1020_1409 | 127 |
| 511 | 3300049824 | Ga0501045_0003419 | Ga0501045_0003419_7552_7938 | 127 |
| 512 | 3300049824 | Ga0501045_0271813 | Ga0501045_0271813_516_902 | 127 |
| 513 | 3300050509 | nmdc:mga0qj67_405998_c1 | nmdc:mga0qj67_405998_c1_285_677 | 127 |
| 514 | 3300050511 | nmdc:mga08y16_775092_c1 | nmdc:mga08y16_775092_c1_160_549 | 127 |
| 515 | 3300054114 | Ga0501084_0324607 | Ga0501084_0324607_308_694 | 127 |
| 516 | 3300003322 | rootL2_10005174 | rootL2_100051741 | 128 |
| 517 | 3300005347 | Ga0070668_100005924 | Ga0070668_10000592410 | 128 |
| 518 | 3300005457 | Ga0070662_100019920 | Ga0070662_1000199204 | 128 |
| 519 | 3300005548 | Ga0070665_100155742 | Ga0070665_1001557422 | 128 |
| 520 | 3300006051 | Ga0075364_10378596 | Ga0075364_103785961 | 128 |
| 521 | 3300009011 | Ga0105251_10000576 | Ga0105251_1000057631 | 128 |
| 522 | 3300009011 | Ga0105251_10025485 | Ga0105251_100254852 | 128 |
| 523 | 3300009036 | Ga0105244_10411907 | Ga0105244_104119072 | 128 |
| 524 | 3300009036 | Ga0105244_10586162 | Ga0105244_105861621 | 128 |
| 525 | 3300009101 | Ga0105247_10269596 | Ga0105247_102695962 | 128 |
| 526 | 3300009545 | Ga0105237_10141798 | Ga0105237_101417982 | 128 |
| 527 | 3300013306 | Ga0163162_10043027 | Ga0163162_100430274 | 128 |
| 528 | 3300013307 | Ga0157372_10045700 | Ga0157372_100457002 | 128 |
| 529 | 3300013307 | Ga0157372_10532628 | Ga0157372_105326282 | 128 |
| 530 | 3300014497 | Ga0182008_10060110 | Ga0182008_100601102 | 128 |
| 531 | 3300015261 | Ga0182006_1003907 | Ga0182006_10039071 | 128 |
| 532 | 3300015262 | Ga0182007_10030055 | Ga0182007_100300552 | 128 |
| 533 | 3300017792 | Ga0163161_10010793 | Ga0163161_100107933 | 128 |
| 534 | 3300021361 | Ga0213872_10207204 | Ga0213872_102072041 | 128 |
| 535 | 3300025711 | Ga0207696_1000361 | Ga0207696_10003612 | 128 |
| 536 | 3300025728 | Ga0207655_1000047 | Ga0207655_1000047203 | 128 |
| 537 | 3300025728 | Ga0207655_1000079 | Ga0207655_100007928 | 128 |
| 538 | 3300025728 | Ga0207655_1041194 | Ga0207655_10411941 | 128 |
| 539 | 3300025735 | Ga0207713_1004277 | Ga0207713_10042776 | 128 |
| 540 | 3300025735 | Ga0207713_1087163 | Ga0207713_10871632 | 128 |
| 541 | 3300025900 | Ga0207710_10358912 | Ga0207710_103589122 | 128 |
| 542 | 3300025933 | Ga0207706_10088631 | Ga0207706_100886312 | 128 |
| 543 | 3300025972 | Ga0207668_10338908 | Ga0207668_103389082 | 128 |
| 544 | 3300028379 | Ga0268266_10272578 | Ga0268266_102725782 | 128 |
| 545 | 3300030742 | Ga0316183_1179590 | Ga0316183_11795901 | 128 |
| 546 | 3300039447 | Ga0436361_0333442 | Ga0436361_0333442_483_869 | 128 |
| 547 | 3300039447 | Ga0436361_0883668 | Ga0436361_0883668_550_936 | 128 |
| 548 | 3300039447 | Ga0436361_0989063 | Ga0436361_0989063_3606_3995 | 128 |
