F476510

General Info

Members Datasets Scaffolds Average Seq Length
706 353 702 107

Family's Representative Sequence

Representative Sequence 3300049770|Ga0501273_072832|Ga0501273_072832_152_538
Length 128
Sequence LPATSFVPSALITGRSCHRSYNRGMKLYKVTFLNHGRVYELYARRVTGSSLWGFTEVGDLVFDVNDGVVIDPTEERLRDEFGNTRVLHLPMQSVVRVEEVDRKGQSAIRDAATGESVVTPFPLPAKPR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2884411467 Dyella sp. AD56 Isolate Rhizosphere
6 2928963466 Dyella japonica 1073 Isolate Unclassified
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
94 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
95 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
98 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
112 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
129 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
198 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
199 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
200 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
201 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
221 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
222 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
225 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
226 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
227 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
230 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
231 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
241 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
242 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
243 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
244 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
245 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
246 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
247 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
253 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
254 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
327 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
328 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
329 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
330 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
331 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
332 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
333 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
334 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
340 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
341 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
342 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
352 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.97
Nodule 0
Rhizoplane 6.8
Rhizosphere 62.75
Stem 0
Stem Tuber 0
Unclassified 10.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2318 2010549000 Bacteria 2298
2 SwRhRL2b_contig_3083456 2162886007 Bacteria 3968
3 JGI24739J22299_10002511 3300001989 Bacteria 7080
4 JGI24737J22298_10000898 3300001990 Bacteria 10587
5 JGI24737J22298_10012164 3300001990 Bacteria 2807
6 JGI24735J21928_10015344 3300002067 Bacteria 2391
7 JGI25156J39149_1002031 3300002705 Bacteria 7719
8 JGI25156J39149_1005020 3300002705 Bacteria 3907
9 JGI25162J39368_1000585 3300002737 Bacteria 26682
10 JGI25162J39368_1001345 3300002737 Bacteria 13629
11 JGI25162J39368_1001632 3300002737 Bacteria 11183
12 JGI25157J39369_1000258 3300002741 Bacteria 38929
13 JGI25157J39369_1000906 3300002741 Bacteria 14206
14 JGI25157J39369_1001632 3300002741 Bacteria 7717
15 JGI25163J39215_1000475 3300002771 Bacteria 12121
16 JGI25164J39214_1000004 3300002772 Bacteria 350814
17 JGI25164J39214_1000677 3300002772 Bacteria 13629
18 JGI25152J39213_1000312 3300002773 Bacteria 31247
19 JGI25150J39212_1000221 3300002774 Bacteria 31248
20 JGI25151J46595_10000093 3300003187 Bacteria 121884
21 JGI25165J46597_1000164 3300003214 Bacteria 104150
22 JGI25165J46597_1001357 3300003214 Bacteria 13629
23 JGI25153J46596_10000061 3300003215 Bacteria 131624
24 rootH1_10021424 3300003316 Bacteria 3046
25 rootH2_10043016 3300003320 Bacteria 3129
26 rootH2_10189554 3300003320 Bacteria 1429
27 rootL2_10138739 3300003322 Bacteria 3199
28 rootH1_10190495 3300003323 Bacteria 1899
29 Ga0055538_1003048 3300003751 Bacteria 2222
30 Ga0055539_1001206 3300003752 Bacteria 5230
31 Ga0055533_1002415 3300003756 Bacteria 4255
32 Ga0055533_1005491 3300003756 Bacteria 2024
33 Ga0055525_1000293 3300003759 Bacteria 44400
34 Ga0055527_1000070 3300003760 Bacteria 85704
35 Ga0055527_1000077 3300003760 Bacteria 79793
36 Ga0055527_1016305 3300003760 Bacteria 803
37 Ga0055535_1000117 3300003761 Bacteria 85705
38 Ga0055535_1000130 3300003761 Bacteria 79793
39 Ga0055535_1001093 3300003761 Bacteria 16552
40 Ga0055535_1001283 3300003761 Bacteria 13629
41 Ga0055535_1001578 3300003761 Bacteria 10993
42 Ga0055535_1011473 3300003761 Bacteria 1399
43 Ga0055535_1028561 3300003761 Bacteria 599
44 Ga0055542_1000156 3300003762 Bacteria 85704
45 Ga0055542_1000174 3300003762 Bacteria 79793
46 Ga0055542_1000184 3300003762 Bacteria 77138
47 Ga0055542_1001071 3300003762 Bacteria 16843
48 Ga0055542_1001086 3300003762 Bacteria 16552
49 Ga0055542_1001273 3300003762 Bacteria 13629
50 Ga0055529_1000102 3300003763 Bacteria 129901
51 Ga0055529_1000201 3300003763 Bacteria 79793
52 Ga0055529_1000353 3300003763 Bacteria 50427
53 Ga0055529_1001006 3300003763 Bacteria 13629
54 Ga0055537_1000572 3300003773 Bacteria 20644
55 Ga0055524_1000393 3300003775 Bacteria 37606
56 Ga0055536_1005416 3300003781 Bacteria 6246
57 Ga0055536_1008638 3300003781 Bacteria 4341
58 Ga0055536_1024198 3300003781 Bacteria 1765
59 Ga0055534_1000527 3300003784 Bacteria 20644
60 Ga0055528_1000855 3300003790 Bacteria 20644
61 Ga0055530_10001682 3300003791 Bacteria 15686
62 Ga0055531_10008817 3300003794 Bacteria 5252
63 Ga0055531_10013482 3300003794 Bacteria 3763
64 Ga0055531_10022842 3300003794 Bacteria 2368
65 Ga0055531_10049384 3300003794 Bacteria 1124
66 Ga0065165_1002561 3300005262 Bacteria 15022
67 Ga0070658_10096605 3300005327 Bacteria 2439
68 Ga0070683_101483383 3300005329 Bacteria 652
69 Ga0070670_100005341 3300005331 Bacteria 10834
70 Ga0070670_100115474 3300005331 Bacteria 2314
71 Ga0070670_101108685 3300005331 Bacteria 722
72 Ga0070670_101505316 3300005331 Bacteria 618
73 Ga0070670_101769652 3300005331 Bacteria 569
74 Ga0070680_101853441 3300005336 Bacteria 523
75 Ga0070682_101406370 3300005337 Bacteria 597
76 Ga0070660_100030951 3300005339 Bacteria 4016
77 Ga0070660_101642800 3300005339 Bacteria 547
78 Ga0070689_100003754 3300005340 Bacteria 10168
79 Ga0070687_100538828 3300005343 Bacteria 792
80 Ga0070661_100217132 3300005344 Bacteria 1465
81 Ga0070661_100244792 3300005344 Bacteria 1382
82 Ga0070661_101369120 3300005344 Bacteria 595
83 Ga0070668_102080038 3300005347 Bacteria 524
84 Ga0070669_100081991 3300005353 Bacteria 2404
85 Ga0070675_101265473 3300005354 Bacteria 679
86 Ga0070675_101279379 3300005354 Bacteria 676
87 Ga0070671_100101724 3300005355 Bacteria 2411
88 Ga0070671_100351778 3300005355 Bacteria 1257
89 Ga0070674_100258178 3300005356 Bacteria 1372
90 Ga0070673_100401476 3300005364 Bacteria 1226
91 Ga0070688_100067733 3300005365 Bacteria 2275
92 Ga0070659_101520039 3300005366 Bacteria 597
93 Ga0070667_100077353 3300005367 Bacteria 2841
94 Ga0070667_101840776 3300005367 Bacteria 570
95 Ga0070713_101934787 3300005436 Bacteria 572
96 Ga0070663_100051543 3300005455 Bacteria 2932
97 Ga0070663_100232870 3300005455 Bacteria 1451
98 Ga0070663_100246127 3300005455 Bacteria 1413
99 Ga0070662_101052018 3300005457 Bacteria 698
100 Ga0070681_10579391 3300005458 Bacteria 1036
101 Ga0070681_11007685 3300005458 Bacteria 753
102 Ga0070685_10020697 3300005466 Bacteria 3563
103 Ga0070679_100146755 3300005530 Bacteria 2336
104 Ga0068853_100032189 3300005539 Bacteria 4441
105 Ga0068853_100130498 3300005539 Bacteria 2249
106 Ga0068853_100640281 3300005539 Bacteria 1011
107 Ga0070672_100005743 3300005543 Bacteria 8270
108 Ga0070665_100814868 3300005548 Bacteria 946
109 Ga0070665_100851210 3300005548 Bacteria 925
110 Ga0070665_102388953 3300005548 Bacteria 531
111 Ga0068855_100071681 3300005563 Bacteria 4028
112 Ga0068855_100361813 3300005563 Bacteria 1596
113 Ga0068855_101577595 3300005563 Bacteria 672
114 Ga0070664_100210219 3300005564 Bacteria 1738
115 Ga0070664_100295361 3300005564 Bacteria 1463
116 Ga0070664_100457157 3300005564 Bacteria 1173
117 Ga0070664_101243865 3300005564 Bacteria 703
118 Ga0068857_100047656 3300005577 Bacteria 3805
119 Ga0068857_100324915 3300005577 Bacteria 1421
120 Ga0068854_100025861 3300005578 Bacteria 4028
121 Ga0068854_100193082 3300005578 Bacteria 1596
122 Ga0068854_100431674 3300005578 Bacteria 1096
123 Ga0068856_100000909 3300005614 Bacteria 31625
124 Ga0068852_100153318 3300005616 Bacteria 2145
125 Ga0068852_100191949 3300005616 Bacteria 1928
126 Ga0068852_100901881 3300005616 Bacteria 901
127 Ga0068852_101418060 3300005616 Bacteria 717
128 Ga0068859_100121970 3300005617 Bacteria 2673
129 Ga0068859_100393341 3300005617 Bacteria 1482
130 Ga0068864_102236860 3300005618 Bacteria 553
131 Ga0068851_10023851 3300005834 Bacteria 2992
132 Ga0068858_100071997 3300005842 Bacteria 3207
133 Ga0068860_100017659 3300005843 Bacteria 6951
134 Ga0068862_100378023 3300005844 Bacteria 1320
135 Ga0068862_101549252 3300005844 Bacteria 669
136 Ga0075364_10000261 3300006051 Bacteria 25565
137 Ga0075366_10319580 3300006195 Bacteria 951
138 Ga0075431_100761496 3300006847 Bacteria 943
139 Ga0097620_100121970 3300006931 Bacteria 2673
140 Ga0097620_100393304 3300006931 Bacteria 1482
141 Ga0105251_10001882 3300009011 Bacteria 17203
142 Ga0105240_10053139 3300009093 Bacteria 5088
143 Ga0105240_10069096 3300009093 Bacteria 4373
144 Ga0105240_10078089 3300009093 Bacteria 4077
145 Ga0105240_10080210 3300009093 Bacteria 4014
146 Ga0105243_10000720 3300009148 Bacteria 31769
147 Ga0105241_10259256 3300009174 Bacteria 1477
148 Ga0105242_11736573 3300009176 Bacteria 661
149 Ga0105237_10000097 3300009545 Bacteria 121349
150 Ga0105237_10880354 3300009545 Bacteria 902