| 549 | 3300041405 | Ga0439438_012978 | Ga0439438_012978_826_1212 | 128 |
| 550 | 3300041407 | Ga0439447_017639 | Ga0439447_017639_1457_1843 | 128 |
| 551 | 3300041411 | Ga0439466_0000004 | Ga0439466_0000004_145574_145960 | 128 |
| 552 | 3300042006 | Ga0439432_019605 | Ga0439432_019605_404_790 | 128 |
| 553 | 3300042010 | Ga0439452_028288 | Ga0439452_028288_478_864 | 128 |
| 554 | 3300042016 | Ga0439463_001507 | Ga0439463_001507_2779_3165 | 128 |
| 555 | 3300042146 | Ga0450907_000221 | Ga0450907_000221_4729_5115 | 128 |
| 556 | 3300046458 | Ga0495591_013966 | Ga0495591_013966_415_801 | 128 |
| 557 | 3300046500 | Ga0495596_0230626 | Ga0495596_0230626_201_587 | 128 |
| 558 | 3300046522 | Ga0495643_0075647 | Ga0495643_0075647_851_1237 | 128 |
| 559 | 3300046524 | Ga0495648_0006032 | Ga0495648_0006032_2562_2948 | 128 |
| 560 | 3300046810 | Ga0495660_0008440 | Ga0495660_0008440_3666_4052 | 128 |
| 561 | 3300047320 | Ga0495672_0000025 | Ga0495672_0000025_218612_218998 | 128 |
| 562 | 3300047446 | Ga0495679_002550 | Ga0495679_002550_7334_7720 | 128 |
| 563 | 3300048903 | Ga0496100_0046797 | Ga0496100_0046797_1402_1788 | 128 |
| 564 | 3300048908 | Ga0496105_0006095 | Ga0496105_0006095_2546_2932 | 128 |
| 565 | 3300048913 | Ga0496110_0460644 | Ga0496110_0460644_428_814 | 128 |
| 566 | 3300048919 | Ga0496116_0105035 | Ga0496116_0105035_407_793 | 128 |
| 567 | 3300048921 | Ga0496118_0000075 | Ga0496118_0000075_145056_145442 | 128 |
| 568 | 3300048921 | Ga0496118_0000996 | Ga0496118_0000996_6743_7129 | 128 |
| 569 | 3300048922 | Ga0496119_0000281 | Ga0496119_0000281_24286_24672 | 128 |
| 570 | 3300048923 | Ga0496120_0000363 | Ga0496120_0000363_9284_9670 | 128 |
| 571 | 3300048924 | Ga0496121_0000057 | Ga0496121_0000057_168435_168821 | 128 |
| 572 | 3300048925 | Ga0496122_0043786 | Ga0496122_0043786_843_1229 | 128 |
| 573 | 3300048926 | Ga0496123_0031853 | Ga0496123_0031853_3364_3750 | 128 |
| 574 | 3300048927 | Ga0496124_0001851 | Ga0496124_0001851_2026_2412 | 128 |
| 575 | 3300048928 | Ga0496125_0003562 | Ga0496125_0003562_13805_14191 | 128 |
| 576 | 3300048929 | Ga0496126_0408706 | Ga0496126_0408706_503_889 | 128 |
| 577 | 2162886007 | SwRhRL2b_contig_2081982 | SwRhRL2b_0935.00000970 | 129 |
| 578 | 3300003320 | rootH2_10007961 | rootH2_100079612 | 129 |
| 579 | 3300003578 | Ga0006562J51391_1034250 | Ga0006562J51391_10342502 | 129 |
| 580 | 3300005289 | Ga0065704_10096250 | Ga0065704_100962501 | 129 |
| 581 | 3300005289 | Ga0065704_10447131 | Ga0065704_104471311 | 129 |
| 582 | 3300005289 | Ga0065704_10589533 | Ga0065704_105895331 | 129 |
| 583 | 3300005366 | Ga0070659_100017935 | Ga0070659_1000179353 | 129 |
| 584 | 3300005548 | Ga0070665_100000033 | Ga0070665_100000033193 | 129 |
| 585 | 3300005577 | Ga0068857_100000005 | Ga0068857_100000005146 | 129 |
| 586 | 3300005834 | Ga0068851_10025488 | Ga0068851_100254881 | 129 |
| 587 | 3300006051 | Ga0075364_10008988 | Ga0075364_100089882 | 129 |
| 588 | 3300006195 | Ga0075366_10003394 | Ga0075366_100033948 | 129 |
| 589 | 3300006946 | Ga0079104_1000046 | Ga0079104_100004641 | 129 |
| 590 | 3300006946 | Ga0079104_1000249 | Ga0079104_100024934 | 129 |
| 591 | 3300006946 | Ga0079104_1001023 | Ga0079104_100102317 | 129 |
| 592 | 3300006946 | Ga0079104_1001675 | Ga0079104_10016756 | 129 |
| 593 | 3300006946 | Ga0079104_1078148 | Ga0079104_10781481 | 129 |
| 594 | 3300009011 | Ga0105251_10006603 | Ga0105251_100066032 | 129 |
| 595 | 3300009011 | Ga0105251_10063250 | Ga0105251_100632501 | 129 |
| 596 | 3300009011 | Ga0105251_10126148 | Ga0105251_101261482 | 129 |
| 597 | 3300009036 | Ga0105244_10000091 | Ga0105244_1000009124 | 129 |
| 598 | 3300009036 | Ga0105244_10039783 | Ga0105244_100397832 | 129 |
| 599 | 3300009092 | Ga0105250_10000095 | Ga0105250_1000009552 | 129 |
| 600 | 3300009092 | Ga0105250_10044506 | Ga0105250_100445062 | 129 |
| 601 | 3300009093 | Ga0105240_10693579 | Ga0105240_106935792 | 129 |
| 602 | 3300009101 | Ga0105247_11110806 | Ga0105247_111108061 | 129 |
| 603 | 3300009148 | Ga0105243_10155174 | Ga0105243_101551742 | 129 |
| 604 | 3300009148 | Ga0105243_10336668 | Ga0105243_103366682 | 129 |
| 605 | 3300009177 | Ga0105248_11513262 | Ga0105248_115132621 | 129 |
| 606 | 3300010375 | Ga0105239_13096906 | Ga0105239_130969061 | 129 |
| 607 | 3300013100 | Ga0157373_10215033 | Ga0157373_102150332 | 129 |
| 608 | 3300013102 | Ga0157371_10971181 | Ga0157371_109711811 | 129 |
| 609 | 3300013104 | Ga0157370_10002672 | Ga0157370_100026727 | 129 |
| 610 | 3300013104 | Ga0157370_11299817 | Ga0157370_112998171 | 129 |
| 611 | 3300015261 | Ga0182006_1000013 | Ga0182006_1000013160 | 129 |
| 612 | 3300015679 | Ga0183366_1002 | Ga0183366_1002339 | 129 |
| 613 | 3300015680 | Ga0183370_1002 | Ga0183370_1002339 | 129 |
| 614 | 3300015685 | Ga0183369_1002 | Ga0183369_1002339 | 129 |
| 615 | 3300015687 | Ga0183368_1005 | Ga0183368_1005339 | 129 |
| 616 | 3300021384 | Ga0213876_10000329 | Ga0213876_1000032926 | 129 |
| 617 | 3300025321 | Ga0207656_10008020 | Ga0207656_100080204 | 129 |
| 618 | 3300025711 | Ga0207696_1000024 | Ga0207696_100002480 | 129 |
| 619 | 3300025728 | Ga0207655_1000044 | Ga0207655_100004424 | 129 |
| 620 | 3300025728 | Ga0207655_1000050 | Ga0207655_1000050237 | 129 |
| 621 | 3300025728 | Ga0207655_1007857 | Ga0207655_10078578 | 129 |
| 622 | 3300025735 | Ga0207713_1000033 | Ga0207713_100003377 | 129 |
| 623 | 3300025735 | Ga0207713_1000134 | Ga0207713_100013428 | 129 |
| 624 | 3300025735 | Ga0207713_1017199 | Ga0207713_10171992 | 129 |