151 Ga0105238_10248899 3300009551 Bacteria 1755
152 Ga0105249_11530538 3300009553 Bacteria 739
153 Ga0105239_10001059 3300010375 Bacteria 38260
154 Ga0105239_10171871 3300010375 Bacteria 2423
155 Ga0105239_10507271 3300010375 Bacteria 1372
156 Ga0105246_11891163 3300011119 Bacteria 573
157 Ga0157340_1007427 3300012473 Bacteria 711
158 Ga0157319_1036975 3300012497 Bacteria 555
159 Ga0157345_1046811 3300012498 Bacteria 538
160 Ga0157314_1000048 3300012500 Bacteria 12500
161 Ga0157347_1046055 3300012502 Bacteria 589
162 Ga0157339_1004456 3300012505 Bacteria 1062
163 Ga0157373_10028254 3300013100 Bacteria 4046
164 Ga0157373_10381905 3300013100 Bacteria 1008
165 Ga0157371_10066305 3300013102 Bacteria 2556
166 Ga0157371_10522053 3300013102 Bacteria 878
167 Ga0157370_10624369 3300013104 Bacteria 986
168 Ga0157369_10020750 3300013105 Bacteria 7343
169 Ga0157369_10031050 3300013105 Bacteria 5888
170 Ga0157369_10110365 3300013105 Bacteria 2924
171 Ga0157369_10127335 3300013105 Bacteria 2699
172 Ga0157378_10831220 3300013297 Bacteria 951
173 Ga0163162_10762579 3300013306 Bacteria 1086
174 Ga0157372_10303041 3300013307 Bacteria 1859
175 Ga0157372_10325770 3300013307 Bacteria 1789
176 Ga0157372_10431109 3300013307 Bacteria 1537
177 Ga0157372_10452587 3300013307 Bacteria 1496
178 Ga0157375_10158743 3300013308 Bacteria 2402
179 Ga0163163_10163739 3300014325 Bacteria 2270
180 Ga0182008_10231576 3300014497 Bacteria 948
181 Ga0182008_10516346 3300014497 Bacteria 659
182 Ga0182006_1006577 3300015261 Bacteria 5387
183 Ga0182005_1001273 3300015265 Bacteria 10373
184 Ga0182005_1194366 3300015265 Bacteria 607
185 Ga0183369_1019 3300015685 Bacteria 115894
186 Ga0183368_1007 3300015687 Bacteria 405609
187 Ga0163161_10338107 3300017792 Bacteria 1194
188 Ga0163161_10730561 3300017792 Bacteria 827
189 Ga0209760_101412 3300025207 Bacteria 2565
190 Ga0209784_100544 3300025224 Bacteria 13789
191 Ga0209566_106220 3300025225 Bacteria 1429
192 Ga0209566_106838 3300025225 Bacteria 1318
193 Ga0209674_100037 3300025226 Bacteria 404339
194 Ga0209674_100299 3300025226 Bacteria 34536
195 Ga0209672_100070 3300025228 Bacteria 174481
196 Ga0209672_100084 3300025228 Bacteria 129975
197 Ga0209672_100099 3300025228 Bacteria 109599
198 Ga0209672_100381 3300025228 Bacteria 27146
199 Ga0209672_101575 3300025228 Bacteria 7732
200 Ga0209672_106816 3300025228 Bacteria 1819
201 Ga0209563_100174 3300025230 Bacteria 44452
202 Ga0207427_100031 3300025231 Bacteria 350866
203 Ga0207427_100831 3300025231 Bacteria 13790
204 Ga0207427_103488 3300025231 Bacteria 3264
205 Ga0207427_108173 3300025231 Bacteria 1181
206 Ga0209437_100061 3300025233 Bacteria 350866
207 Ga0209437_100123 3300025233 Bacteria 200393
208 Ga0209437_100323 3300025233 Bacteria 61084
209 Ga0209437_131123 3300025233 Bacteria 538
210 Ga0209258_100054 3300025242 Bacteria 339063
211 Ga0209258_100104 3300025242 Bacteria 208582
212 Ga0209258_100188 3300025242 Bacteria 130022
213 Ga0209258_100218 3300025242 Bacteria 109599
214 Ga0209258_100281 3300025242 Bacteria 85049
215 Ga0209258_100923 3300025242 Bacteria 14716
216 Ga0209258_106372 3300025242 Bacteria 1858
217 Ga0207425_1000015 3300025245 Bacteria 466368
218 Ga0209646_1000619 3300025246 Bacteria 13641
219 Ga0209646_1007923 3300025246 Bacteria 1723
220 Ga0209646_1012880 3300025246 Bacteria 1278
221 Ga0209026_1000171 3300025250 Bacteria 98984
222 Ga0209026_1000550 3300025250 Bacteria 25769
223 Ga0209026_1001022 3300025250 Bacteria 13766
224 Ga0209677_101680 3300025253 Bacteria 9248
225 Ga0209677_132389 3300025253 Bacteria 522
226 Ga0209148_1000063 3300025254 Bacteria 346881
227 Ga0209148_1000066 3300025254 Bacteria 339063
228 Ga0209148_1000106 3300025254 Bacteria 208597
229 Ga0209148_1000196 3300025254 Bacteria 109599
230 Ga0209148_1000252 3300025254 Bacteria 85199
231 Ga0209148_1001272 3300025254 Bacteria 13790
232 Ga0209759_1000137 3300025256 Bacteria 125216
233 Ga0209759_1000487 3300025256 Bacteria 43693
234 Ga0209759_1001414 3300025256 Bacteria 13669
235 Ga0209759_1003274 3300025256 Bacteria 6537
236 Ga0209129_1000131 3300025258 Bacteria 127801
237 Ga0209129_1006938 3300025258 Bacteria 3502
238 Ga0209233_1000076 3300025261 Bacteria 350866
239 Ga0209233_1000136 3300025261 Bacteria 200393
240 Ga0209233_1012259 3300025261 Bacteria 2491
241 Ga0209565_1000001 3300025263 Bacteria 2950419
242 Ga0209455_1000146 3300025272 Bacteria 133032
243 Ga0209455_1000173 3300025272 Bacteria 109599
244 Ga0209455_1000831 3300025272 Bacteria 16664
245 Ga0209455_1001041 3300025272 Bacteria 13812
246 Ga0209455_1008836 3300025272 Bacteria 2699
247 Ga0209455_1010273 3300025272 Bacteria 2392
248 Ga0209673_1000001 3300025273 Bacteria 3176258
249 Ga0209673_1006434 3300025273 Bacteria 5668
250 Ga0209130_1005216 3300025284 Bacteria 4592
251 Ga0209675_1000001 3300025291 Bacteria 2950293
252 Ga0209675_1003612 3300025291 Bacteria 7267
253 Ga0209676_1001795 3300025292 Bacteria 18008
254 Ga0209676_1002044 3300025292 Bacteria 15780
255 Ga0209676_1007405 3300025292 Bacteria 5158
256 Ga0209676_1008414 3300025292 Bacteria 4604
257 Ga0209676_1009197 3300025292 Bacteria 4297
258 Ga0209025_1000002 3300025294 Bacteria 1393142
259 Ga0209025_1000030 3300025294 Bacteria 441196
260 Ga0209025_1005191 3300025294 Bacteria 10762
261 Ga0209025_1030021 3300025294 Bacteria 2613
262 Ga0209025_1103958 3300025294 Bacteria 891
263 Ga0209564_1000001 3300025295 Bacteria 3176258
264 Ga0209758_1000003 3300025297 Bacteria 1398533
265 Ga0209758_1017138 3300025297 Bacteria 3630
266 Ga0209758_1019182 3300025297 Bacteria 3312
267 Ga0209050_1000429 3300025298 Bacteria 77085
268 Ga0209256_1000006 3300025299 Bacteria 1250310
269 Ga0209256_1002127 3300025299 Bacteria 17165
270 Ga0209256_1007777 3300025299 Bacteria 5172
271 Ga0209256_1008339 3300025299 Bacteria 4830
272 Ga0207426_1064789 3300025302 Bacteria 1038
273 Ga0209051_1029247 3300025303 Bacteria 2159
274 Ga0209257_1000336 3300025304 Bacteria 97981
275 Ga0209257_1001853 3300025304 Bacteria 22971
276 Ga0209257_1001936 3300025304 Bacteria 22336
277 Ga0209257_1002007 3300025304 Bacteria 21769
278 Ga0209257_1006315 3300025304 Bacteria 7720
279 Ga0207656_10022662 3300025321 Bacteria 2522
280 Ga0207713_1003029 3300025735 Bacteria 11720
281 Ga0207642_10325457 3300025899 Bacteria 899
282 Ga0207647_10003619 3300025904 Bacteria 11569
283 Ga0207647_10004339 3300025904 Bacteria 10511
284 Ga0207647_10102547 3300025904 Bacteria 1697
285 Ga0207643_10661549 3300025908 Bacteria 674
286 Ga0207654_10153932 3300025911 Bacteria 1478
287 Ga0207707_10317991 3300025912 Bacteria 1344
288 Ga0207695_10010112 3300025913 Bacteria 11576
289 Ga0207695_10017110 3300025913 Bacteria 8453
290 Ga0207695_10034917 3300025913 Bacteria 5461
291 Ga0207695_10058395 3300025913 Bacteria 4004
292 Ga0207671_10000119 3300025914 Bacteria 121359
293 Ga0207660_11047306 3300025917 Bacteria 665
294 Ga0207662_10629092 3300025918 Bacteria 748
295 Ga0207657_10011830 3300025919 Bacteria 8638
296 Ga0207657_10140190 3300025919 Bacteria 1976
297 Ga0207649_10246167 3300025920 Bacteria 1285
298 Ga0207649_10291108 3300025920 Bacteria 1191
299 Ga0207652_10339288 3300025921 Bacteria 1356
300 Ga0207681_10125182 3300025923 Bacteria 1891
301 Ga0207694_10210265 3300025924 Bacteria 1585
302 Ga0207694_10919745 3300025924 Bacteria 740
303 Ga0207650_10004256 3300025925 Bacteria 9768
304 Ga0207650_10476465 3300025925 Bacteria 1041
305 Ga0207650_10654661 3300025925 Bacteria 886
306 Ga0207650_11710214 3300025925 Bacteria 533
307 Ga0207659_10392983 3300025926 Bacteria 1158
308 Ga0207644_10192433 3300025931 Bacteria 1604
309 Ga0207644_10491218 3300025931 Bacteria 1012
310 Ga0207706_10316533 3300025933 Bacteria 1358
311 Ga0207706_10487466 3300025933 Bacteria 1065
312 Ga0207686_10964471 3300025934 Bacteria 691
313 Ga0207709_10001168 3300025935 Bacteria 19045
314 Ga0207670_10002189 3300025936 Bacteria 10219
315 Ga0207670_10668341 3300025936 Bacteria 858
316 Ga0207669_10230593 3300025937 Bacteria 1366
317 Ga0207691_10131251 3300025940 Bacteria 2213
318 Ga0207679_10067364 3300025945 Bacteria 2686
319 Ga0207679_10087256 3300025945 Bacteria 2402
320 Ga0207679_10296996 3300025945 Bacteria 1391
321 Ga0207679_10326218 3300025945 Bacteria 1331
322 Ga0207667_10001947 3300025949 Bacteria 25869
323 Ga0207667_10253217 3300025949 Bacteria 1801
324 Ga0207651_10091042 3300025960 Bacteria 2232
325 Ga0207668_10061007 3300025972 Bacteria 2649
326 Ga0207640_10003313 3300025981 Bacteria 8682
327 Ga0207640_10019106 3300025981 Bacteria 4042
328 Ga0207640_10302021 3300025981 Bacteria 1267
329 Ga0207677_10211592 3300026023 Bacteria 1549
330 Ga0207703_10287005 3300026035 Bacteria 1497
331 Ga0207639_10107968 3300026041 Bacteria 2262
332 Ga0207639_10203853 3300026041 Bacteria 1698
333 Ga0207639_11190600 3300026041 Bacteria 715
334 Ga0207678_10066833 3300026067 Bacteria 3086
335 Ga0207678_10069102 3300026067 Bacteria 3029
336 Ga0207678_10102487 3300026067 Bacteria 2443
337 Ga0207678_10129759 3300026067 Bacteria 2150
338 Ga0207702_10001326 3300026078 Bacteria 24789
339 Ga0207648_10165160 3300026089 Bacteria 1956
340 Ga0207674_10001298 3300026116 Bacteria 32640
341 Ga0207674_10733770 3300026116 Bacteria 953
342 Ga0207683_10244072 3300026121 Bacteria 1638
343 Ga0207698_10202276 3300026142 Bacteria 1779
344 Ga0207698_10801184 3300026142 Bacteria 944
345 Ga0209371_1000025 3300027312 Bacteria 450640
346 Ga0209984_1069063 3300027424 Bacteria 527
347 Ga0209999_1003170 3300027543 Bacteria 2931
348 Ga0209982_1004176 3300027552 Bacteria 2066
349 Ga0209970_1023780 3300027614 Bacteria 1044
350 Ga0209983_1002053 3300027665 Bacteria 4444
351 Ga0209971_1004182 3300027682 Bacteria 3423
352 Ga0209974_10012492 3300027876 Bacteria 2839
353 Ga0209974_10143883 3300027876 Bacteria 857
354 Ga0268266_10702354 3300028379 Bacteria 975
355 Ga0268265_10925022 3300028380 Bacteria 857
356 Ga0268265_11867393 3300028380 Bacteria 607
357 Ga0268264_10121773 3300028381 Bacteria 2300
358 Ga0307515_10222018 3300028794 Bacteria 1705
359 Ga0265338_10221083 3300028800 Bacteria 1415
360 Ga0268256_1000027 3300030500 Bacteria 450640