| 625 | 3300025735 | Ga0207713_1082750 | Ga0207713_10827502 | 129 |
| 626 | 3300025932 | Ga0207690_10041333 | Ga0207690_100413332 | 129 |
| 627 | 3300025935 | Ga0207709_10152812 | Ga0207709_101528122 | 129 |
| 628 | 3300026116 | Ga0207674_10000523 | Ga0207674_1000052321 | 129 |
| 629 | 3300027111 | Ga0209281_1000022 | Ga0209281_100002243 | 129 |
| 630 | 3300027111 | Ga0209281_1000048 | Ga0209281_100004892 | 129 |
| 631 | 3300027111 | Ga0209281_1000056 | Ga0209281_100005615 | 129 |
| 632 | 3300027111 | Ga0209281_1000120 | Ga0209281_1000120194 | 129 |
| 633 | 3300027111 | Ga0209281_1000243 | Ga0209281_100024356 | 129 |
| 634 | 3300027111 | Ga0209281_1000422 | Ga0209281_10004222 | 129 |
| 635 | 3300027312 | Ga0209371_1000013 | Ga0209371_1000013280 | 129 |
| 636 | 3300027312 | Ga0209371_1000427 | Ga0209371_100042725 | 129 |
| 637 | 3300027312 | Ga0209371_1001124 | Ga0209371_10011246 | 129 |
| 638 | 3300027312 | Ga0209371_1023428 | Ga0209371_10234281 | 129 |
| 639 | 3300027312 | Ga0209371_1032708 | Ga0209371_10327082 | 129 |
| 640 | 3300028379 | Ga0268266_10000041 | Ga0268266_1000004191 | 129 |
| 641 | 3300030500 | Ga0268256_1000014 | Ga0268256_1000014398 | 129 |
| 642 | 3300030500 | Ga0268256_1000363 | Ga0268256_100036325 | 129 |
| 643 | 3300030500 | Ga0268256_1021499 | Ga0268256_10214992 | 129 |
| 644 | 3300030500 | Ga0268256_1026531 | Ga0268256_10265311 | 129 |
| 645 | 3300031691 | Ga0316579_10079102 | Ga0316579_100791022 | 129 |
| 646 | 3300031727 | Ga0316576_10208429 | Ga0316576_102084292 | 129 |
| 647 | 3300031727 | Ga0316576_10346584 | Ga0316576_103465842 | 129 |
| 648 | 3300031728 | Ga0316578_10006169 | Ga0316578_100061694 | 129 |
| 649 | 3300031728 | Ga0316578_10015116 | Ga0316578_100151164 | 129 |
| 650 | 3300031733 | Ga0316577_10019864 | Ga0316577_100198642 | 129 |
| 651 | 3300032137 | Ga0316585_10016316 | Ga0316585_100163163 | 129 |
| 652 | 3300032139 | Ga0316580_10002910 | Ga0316580_100029102 | 129 |
| 653 | 3300032139 | Ga0316580_10011437 | Ga0316580_100114372 | 129 |
| 654 | 3300032168 | Ga0316593_10005031 | Ga0316593_100050312 | 129 |
| 655 | 3300032168 | Ga0316593_10062511 | Ga0316593_100625112 | 129 |
| 656 | 3300033524 | Ga0316592_1000666 | Ga0316592_10006664 | 129 |
| 657 | 3300033524 | Ga0316592_1011089 | Ga0316592_10110892 | 129 |
| 658 | 3300033528 | Ga0316588_1000764 | Ga0316588_10007643 | 129 |
| 659 | 3300033528 | Ga0316588_1005250 | Ga0316588_10052502 | 129 |
| 660 | 3300033541 | Ga0316596_1023746 | Ga0316596_10237462 | 129 |
| 661 | 3300033541 | Ga0316596_1039709 | Ga0316596_10397092 | 129 |
| 662 | 3300035398 | Ga0316574_0004273 | Ga0316574_0004273_2967_3359 | 129 |
| 663 | 3300035398 | Ga0316574_0267348 | Ga0316574_0267348_339_731 | 129 |
| 664 | 3300036647 | Ga0316582_0024850 | Ga0316582_0024850_176_568 | 129 |
| 665 | 3300036647 | Ga0316582_0048224 | Ga0316582_0048224_2224_2616 | 129 |
| 666 | 3300036712 | Ga0316584_0010338 | Ga0316584_0010338_3918_4310 | 129 |
| 667 | 3300036712 | Ga0316584_0025194 | Ga0316584_0025194_1147_1539 | 129 |
| 668 | 3300037588 | Ga0316581_0065812 | Ga0316581_0065812_127_519 | 129 |
| 669 | 3300038726 | Ga0400490_40590 | Ga0400490_40590_593_988 | 129 |
| 670 | 3300038741 | Ga0400488_62682 | Ga0400488_62682_523_918 | 129 |
| 671 | 3300039110 | Ga0400487_14017 | Ga0400487_14017_1072_1467 | 129 |
| 672 | 3300039437 | Ga0436365_0042508 | Ga0436365_0042508_23747_24190 | 129 |
| 673 | 3300041405 | Ga0439438_003218 | Ga0439438_003218_5124_5513 | 129 |
| 674 | 3300041486 | Ga0451807_0974327 | Ga0451807_0974327_411_803 | 129 |
| 675 | 3300041512 | Ga0451853_2427319 | Ga0451853_2427319_1913_2302 | 129 |
| 676 | 3300042006 | Ga0439432_027215 | Ga0439432_027215_1316_1705 | 129 |
| 677 | 3300042010 | Ga0439452_000011 | Ga0439452_000011_409900_410295 | 129 |
| 678 | 3300042010 | Ga0439452_000344 | Ga0439452_000344_18828_19217 | 129 |
| 679 | 3300042010 | Ga0439452_002524 | Ga0439452_002524_5978_6367 | 129 |
| 680 | 3300042137 | Ga0450902_052006 | Ga0450902_052006_270_659 | 129 |
| 681 | 3300042439 | Ga0439464_0001655 | Ga0439464_0001655_107_496 | 129 |
| 682 | 3300044669 | Ga0466981_0000001 | Ga0466981_0000001_118856_119245 | 129 |
| 683 | 3300046471 | Ga0495650_0000059 | Ga0495650_0000059_15124_15513 | 129 |
| 684 | 3300048903 | Ga0496100_0306909 | Ga0496100_0306909_730_1119 | 129 |
| 685 | 3300048903 | Ga0496100_1008716 | Ga0496100_1008716_71_460 | 129 |
| 686 | 3300048904 | Ga0496101_1058770 | Ga0496101_1058770_134_523 | 129 |
| 687 | 3300048907 | Ga0496104_0000680 | Ga0496104_0000680_20495_20884 | 129 |
| 688 | 3300048908 | Ga0496105_0009823 | Ga0496105_0009823_7030_7419 | 129 |
| 689 | 3300048916 | Ga0496113_0462794 | Ga0496113_0462794_597_986 | 129 |
| 690 | 3300048919 | Ga0496116_0002364 | Ga0496116_0002364_13181_13570 | 129 |
| 691 | 3300048919 | Ga0496116_0067587 | Ga0496116_0067587_721_1110 | 129 |
| 692 | 3300048920 | Ga0496117_0000168 | Ga0496117_0000168_124060_124449 | 129 |
| 693 | 3300048921 | Ga0496118_0000304 | Ga0496118_0000304_18973_19362 | 129 |
| 694 | 3300048922 | Ga0496119_0017781 | Ga0496119_0017781_58_447 | 129 |
| 695 | 3300048923 | Ga0496120_0013938 | Ga0496120_0013938_108_497 | 129 |
| 696 | 3300048923 | Ga0496120_0147265 | Ga0496120_0147265_32_421 | 129 |
| 697 | 3300048924 | Ga0496121_0020822 | Ga0496121_0020822_89_478 | 129 |
| 698 | 3300048924 | Ga0496121_0669107 | Ga0496121_0669107_38_427 | 129 |
| 699 | 3300048925 | Ga0496122_0002021 | Ga0496122_0002021_14978_15421 | 129 |