361 Ga0316176_1093772 3300030732 Bacteria 550
362 Ga0314311_1024079 3300030733 Bacteria 8759
363 Ga0316178_1070040 3300030735 Bacteria 1402
364 Ga0316182_1288570 3300030745 Bacteria 2544
365 Ga0307513_10001910 3300031456 Bacteria 29613
366 Ga0307513_10180614 3300031456 Bacteria 1974
367 Ga0307513_10217896 3300031456 Bacteria 1733
368 Ga0307408_100388434 3300031548 Bacteria 1195
369 Ga0307408_100514605 3300031548 Bacteria 1050
370 Ga0307408_100882533 3300031548 Bacteria 817
371 Ga0307408_100944790 3300031548 Bacteria 792
372 Ga0307405_10051058 3300031731 Bacteria 2564
373 Ga0307405_10540874 3300031731 Bacteria 941
374 Ga0307413_10180981 3300031824 Bacteria 1503
375 Ga0307413_10236922 3300031824 Bacteria 1344
376 Ga0307413_10609843 3300031824 Bacteria 894
377 Ga0307410_10092428 3300031852 Bacteria 2151
378 Ga0307406_10294410 3300031901 Bacteria 1244
379 Ga0307406_11800255 3300031901 Bacteria 544
380 Ga0307407_10300183 3300031903 Bacteria 1119
381 Ga0307412_10010200 3300031911 Bacteria 5406
382 Ga0307412_10319964 3300031911 Bacteria 1234
383 Ga0307412_10342889 3300031911 Bacteria 1196
384 Ga0307409_100925890 3300031995 Bacteria 886
385 Ga0307409_102416732 3300031995 Bacteria 554
386 Ga0307416_100097588 3300032002 Bacteria 2545
387 Ga0307416_100392983 3300032002 Bacteria 1421
388 Ga0307414_10006203 3300032004 Bacteria 6647
389 Ga0307414_10257343 3300032004 Bacteria 1454
390 Ga0307414_10910731 3300032004 Bacteria 806
391 Ga0307411_10565188 3300032005 Bacteria 972
392 Ga0307415_100135850 3300032126 Bacteria 1870
393 Ga0307415_100137324 3300032126 Bacteria 1861
394 Ga0395899_0000146 3300037312 Bacteria 107272
395 Ga0395899_0012324 3300037312 Bacteria 6550
396 Ga0395899_0060457 3300037312 Bacteria 2791
397 Ga0395899_0112438 3300037312 Bacteria 1956
398 Ga0395899_0127101 3300037312 Bacteria 1822
399 Ga0395899_0212266 3300037312 Bacteria 1344
400 Ga0395899_0762455 3300037312 Bacteria 601
401 Ga0395900_0000272 3300037418 Bacteria 78624
402 Ga0395900_0000706 3300037418 Bacteria 44517
403 Ga0395900_0005525 3300037418 Bacteria 13238
404 Ga0395900_0156726 3300037418 Bacteria 2325
405 Ga0395900_0180956 3300037418 Bacteria 2142
406 Ga0395900_0211976 3300037418 Bacteria 1956
407 Ga0395898_0000329 3300037466 Bacteria 107288
408 Ga0395898_0000387 3300037466 Bacteria 96473
409 Ga0395898_0006340 3300037466 Bacteria 12645
410 Ga0395898_0051318 3300037466 Bacteria 4034
411 Ga0395898_0100309 3300037466 Bacteria 2780
412 Ga0395898_0117860 3300037466 Bacteria 2543
413 Ga0395898_0516582 3300037466 Bacteria 1135
414 Ga0395898_0747058 3300037466 Bacteria 920
415 Ga0395905_1057310 3300037471 Bacteria 715
416 Ga0395905_1168933 3300037471 Bacteria 673
417 Ga0395905_1462927 3300037471 Bacteria 587
418 Ga0395901_0080818 3300038443 Bacteria 3394
419 Ga0395901_0086604 3300038443 Bacteria 3275
420 Ga0395901_0100329 3300038443 Bacteria 3036
421 Ga0395901_0114438 3300038443 Bacteria 2833
422 Ga0395901_0178598 3300038443 Bacteria 2226
423 Ga0395901_0265101 3300038443 Bacteria 1787
424 Ga0395901_0574668 3300038443 Bacteria 1139
425 Ga0237819_00236 3300038705 Bacteria 20281
426 Ga0439436_0005936 3300041404 Bacteria 3744
427 Ga0439436_0057950 3300041404 Bacteria 1086
428 Ga0439439_0042318 3300041406 Bacteria 1183
429 Ga0439439_0128463 3300041406 Bacteria 711
430 Ga0439465_0347867 3300041413 Bacteria 559
431 Ga0451787_607498 3300041441 Bacteria 1178
432 Ga0451791_1078979 3300041451 Bacteria 1671
433 Ga0451791_1601619 3300041451 Bacteria 795
434 Ga0451793_0499790 3300041452 Bacteria 1088
435 Ga0451793_0935961 3300041452 Bacteria 749
436 Ga0451793_1186641 3300041452 Bacteria 1020
437 Ga0451797_0296971 3300041453 Bacteria 3358
438 Ga0451797_0309277 3300041453 Bacteria 764
439 Ga0451797_0487859 3300041453 Bacteria 616
440 Ga0451800_0738262 3300041459 Bacteria 8638
441 Ga0451800_1647684 3300041459 Bacteria 741
442 Ga0451802_1263235 3300041460 Bacteria 1452
443 Ga0451802_1631226 3300041460 Bacteria 520
444 Ga0451806_250174 3300041462 Bacteria 1150
445 Ga0451804_0352159 3300041463 Bacteria 687
446 Ga0451804_0831922 3300041463 Bacteria 8128
447 Ga0451807_0161263 3300041486 Bacteria 799
448 Ga0451807_0330082 3300041486 Bacteria 574
449 Ga0451807_0683873 3300041486 Bacteria 522
450 Ga0451807_1108932 3300041486 Bacteria 8511
451 Ga0451807_1270057 3300041486 Bacteria 613
452 Ga0451807_2641394 3300041486 Bacteria 515
453 Ga0451833_1485257 3300041491 Bacteria 702
454 Ga0451837_0563368 3300041494 Bacteria 570
455 Ga0451837_1261700 3300041494 Bacteria 789
456 Ga0451839_1008954 3300041496 Bacteria 920
457 Ga0451843_0940890 3300041509 Bacteria 513
458 Ga0451843_1204386 3300041509 Bacteria 562
459 Ga0451843_1305810 3300041509 Bacteria 1565
460 Ga0451843_1349917 3300041509 Bacteria 575
461 Ga0451853_2568479 3300041512 Bacteria 668
462 Ga0451853_2783524 3300041512 Bacteria 1095
463 Ga0451853_3065596 3300041512 Bacteria 2237
464 Ga0439431_0024710 3300041997 Bacteria 1464
465 Ga0439433_0013143 3300041999 Bacteria 1818
466 Ga0439433_0014237 3300041999 Bacteria 1751
467 Ga0439433_0052184 3300041999 Bacteria 966
468 Ga0439445_0181258 3300042004 Bacteria 619
469 Ga0439448_0022066 3300042005 Bacteria 1976
470 Ga0439432_048250 3300042006 Bacteria 1334
471 Ga0439432_058718 3300042006 Bacteria 1189
472 Ga0439432_061618 3300042006 Bacteria 1156
473 Ga0439432_125989 3300042006 Bacteria 757
474 Ga0439449_0004794 3300042007 Bacteria 5219
475 Ga0439449_0006005 3300042007 Bacteria 4638
476 Ga0439449_0023675 3300042007 Bacteria 2296
477 Ga0439449_0044505 3300042007 Bacteria 1646
478 Ga0439449_0062623 3300042007 Bacteria 1372
479 Ga0439449_0212730 3300042007 Bacteria 724
480 Ga0439455_0104683 3300042012 Bacteria 784
481 Ga0439457_036129 3300042014 Bacteria 1099
482 Ga0439462_0011336 3300042015 Bacteria 2269
483 Ga0439462_0036505 3300042015 Bacteria 1308
484 Ga0439462_0054119 3300042015 Bacteria 1081
485 Ga0450905_000985 3300042142 Bacteria 3567
486 Ga0439434_0036439 3300042435 Bacteria 1505
487 Ga0451577_0004886 3300042876 Bacteria 13970
488 Ga0466969_0042827 3300044656 Bacteria 2257
489 Ga0466969_0044980 3300044656 Bacteria 2193
490 Ga0466969_0068577 3300044656 Bacteria 1708
491 Ga0466969_0123395 3300044656 Bacteria 1205
492 Ga0466972_0120151 3300044658 Bacteria 1239
493 Ga0466975_0328806 3300044661 Bacteria 969
494 Ga0466989_0052329 3300044663 Bacteria 2498
495 Ga0466982_0000238 3300044672 Bacteria 14645
496 Ga0466965_0057434 3300044683 Bacteria 1939
497 Ga0466965_0245410 3300044683 Bacteria 959
498 Ga0466966_0025895 3300044684 Bacteria 3831
499 Ga0466966_0055894 3300044684 Bacteria 2497
500 Ga0466966_0112713 3300044684 Bacteria 1675
501 Ga0466966_0168758 3300044684 Bacteria 1330
502 Ga0466961_0000454 3300044693 Bacteria 26030
503 Ga0466961_0002186 3300044693 Bacteria 12157
504 Ga0466961_0003288 3300044693 Bacteria 10070
505 Ga0466961_0029207 3300044693 Bacteria 3545
506 Ga0466961_0151176 3300044693 Bacteria 1449
507 Ga0466961_0309044 3300044693 Bacteria 965
508 Ga0466963_0110736 3300044694 Bacteria 1885
509 Ga0466963_0345233 3300044694 Bacteria 1048
510 Ga0466963_0390656 3300044694 Bacteria 981
511 Ga0466964_0022882 3300044706 Bacteria 2427
512 Ga0466964_0066792 3300044706 Bacteria 1510
513 Ga0466964_0143546 3300044706 Bacteria 1100
514 Ga0453684_0279891 3300044712 Bacteria 1903
515 Ga0466971_0009727 3300044719 Bacteria 4197
516 Ga0466971_0050142 3300044719 Bacteria 1878
517 Ga0466971_0083049 3300044719 Bacteria 1462
518 Ga0466968_0086903 3300044735 Bacteria 1380
519 Ga0466968_0331966 3300044735 Bacteria 736
520 Ga0466970_0003933 3300044765 Bacteria 7282
521 Ga0466970_0014932 3300044765 Bacteria 3992
522 Ga0466970_0169208 3300044765 Bacteria 1210
523 Ga0466957_0004779 3300044842 Bacteria 7582
524 Ga0466957_0345444 3300044842 Bacteria 1008
525 Ga0466957_0775841 3300044842 Bacteria 680
526 Ga0466957_0964500 3300044842 Bacteria 611
527 Ga0466959_0073069 3300045049 Bacteria 2481
528 Ga0466959_0148968 3300045049 Bacteria 1650
529 Ga0466959_0150644 3300045049 Bacteria 1640
530 Ga0466959_0173452 3300045049 Bacteria 1511
531 Ga0466959_0216063 3300045049 Bacteria 1331
532 Ga0466959_0744362 3300045049 Bacteria 656
533 Ga0466958_0050066 3300045836 Bacteria 2529
534 Ga0466958_0075745 3300045836 Bacteria 2064
535 Ga0466958_0089371 3300045836 Bacteria 1904
536 Ga0466958_0115612 3300045836 Bacteria 1676
537 Ga0466967_0212702 3300045976 Bacteria 1834
538 Ga0466967_0938100 3300045976 Bacteria 861
539 Ga0495638_0000081 3300046460 Bacteria 155203
540 Ga0495638_0000127 3300046460 Bacteria 123576
541 Ga0495638_0000275 3300046460 Bacteria 69671
542 Ga0495638_0286280 3300046460 Bacteria 893
543 Ga0495638_0292617 3300046460 Bacteria 880
544 Ga0495650_0000409 3300046471 Bacteria 70670
545 Ga0495650_0145613 3300046471 Bacteria 854
546 Ga0495605_0144241 3300046474 Bacteria 1066
547 Ga0495607_0082582 3300046501 Bacteria 1762
548 Ga0495606_0001687 3300046507 Bacteria 28517
549 Ga0495606_0017638 3300046507 Bacteria 5387
550 Ga0495616_0021918 3300046513 Bacteria 3453
551 Ga0495616_0031168 3300046513 Bacteria 2795
552 Ga0495643_0166093 3300046522 Bacteria 1082
553 Ga0495663_0002500 3300046525 Bacteria 5524
554 Ga0495663_0213148 3300046525 Bacteria 677
555 Ga0495654_0393459 3300046530 Bacteria 551
556 Ga0495598_0011752 3300046537 Bacteria 2130
557 Ga0495598_0055897 3300046537 Bacteria 1203
558 Ga0495621_0000158 3300046539 Bacteria 15042
559 Ga0495621_0007280 3300046539 Bacteria 3271
560 Ga0495621_0132257 3300046539 Bacteria 971
561 Ga0495633_0024292 3300046558 Bacteria 2996
562 Ga0495633_0314442 3300046558 Bacteria 711
563 Ga0495656_0031151 3300046615 Bacteria 2161
564 Ga0495656_0037849 3300046615 Bacteria 1995
565 Ga0495625_0108062 3300046660 Bacteria 1903
566 Ga0495625_0254744 3300046660 Bacteria 1138
567 Ga0495659_0171417 3300046664 Bacteria 880
568 Ga0495670_0040546 3300046691 Bacteria 2322
569 Ga0495670_0239982 3300046691 Bacteria 965
570 Ga0495671_0053288 3300046692 Bacteria 2008
571 Ga0495649_0017115 3300046694 Bacteria 4097
572 Ga0495660_0244951 3300046810 Bacteria 834
573 Ga0495636_0114366 3300047318 Bacteria 1189
574 Ga0495636_0115863 3300047318 Bacteria 1182
575 Ga0495636_0232019 3300047318 Bacteria 849
576 Ga0495681_0029027 3300047470 Bacteria 2837
577 Ga0495686_0014996 3300047472 Bacteria 5312
578 Ga0496101_0020503 3300048904 Bacteria 4528
579 Ga0496101_0025773 3300048904 Bacteria 4082
580 Ga0496101_0797256 3300048904 Bacteria 745
581 Ga0496104_0187426 3300048907 Bacteria 1980
582 Ga0496104_0287955 3300048907 Bacteria 1555
583 Ga0496104_0649075 3300048907 Bacteria 964
584 Ga0496105_0012987 3300048908 Bacteria 6598
585 Ga0496105_0635880 3300048908 Bacteria 825
586 Ga0496107_0048218 3300048910 Bacteria 3068
587 Ga0496107_1293593 3300048910 Bacteria 522
588 Ga0496108_0098974 3300048911 Bacteria 2485
589 Ga0496108_0247334 3300048911 Bacteria 1551
590 Ga0496109_0110210 3300048912 Bacteria 2559
591 Ga0496109_0455885 3300048912 Bacteria 1208
592 Ga0496109_0789428 3300048912 Bacteria 888
593 Ga0496111_1253664 3300048914 Bacteria 524
594 Ga0496112_0123874 3300048915 Bacteria 2556
595 Ga0496112_0560102 3300048915 Bacteria 1076
596 Ga0496113_0432274 3300048916 Bacteria 1057
597 Ga0496113_0546180 3300048916 Bacteria 929
598 Ga0496114_0297297 3300048917 Bacteria 1425
599 Ga0496115_0000117 3300048918 Bacteria 72413
600 Ga0496115_0000190 3300048918 Bacteria 57279
601 Ga0496115_0004084 3300048918 Bacteria 10548
602 Ga0496115_0043165 3300048918 Bacteria 3595
603 Ga0496115_0157922 3300048918 Bacteria 1873
604 Ga0496116_0051347 3300048919 Bacteria 2740
605 Ga0496116_0261368 3300048919 Bacteria 853
606 Ga0496117_0004489 3300048920 Bacteria 15339
607 Ga0496117_0013031 3300048920 Bacteria 7281
608 Ga0496117_0022259 3300048920 Bacteria 5088
609 Ga0496118_0032824 3300048921 Bacteria 4268
610 Ga0496118_0044969 3300048921 Bacteria 3451
611 Ga0496118_0501017 3300048921 Unclassified 604
612 Ga0496119_0000094 3300048922 Bacteria 130089
613 Ga0496119_0002665 3300048922 Bacteria 19313
614 Ga0496119_0006116 3300048922 Bacteria 11270
615 Ga0496120_0000013 3300048923 Bacteria 331109
616 Ga0496120_0001298 3300048923 Bacteria 31048
617 Ga0496120_0018926 3300048923 Bacteria 4422
618 Ga0496121_0000630 3300048924 Bacteria 65787
619 Ga0496121_0027144 3300048924 Bacteria 5366
620 Ga0496121_0032433 3300048924 Bacteria 4747
621 Ga0496121_0585529 3300048924 Bacteria 691
622 Ga0496122_0000379 3300048925 Bacteria 95139
623 Ga0496122_0065289 3300048925 Bacteria 2640
624 Ga0496123_0003291 3300048926 Bacteria 18304
625 Ga0496124_0006411 3300048927 Bacteria 12827
626 Ga0496124_0065842 3300048927 Bacteria 3020
627 Ga0496125_0001082 3300048928 Bacteria 41965
628 Ga0496125_0169769 3300048928 Bacteria 1468
629 Ga0496126_0001676 3300048929 Bacteria 33222
630 Ga0496126_0014304 3300048929 Bacteria 8028
631 Ga0496126_0049035 3300048929 Bacteria 3856
632 Ga0496126_0068561 3300048929 Bacteria 3166
633 Ga0496126_0612825 3300048929 Bacteria 856
634 Ga0496126_0791827 3300048929 Bacteria 728
635 Ga0495678_046559 3300049459 Bacteria 1703
636 Ga0495678_096185 3300049459 Bacteria 1034
637 Ga0501031_0259915 3300049568 Bacteria 1128
638 Ga0501032_0009975 3300049569 Bacteria 6859
639 Ga0501032_0067653 3300049569 Bacteria 2386
640 Ga0501032_0252333 3300049569 Bacteria 1145
641 Ga0501033_0003839 3300049570 Bacteria 12218
642 Ga0501034_0009841 3300049571 Bacteria 9996
643 Ga0501034_0011634 3300049571 Bacteria 9110
644 Ga0501034_0249743 3300049571 Bacteria 1718
645 Ga0501034_0299721 3300049571 Bacteria 1544
646 Ga0501034_0519096 3300049571 Bacteria 1103
647 Ga0501036_0008146 3300049572 Bacteria 8589
648 Ga0501036_0643676 3300049572 Bacteria 878
649 Ga0501037_0413684 3300049573 Bacteria 924
650 Ga0501038_0000610 3300049574 Bacteria 31817
651 Ga0501039_0275574 3300049575 Bacteria 1322
652 Ga0501039_0361831 3300049575 Bacteria 1140
653 Ga0501043_0027305 3300049579 Bacteria 4482
654 Ga0501043_0037923 3300049579 Bacteria 3791
655 Ga0501047_0027284 3300049581 Bacteria 5501
656 Ga0501047_0146890 3300049581 Bacteria 2234
657 Ga0501047_0183554 3300049581 Bacteria 1958
658 Ga0501047_1303742 3300049581 Bacteria 540
659 Ga0501068_0050100 3300049584 Bacteria 2524
660 Ga0501070_0753061 3300049586 Bacteria 767
661 Ga0501071_0544692 3300049587 Bacteria 891
662 Ga0501202_021938 3300049652 Bacteria 1280
663 Ga0501206_030139 3300049653 Bacteria 804
664 Ga0501216_070147 3300049660 Bacteria 723
665 Ga0501217_106725 3300049661 Bacteria 801
666 Ga0501223_027230 3300049663 Bacteria 1112
667 Ga0501239_023745 3300049672 Bacteria 769
668 Ga0501250_034087 3300049680 Bacteria 720
669 Ga0501252_090248 3300049682 Bacteria 518
670 Ga0501221_180543 3300049704 Bacteria 577
671 Ga0501225_0026305 3300049705 Bacteria 1600
672 Ga0501245_085779 3300049708 Bacteria 616
673 Ga0501079_0900908 3300049741 Bacteria 697
674 Ga0501080_0031762 3300049742 Bacteria 4920
675 Ga0501241_107096 3300049758 Bacteria 608
676 Ga0501263_002926 3300049760 Bacteria 1787
677 Ga0501268_003743 3300049765 Bacteria 2103
678 Ga0501268_027823 3300049765 Bacteria 1007
679 Ga0501273_072832 3300049770 Bacteria 560
680 Ga0501035_0005516 3300049822 Bacteria 11954
681 Ga0501035_0269998 3300049822 Bacteria 1440
682 Ga0501035_0289660 3300049822 Bacteria 1382
683 Ga0501035_0330786 3300049822 Bacteria 1278
684 Ga0501035_1420250 3300049822 Bacteria 531
685 Ga0501044_0101688 3300049823 Bacteria 2891
686 Ga0501044_0119435 3300049823 Bacteria 2638
687 Ga0501044_0384203 3300049823 Bacteria 1319
688 Ga0501044_0803523 3300049823 Bacteria 820
689 Ga0501044_1081809 3300049823 Bacteria 672
690 nmdc:mga03n38_667452_c1 3300050490 Bacteria 597
691 nmdc:mga03n38_820072_c1 3300050490 Bacteria 543
692 nmdc:mga00v17_3525_c1 3300050491 Bacteria 8086
693 nmdc:mga06r32_850470_c1 3300050510 Bacteria 871
694 Ga0500600_0152172 3300053149 Bacteria 1149
695 Ga0500622_0189400 3300053156 Bacteria 944
696 Ga0500634_0000111 3300053161 Bacteria 30297
697 Ga0500611_091189 3300053727 Bacteria 776
698 Ga0500565_010275 3300053734 Bacteria 952
699 Ga0466962_0020737 3300061719 Bacteria 3158
700 Ga0466962_0056725 3300061719 Bacteria 1870
701 Ga0466962_0063464 3300061719 Bacteria 1763
702 Ga0466962_0094702 3300061719 Bacteria 1431

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2687453130 2687581366 102
2 iso_pu_bacteria 2739367700 2739733644 102
3 iso_pu_bacteria 2884411467 2884411849 102
4 iso_pu_bacteria 2928963466 2928966167 102
5 3300026067 Ga0207678_10066833 Ga0207678_100668333 103
6 3300005327 Ga0070658_10096605 Ga0070658_100966053 104
7 3300005329 Ga0070683_101483383 Ga0070683_1014833832 104
8 3300005331 Ga0070670_100115474 Ga0070670_1001154742 104
9 3300005336 Ga0070680_101853441 Ga0070680_1018534411 104
10 3300005339 Ga0070660_100030951 Ga0070660_1000309514 104
11 3300005339 Ga0070660_101642800 Ga0070660_1016428001 104
12 3300005343 Ga0070687_100538828 Ga0070687_1005388282 104
13 3300005344 Ga0070661_101369120 Ga0070661_1013691201 104
14 3300005347 Ga0070668_102080038 Ga0070668_1020800381 104
15 3300005353 Ga0070669_100081991 Ga0070669_1000819912 104
16 3300005354 Ga0070675_101265473 Ga0070675_1012654731 104
17 3300005354 Ga0070675_101279379 Ga0070675_1012793792 104
18 3300005355 Ga0070671_100351778 Ga0070671_1003517781 104
19 3300005356 Ga0070674_100258178 Ga0070674_1002581782 104
20 3300005364 Ga0070673_100401476 Ga0070673_1004014762 104
21 3300005366 Ga0070659_101520039 Ga0070659_1015200392 104
22 3300005367 Ga0070667_101840776 Ga0070667_1018407761 104
23 3300005457 Ga0070662_101052018 Ga0070662_1010520182 104
24 3300005458 Ga0070681_11007685 Ga0070681_110076852 104
25 3300005530 Ga0070679_100146755 Ga0070679_1001467553 104
26 3300005543 Ga0070672_100005743 Ga0070672_1000057434 104
27 3300005548 Ga0070665_102388953 Ga0070665_1023889532 104
28 3300005563 Ga0068855_101577595 Ga0068855_1015775952 104
29 3300005564 Ga0070664_100210219 Ga0070664_1002102192 104
30 3300005564 Ga0070664_100457157 Ga0070664_1004571572 104
31 3300005564 Ga0070664_101243865 Ga0070664_1012438652 104
32 3300005616 Ga0068852_100901881 Ga0068852_1009018812 104
33 3300005616 Ga0068852_101418060 Ga0068852_1014180601 104
34 3300009176 Ga0105242_11736573 Ga0105242_117365731 104
35 3300013100 Ga0157373_10028254 Ga0157373_100282544 104
36 3300013102 Ga0157371_10066305 Ga0157371_100663052 104
37 3300013104 Ga0157370_10624369 Ga0157370_106243692 104
38 3300013105 Ga0157369_10020750 Ga0157369_100207507 104
39 3300013307 Ga0157372_10303041 Ga0157372_103030412 104
40 3300013307 Ga0157372_10431109 Ga0157372_104311093 104
41 3300013308 Ga0157375_10158743 Ga0157375_101587433 104
42 3300017792 Ga0163161_10338107 Ga0163161_103381072 104
43 3300025899 Ga0207642_10325457 Ga0207642_103254572 104
44 3300025908 Ga0207643_10661549 Ga0207643_106615491 104
45 3300025917 Ga0207660_11047306 Ga0207660_110473062 104
46 3300025918 Ga0207662_10629092 Ga0207662_106290922 104
47 3300025919 Ga0207657_10011830 Ga0207657_100118307 104
48 3300025919 Ga0207657_10140190 Ga0207657_101401903 104
49 3300025921 Ga0207652_10339288 Ga0207652_103392882 104
50 3300025923 Ga0207681_10125182 Ga0207681_101251822 104
51 3300025925 Ga0207650_10476465 Ga0207650_104764652 104
52 3300025926 Ga0207659_10392983 Ga0207659_103929832 104
53 3300025931 Ga0207644_10491218 Ga0207644_104912182 104
54 3300025933 Ga0207706_10316533 Ga0207706_103165332 104
55 3300025933 Ga0207706_10487466 Ga0207706_104874662 104
56 3300025934 Ga0207686_10964471 Ga0207686_109644711 104
57 3300025937 Ga0207669_10230593 Ga0207669_102305932 104
58 3300025940 Ga0207691_10131251 Ga0207691_101312513 104
59 3300025945 Ga0207679_10067364 Ga0207679_100673642 104
60 3300025945 Ga0207679_10087256 Ga0207679_100872562 104
61 3300025945 Ga0207679_10326218 Ga0207679_103262182 104
62 3300025960 Ga0207651_10091042 Ga0207651_100910423 104
63 3300026089 Ga0207648_10165160 Ga0207648_101651601 104
64 3300026116 Ga0207674_10733770 Ga0207674_107337702 104
65 3300026121 Ga0207683_10244072 Ga0207683_102440722 104
66 3300026142 Ga0207698_10801184 Ga0207698_108011842 104
67 3300037418 Ga0395900_0180956 Ga0395900_0180956_336_650 104
68 3300037466 Ga0395898_0747058 Ga0395898_0747058_306_620 104
69 3300037471 Ga0395905_1168933 Ga0395905_1168933_22_345 104
70 3300042006 Ga0439432_061618 Ga0439432_061618_571_885 104
71 3300042007 Ga0439449_0044505 Ga0439449_0044505_189_503 104
72 3300042012 Ga0439455_0104683 Ga0439455_0104683_302_625 104
73 3300046537 Ga0495598_0011752 Ga0495598_0011752_462_776 104
74 3300046539 Ga0495621_0132257 Ga0495621_0132257_262_576 104
75 3300048912 Ga0496109_0789428 Ga0496109_0789428_81_395 104
76 3300048914 Ga0496111_1253664 Ga0496111_1253664_174_488 104
77 3300001989 JGI24739J22299_10002511 JGI24739J22299_100025112 105
78 3300001990 JGI24737J22298_10000898 JGI24737J22298_100008989 105
79 3300001990 JGI24737J22298_10012164 JGI24737J22298_100121643 105
80 3300002067 JGI24735J21928_10015344 JGI24735J21928_100153445 105
81 3300002705 JGI25156J39149_1002031 JGI25156J39149_10020313 105
82 3300002705 JGI25156J39149_1005020 JGI25156J39149_10050202 105
83 3300002737 JGI25162J39368_1000585 JGI25162J39368_10005852 105
84 3300002737 JGI25162J39368_1001345 JGI25162J39368_10013452 105
85 3300002737 JGI25162J39368_1001632 JGI25162J39368_10016328 105
86 3300002741 JGI25157J39369_1000258 JGI25157J39369_100025834 105
87 3300002741 JGI25157J39369_1000906 JGI25157J39369_10009069 105
88 3300002741 JGI25157J39369_1001632 JGI25157J39369_10016323 105
89 3300002771 JGI25163J39215_1000475 JGI25163J39215_10004758 105
90 3300002772 JGI25164J39214_1000004 JGI25164J39214_1000004304 105
91 3300002772 JGI25164J39214_1000677 JGI25164J39214_10006772 105
92 3300003214 JGI25165J46597_1000164 JGI25165J46597_100016498 105
93 3300003214 JGI25165J46597_1001357 JGI25165J46597_10013572 105
94 3300003316 rootH1_10021424 rootH1_100214243 105
95 3300003320 rootH2_10043016 rootH2_100430163 105
96 3300003320 rootH2_10189554 rootH2_101895543 105
97 3300003322 rootL2_10138739 rootL2_101387393 105
98 3300003323 rootH1_10190495 rootH1_101904952 105
99 3300003751 Ga0055538_1003048 Ga0055538_10030481 105
100 3300003752 Ga0055539_1001206 Ga0055539_10012065 105
101 3300003756 Ga0055533_1002415 Ga0055533_10024154 105
102 3300003756 Ga0055533_1005491 Ga0055533_10054912 105
103 3300003759 Ga0055525_1000293 Ga0055525_100029338 105
104 3300003760 Ga0055527_1000070 Ga0055527_10000704 105
105 3300003760 Ga0055527_1000077 Ga0055527_10000772 105
106 3300003760 Ga0055527_1016305 Ga0055527_10163051 105
107 3300003761 Ga0055535_1000117 Ga0055535_10001174 105
108 3300003761 Ga0055535_1000130 Ga0055535_100013078 105
109 3300003761 Ga0055535_1001093 Ga0055535_10010932 105
110 3300003761 Ga0055535_1001283 Ga0055535_10012839 105
111 3300003761 Ga0055535_1001578 Ga0055535_10015783 105
112 3300003761 Ga0055535_1011473 Ga0055535_10114731 105
113 3300003761 Ga0055535_1028561 Ga0055535_10285612 105
114 3300003762 Ga0055542_1000156 Ga0055542_100015683 105
115 3300003762 Ga0055542_1000174 Ga0055542_100017478 105
116 3300003762 Ga0055542_1000184 Ga0055542_10001842 105
117 3300003762 Ga0055542_1001071 Ga0055542_10010713 105
118 3300003762 Ga0055542_1001086 Ga0055542_100108612 105
119 3300003762 Ga0055542_1001273 Ga0055542_10012732 105
120 3300003763 Ga0055529_1000102 Ga0055529_1000102124 105
121 3300003763 Ga0055529_1000201 Ga0055529_100020178 105
122 3300003763 Ga0055529_1000353 Ga0055529_100035346 105
123 3300003763 Ga0055529_1001006 Ga0055529_10010062 105
124 3300003773 Ga0055537_1000572 Ga0055537_100057211 105
125 3300003775 Ga0055524_1000393 Ga0055524_100039327 105
126 3300003784 Ga0055534_1000527 Ga0055534_100052711 105
127 3300003790 Ga0055528_1000855 Ga0055528_100085511 105
128 3300005262 Ga0065165_1002561 Ga0065165_10025612 105
129 3300005331 Ga0070670_101505316 Ga0070670_1015053161 105
130 3300005337 Ga0070682_101406370 Ga0070682_1014063702 105
131 3300005340 Ga0070689_100003754 Ga0070689_1000037548 105
132 3300005344 Ga0070661_100217132 Ga0070661_1002171322 105
133 3300005355 Ga0070671_100101724 Ga0070671_1001017243 105
134 3300005365 Ga0070688_100067733 Ga0070688_1000677332 105
135 3300005436 Ga0070713_101934787 Ga0070713_1019347871 105
136 3300005455 Ga0070663_100051543 Ga0070663_1000515433 105
137 3300005455 Ga0070663_100232870 Ga0070663_1002328702 105
138 3300005455 Ga0070663_100246127 Ga0070663_1002461273 105
139 3300005458 Ga0070681_10579391 Ga0070681_105793912 105
140 3300005466 Ga0070685_10020697 Ga0070685_100206972 105
141 3300005539 Ga0068853_100640281 Ga0068853_1006402812 105
142 3300005548 Ga0070665_100851210 Ga0070665_1008512102 105
143 3300005563 Ga0068855_100071681 Ga0068855_1000716813 105
144 3300005563 Ga0068855_100361813 Ga0068855_1003618132 105
145 3300005564 Ga0070664_100295361 Ga0070664_1002953612 105
146 3300005577 Ga0068857_100047656 Ga0068857_1000476563 105
147 3300005577 Ga0068857_100324915 Ga0068857_1003249153 105
148 3300005578 Ga0068854_100025861 Ga0068854_1000258613 105
149 3300005578 Ga0068854_100193082 Ga0068854_1001930822 105
150 3300005614 Ga0068856_100000909 Ga0068856_1000009093 105
151 3300005616 Ga0068852_100191949 Ga0068852_1001919492 105
152 3300005617 Ga0068859_100121970 Ga0068859_1001219703 105
153 3300005618 Ga0068864_102236860 Ga0068864_1022368602 105
154 3300005834 Ga0068851_10023851 Ga0068851_100238513 105
155 3300005842 Ga0068858_100071997 Ga0068858_1000719972 105
156 3300005843 Ga0068860_100017659 Ga0068860_1000176594 105
157 3300005844 Ga0068862_100378023 Ga0068862_1003780232 105
158 3300006931 Ga0097620_100121970 Ga0097620_1001219703 105
159 3300009093 Ga0105240_10053139 Ga0105240_100531393 105
160 3300009093 Ga0105240_10069096 Ga0105240_100690963 105
161 3300009093 Ga0105240_10078089 Ga0105240_100780893 105
162 3300009093 Ga0105240_10080210 Ga0105240_100802103 105
163 3300009174 Ga0105241_10259256 Ga0105241_102592562 105
164 3300009545 Ga0105237_10000097 Ga0105237_1000009795 105
165 3300009545 Ga0105237_10880354 Ga0105237_108803542 105
166 3300009551 Ga0105238_10248899 Ga0105238_102488992 105
167 3300009553 Ga0105249_11530538 Ga0105249_115305382 105
168 3300010375 Ga0105239_10001059 Ga0105239_1000105928 105
169 3300010375 Ga0105239_10171871 Ga0105239_101718713 105
170 3300012473 Ga0157340_1007427 Ga0157340_10074272 105
171 3300012497 Ga0157319_1036975 Ga0157319_10369752 105
172 3300012498 Ga0157345_1046811 Ga0157345_10468112 105
173 3300012500 Ga0157314_1000048 Ga0157314_10000489 105
174 3300012502 Ga0157347_1046055 Ga0157347_10460552 105
175 3300012505 Ga0157339_1004456 Ga0157339_10044562 105
176 3300013100 Ga0157373_10381905 Ga0157373_103819052 105
177 3300013102 Ga0157371_10522053 Ga0157371_105220532 105
178 3300013105 Ga0157369_10031050 Ga0157369_100310504 105
179 3300013105 Ga0157369_10110365 Ga0157369_101103653 105
180 3300013105 Ga0157369_10127335 Ga0157369_101273352 105
181 3300013306 Ga0163162_10762579 Ga0163162_107625792 105
182 3300013307 Ga0157372_10325770 Ga0157372_103257702 105
183 3300013307 Ga0157372_10452587 Ga0157372_104525872 105
184 3300014325 Ga0163163_10163739 Ga0163163_101637392 105
185 3300014497 Ga0182008_10231576 Ga0182008_102315761 105
186 3300014497 Ga0182008_10516346 Ga0182008_105163461 105
187 3300015265 Ga0182005_1194366 Ga0182005_11943662 105
188 3300015685 Ga0183369_1019 Ga0183369_10193 105
189 3300015687 Ga0183368_1007 Ga0183368_1007360 105
190 3300025207 Ga0209760_101412 Ga0209760_1014122 105
191 3300025224 Ga0209784_100544 Ga0209784_1005449 105
192 3300025225 Ga0209566_106220 Ga0209566_1062203 105
193 3300025225 Ga0209566_106838 Ga0209566_1068382 105
194 3300025226 Ga0209674_100037 Ga0209674_1000373 105
195 3300025226 Ga0209674_100299 Ga0209674_10029930 105
196 3300025228 Ga0209672_100070 Ga0209672_1000703 105
197 3300025228 Ga0209672_100084 Ga0209672_1000843 105
198 3300025228 Ga0209672_100099 Ga0209672_1000993 105
199 3300025228 Ga0209672_100381 Ga0209672_10038118 105
200 3300025228 Ga0209672_101575 Ga0209672_1015753 105
201 3300025228 Ga0209672_106816 Ga0209672_1068162 105
202 3300025230 Ga0209563_100174 Ga0209563_1001743 105
203 3300025231 Ga0207427_100031 Ga0207427_1000313 105
204 3300025231 Ga0207427_100831 Ga0207427_1008319 105
205 3300025231 Ga0207427_103488 Ga0207427_1034883 105
206 3300025231 Ga0207427_108173 Ga0207427_1081732 105
207 3300025233 Ga0209437_100061 Ga0209437_100061302 105
208 3300025233 Ga0209437_100123 Ga0209437_100123153 105
209 3300025233 Ga0209437_100323 Ga0209437_10032358 105
210 3300025233 Ga0209437_131123 Ga0209437_1311232 105
211 3300025242 Ga0209258_100054 Ga0209258_100054294 105
212 3300025242 Ga0209258_100104 Ga0209258_100104176 105
213 3300025242 Ga0209258_100188 Ga0209258_100188120 105
214 3300025242 Ga0209258_100218 Ga0209258_1002183 105
215 3300025242 Ga0209258_100281 Ga0209258_10028170 105
216 3300025242 Ga0209258_100923 Ga0209258_10092310 105
217 3300025242 Ga0209258_106372 Ga0209258_1063722 105
218 3300025246 Ga0209646_1000619 Ga0209646_10006194 105
219 3300025246 Ga0209646_1007923 Ga0209646_10079232 105
220 3300025246 Ga0209646_1012880 Ga0209646_10128801 105
221 3300025250 Ga0209026_1000171 Ga0209026_100017192 105
222 3300025250 Ga0209026_1000550 Ga0209026_10005503 105
223 3300025250 Ga0209026_1001022 Ga0209026_10010229 105
224 3300025253 Ga0209677_101680 Ga0209677_1016803 105
225 3300025253 Ga0209677_132389 Ga0209677_1323891 105
226 3300025254 Ga0209148_1000063 Ga0209148_1000063299 105
227 3300025254 Ga0209148_1000066 Ga0209148_1000066294 105
228 3300025254 Ga0209148_1000106 Ga0209148_1000106177 105
229 3300025254 Ga0209148_1000196 Ga0209148_10001963 105
230 3300025254 Ga0209148_1000252 Ga0209148_10002522 105
231 3300025254 Ga0209148_1001272 Ga0209148_10012729 105
232 3300025256 Ga0209759_1000137 Ga0209759_1000137115 105
233 3300025256 Ga0209759_1000487 Ga0209759_10004874 105
234 3300025256 Ga0209759_1001414 Ga0209759_10014149 105
235 3300025256 Ga0209759_1003274 Ga0209759_10032746 105
236 3300025258 Ga0209129_1006938 Ga0209129_10069384 105
237 3300025261 Ga0209233_1000076 Ga0209233_10000763 105
238 3300025261 Ga0209233_1000136 Ga0209233_1000136153 105
239 3300025261 Ga0209233_1012259 Ga0209233_10122592 105
240 3300025263 Ga0209565_1000001 Ga0209565_100000111 105
241 3300025272 Ga0209455_1000146 Ga0209455_10001463 105
242 3300025272 Ga0209455_1000173 Ga0209455_10001733 105
243 3300025272 Ga0209455_1000831 Ga0209455_100083111 105
244 3300025272 Ga0209455_1001041 Ga0209455_10010419 105
245 3300025272 Ga0209455_1008836 Ga0209455_10088363 105
246 3300025272 Ga0209455_1010273 Ga0209455_10102735 105
247 3300025273 Ga0209673_1000001 Ga0209673_100000111 105
248 3300025291 Ga0209675_1000001 Ga0209675_10000012521 105
249 3300025294 Ga0209025_1000030 Ga0209025_100003015 105
250 3300025294 Ga0209025_1103958 Ga0209025_11039582 105
251 3300025295 Ga0209564_1000001 Ga0209564_10000012683 105
252 3300025297 Ga0209758_1017138 Ga0209758_10171382 105
253 3300025297 Ga0209758_1019182 Ga0209758_10191822 105
254 3300025299 Ga0209256_1000006 Ga0209256_10000061119 105
255 3300025321 Ga0207656_10022662 Ga0207656_100226622 105
256 3300025904 Ga0207647_10003619 Ga0207647_100036192 105
257 3300025904 Ga0207647_10004339 Ga0207647_100043392 105
258 3300025904 Ga0207647_10102547 Ga0207647_101025472 105
259 3300025911 Ga0207654_10153932 Ga0207654_101539322 105
260 3300025912 Ga0207707_10317991 Ga0207707_103179912 105
261 3300025913 Ga0207695_10010112 Ga0207695_100101123 105
262 3300025913 Ga0207695_10017110 Ga0207695_100171107 105
263 3300025913 Ga0207695_10034917 Ga0207695_100349175 105
264 3300025913 Ga0207695_10058395 Ga0207695_100583953 105
265 3300025914 Ga0207671_10000119 Ga0207671_1000011994 105
266 3300025920 Ga0207649_10246167 Ga0207649_102461672 105
267 3300025924 Ga0207694_10210265 Ga0207694_102102652 105
268 3300025924 Ga0207694_10919745 Ga0207694_109197452 105
269 3300025925 Ga0207650_11710214 Ga0207650_117102141 105
270 3300025931 Ga0207644_10192433 Ga0207644_101924332 105
271 3300025936 Ga0207670_10002189 Ga0207670_100021898 105
272 3300025945 Ga0207679_10296996 Ga0207679_102969962 105
273 3300025949 Ga0207667_10001947 Ga0207667_100019472 105
274 3300025949 Ga0207667_10253217 Ga0207667_102532172 105
275 3300025981 Ga0207640_10003313 Ga0207640_100033137 105
276 3300025981 Ga0207640_10019106 Ga0207640_100191062 105
277 3300026035 Ga0207703_10287005 Ga0207703_102870052 105
278 3300026067 Ga0207678_10069102 Ga0207678_100691023 105
279 3300026067 Ga0207678_10102487 Ga0207678_101024872 105
280 3300026067 Ga0207678_10129759 Ga0207678_101297592 105
281 3300026078 Ga0207702_10001326 Ga0207702_1000132619 105
282 3300026116 Ga0207674_10001298 Ga0207674_100012982 105
283 3300026142 Ga0207698_10202276 Ga0207698_102022763 105
284 3300028379 Ga0268266_10702354 Ga0268266_107023542 105
285 3300028380 Ga0268265_10925022 Ga0268265_109250222 105
286 3300028381 Ga0268264_10121773 Ga0268264_101217733 105
287 3300028800 Ga0265338_10221083 Ga0265338_102210832 105
288 3300030745 Ga0316182_1288570 Ga0316182_12885703 105
289 3300031548 Ga0307408_100388434 Ga0307408_1003884342 105
290 3300031548 Ga0307408_100514605 Ga0307408_1005146051 105
291 3300031824 Ga0307413_10236922 Ga0307413_102369222 105
292 3300031852 Ga0307410_10092428 Ga0307410_100924281 105
293 3300031911 Ga0307412_10010200 Ga0307412_100102004 105
294 3300031995 Ga0307409_102416732 Ga0307409_1024167321 105
295 3300032002 Ga0307416_100392983 Ga0307416_1003929831 105
296 3300032005 Ga0307411_10565188 Ga0307411_105651882 105
297 3300032126 Ga0307415_100135850 Ga0307415_1001358503 105
298 3300037312 Ga0395899_0000146 Ga0395899_0000146_105925_106248 105
299 3300037312 Ga0395899_0012324 Ga0395899_0012324_943_1275 105
300 3300037312 Ga0395899_0060457 Ga0395899_0060457_765_1088 105
301 3300037312 Ga0395899_0112438 Ga0395899_0112438_597_920 105
302 3300037312 Ga0395899_0127101 Ga0395899_0127101_1159_1482 105
303 3300037312 Ga0395899_0212266 Ga0395899_0212266_523_846 105
304 3300037312 Ga0395899_0762455 Ga0395899_0762455_109_426 105
305 3300037418 Ga0395900_0000272 Ga0395900_0000272_77328_77651 105
306 3300037418 Ga0395900_0000706 Ga0395900_0000706_43186_43509 105
307 3300037418 Ga0395900_0005525 Ga0395900_0005525_1113_1436 105
308 3300037418 Ga0395900_0156726 Ga0395900_0156726_1010_1333 105
309 3300037418 Ga0395900_0211976 Ga0395900_0211976_495_818 105
310 3300037466 Ga0395898_0000329 Ga0395898_0000329_1024_1347 105
311 3300037466 Ga0395898_0000387 Ga0395898_0000387_958_1290 105
312 3300037466 Ga0395898_0006340 Ga0395898_0006340_1387_1710 105
313 3300037466 Ga0395898_0051318 Ga0395898_0051318_577_894 105
314 3300037466 Ga0395898_0100309 Ga0395898_0100309_1096_1419 105
315 3300037466 Ga0395898_0117860 Ga0395898_0117860_1212_1535 105
316 3300037466 Ga0395898_0516582 Ga0395898_0516582_267_590 105
317 3300037471 Ga0395905_1057310 Ga0395905_1057310_263_586 105
318 3300038443 Ga0395901_0080818 Ga0395901_0080818_1109_1432 105
319 3300038443 Ga0395901_0086604 Ga0395901_0086604_1068_1391 105
320 3300038443 Ga0395901_0100329 Ga0395901_0100329_1704_2027 105
321 3300038443 Ga0395901_0114438 Ga0395901_0114438_2145_2468 105
322 3300038443 Ga0395901_0178598 Ga0395901_0178598_1096_1419 105
323 3300038443 Ga0395901_0265101 Ga0395901_0265101_1052_1369 105
324 3300038443 Ga0395901_0574668 Ga0395901_0574668_366_689 105
325 3300042005 Ga0439448_0022066 Ga0439448_0022066_535_861 105
326 3300042007 Ga0439449_0006005 Ga0439449_0006005_1077_1394 105
327 3300044656 Ga0466969_0042827 Ga0466969_0042827_1219_1542 105
328 3300044656 Ga0466969_0044980 Ga0466969_0044980_988_1314 105
329 3300044656 Ga0466969_0068577 Ga0466969_0068577_906_1229 105
330 3300044656 Ga0466969_0123395 Ga0466969_0123395_790_1113 105
331 3300044658 Ga0466972_0120151 Ga0466972_0120151_106_432 105
332 3300044661 Ga0466975_0328806 Ga0466975_0328806_624_947 105
333 3300044663 Ga0466989_0052329 Ga0466989_0052329_137_460 105
334 3300044672 Ga0466982_0000238 Ga0466982_0000238_1269_1595 105
335 3300044683 Ga0466965_0057434 Ga0466965_0057434_939_1262 105
336 3300044683 Ga0466965_0245410 Ga0466965_0245410_412_735 105
337 3300044684 Ga0466966_0025895 Ga0466966_0025895_2256_2579 105
338 3300044684 Ga0466966_0055894 Ga0466966_0055894_993_1316 105
339 3300044684 Ga0466966_0112713 Ga0466966_0112713_1084_1410 105
340 3300044684 Ga0466966_0168758 Ga0466966_0168758_855_1178 105
341 3300044693 Ga0466961_0000454 Ga0466961_0000454_997_1320 105
342 3300044693 Ga0466961_0002186 Ga0466961_0002186_11519_11842 105
343 3300044693 Ga0466961_0003288 Ga0466961_0003288_9736_10059 105
344 3300044693 Ga0466961_0029207 Ga0466961_0029207_1210_1533 105
345 3300044693 Ga0466961_0151176 Ga0466961_0151176_1115_1438 105
346 3300044693 Ga0466961_0309044 Ga0466961_0309044_335_661 105
347 3300044694 Ga0466963_0110736 Ga0466963_0110736_809_1132 105
348 3300044694 Ga0466963_0345233 Ga0466963_0345233_376_699 105
349 3300044694 Ga0466963_0390656 Ga0466963_0390656_370_693 105
350 3300044706 Ga0466964_0022882 Ga0466964_0022882_1142_1468 105
351 3300044706 Ga0466964_0066792 Ga0466964_0066792_135_458 105
352 3300044706 Ga0466964_0143546 Ga0466964_0143546_294_617 105
353 3300044719 Ga0466971_0009727 Ga0466971_0009727_2938_3261 105
354 3300044719 Ga0466971_0050142 Ga0466971_0050142_1038_1364 105
355 3300044719 Ga0466971_0083049 Ga0466971_0083049_337_660 105
356 3300044735 Ga0466968_0086903 Ga0466968_0086903_756_1082 105
357 3300044735 Ga0466968_0331966 Ga0466968_0331966_319_642 105
358 3300044765 Ga0466970_0003933 Ga0466970_0003933_1008_1331 105
359 3300044765 Ga0466970_0014932 Ga0466970_0014932_139_462 105
360 3300044765 Ga0466970_0169208 Ga0466970_0169208_291_617 105
361 3300044842 Ga0466957_0004779 Ga0466957_0004779_5738_6061 105
362 3300044842 Ga0466957_0345444 Ga0466957_0345444_197_520 105
363 3300044842 Ga0466957_0775841 Ga0466957_0775841_334_657 105
364 3300044842 Ga0466957_0964500 Ga0466957_0964500_208_531 105
365 3300045049 Ga0466959_0073069 Ga0466959_0073069_937_1260 105
366 3300045049 Ga0466959_0148968 Ga0466959_0148968_838_1161 105
367 3300045049 Ga0466959_0150644 Ga0466959_0150644_1032_1355 105
368 3300045049 Ga0466959_0173452 Ga0466959_0173452_977_1300 105
369 3300045049 Ga0466959_0216063 Ga0466959_0216063_974_1300 105
370 3300045049 Ga0466959_0744362 Ga0466959_0744362_144_476 105
371 3300045836 Ga0466958_0050066 Ga0466958_0050066_482_805 105
372 3300045836 Ga0466958_0075745 Ga0466958_0075745_76_399 105
373 3300045836 Ga0466958_0089371 Ga0466958_0089371_162_485 105
374 3300045836 Ga0466958_0115612 Ga0466958_0115612_329_661 105
375 3300045976 Ga0466967_0212702 Ga0466967_0212702_34_357 105
376 3300045976 Ga0466967_0938100 Ga0466967_0938100_482_805 105
377 3300046460 Ga0495638_0000081 Ga0495638_0000081_153080_153403 105
378 3300046460 Ga0495638_0000127 Ga0495638_0000127_122042_122365 105
379 3300046460 Ga0495638_0000275 Ga0495638_0000275_1211_1534 105
380 3300046471 Ga0495650_0000409 Ga0495650_0000409_68825_69148 105
381 3300046507 Ga0495606_0001687 Ga0495606_0001687_27249_27572 105
382 3300046660 Ga0495625_0108062 Ga0495625_0108062_352_675 105
383 3300046660 Ga0495625_0254744 Ga0495625_0254744_734_1057 105
384 3300046694 Ga0495649_0017115 Ga0495649_0017115_788_1111 105
385 3300048904 Ga0496101_0020503 Ga0496101_0020503_1537_1869 105
386 3300048904 Ga0496101_0025773 Ga0496101_0025773_1601_1918 105
387 3300048904 Ga0496101_0797256 Ga0496101_0797256_77_394 105
388 3300048907 Ga0496104_0187426 Ga0496104_0187426_873_1205 105
389 3300048907 Ga0496104_0287955 Ga0496104_0287955_634_957 105
390 3300048907 Ga0496104_0649075 Ga0496104_0649075_430_753 105
391 3300048908 Ga0496105_0012987 Ga0496105_0012987_459_791 105
392 3300048908 Ga0496105_0635880 Ga0496105_0635880_353_670 105
393 3300048910 Ga0496107_0048218 Ga0496107_0048218_1407_1739 105
394 3300048910 Ga0496107_1293593 Ga0496107_1293593_145_462 105
395 3300048911 Ga0496108_0098974 Ga0496108_0098974_74_391 105
396 3300048912 Ga0496109_0110210 Ga0496109_0110210_1494_1811 105
397 3300048915 Ga0496112_0123874 Ga0496112_0123874_1781_2104 105
398 3300048915 Ga0496112_0560102 Ga0496112_0560102_725_1042 105
399 3300048916 Ga0496113_0432274 Ga0496113_0432274_702_1019 105
400 3300048916 Ga0496113_0546180 Ga0496113_0546180_472_795 105
401 3300048917 Ga0496114_0297297 Ga0496114_0297297_880_1203 105
402 3300048918 Ga0496115_0000117 Ga0496115_0000117_70909_71232 105
403 3300048918 Ga0496115_0000190 Ga0496115_0000190_968_1291 105
404 3300048918 Ga0496115_0004084 Ga0496115_0004084_9213_9545 105
405 3300048918 Ga0496115_0043165 Ga0496115_0043165_759_1082 105
406 3300048918 Ga0496115_0157922 Ga0496115_0157922_933_1256 105
407 3300048919 Ga0496116_0261368 Ga0496116_0261368_101_433 105
408 3300048920 Ga0496117_0013031 Ga0496117_0013031_6732_7064 105
409 3300048920 Ga0496117_0022259 Ga0496117_0022259_323_655 105
410 3300048921 Ga0496118_0032824 Ga0496118_0032824_858_1190 105
411 3300048921 Ga0496118_0501017 Ga0496118_0501017_235_558 105
412 3300048922 Ga0496119_0000094 Ga0496119_0000094_810_1142 105
413 3300048922 Ga0496119_0002665 Ga0496119_0002665_1181_1513 105
414 3300048923 Ga0496120_0000013 Ga0496120_0000013_329924_330256 105
415 3300048923 Ga0496120_0018926 Ga0496120_0018926_2877_3209 105
416 3300048924 Ga0496121_0000630 Ga0496121_0000630_63929_64252 105
417 3300048924 Ga0496121_0027144 Ga0496121_0027144_517_849 105
418 3300048924 Ga0496121_0032433 Ga0496121_0032433_1457_1783 105
419 3300048924 Ga0496121_0585529 Ga0496121_0585529_38_370 105
420 3300048928 Ga0496125_0001082 Ga0496125_0001082_40643_40969 105
421 3300048929 Ga0496126_0001676 Ga0496126_0001676_1419_1751 105
422 3300048929 Ga0496126_0014304 Ga0496126_0014304_1082_1414 105
423 3300048929 Ga0496126_0049035 Ga0496126_0049035_961_1284 105
424 3300048929 Ga0496126_0068561 Ga0496126_0068561_1967_2290 105
425 3300048929 Ga0496126_0791827 Ga0496126_0791827_145_471 105
426 3300049459 Ga0495678_046559 Ga0495678_046559_787_1110 105
427 3300049459 Ga0495678_096185 Ga0495678_096185_373_696 105
428 3300049568 Ga0501031_0259915 Ga0501031_0259915_457_780 105
429 3300049569 Ga0501032_0067653 Ga0501032_0067653_724_1047 105
430 3300049570 Ga0501033_0003839 Ga0501033_0003839_5905_6237 105
431 3300049571 Ga0501034_0299721 Ga0501034_0299721_911_1234 105
432 3300049571 Ga0501034_0519096 Ga0501034_0519096_426_749 105
433 3300049572 Ga0501036_0643676 Ga0501036_0643676_453_785 105
434 3300049573 Ga0501037_0413684 Ga0501037_0413684_544_867 105
435 3300049575 Ga0501039_0361831 Ga0501039_0361831_588_911 105
436 3300049579 Ga0501043_0027305 Ga0501043_0027305_1450_1773 105
437 3300049581 Ga0501047_0146890 Ga0501047_0146890_619_942 105
438 3300049581 Ga0501047_0183554 Ga0501047_0183554_1496_1822 105
439 3300049581 Ga0501047_1303742 Ga0501047_1303742_77_409 105
440 3300049652 Ga0501202_021938 Ga0501202_021938_202_519 105
441 3300049653 Ga0501206_030139 Ga0501206_030139_276_593 105
442 3300049660 Ga0501216_070147 Ga0501216_070147_282_599 105
443 3300049663 Ga0501223_027230 Ga0501223_027230_268_585 105
444 3300049672 Ga0501239_023745 Ga0501239_023745_115_432 105
445 3300049680 Ga0501250_034087 Ga0501250_034087_115_432 105
446 3300049682 Ga0501252_090248 Ga0501252_090248_182_499 105
447 3300049704 Ga0501221_180543 Ga0501221_180543_61_378 105
448 3300049705 Ga0501225_0026305 Ga0501225_0026305_994_1311 105
449 3300049708 Ga0501245_085779 Ga0501245_085779_247_564 105
450 3300049758 Ga0501241_107096 Ga0501241_107096_99_416 105
451 3300049765 Ga0501268_003743 Ga0501268_003743_1201_1518 105
452 3300049822 Ga0501035_0269998 Ga0501035_0269998_1051_1374 105
453 3300049822 Ga0501035_0289660 Ga0501035_0289660_481_813 105
454 3300049822 Ga0501035_0330786 Ga0501035_0330786_495_818 105
455 3300049822 Ga0501035_1420250 Ga0501035_1420250_141_464 105
456 3300049823 Ga0501044_0101688 Ga0501044_0101688_1260_1583 105
457 3300049823 Ga0501044_0803523 Ga0501044_0803523_476_799 105
458 3300049823 Ga0501044_1081809 Ga0501044_1081809_22_345 105
459 3300053149 Ga0500600_0152172 Ga0500600_0152172_169_495 105
460 3300061719 Ga0466962_0020737 Ga0466962_0020737_2231_2554 105
461 3300061719 Ga0466962_0056725 Ga0466962_0056725_115_438 105
462 3300061719 Ga0466962_0063464 Ga0466962_0063464_924_1250 105
463 3300061719 Ga0466962_0094702 Ga0466962_0094702_934_1257 105
464 2010549000 RicEn_C2318 RicEn_42670 106
465 2162886007 SwRhRL2b_contig_3083456 SwRhRL2b_0168.00000170 106
466 3300002773 JGI25152J39213_1000312 JGI25152J39213_100031231 106
467 3300002774 JGI25150J39212_1000221 JGI25150J39212_10002212 106
468 3300003187 JGI25151J46595_10000093 JGI25151J46595_1000009338 106
469 3300003215 JGI25153J46596_10000061 JGI25153J46596_1000006144 106
470 3300003781 Ga0055536_1005416 Ga0055536_10054165 106
471 3300003781 Ga0055536_1008638 Ga0055536_10086385 106
472 3300003781 Ga0055536_1024198 Ga0055536_10241982 106
473 3300003791 Ga0055530_10001682 Ga0055530_100016823 106
474 3300003794 Ga0055531_10008817 Ga0055531_100088171 106
475 3300003794 Ga0055531_10013482 Ga0055531_100134824 106
476 3300003794 Ga0055531_10022842 Ga0055531_100228423 106
477 3300003794 Ga0055531_10049384 Ga0055531_100493842 106
478 3300005331 Ga0070670_100005341 Ga0070670_1000053416 106
479 3300005331 Ga0070670_101108685 Ga0070670_1011086852 106
480 3300005331 Ga0070670_101769652 Ga0070670_1017696521 106
481 3300005344 Ga0070661_100244792 Ga0070661_1002447922 106
482 3300005367 Ga0070667_100077353 Ga0070667_1000773532 106
483 3300005539 Ga0068853_100032189 Ga0068853_1000321894 106
484 3300005539 Ga0068853_100130498 Ga0068853_1001304982 106
485 3300005548 Ga0070665_100814868 Ga0070665_1008148682 106
486 3300005578 Ga0068854_100431674 Ga0068854_1004316741 106
487 3300005616 Ga0068852_100153318 Ga0068852_1001533182 106
488 3300005617 Ga0068859_100393341 Ga0068859_1003933413 106
489 3300005844 Ga0068862_101549252 Ga0068862_1015492522 106
490 3300006051 Ga0075364_10000261 Ga0075364_100002616 106
491 3300006195 Ga0075366_10319580 Ga0075366_103195801 106
492 3300006847 Ga0075431_100761496 Ga0075431_1007614961 106
493 3300006931 Ga0097620_100393304 Ga0097620_1003933043 106
494 3300009011 Ga0105251_10001882 Ga0105251_100018828 106
495 3300009148 Ga0105243_10000720 Ga0105243_100007202 106
496 3300010375 Ga0105239_10507271 Ga0105239_105072712 106
497 3300011119 Ga0105246_11891163 Ga0105246_118911631 106
498 3300013297 Ga0157378_10831220 Ga0157378_108312202 106
499 3300015261 Ga0182006_1006577 Ga0182006_10065773 106
500 3300015265 Ga0182005_1001273 Ga0182005_10012734 106
501 3300017792 Ga0163161_10730561 Ga0163161_107305612 106
502 3300025245 Ga0207425_1000015 Ga0207425_1000015358 106
503 3300025258 Ga0209129_1000131 Ga0209129_100013155 106
504 3300025273 Ga0209673_1006434 Ga0209673_10064344 106
505 3300025284 Ga0209130_1005216 Ga0209130_10052163 106
506 3300025291 Ga0209675_1003612 Ga0209675_10036124 106
507 3300025292 Ga0209676_1001795 Ga0209676_100179510 106
508 3300025292 Ga0209676_1002044 Ga0209676_100204414 106
509 3300025292 Ga0209676_1007405 Ga0209676_10074055 106
510 3300025292 Ga0209676_1008414 Ga0209676_10084141 106
511 3300025292 Ga0209676_1009197 Ga0209676_10091973 106
512 3300025294 Ga0209025_1000002 Ga0209025_10000021256 106
513 3300025294 Ga0209025_1005191 Ga0209025_100519110 106
514 3300025294 Ga0209025_1030021 Ga0209025_10300212 106
515 3300025297 Ga0209758_1000003 Ga0209758_10000031263 106
516 3300025298 Ga0209050_1000429 Ga0209050_100042952 106
517 3300025299 Ga0209256_1002127 Ga0209256_10021275 106
518 3300025299 Ga0209256_1007777 Ga0209256_10077773 106
519 3300025299 Ga0209256_1008339 Ga0209256_10083394 106
520 3300025302 Ga0207426_1064789 Ga0207426_10647892 106
521 3300025303 Ga0209051_1029247 Ga0209051_10292472 106
522 3300025304 Ga0209257_1000336 Ga0209257_100033621 106
523 3300025304 Ga0209257_1001853 Ga0209257_10018538 106
524 3300025304 Ga0209257_1001936 Ga0209257_10019367 106
525 3300025304 Ga0209257_1002007 Ga0209257_10020079 106
526 3300025304 Ga0209257_1006315 Ga0209257_10063152 106
527 3300025735 Ga0207713_1003029 Ga0207713_10030298 106
528 3300025920 Ga0207649_10291108 Ga0207649_102911082 106
529 3300025925 Ga0207650_10004256 Ga0207650_100042567 106
530 3300025925 Ga0207650_10654661 Ga0207650_106546612 106
531 3300025935 Ga0207709_10001168 Ga0207709_100011682 106
532 3300025936 Ga0207670_10668341 Ga0207670_106683412 106
533 3300025972 Ga0207668_10061007 Ga0207668_100610072 106
534 3300025981 Ga0207640_10302021 Ga0207640_103020212 106
535 3300026023 Ga0207677_10211592 Ga0207677_102115922 106
536 3300026041 Ga0207639_10107968 Ga0207639_101079684 106
537 3300026041 Ga0207639_10203853 Ga0207639_102038533 106
538 3300026041 Ga0207639_11190600 Ga0207639_111906001 106
539 3300027312 Ga0209371_1000025 Ga0209371_1000025376 106
540 3300027424 Ga0209984_1069063 Ga0209984_10690631 106
541 3300027543 Ga0209999_1003170 Ga0209999_10031703 106
542 3300027552 Ga0209982_1004176 Ga0209982_10041763 106
543 3300027614 Ga0209970_1023780 Ga0209970_10237802 106
544 3300027665 Ga0209983_1002053 Ga0209983_10020532 106
545 3300027682 Ga0209971_1004182 Ga0209971_10041822 106
546 3300027876 Ga0209974_10012492 Ga0209974_100124924 106
547 3300027876 Ga0209974_10143883 Ga0209974_101438832 106
548 3300028380 Ga0268265_11867393 Ga0268265_118673932 106
549 3300028794 Ga0307515_10222018 Ga0307515_102220182 106
550 3300030500 Ga0268256_1000027 Ga0268256_1000027376 106
551 3300030732 Ga0316176_1093772 Ga0316176_10937721 106
552 3300030733 Ga0314311_1024079 Ga0314311_10240795 106
553 3300030735 Ga0316178_1070040 Ga0316178_10700402 106
554 3300031456 Ga0307513_10001910 Ga0307513_100019106 106
555 3300031456 Ga0307513_10180614 Ga0307513_101806142 106
556 3300031456 Ga0307513_10217896 Ga0307513_102178963 106
557 3300031548 Ga0307408_100882533 Ga0307408_1008825332 106
558 3300031548 Ga0307408_100944790 Ga0307408_1009447902 106
559 3300031731 Ga0307405_10051058 Ga0307405_100510583 106
560 3300031731 Ga0307405_10540874 Ga0307405_105408742 106
561 3300031824 Ga0307413_10180981 Ga0307413_101809811 106
562 3300031824 Ga0307413_10609843 Ga0307413_106098433 106
563 3300031901 Ga0307406_10294410 Ga0307406_102944102 106
564 3300031901 Ga0307406_11800255 Ga0307406_118002551 106
565 3300031903 Ga0307407_10300183 Ga0307407_103001832 106
566 3300031911 Ga0307412_10319964 Ga0307412_103199642 106
567 3300031911 Ga0307412_10342889 Ga0307412_103428892 106
568 3300031995 Ga0307409_100925890 Ga0307409_1009258902 106
569 3300032002 Ga0307416_100097588 Ga0307416_1000975883 106
570 3300032004 Ga0307414_10006203 Ga0307414_100062033 106
571 3300032004 Ga0307414_10257343 Ga0307414_102573432 106
572 3300032004 Ga0307414_10910731 Ga0307414_109107311 106
573 3300032126 Ga0307415_100137324 Ga0307415_1001373243 106
574 3300037471 Ga0395905_1462927 Ga0395905_1462927_56_412 106
575 3300038705 Ga0237819_00236 Ga0237819_00236_8963_9283 106
576 3300041404 Ga0439436_0005936 Ga0439436_0005936_3281_3601 106
577 3300041404 Ga0439436_0057950 Ga0439436_0057950_517_837 106
578 3300041406 Ga0439439_0042318 Ga0439439_0042318_162_482 106
579 3300041406 Ga0439439_0128463 Ga0439439_0128463_131_463 106
580 3300041413 Ga0439465_0347867 Ga0439465_0347867_193_528 106
581 3300041441 Ga0451787_607498 Ga0451787_607498_816_1136 106
582 3300041451 Ga0451791_1078979 Ga0451791_1078979_1024_1344 106
583 3300041451 Ga0451791_1601619 Ga0451791_1601619_295_615 106
584 3300041452 Ga0451793_0499790 Ga0451793_0499790_102_422 106
585 3300041452 Ga0451793_0935961 Ga0451793_0935961_281_601 106
586 3300041452 Ga0451793_1186641 Ga0451793_1186641_197_517 106
587 3300041453 Ga0451797_0296971 Ga0451797_0296971_520_840 106
588 3300041453 Ga0451797_0309277 Ga0451797_0309277_189_509 106
589 3300041453 Ga0451797_0487859 Ga0451797_0487859_228_548 106
590 3300041459 Ga0451800_0738262 Ga0451800_0738262_7051_7371 106
591 3300041459 Ga0451800_1647684 Ga0451800_1647684_39_359 106
592 3300041460 Ga0451802_1263235 Ga0451802_1263235_977_1297 106
593 3300041460 Ga0451802_1631226 Ga0451802_1631226_112_432 106
594 3300041462 Ga0451806_250174 Ga0451806_250174_711_1031 106
595 3300041463 Ga0451804_0352159 Ga0451804_0352159_133_453 106
596 3300041463 Ga0451804_0831922 Ga0451804_0831922_6710_7030 106
597 3300041486 Ga0451807_0161263 Ga0451807_0161263_38_358 106
598 3300041486 Ga0451807_0330082 Ga0451807_0330082_78_398 106
599 3300041486 Ga0451807_0683873 Ga0451807_0683873_133_453 106
600 3300041486 Ga0451807_1108932 Ga0451807_1108932_7052_7372 106
601 3300041486 Ga0451807_1270057 Ga0451807_1270057_277_597 106
602 3300041486 Ga0451807_2641394 Ga0451807_2641394_36_356 106
603 3300041491 Ga0451833_1485257 Ga0451833_1485257_86_406 106
604 3300041494 Ga0451837_0563368 Ga0451837_0563368_201_521 106
605 3300041494 Ga0451837_1261700 Ga0451837_1261700_289_609 106
606 3300041496 Ga0451839_1008954 Ga0451839_1008954_337_657 106
607 3300041509 Ga0451843_0940890 Ga0451843_0940890_26_349 106
608 3300041509 Ga0451843_1204386 Ga0451843_1204386_10_330 106
609 3300041509 Ga0451843_1305810 Ga0451843_1305810_519_839 106
610 3300041509 Ga0451843_1349917 Ga0451843_1349917_158_478 106
611 3300041512 Ga0451853_2568479 Ga0451853_2568479_172_492 106
612 3300041512 Ga0451853_2783524 Ga0451853_2783524_84_404 106
613 3300041512 Ga0451853_3065596 Ga0451853_3065596_1517_1840 106
614 3300041997 Ga0439431_0024710 Ga0439431_0024710_304_624 106
615 3300041999 Ga0439433_0013143 Ga0439433_0013143_379_702 106
616 3300041999 Ga0439433_0014237 Ga0439433_0014237_241_561 106
617 3300041999 Ga0439433_0052184 Ga0439433_0052184_251_571 106
618 3300042004 Ga0439445_0181258 Ga0439445_0181258_89_412 106
619 3300042006 Ga0439432_048250 Ga0439432_048250_747_1070 106
620 3300042006 Ga0439432_058718 Ga0439432_058718_383_703 106
621 3300042006 Ga0439432_125989 Ga0439432_125989_204_524 106
622 3300042007 Ga0439449_0004794 Ga0439449_0004794_2733_3053 106
623 3300042007 Ga0439449_0023675 Ga0439449_0023675_1312_1632 106
624 3300042007 Ga0439449_0062623 Ga0439449_0062623_575_895 106
625 3300042007 Ga0439449_0212730 Ga0439449_0212730_205_528 106
626 3300042014 Ga0439457_036129 Ga0439457_036129_654_974 106
627 3300042015 Ga0439462_0011336 Ga0439462_0011336_1868_2203 106
628 3300042015 Ga0439462_0036505 Ga0439462_0036505_230_550 106
629 3300042015 Ga0439462_0054119 Ga0439462_0054119_562_882 106
630 3300042142 Ga0450905_000985 Ga0450905_000985_3058_3378 106
631 3300042435 Ga0439434_0036439 Ga0439434_0036439_1156_1476 106
632 3300042876 Ga0451577_0004886 Ga0451577_0004886_4170_4490 106
633 3300044712 Ga0453684_0279891 Ga0453684_0279891_331_651 106
634 3300046460 Ga0495638_0286280 Ga0495638_0286280_446_766 106
635 3300046460 Ga0495638_0292617 Ga0495638_0292617_275_595 106
636 3300046471 Ga0495650_0145613 Ga0495650_0145613_247_570 106
637 3300046474 Ga0495605_0144241 Ga0495605_0144241_703_1026 106
638 3300046501 Ga0495607_0082582 Ga0495607_0082582_780_1103 106
639 3300046507 Ga0495606_0017638 Ga0495606_0017638_2535_2858 106
640 3300046513 Ga0495616_0021918 Ga0495616_0021918_1667_1990 106
641 3300046513 Ga0495616_0031168 Ga0495616_0031168_776_1096 106
642 3300046522 Ga0495643_0166093 Ga0495643_0166093_184_504 106
643 3300046525 Ga0495663_0002500 Ga0495663_0002500_1460_1780 106
644 3300046525 Ga0495663_0213148 Ga0495663_0213148_56_376 106
645 3300046530 Ga0495654_0393459 Ga0495654_0393459_135_455 106
646 3300046537 Ga0495598_0055897 Ga0495598_0055897_477_797 106
647 3300046539 Ga0495621_0000158 Ga0495621_0000158_6810_7130 106
648 3300046539 Ga0495621_0007280 Ga0495621_0007280_283_603 106
649 3300046558 Ga0495633_0024292 Ga0495633_0024292_73_393 106
650 3300046558 Ga0495633_0314442 Ga0495633_0314442_240_563 106
651 3300046615 Ga0495656_0031151 Ga0495656_0031151_15_335 106
652 3300046615 Ga0495656_0037849 Ga0495656_0037849_1598_1918 106
653 3300046664 Ga0495659_0171417 Ga0495659_0171417_237_557 106
654 3300046691 Ga0495670_0040546 Ga0495670_0040546_68_388 106
655 3300046691 Ga0495670_0239982 Ga0495670_0239982_132_452 106
656 3300046692 Ga0495671_0053288 Ga0495671_0053288_1582_1902 106
657 3300046810 Ga0495660_0244951 Ga0495660_0244951_253_576 106
658 3300047318 Ga0495636_0114366 Ga0495636_0114366_171_491 106
659 3300047318 Ga0495636_0115863 Ga0495636_0115863_123_443 106
660 3300047318 Ga0495636_0232019 Ga0495636_0232019_132_452 106
661 3300047470 Ga0495681_0029027 Ga0495681_0029027_1833_2156 106
662 3300047472 Ga0495686_0014996 Ga0495686_0014996_4509_4829 106
663 3300048911 Ga0496108_0247334 Ga0496108_0247334_1021_1362 106
664 3300048912 Ga0496109_0455885 Ga0496109_0455885_478_819 106
665 3300048919 Ga0496116_0051347 Ga0496116_0051347_1067_1387 106
666 3300048920 Ga0496117_0004489 Ga0496117_0004489_14588_14908 106
667 3300048921 Ga0496118_0044969 Ga0496118_0044969_1282_1602 106
668 3300048922 Ga0496119_0006116 Ga0496119_0006116_1638_1958 106
669 3300048923 Ga0496120_0001298 Ga0496120_0001298_8804_9124 106
670 3300048925 Ga0496122_0000379 Ga0496122_0000379_86003_86323 106
671 3300048925 Ga0496122_0065289 Ga0496122_0065289_655_975 106
672 3300048926 Ga0496123_0003291 Ga0496123_0003291_9584_9904 106
673 3300048927 Ga0496124_0006411 Ga0496124_0006411_3325_3645 106
674 3300048927 Ga0496124_0065842 Ga0496124_0065842_1637_1957 106
675 3300048928 Ga0496125_0169769 Ga0496125_0169769_520_840 106
676 3300048929 Ga0496126_0612825 Ga0496126_0612825_31_351 106
677 3300049569 Ga0501032_0009975 Ga0501032_0009975_542_916 106
678 3300049569 Ga0501032_0252333 Ga0501032_0252333_233_553 106
679 3300049571 Ga0501034_0009841 Ga0501034_0009841_1351_1725 106
680 3300049571 Ga0501034_0011634 Ga0501034_0011634_4677_5000 106
681 3300049571 Ga0501034_0249743 Ga0501034_0249743_905_1225 106
682 3300049572 Ga0501036_0008146 Ga0501036_0008146_7622_7996 106
683 3300049574 Ga0501038_0000610 Ga0501038_0000610_7533_7907 106
684 3300049575 Ga0501039_0275574 Ga0501039_0275574_969_1289 106
685 3300049579 Ga0501043_0037923 Ga0501043_0037923_537_911 106
686 3300049581 Ga0501047_0027284 Ga0501047_0027284_4574_4948 106
687 3300049584 Ga0501068_0050100 Ga0501068_0050100_81_455 106
688 3300049586 Ga0501070_0753061 Ga0501070_0753061_16_390 106
689 3300049587 Ga0501071_0544692 Ga0501071_0544692_73_393 106
690 3300049661 Ga0501217_106725 Ga0501217_106725_283_603 106
691 3300049741 Ga0501079_0900908 Ga0501079_0900908_310_684 106
692 3300049742 Ga0501080_0031762 Ga0501080_0031762_4313_4687 106
693 3300049760 Ga0501263_002926 Ga0501263_002926_1172_1492 106
694 3300049765 Ga0501268_027823 Ga0501268_027823_379_699 106
695 3300049770 Ga0501273_072832 Ga0501273_072832_152_538 106
696 3300049822 Ga0501035_0005516 Ga0501035_0005516_4975_5349 106
697 3300049823 Ga0501044_0119435 Ga0501044_0119435_1131_1505 106
698 3300049823 Ga0501044_0384203 Ga0501044_0384203_428_748 106
699 3300050490 nmdc:mga03n38_667452_c1 nmdc:mga03n38_667452_c1_46_366 106
700 3300050490 nmdc:mga03n38_820072_c1 nmdc:mga03n38_820072_c1_46_366 106
701 3300050491 nmdc:mga00v17_3525_c1 nmdc:mga00v17_3525_c1_2941_3261 106
702 3300050510 nmdc:mga06r32_850470_c1 nmdc:mga06r32_850470_c1_51_371 106
703 3300053156 Ga0500622_0189400 Ga0500622_0189400_429_752 106
704 3300053161 Ga0500634_0000111 Ga0500634_0000111_26887_27207 106
705 3300053727 Ga0500611_091189 Ga0500611_091189_404_724 106
706 3300053734 Ga0500565_010275 Ga0500565_010275_375_695 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08850

DUF1820

Domain of unknown function (DUF1820)

26

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og8-assembly1.cif.gz_A wild-type hfq protein from neisseria meningitidis 0.7666 4 80
3m4g-assembly2.cif.gz_G h57a hfq from pseudomonas aeruginosa 0.7599 3 80
8p91-assembly1.cif.gz_A hfq from chromobacterium haemolyticum; a p6 space group monomer 0.754 4 83
7ogw-assembly1.cif.gz_A q9a mutant of hfq protein from neisseria meningitidis 0.7507 4 83
5uk7-assembly1.cif.gz_B escherichia coli hfq bound to dsdna 0.7482 3 81
ID Description Score Start End Superfamily
af_Q2FWX7_36_130_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7419 5 76 2.30.29.30
af_Q2FYZ1_1_77_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7323 3 83 2.30.30.100
4nl2F00 Mainly Beta;Roll;SH3 type barrels.; 0.7216 3 83 2.30.30.100
af_Q2G2D3_87_153_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.6972 3 78 2.30.30.180
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.696 4 83 2.30.30.100
ID Description Score Start End GO Terms
AF-G7UW60-F1-model_v4 DUF1820 family protein 0.9203 1 106
AF-A0A656YHN7-F1-model_v4 deleted 0.9161 1 89
AF-G7UW60-F1-model_v4 DUF1820 family protein 0.9121 1 106
AF-A0A2G6C9Y0-F1-model_v4 DUF1820 domain-containing protein 0.9008 2 82
AF-A0A661PST2-F1-model_v4 DUF1820 family protein 0.8963 3 80

Feature Viewer

pLDDT pTM Quality
72.17 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map