| 700 | 3300048925 | Ga0496122_0002096 | Ga0496122_0002096_11699_12088 | 129 |
| 701 | 3300048925 | Ga0496122_0069982 | Ga0496122_0069982_1252_1641 | 129 |
| 702 | 3300048926 | Ga0496123_0000605 | Ga0496123_0000605_15264_15653 | 129 |
| 703 | 3300048926 | Ga0496123_0002325 | Ga0496123_0002325_6017_6406 | 129 |
| 704 | 3300048926 | Ga0496123_0472030 | Ga0496123_0472030_55_450 | 129 |
| 705 | 3300048927 | Ga0496124_0133469 | Ga0496124_0133469_813_1205 | 129 |
| 706 | 3300048927 | Ga0496124_0177748 | Ga0496124_0177748_301_690 | 129 |
| 707 | 3300048928 | Ga0496125_0000081 | Ga0496125_0000081_205989_206378 | 129 |
| 708 | 3300048928 | Ga0496125_0007362 | Ga0496125_0007362_6122_6511 | 129 |
| 709 | 3300048928 | Ga0496125_0022828 | Ga0496125_0022828_5326_5715 | 129 |
| 710 | 3300048929 | Ga0496126_0001662 | Ga0496126_0001662_9752_10141 | 129 |
| 711 | 3300048929 | Ga0496126_0005302 | Ga0496126_0005302_5975_6364 | 129 |
| 712 | 3300048929 | Ga0496126_0155487 | Ga0496126_0155487_73_462 | 129 |
| 713 | 3300048929 | Ga0496126_0394059 | Ga0496126_0394059_710_1099 | 129 |
| 714 | 3300050491 | nmdc:mga00v17_6047_c1 | nmdc:mga00v17_6047_c1_3510_3899 | 129 |
| 715 | 3300050493 | nmdc:mga0k408_4578_c1 | nmdc:mga0k408_4578_c1_804_1193 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a8k-assembly1.cif.gz_E | crystal structure of etd97n-ehred complex | 0.9901 | 3 | 127 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9896 | 3 | 129 |
| 3a7a-assembly2.cif.gz_D | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9871 | 3 | 129 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9845 | 3 | 128 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9827 | 2 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3a8jE00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9855 | 2 | 127 | 2.40.50.100 |
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9835 | 8 | 125 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9806 | 8 | 128 | 2.40.50.100 |
| af_K7TZ76_31_128_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9715 | 38 | 129 | 2.40.50.100 |
| 3a8jE00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9701 | 2 | 127 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5GR25-F1-model_v4 | Glycine cleavage system H protein | 0.9989 | 3 | 122 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A6I6IGN9-F1-model_v4 | deleted | 0.9976 | 1 | 127 |
|
| AF-A0A3M0Z9B7-F1-model_v4 | Glycine cleavage system H protein | 0.9976 | 3 | 128 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A6N9B0N4-F1-model_v4 | Glycine cleavage system H protein | 0.9975 | 1 | 128 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A6A5KVE9-F1-model_v4 | deleted | 0.9974 | 1 | 117 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar