F476510
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 706 | 353 | 702 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300049770|Ga0501273_072832|Ga0501273_072832_152_538 |
| Length | 128 |
| Sequence | LPATSFVPSALITGRSCHRSYNRGMKLYKVTFLNHGRVYELYARRVTGSSLWGFTEVGDLVFDVNDGVVIDPTEERLRDEFGNTRVLHLPMQSVVRVEEVDRKGQSAIRDAATGESVVTPFPLPAKPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 4 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 5 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 6 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 94 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 95 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 96 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 97 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 98 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 112 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 199 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 200 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 201 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 221 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 222 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 235 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 236 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 240 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 241 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 242 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 243 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 244 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 245 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 246 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 247 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 251 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 252 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 253 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 254 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 302 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 328 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 329 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 330 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 332 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 335 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 341 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 342 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 349 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 350 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 352 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 353 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.97 |
| Nodule | 0 |
| Rhizoplane | 6.8 |
| Rhizosphere | 62.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C2318 | 2010549000 | Bacteria | 2298 |
| 2 | SwRhRL2b_contig_3083456 | 2162886007 | Bacteria | 3968 |
| 3 | JGI24739J22299_10002511 | 3300001989 | Bacteria | 7080 |
| 4 | JGI24737J22298_10000898 | 3300001990 | Bacteria | 10587 |
| 5 | JGI24737J22298_10012164 | 3300001990 | Bacteria | 2807 |
| 6 | JGI24735J21928_10015344 | 3300002067 | Bacteria | 2391 |
| 7 | JGI25156J39149_1002031 | 3300002705 | Bacteria | 7719 |
| 8 | JGI25156J39149_1005020 | 3300002705 | Bacteria | 3907 |
| 9 | JGI25162J39368_1000585 | 3300002737 | Bacteria | 26682 |
| 10 | JGI25162J39368_1001345 | 3300002737 | Bacteria | 13629 |
| 11 | JGI25162J39368_1001632 | 3300002737 | Bacteria | 11183 |
| 12 | JGI25157J39369_1000258 | 3300002741 | Bacteria | 38929 |
| 13 | JGI25157J39369_1000906 | 3300002741 | Bacteria | 14206 |
| 14 | JGI25157J39369_1001632 | 3300002741 | Bacteria | 7717 |
| 15 | JGI25163J39215_1000475 | 3300002771 | Bacteria | 12121 |
| 16 | JGI25164J39214_1000004 | 3300002772 | Bacteria | 350814 |
| 17 | JGI25164J39214_1000677 | 3300002772 | Bacteria | 13629 |
| 18 | JGI25152J39213_1000312 | 3300002773 | Bacteria | 31247 |
| 19 | JGI25150J39212_1000221 | 3300002774 | Bacteria | 31248 |
| 20 | JGI25151J46595_10000093 | 3300003187 | Bacteria | 121884 |
| 21 | JGI25165J46597_1000164 | 3300003214 | Bacteria | 104150 |
| 22 | JGI25165J46597_1001357 | 3300003214 | Bacteria | 13629 |
| 23 | JGI25153J46596_10000061 | 3300003215 | Bacteria | 131624 |
| 24 | rootH1_10021424 | 3300003316 | Bacteria | 3046 |
| 25 | rootH2_10043016 | 3300003320 | Bacteria | 3129 |
| 26 | rootH2_10189554 | 3300003320 | Bacteria | 1429 |
| 27 | rootL2_10138739 | 3300003322 | Bacteria | 3199 |
| 28 | rootH1_10190495 | 3300003323 | Bacteria | 1899 |
| 29 | Ga0055538_1003048 | 3300003751 | Bacteria | 2222 |
| 30 | Ga0055539_1001206 | 3300003752 | Bacteria | 5230 |
| 31 | Ga0055533_1002415 | 3300003756 | Bacteria | 4255 |
| 32 | Ga0055533_1005491 | 3300003756 | Bacteria | 2024 |
| 33 | Ga0055525_1000293 | 3300003759 | Bacteria | 44400 |
| 34 | Ga0055527_1000070 | 3300003760 | Bacteria | 85704 |
| 35 | Ga0055527_1000077 | 3300003760 | Bacteria | 79793 |
| 36 | Ga0055527_1016305 | 3300003760 | Bacteria | 803 |
| 37 | Ga0055535_1000117 | 3300003761 | Bacteria | 85705 |
| 38 | Ga0055535_1000130 | 3300003761 | Bacteria | 79793 |
| 39 | Ga0055535_1001093 | 3300003761 | Bacteria | 16552 |
| 40 | Ga0055535_1001283 | 3300003761 | Bacteria | 13629 |
| 41 | Ga0055535_1001578 | 3300003761 | Bacteria | 10993 |
| 42 | Ga0055535_1011473 | 3300003761 | Bacteria | 1399 |
| 43 | Ga0055535_1028561 | 3300003761 | Bacteria | 599 |
| 44 | Ga0055542_1000156 | 3300003762 | Bacteria | 85704 |
| 45 | Ga0055542_1000174 | 3300003762 | Bacteria | 79793 |
| 46 | Ga0055542_1000184 | 3300003762 | Bacteria | 77138 |
| 47 | Ga0055542_1001071 | 3300003762 | Bacteria | 16843 |
| 48 | Ga0055542_1001086 | 3300003762 | Bacteria | 16552 |
| 49 | Ga0055542_1001273 | 3300003762 | Bacteria | 13629 |
| 50 | Ga0055529_1000102 | 3300003763 | Bacteria | 129901 |
| 51 | Ga0055529_1000201 | 3300003763 | Bacteria | 79793 |
| 52 | Ga0055529_1000353 | 3300003763 | Bacteria | 50427 |
| 53 | Ga0055529_1001006 | 3300003763 | Bacteria | 13629 |
| 54 | Ga0055537_1000572 | 3300003773 | Bacteria | 20644 |
| 55 | Ga0055524_1000393 | 3300003775 | Bacteria | 37606 |
| 56 | Ga0055536_1005416 | 3300003781 | Bacteria | 6246 |
| 57 | Ga0055536_1008638 | 3300003781 | Bacteria | 4341 |
| 58 | Ga0055536_1024198 | 3300003781 | Bacteria | 1765 |
| 59 | Ga0055534_1000527 | 3300003784 | Bacteria | 20644 |
| 60 | Ga0055528_1000855 | 3300003790 | Bacteria | 20644 |
| 61 | Ga0055530_10001682 | 3300003791 | Bacteria | 15686 |
| 62 | Ga0055531_10008817 | 3300003794 | Bacteria | 5252 |
| 63 | Ga0055531_10013482 | 3300003794 | Bacteria | 3763 |
| 64 | Ga0055531_10022842 | 3300003794 | Bacteria | 2368 |
| 65 | Ga0055531_10049384 | 3300003794 | Bacteria | 1124 |
| 66 | Ga0065165_1002561 | 3300005262 | Bacteria | 15022 |
| 67 | Ga0070658_10096605 | 3300005327 | Bacteria | 2439 |
| 68 | Ga0070683_101483383 | 3300005329 | Bacteria | 652 |
| 69 | Ga0070670_100005341 | 3300005331 | Bacteria | 10834 |
| 70 | Ga0070670_100115474 | 3300005331 | Bacteria | 2314 |
| 71 | Ga0070670_101108685 | 3300005331 | Bacteria | 722 |
| 72 | Ga0070670_101505316 | 3300005331 | Bacteria | 618 |
| 73 | Ga0070670_101769652 | 3300005331 | Bacteria | 569 |
| 74 | Ga0070680_101853441 | 3300005336 | Bacteria | 523 |
| 75 | Ga0070682_101406370 | 3300005337 | Bacteria | 597 |
| 76 | Ga0070660_100030951 | 3300005339 | Bacteria | 4016 |
| 77 | Ga0070660_101642800 | 3300005339 | Bacteria | 547 |
| 78 | Ga0070689_100003754 | 3300005340 | Bacteria | 10168 |
| 79 | Ga0070687_100538828 | 3300005343 | Bacteria | 792 |
| 80 | Ga0070661_100217132 | 3300005344 | Bacteria | 1465 |
| 81 | Ga0070661_100244792 | 3300005344 | Bacteria | 1382 |
| 82 | Ga0070661_101369120 | 3300005344 | Bacteria | 595 |
| 83 | Ga0070668_102080038 | 3300005347 | Bacteria | 524 |
| 84 | Ga0070669_100081991 | 3300005353 | Bacteria | 2404 |
| 85 | Ga0070675_101265473 | 3300005354 | Bacteria | 679 |
| 86 | Ga0070675_101279379 | 3300005354 | Bacteria | 676 |
| 87 | Ga0070671_100101724 | 3300005355 | Bacteria | 2411 |
| 88 | Ga0070671_100351778 | 3300005355 | Bacteria | 1257 |
| 89 | Ga0070674_100258178 | 3300005356 | Bacteria | 1372 |
| 90 | Ga0070673_100401476 | 3300005364 | Bacteria | 1226 |
| 91 | Ga0070688_100067733 | 3300005365 | Bacteria | 2275 |
| 92 | Ga0070659_101520039 | 3300005366 | Bacteria | 597 |
| 93 | Ga0070667_100077353 | 3300005367 | Bacteria | 2841 |
| 94 | Ga0070667_101840776 | 3300005367 | Bacteria | 570 |
| 95 | Ga0070713_101934787 | 3300005436 | Bacteria | 572 |
| 96 | Ga0070663_100051543 | 3300005455 | Bacteria | 2932 |
| 97 | Ga0070663_100232870 | 3300005455 | Bacteria | 1451 |
| 98 | Ga0070663_100246127 | 3300005455 | Bacteria | 1413 |
| 99 | Ga0070662_101052018 | 3300005457 | Bacteria | 698 |
| 100 | Ga0070681_10579391 | 3300005458 | Bacteria | 1036 |
| 101 | Ga0070681_11007685 | 3300005458 | Bacteria | 753 |
| 102 | Ga0070685_10020697 | 3300005466 | Bacteria | 3563 |
| 103 | Ga0070679_100146755 | 3300005530 | Bacteria | 2336 |
| 104 | Ga0068853_100032189 | 3300005539 | Bacteria | 4441 |
| 105 | Ga0068853_100130498 | 3300005539 | Bacteria | 2249 |
| 106 | Ga0068853_100640281 | 3300005539 | Bacteria | 1011 |
| 107 | Ga0070672_100005743 | 3300005543 | Bacteria | 8270 |
| 108 | Ga0070665_100814868 | 3300005548 | Bacteria | 946 |
| 109 | Ga0070665_100851210 | 3300005548 | Bacteria | 925 |
| 110 | Ga0070665_102388953 | 3300005548 | Bacteria | 531 |
| 111 | Ga0068855_100071681 | 3300005563 | Bacteria | 4028 |
| 112 | Ga0068855_100361813 | 3300005563 | Bacteria | 1596 |
| 113 | Ga0068855_101577595 | 3300005563 | Bacteria | 672 |
| 114 | Ga0070664_100210219 | 3300005564 | Bacteria | 1738 |
| 115 | Ga0070664_100295361 | 3300005564 | Bacteria | 1463 |
| 116 | Ga0070664_100457157 | 3300005564 | Bacteria | 1173 |
| 117 | Ga0070664_101243865 | 3300005564 | Bacteria | 703 |
| 118 | Ga0068857_100047656 | 3300005577 | Bacteria | 3805 |
| 119 | Ga0068857_100324915 | 3300005577 | Bacteria | 1421 |
| 120 | Ga0068854_100025861 | 3300005578 | Bacteria | 4028 |
| 121 | Ga0068854_100193082 | 3300005578 | Bacteria | 1596 |
| 122 | Ga0068854_100431674 | 3300005578 | Bacteria | 1096 |
| 123 | Ga0068856_100000909 | 3300005614 | Bacteria | 31625 |
| 124 | Ga0068852_100153318 | 3300005616 | Bacteria | 2145 |
| 125 | Ga0068852_100191949 | 3300005616 | Bacteria | 1928 |
| 126 | Ga0068852_100901881 | 3300005616 | Bacteria | 901 |
| 127 | Ga0068852_101418060 | 3300005616 | Bacteria | 717 |
| 128 | Ga0068859_100121970 | 3300005617 | Bacteria | 2673 |
| 129 | Ga0068859_100393341 | 3300005617 | Bacteria | 1482 |
| 130 | Ga0068864_102236860 | 3300005618 | Bacteria | 553 |
| 131 | Ga0068851_10023851 | 3300005834 | Bacteria | 2992 |
| 132 | Ga0068858_100071997 | 3300005842 | Bacteria | 3207 |
| 133 | Ga0068860_100017659 | 3300005843 | Bacteria | 6951 |
| 134 | Ga0068862_100378023 | 3300005844 | Bacteria | 1320 |
| 135 | Ga0068862_101549252 | 3300005844 | Bacteria | 669 |
| 136 | Ga0075364_10000261 | 3300006051 | Bacteria | 25565 |
| 137 | Ga0075366_10319580 | 3300006195 | Bacteria | 951 |
| 138 | Ga0075431_100761496 | 3300006847 | Bacteria | 943 |
| 139 | Ga0097620_100121970 | 3300006931 | Bacteria | 2673 |
| 140 | Ga0097620_100393304 | 3300006931 | Bacteria | 1482 |
| 141 | Ga0105251_10001882 | 3300009011 | Bacteria | 17203 |
| 142 | Ga0105240_10053139 | 3300009093 | Bacteria | 5088 |
| 143 | Ga0105240_10069096 | 3300009093 | Bacteria | 4373 |
| 144 | Ga0105240_10078089 | 3300009093 | Bacteria | 4077 |
| 145 | Ga0105240_10080210 | 3300009093 | Bacteria | 4014 |
| 146 | Ga0105243_10000720 | 3300009148 | Bacteria | 31769 |
| 147 | Ga0105241_10259256 | 3300009174 | Bacteria | 1477 |
| 148 | Ga0105242_11736573 | 3300009176 | Bacteria | 661 |
| 149 | Ga0105237_10000097 | 3300009545 | Bacteria | 121349 |
| 150 | Ga0105237_10880354 | 3300009545 | Bacteria | 902 |
| 151 | Ga0105238_10248899 | 3300009551 | Bacteria | 1755 |
| 152 | Ga0105249_11530538 | 3300009553 | Bacteria | 739 |
| 153 | Ga0105239_10001059 | 3300010375 | Bacteria | 38260 |
| 154 | Ga0105239_10171871 | 3300010375 | Bacteria | 2423 |
| 155 | Ga0105239_10507271 | 3300010375 | Bacteria | 1372 |
| 156 | Ga0105246_11891163 | 3300011119 | Bacteria | 573 |
| 157 | Ga0157340_1007427 | 3300012473 | Bacteria | 711 |
| 158 | Ga0157319_1036975 | 3300012497 | Bacteria | 555 |
| 159 | Ga0157345_1046811 | 3300012498 | Bacteria | 538 |
| 160 | Ga0157314_1000048 | 3300012500 | Bacteria | 12500 |
| 161 | Ga0157347_1046055 | 3300012502 | Bacteria | 589 |
| 162 | Ga0157339_1004456 | 3300012505 | Bacteria | 1062 |
| 163 | Ga0157373_10028254 | 3300013100 | Bacteria | 4046 |
| 164 | Ga0157373_10381905 | 3300013100 | Bacteria | 1008 |
| 165 | Ga0157371_10066305 | 3300013102 | Bacteria | 2556 |
| 166 | Ga0157371_10522053 | 3300013102 | Bacteria | 878 |
| 167 | Ga0157370_10624369 | 3300013104 | Bacteria | 986 |
| 168 | Ga0157369_10020750 | 3300013105 | Bacteria | 7343 |
| 169 | Ga0157369_10031050 | 3300013105 | Bacteria | 5888 |
| 170 | Ga0157369_10110365 | 3300013105 | Bacteria | 2924 |
| 171 | Ga0157369_10127335 | 3300013105 | Bacteria | 2699 |
| 172 | Ga0157378_10831220 | 3300013297 | Bacteria | 951 |
| 173 | Ga0163162_10762579 | 3300013306 | Bacteria | 1086 |
| 174 | Ga0157372_10303041 | 3300013307 | Bacteria | 1859 |
| 175 | Ga0157372_10325770 | 3300013307 | Bacteria | 1789 |
| 176 | Ga0157372_10431109 | 3300013307 | Bacteria | 1537 |
| 177 | Ga0157372_10452587 | 3300013307 | Bacteria | 1496 |
| 178 | Ga0157375_10158743 | 3300013308 | Bacteria | 2402 |
| 179 | Ga0163163_10163739 | 3300014325 | Bacteria | 2270 |
| 180 | Ga0182008_10231576 | 3300014497 | Bacteria | 948 |
| 181 | Ga0182008_10516346 | 3300014497 | Bacteria | 659 |
| 182 | Ga0182006_1006577 | 3300015261 | Bacteria | 5387 |
| 183 | Ga0182005_1001273 | 3300015265 | Bacteria | 10373 |
| 184 | Ga0182005_1194366 | 3300015265 | Bacteria | 607 |
| 185 | Ga0183369_1019 | 3300015685 | Bacteria | 115894 |
| 186 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 187 | Ga0163161_10338107 | 3300017792 | Bacteria | 1194 |
| 188 | Ga0163161_10730561 | 3300017792 | Bacteria | 827 |
| 189 | Ga0209760_101412 | 3300025207 | Bacteria | 2565 |
| 190 | Ga0209784_100544 | 3300025224 | Bacteria | 13789 |
| 191 | Ga0209566_106220 | 3300025225 | Bacteria | 1429 |
| 192 | Ga0209566_106838 | 3300025225 | Bacteria | 1318 |
| 193 | Ga0209674_100037 | 3300025226 | Bacteria | 404339 |
| 194 | Ga0209674_100299 | 3300025226 | Bacteria | 34536 |
| 195 | Ga0209672_100070 | 3300025228 | Bacteria | 174481 |
| 196 | Ga0209672_100084 | 3300025228 | Bacteria | 129975 |
| 197 | Ga0209672_100099 | 3300025228 | Bacteria | 109599 |
| 198 | Ga0209672_100381 | 3300025228 | Bacteria | 27146 |
| 199 | Ga0209672_101575 | 3300025228 | Bacteria | 7732 |
| 200 | Ga0209672_106816 | 3300025228 | Bacteria | 1819 |
| 201 | Ga0209563_100174 | 3300025230 | Bacteria | 44452 |
| 202 | Ga0207427_100031 | 3300025231 | Bacteria | 350866 |
| 203 | Ga0207427_100831 | 3300025231 | Bacteria | 13790 |
| 204 | Ga0207427_103488 | 3300025231 | Bacteria | 3264 |
| 205 | Ga0207427_108173 | 3300025231 | Bacteria | 1181 |
| 206 | Ga0209437_100061 | 3300025233 | Bacteria | 350866 |
| 207 | Ga0209437_100123 | 3300025233 | Bacteria | 200393 |
| 208 | Ga0209437_100323 | 3300025233 | Bacteria | 61084 |
| 209 | Ga0209437_131123 | 3300025233 | Bacteria | 538 |
| 210 | Ga0209258_100054 | 3300025242 | Bacteria | 339063 |
| 211 | Ga0209258_100104 | 3300025242 | Bacteria | 208582 |
| 212 | Ga0209258_100188 | 3300025242 | Bacteria | 130022 |
| 213 | Ga0209258_100218 | 3300025242 | Bacteria | 109599 |
| 214 | Ga0209258_100281 | 3300025242 | Bacteria | 85049 |
| 215 | Ga0209258_100923 | 3300025242 | Bacteria | 14716 |
| 216 | Ga0209258_106372 | 3300025242 | Bacteria | 1858 |
| 217 | Ga0207425_1000015 | 3300025245 | Bacteria | 466368 |
| 218 | Ga0209646_1000619 | 3300025246 | Bacteria | 13641 |
| 219 | Ga0209646_1007923 | 3300025246 | Bacteria | 1723 |
| 220 | Ga0209646_1012880 | 3300025246 | Bacteria | 1278 |
| 221 | Ga0209026_1000171 | 3300025250 | Bacteria | 98984 |
| 222 | Ga0209026_1000550 | 3300025250 | Bacteria | 25769 |
| 223 | Ga0209026_1001022 | 3300025250 | Bacteria | 13766 |
| 224 | Ga0209677_101680 | 3300025253 | Bacteria | 9248 |
| 225 | Ga0209677_132389 | 3300025253 | Bacteria | 522 |
| 226 | Ga0209148_1000063 | 3300025254 | Bacteria | 346881 |
| 227 | Ga0209148_1000066 | 3300025254 | Bacteria | 339063 |
| 228 | Ga0209148_1000106 | 3300025254 | Bacteria | 208597 |
| 229 | Ga0209148_1000196 | 3300025254 | Bacteria | 109599 |
| 230 | Ga0209148_1000252 | 3300025254 | Bacteria | 85199 |
| 231 | Ga0209148_1001272 | 3300025254 | Bacteria | 13790 |
| 232 | Ga0209759_1000137 | 3300025256 | Bacteria | 125216 |
| 233 | Ga0209759_1000487 | 3300025256 | Bacteria | 43693 |
| 234 | Ga0209759_1001414 | 3300025256 | Bacteria | 13669 |
| 235 | Ga0209759_1003274 | 3300025256 | Bacteria | 6537 |
| 236 | Ga0209129_1000131 | 3300025258 | Bacteria | 127801 |
| 237 | Ga0209129_1006938 | 3300025258 | Bacteria | 3502 |
| 238 | Ga0209233_1000076 | 3300025261 | Bacteria | 350866 |
| 239 | Ga0209233_1000136 | 3300025261 | Bacteria | 200393 |
| 240 | Ga0209233_1012259 | 3300025261 | Bacteria | 2491 |
| 241 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 242 | Ga0209455_1000146 | 3300025272 | Bacteria | 133032 |
| 243 | Ga0209455_1000173 | 3300025272 | Bacteria | 109599 |
| 244 | Ga0209455_1000831 | 3300025272 | Bacteria | 16664 |
| 245 | Ga0209455_1001041 | 3300025272 | Bacteria | 13812 |
| 246 | Ga0209455_1008836 | 3300025272 | Bacteria | 2699 |
| 247 | Ga0209455_1010273 | 3300025272 | Bacteria | 2392 |
| 248 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 249 | Ga0209673_1006434 | 3300025273 | Bacteria | 5668 |
| 250 | Ga0209130_1005216 | 3300025284 | Bacteria | 4592 |
| 251 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 252 | Ga0209675_1003612 | 3300025291 | Bacteria | 7267 |
| 253 | Ga0209676_1001795 | 3300025292 | Bacteria | 18008 |
| 254 | Ga0209676_1002044 | 3300025292 | Bacteria | 15780 |
| 255 | Ga0209676_1007405 | 3300025292 | Bacteria | 5158 |
| 256 | Ga0209676_1008414 | 3300025292 | Bacteria | 4604 |
| 257 | Ga0209676_1009197 | 3300025292 | Bacteria | 4297 |
| 258 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 259 | Ga0209025_1000030 | 3300025294 | Bacteria | 441196 |
| 260 | Ga0209025_1005191 | 3300025294 | Bacteria | 10762 |
| 261 | Ga0209025_1030021 | 3300025294 | Bacteria | 2613 |
| 262 | Ga0209025_1103958 | 3300025294 | Bacteria | 891 |
| 263 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 264 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 265 | Ga0209758_1017138 | 3300025297 | Bacteria | 3630 |
| 266 | Ga0209758_1019182 | 3300025297 | Bacteria | 3312 |
| 267 | Ga0209050_1000429 | 3300025298 | Bacteria | 77085 |
| 268 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 269 | Ga0209256_1002127 | 3300025299 | Bacteria | 17165 |
| 270 | Ga0209256_1007777 | 3300025299 | Bacteria | 5172 |
| 271 | Ga0209256_1008339 | 3300025299 | Bacteria | 4830 |
| 272 | Ga0207426_1064789 | 3300025302 | Bacteria | 1038 |
| 273 | Ga0209051_1029247 | 3300025303 | Bacteria | 2159 |
| 274 | Ga0209257_1000336 | 3300025304 | Bacteria | 97981 |
| 275 | Ga0209257_1001853 | 3300025304 | Bacteria | 22971 |
| 276 | Ga0209257_1001936 | 3300025304 | Bacteria | 22336 |
| 277 | Ga0209257_1002007 | 3300025304 | Bacteria | 21769 |
| 278 | Ga0209257_1006315 | 3300025304 | Bacteria | 7720 |
| 279 | Ga0207656_10022662 | 3300025321 | Bacteria | 2522 |
| 280 | Ga0207713_1003029 | 3300025735 | Bacteria | 11720 |
| 281 | Ga0207642_10325457 | 3300025899 | Bacteria | 899 |
| 282 | Ga0207647_10003619 | 3300025904 | Bacteria | 11569 |
| 283 | Ga0207647_10004339 | 3300025904 | Bacteria | 10511 |
| 284 | Ga0207647_10102547 | 3300025904 | Bacteria | 1697 |
| 285 | Ga0207643_10661549 | 3300025908 | Bacteria | 674 |
| 286 | Ga0207654_10153932 | 3300025911 | Bacteria | 1478 |
| 287 | Ga0207707_10317991 | 3300025912 | Bacteria | 1344 |
| 288 | Ga0207695_10010112 | 3300025913 | Bacteria | 11576 |
| 289 | Ga0207695_10017110 | 3300025913 | Bacteria | 8453 |
| 290 | Ga0207695_10034917 | 3300025913 | Bacteria | 5461 |
| 291 | Ga0207695_10058395 | 3300025913 | Bacteria | 4004 |
| 292 | Ga0207671_10000119 | 3300025914 | Bacteria | 121359 |
| 293 | Ga0207660_11047306 | 3300025917 | Bacteria | 665 |
| 294 | Ga0207662_10629092 | 3300025918 | Bacteria | 748 |
| 295 | Ga0207657_10011830 | 3300025919 | Bacteria | 8638 |
| 296 | Ga0207657_10140190 | 3300025919 | Bacteria | 1976 |
| 297 | Ga0207649_10246167 | 3300025920 | Bacteria | 1285 |
| 298 | Ga0207649_10291108 | 3300025920 | Bacteria | 1191 |
| 299 | Ga0207652_10339288 | 3300025921 | Bacteria | 1356 |
| 300 | Ga0207681_10125182 | 3300025923 | Bacteria | 1891 |
| 301 | Ga0207694_10210265 | 3300025924 | Bacteria | 1585 |
| 302 | Ga0207694_10919745 | 3300025924 | Bacteria | 740 |
| 303 | Ga0207650_10004256 | 3300025925 | Bacteria | 9768 |
| 304 | Ga0207650_10476465 | 3300025925 | Bacteria | 1041 |
| 305 | Ga0207650_10654661 | 3300025925 | Bacteria | 886 |
| 306 | Ga0207650_11710214 | 3300025925 | Bacteria | 533 |
| 307 | Ga0207659_10392983 | 3300025926 | Bacteria | 1158 |
| 308 | Ga0207644_10192433 | 3300025931 | Bacteria | 1604 |
| 309 | Ga0207644_10491218 | 3300025931 | Bacteria | 1012 |
| 310 | Ga0207706_10316533 | 3300025933 | Bacteria | 1358 |
| 311 | Ga0207706_10487466 | 3300025933 | Bacteria | 1065 |
| 312 | Ga0207686_10964471 | 3300025934 | Bacteria | 691 |
| 313 | Ga0207709_10001168 | 3300025935 | Bacteria | 19045 |
| 314 | Ga0207670_10002189 | 3300025936 | Bacteria | 10219 |
| 315 | Ga0207670_10668341 | 3300025936 | Bacteria | 858 |
| 316 | Ga0207669_10230593 | 3300025937 | Bacteria | 1366 |
| 317 | Ga0207691_10131251 | 3300025940 | Bacteria | 2213 |
| 318 | Ga0207679_10067364 | 3300025945 | Bacteria | 2686 |
| 319 | Ga0207679_10087256 | 3300025945 | Bacteria | 2402 |
| 320 | Ga0207679_10296996 | 3300025945 | Bacteria | 1391 |
| 321 | Ga0207679_10326218 | 3300025945 | Bacteria | 1331 |
| 322 | Ga0207667_10001947 | 3300025949 | Bacteria | 25869 |
| 323 | Ga0207667_10253217 | 3300025949 | Bacteria | 1801 |
| 324 | Ga0207651_10091042 | 3300025960 | Bacteria | 2232 |
| 325 | Ga0207668_10061007 | 3300025972 | Bacteria | 2649 |
| 326 | Ga0207640_10003313 | 3300025981 | Bacteria | 8682 |
| 327 | Ga0207640_10019106 | 3300025981 | Bacteria | 4042 |
| 328 | Ga0207640_10302021 | 3300025981 | Bacteria | 1267 |
| 329 | Ga0207677_10211592 | 3300026023 | Bacteria | 1549 |
| 330 | Ga0207703_10287005 | 3300026035 | Bacteria | 1497 |
| 331 | Ga0207639_10107968 | 3300026041 | Bacteria | 2262 |
| 332 | Ga0207639_10203853 | 3300026041 | Bacteria | 1698 |
| 333 | Ga0207639_11190600 | 3300026041 | Bacteria | 715 |
| 334 | Ga0207678_10066833 | 3300026067 | Bacteria | 3086 |
| 335 | Ga0207678_10069102 | 3300026067 | Bacteria | 3029 |
| 336 | Ga0207678_10102487 | 3300026067 | Bacteria | 2443 |
| 337 | Ga0207678_10129759 | 3300026067 | Bacteria | 2150 |
| 338 | Ga0207702_10001326 | 3300026078 | Bacteria | 24789 |
| 339 | Ga0207648_10165160 | 3300026089 | Bacteria | 1956 |
| 340 | Ga0207674_10001298 | 3300026116 | Bacteria | 32640 |
| 341 | Ga0207674_10733770 | 3300026116 | Bacteria | 953 |
| 342 | Ga0207683_10244072 | 3300026121 | Bacteria | 1638 |
| 343 | Ga0207698_10202276 | 3300026142 | Bacteria | 1779 |
| 344 | Ga0207698_10801184 | 3300026142 | Bacteria | 944 |
| 345 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 346 | Ga0209984_1069063 | 3300027424 | Bacteria | 527 |
| 347 | Ga0209999_1003170 | 3300027543 | Bacteria | 2931 |
| 348 | Ga0209982_1004176 | 3300027552 | Bacteria | 2066 |
| 349 | Ga0209970_1023780 | 3300027614 | Bacteria | 1044 |
| 350 | Ga0209983_1002053 | 3300027665 | Bacteria | 4444 |
| 351 | Ga0209971_1004182 | 3300027682 | Bacteria | 3423 |
| 352 | Ga0209974_10012492 | 3300027876 | Bacteria | 2839 |
| 353 | Ga0209974_10143883 | 3300027876 | Bacteria | 857 |
| 354 | Ga0268266_10702354 | 3300028379 | Bacteria | 975 |
| 355 | Ga0268265_10925022 | 3300028380 | Bacteria | 857 |
| 356 | Ga0268265_11867393 | 3300028380 | Bacteria | 607 |
| 357 | Ga0268264_10121773 | 3300028381 | Bacteria | 2300 |
| 358 | Ga0307515_10222018 | 3300028794 | Bacteria | 1705 |
| 359 | Ga0265338_10221083 | 3300028800 | Bacteria | 1415 |
| 360 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 361 | Ga0316176_1093772 | 3300030732 | Bacteria | 550 |
| 362 | Ga0314311_1024079 | 3300030733 | Bacteria | 8759 |
| 363 | Ga0316178_1070040 | 3300030735 | Bacteria | 1402 |
| 364 | Ga0316182_1288570 | 3300030745 | Bacteria | 2544 |
| 365 | Ga0307513_10001910 | 3300031456 | Bacteria | 29613 |
| 366 | Ga0307513_10180614 | 3300031456 | Bacteria | 1974 |
| 367 | Ga0307513_10217896 | 3300031456 | Bacteria | 1733 |
| 368 | Ga0307408_100388434 | 3300031548 | Bacteria | 1195 |
| 369 | Ga0307408_100514605 | 3300031548 | Bacteria | 1050 |
| 370 | Ga0307408_100882533 | 3300031548 | Bacteria | 817 |
| 371 | Ga0307408_100944790 | 3300031548 | Bacteria | 792 |
| 372 | Ga0307405_10051058 | 3300031731 | Bacteria | 2564 |
| 373 | Ga0307405_10540874 | 3300031731 | Bacteria | 941 |
| 374 | Ga0307413_10180981 | 3300031824 | Bacteria | 1503 |
| 375 | Ga0307413_10236922 | 3300031824 | Bacteria | 1344 |
| 376 | Ga0307413_10609843 | 3300031824 | Bacteria | 894 |
| 377 | Ga0307410_10092428 | 3300031852 | Bacteria | 2151 |
| 378 | Ga0307406_10294410 | 3300031901 | Bacteria | 1244 |
| 379 | Ga0307406_11800255 | 3300031901 | Bacteria | 544 |
| 380 | Ga0307407_10300183 | 3300031903 | Bacteria | 1119 |
| 381 | Ga0307412_10010200 | 3300031911 | Bacteria | 5406 |
| 382 | Ga0307412_10319964 | 3300031911 | Bacteria | 1234 |
| 383 | Ga0307412_10342889 | 3300031911 | Bacteria | 1196 |
| 384 | Ga0307409_100925890 | 3300031995 | Bacteria | 886 |
| 385 | Ga0307409_102416732 | 3300031995 | Bacteria | 554 |
| 386 | Ga0307416_100097588 | 3300032002 | Bacteria | 2545 |
| 387 | Ga0307416_100392983 | 3300032002 | Bacteria | 1421 |
| 388 | Ga0307414_10006203 | 3300032004 | Bacteria | 6647 |
| 389 | Ga0307414_10257343 | 3300032004 | Bacteria | 1454 |
| 390 | Ga0307414_10910731 | 3300032004 | Bacteria | 806 |
| 391 | Ga0307411_10565188 | 3300032005 | Bacteria | 972 |
| 392 | Ga0307415_100135850 | 3300032126 | Bacteria | 1870 |
| 393 | Ga0307415_100137324 | 3300032126 | Bacteria | 1861 |
| 394 | Ga0395899_0000146 | 3300037312 | Bacteria | 107272 |
| 395 | Ga0395899_0012324 | 3300037312 | Bacteria | 6550 |
| 396 | Ga0395899_0060457 | 3300037312 | Bacteria | 2791 |
| 397 | Ga0395899_0112438 | 3300037312 | Bacteria | 1956 |
| 398 | Ga0395899_0127101 | 3300037312 | Bacteria | 1822 |
| 399 | Ga0395899_0212266 | 3300037312 | Bacteria | 1344 |
| 400 | Ga0395899_0762455 | 3300037312 | Bacteria | 601 |
| 401 | Ga0395900_0000272 | 3300037418 | Bacteria | 78624 |
| 402 | Ga0395900_0000706 | 3300037418 | Bacteria | 44517 |
| 403 | Ga0395900_0005525 | 3300037418 | Bacteria | 13238 |
| 404 | Ga0395900_0156726 | 3300037418 | Bacteria | 2325 |
| 405 | Ga0395900_0180956 | 3300037418 | Bacteria | 2142 |
| 406 | Ga0395900_0211976 | 3300037418 | Bacteria | 1956 |
| 407 | Ga0395898_0000329 | 3300037466 | Bacteria | 107288 |
| 408 | Ga0395898_0000387 | 3300037466 | Bacteria | 96473 |
| 409 | Ga0395898_0006340 | 3300037466 | Bacteria | 12645 |
| 410 | Ga0395898_0051318 | 3300037466 | Bacteria | 4034 |
| 411 | Ga0395898_0100309 | 3300037466 | Bacteria | 2780 |
| 412 | Ga0395898_0117860 | 3300037466 | Bacteria | 2543 |
| 413 | Ga0395898_0516582 | 3300037466 | Bacteria | 1135 |
| 414 | Ga0395898_0747058 | 3300037466 | Bacteria | 920 |
| 415 | Ga0395905_1057310 | 3300037471 | Bacteria | 715 |
| 416 | Ga0395905_1168933 | 3300037471 | Bacteria | 673 |
| 417 | Ga0395905_1462927 | 3300037471 | Bacteria | 587 |
| 418 | Ga0395901_0080818 | 3300038443 | Bacteria | 3394 |
| 419 | Ga0395901_0086604 | 3300038443 | Bacteria | 3275 |
| 420 | Ga0395901_0100329 | 3300038443 | Bacteria | 3036 |
| 421 | Ga0395901_0114438 | 3300038443 | Bacteria | 2833 |
| 422 | Ga0395901_0178598 | 3300038443 | Bacteria | 2226 |
| 423 | Ga0395901_0265101 | 3300038443 | Bacteria | 1787 |
| 424 | Ga0395901_0574668 | 3300038443 | Bacteria | 1139 |
| 425 | Ga0237819_00236 | 3300038705 | Bacteria | 20281 |
| 426 | Ga0439436_0005936 | 3300041404 | Bacteria | 3744 |
| 427 | Ga0439436_0057950 | 3300041404 | Bacteria | 1086 |
| 428 | Ga0439439_0042318 | 3300041406 | Bacteria | 1183 |
| 429 | Ga0439439_0128463 | 3300041406 | Bacteria | 711 |
| 430 | Ga0439465_0347867 | 3300041413 | Bacteria | 559 |
| 431 | Ga0451787_607498 | 3300041441 | Bacteria | 1178 |
| 432 | Ga0451791_1078979 | 3300041451 | Bacteria | 1671 |
| 433 | Ga0451791_1601619 | 3300041451 | Bacteria | 795 |
| 434 | Ga0451793_0499790 | 3300041452 | Bacteria | 1088 |
| 435 | Ga0451793_0935961 | 3300041452 | Bacteria | 749 |
| 436 | Ga0451793_1186641 | 3300041452 | Bacteria | 1020 |
| 437 | Ga0451797_0296971 | 3300041453 | Bacteria | 3358 |
| 438 | Ga0451797_0309277 | 3300041453 | Bacteria | 764 |
| 439 | Ga0451797_0487859 | 3300041453 | Bacteria | 616 |
| 440 | Ga0451800_0738262 | 3300041459 | Bacteria | 8638 |
| 441 | Ga0451800_1647684 | 3300041459 | Bacteria | 741 |
| 442 | Ga0451802_1263235 | 3300041460 | Bacteria | 1452 |
| 443 | Ga0451802_1631226 | 3300041460 | Bacteria | 520 |
| 444 | Ga0451806_250174 | 3300041462 | Bacteria | 1150 |
| 445 | Ga0451804_0352159 | 3300041463 | Bacteria | 687 |
| 446 | Ga0451804_0831922 | 3300041463 | Bacteria | 8128 |
| 447 | Ga0451807_0161263 | 3300041486 | Bacteria | 799 |
| 448 | Ga0451807_0330082 | 3300041486 | Bacteria | 574 |
| 449 | Ga0451807_0683873 | 3300041486 | Bacteria | 522 |
| 450 | Ga0451807_1108932 | 3300041486 | Bacteria | 8511 |
| 451 | Ga0451807_1270057 | 3300041486 | Bacteria | 613 |
| 452 | Ga0451807_2641394 | 3300041486 | Bacteria | 515 |
| 453 | Ga0451833_1485257 | 3300041491 | Bacteria | 702 |
| 454 | Ga0451837_0563368 | 3300041494 | Bacteria | 570 |
| 455 | Ga0451837_1261700 | 3300041494 | Bacteria | 789 |
| 456 | Ga0451839_1008954 | 3300041496 | Bacteria | 920 |
| 457 | Ga0451843_0940890 | 3300041509 | Bacteria | 513 |
| 458 | Ga0451843_1204386 | 3300041509 | Bacteria | 562 |
| 459 | Ga0451843_1305810 | 3300041509 | Bacteria | 1565 |
| 460 | Ga0451843_1349917 | 3300041509 | Bacteria | 575 |
| 461 | Ga0451853_2568479 | 3300041512 | Bacteria | 668 |
| 462 | Ga0451853_2783524 | 3300041512 | Bacteria | 1095 |
| 463 | Ga0451853_3065596 | 3300041512 | Bacteria | 2237 |
| 464 | Ga0439431_0024710 | 3300041997 | Bacteria | 1464 |
| 465 | Ga0439433_0013143 | 3300041999 | Bacteria | 1818 |
| 466 | Ga0439433_0014237 | 3300041999 | Bacteria | 1751 |
| 467 | Ga0439433_0052184 | 3300041999 | Bacteria | 966 |
| 468 | Ga0439445_0181258 | 3300042004 | Bacteria | 619 |
| 469 | Ga0439448_0022066 | 3300042005 | Bacteria | 1976 |
| 470 | Ga0439432_048250 | 3300042006 | Bacteria | 1334 |
| 471 | Ga0439432_058718 | 3300042006 | Bacteria | 1189 |
| 472 | Ga0439432_061618 | 3300042006 | Bacteria | 1156 |
| 473 | Ga0439432_125989 | 3300042006 | Bacteria | 757 |
| 474 | Ga0439449_0004794 | 3300042007 | Bacteria | 5219 |
| 475 | Ga0439449_0006005 | 3300042007 | Bacteria | 4638 |
| 476 | Ga0439449_0023675 | 3300042007 | Bacteria | 2296 |
| 477 | Ga0439449_0044505 | 3300042007 | Bacteria | 1646 |
| 478 | Ga0439449_0062623 | 3300042007 | Bacteria | 1372 |
| 479 | Ga0439449_0212730 | 3300042007 | Bacteria | 724 |
| 480 | Ga0439455_0104683 | 3300042012 | Bacteria | 784 |
| 481 | Ga0439457_036129 | 3300042014 | Bacteria | 1099 |
| 482 | Ga0439462_0011336 | 3300042015 | Bacteria | 2269 |
| 483 | Ga0439462_0036505 | 3300042015 | Bacteria | 1308 |
| 484 | Ga0439462_0054119 | 3300042015 | Bacteria | 1081 |
| 485 | Ga0450905_000985 | 3300042142 | Bacteria | 3567 |
| 486 | Ga0439434_0036439 | 3300042435 | Bacteria | 1505 |
| 487 | Ga0451577_0004886 | 3300042876 | Bacteria | 13970 |
| 488 | Ga0466969_0042827 | 3300044656 | Bacteria | 2257 |
| 489 | Ga0466969_0044980 | 3300044656 | Bacteria | 2193 |
| 490 | Ga0466969_0068577 | 3300044656 | Bacteria | 1708 |
| 491 | Ga0466969_0123395 | 3300044656 | Bacteria | 1205 |
| 492 | Ga0466972_0120151 | 3300044658 | Bacteria | 1239 |
| 493 | Ga0466975_0328806 | 3300044661 | Bacteria | 969 |
| 494 | Ga0466989_0052329 | 3300044663 | Bacteria | 2498 |
| 495 | Ga0466982_0000238 | 3300044672 | Bacteria | 14645 |
| 496 | Ga0466965_0057434 | 3300044683 | Bacteria | 1939 |
| 497 | Ga0466965_0245410 | 3300044683 | Bacteria | 959 |
| 498 | Ga0466966_0025895 | 3300044684 | Bacteria | 3831 |
| 499 | Ga0466966_0055894 | 3300044684 | Bacteria | 2497 |
| 500 | Ga0466966_0112713 | 3300044684 | Bacteria | 1675 |
| 501 | Ga0466966_0168758 | 3300044684 | Bacteria | 1330 |
| 502 | Ga0466961_0000454 | 3300044693 | Bacteria | 26030 |
| 503 | Ga0466961_0002186 | 3300044693 | Bacteria | 12157 |
| 504 | Ga0466961_0003288 | 3300044693 | Bacteria | 10070 |
| 505 | Ga0466961_0029207 | 3300044693 | Bacteria | 3545 |
| 506 | Ga0466961_0151176 | 3300044693 | Bacteria | 1449 |
| 507 | Ga0466961_0309044 | 3300044693 | Bacteria | 965 |
| 508 | Ga0466963_0110736 | 3300044694 | Bacteria | 1885 |
| 509 | Ga0466963_0345233 | 3300044694 | Bacteria | 1048 |
| 510 | Ga0466963_0390656 | 3300044694 | Bacteria | 981 |
| 511 | Ga0466964_0022882 | 3300044706 | Bacteria | 2427 |
| 512 | Ga0466964_0066792 | 3300044706 | Bacteria | 1510 |
| 513 | Ga0466964_0143546 | 3300044706 | Bacteria | 1100 |
| 514 | Ga0453684_0279891 | 3300044712 | Bacteria | 1903 |
| 515 | Ga0466971_0009727 | 3300044719 | Bacteria | 4197 |
| 516 | Ga0466971_0050142 | 3300044719 | Bacteria | 1878 |
| 517 | Ga0466971_0083049 | 3300044719 | Bacteria | 1462 |
| 518 | Ga0466968_0086903 | 3300044735 | Bacteria | 1380 |
| 519 | Ga0466968_0331966 | 3300044735 | Bacteria | 736 |
| 520 | Ga0466970_0003933 | 3300044765 | Bacteria | 7282 |
| 521 | Ga0466970_0014932 | 3300044765 | Bacteria | 3992 |
| 522 | Ga0466970_0169208 | 3300044765 | Bacteria | 1210 |
| 523 | Ga0466957_0004779 | 3300044842 | Bacteria | 7582 |
| 524 | Ga0466957_0345444 | 3300044842 | Bacteria | 1008 |
| 525 | Ga0466957_0775841 | 3300044842 | Bacteria | 680 |
| 526 | Ga0466957_0964500 | 3300044842 | Bacteria | 611 |
| 527 | Ga0466959_0073069 | 3300045049 | Bacteria | 2481 |
| 528 | Ga0466959_0148968 | 3300045049 | Bacteria | 1650 |
| 529 | Ga0466959_0150644 | 3300045049 | Bacteria | 1640 |
| 530 | Ga0466959_0173452 | 3300045049 | Bacteria | 1511 |
| 531 | Ga0466959_0216063 | 3300045049 | Bacteria | 1331 |
| 532 | Ga0466959_0744362 | 3300045049 | Bacteria | 656 |
| 533 | Ga0466958_0050066 | 3300045836 | Bacteria | 2529 |
| 534 | Ga0466958_0075745 | 3300045836 | Bacteria | 2064 |
| 535 | Ga0466958_0089371 | 3300045836 | Bacteria | 1904 |
| 536 | Ga0466958_0115612 | 3300045836 | Bacteria | 1676 |
| 537 | Ga0466967_0212702 | 3300045976 | Bacteria | 1834 |
| 538 | Ga0466967_0938100 | 3300045976 | Bacteria | 861 |
| 539 | Ga0495638_0000081 | 3300046460 | Bacteria | 155203 |
| 540 | Ga0495638_0000127 | 3300046460 | Bacteria | 123576 |
| 541 | Ga0495638_0000275 | 3300046460 | Bacteria | 69671 |
| 542 | Ga0495638_0286280 | 3300046460 | Bacteria | 893 |
| 543 | Ga0495638_0292617 | 3300046460 | Bacteria | 880 |
| 544 | Ga0495650_0000409 | 3300046471 | Bacteria | 70670 |
| 545 | Ga0495650_0145613 | 3300046471 | Bacteria | 854 |
| 546 | Ga0495605_0144241 | 3300046474 | Bacteria | 1066 |
| 547 | Ga0495607_0082582 | 3300046501 | Bacteria | 1762 |
| 548 | Ga0495606_0001687 | 3300046507 | Bacteria | 28517 |
| 549 | Ga0495606_0017638 | 3300046507 | Bacteria | 5387 |
| 550 | Ga0495616_0021918 | 3300046513 | Bacteria | 3453 |
| 551 | Ga0495616_0031168 | 3300046513 | Bacteria | 2795 |
| 552 | Ga0495643_0166093 | 3300046522 | Bacteria | 1082 |
| 553 | Ga0495663_0002500 | 3300046525 | Bacteria | 5524 |
| 554 | Ga0495663_0213148 | 3300046525 | Bacteria | 677 |
| 555 | Ga0495654_0393459 | 3300046530 | Bacteria | 551 |
| 556 | Ga0495598_0011752 | 3300046537 | Bacteria | 2130 |
| 557 | Ga0495598_0055897 | 3300046537 | Bacteria | 1203 |
| 558 | Ga0495621_0000158 | 3300046539 | Bacteria | 15042 |
| 559 | Ga0495621_0007280 | 3300046539 | Bacteria | 3271 |
| 560 | Ga0495621_0132257 | 3300046539 | Bacteria | 971 |
| 561 | Ga0495633_0024292 | 3300046558 | Bacteria | 2996 |
| 562 | Ga0495633_0314442 | 3300046558 | Bacteria | 711 |
| 563 | Ga0495656_0031151 | 3300046615 | Bacteria | 2161 |
| 564 | Ga0495656_0037849 | 3300046615 | Bacteria | 1995 |
| 565 | Ga0495625_0108062 | 3300046660 | Bacteria | 1903 |
| 566 | Ga0495625_0254744 | 3300046660 | Bacteria | 1138 |
| 567 | Ga0495659_0171417 | 3300046664 | Bacteria | 880 |
| 568 | Ga0495670_0040546 | 3300046691 | Bacteria | 2322 |
| 569 | Ga0495670_0239982 | 3300046691 | Bacteria | 965 |
| 570 | Ga0495671_0053288 | 3300046692 | Bacteria | 2008 |
| 571 | Ga0495649_0017115 | 3300046694 | Bacteria | 4097 |
| 572 | Ga0495660_0244951 | 3300046810 | Bacteria | 834 |
| 573 | Ga0495636_0114366 | 3300047318 | Bacteria | 1189 |
| 574 | Ga0495636_0115863 | 3300047318 | Bacteria | 1182 |
| 575 | Ga0495636_0232019 | 3300047318 | Bacteria | 849 |
| 576 | Ga0495681_0029027 | 3300047470 | Bacteria | 2837 |
| 577 | Ga0495686_0014996 | 3300047472 | Bacteria | 5312 |
| 578 | Ga0496101_0020503 | 3300048904 | Bacteria | 4528 |
| 579 | Ga0496101_0025773 | 3300048904 | Bacteria | 4082 |
| 580 | Ga0496101_0797256 | 3300048904 | Bacteria | 745 |
| 581 | Ga0496104_0187426 | 3300048907 | Bacteria | 1980 |
| 582 | Ga0496104_0287955 | 3300048907 | Bacteria | 1555 |
| 583 | Ga0496104_0649075 | 3300048907 | Bacteria | 964 |
| 584 | Ga0496105_0012987 | 3300048908 | Bacteria | 6598 |
| 585 | Ga0496105_0635880 | 3300048908 | Bacteria | 825 |
| 586 | Ga0496107_0048218 | 3300048910 | Bacteria | 3068 |
| 587 | Ga0496107_1293593 | 3300048910 | Bacteria | 522 |
| 588 | Ga0496108_0098974 | 3300048911 | Bacteria | 2485 |
| 589 | Ga0496108_0247334 | 3300048911 | Bacteria | 1551 |
| 590 | Ga0496109_0110210 | 3300048912 | Bacteria | 2559 |
| 591 | Ga0496109_0455885 | 3300048912 | Bacteria | 1208 |
| 592 | Ga0496109_0789428 | 3300048912 | Bacteria | 888 |
| 593 | Ga0496111_1253664 | 3300048914 | Bacteria | 524 |
| 594 | Ga0496112_0123874 | 3300048915 | Bacteria | 2556 |
| 595 | Ga0496112_0560102 | 3300048915 | Bacteria | 1076 |
| 596 | Ga0496113_0432274 | 3300048916 | Bacteria | 1057 |
| 597 | Ga0496113_0546180 | 3300048916 | Bacteria | 929 |
| 598 | Ga0496114_0297297 | 3300048917 | Bacteria | 1425 |
| 599 | Ga0496115_0000117 | 3300048918 | Bacteria | 72413 |
| 600 | Ga0496115_0000190 | 3300048918 | Bacteria | 57279 |
| 601 | Ga0496115_0004084 | 3300048918 | Bacteria | 10548 |
| 602 | Ga0496115_0043165 | 3300048918 | Bacteria | 3595 |
| 603 | Ga0496115_0157922 | 3300048918 | Bacteria | 1873 |
| 604 | Ga0496116_0051347 | 3300048919 | Bacteria | 2740 |
| 605 | Ga0496116_0261368 | 3300048919 | Bacteria | 853 |
| 606 | Ga0496117_0004489 | 3300048920 | Bacteria | 15339 |
| 607 | Ga0496117_0013031 | 3300048920 | Bacteria | 7281 |
| 608 | Ga0496117_0022259 | 3300048920 | Bacteria | 5088 |
| 609 | Ga0496118_0032824 | 3300048921 | Bacteria | 4268 |
| 610 | Ga0496118_0044969 | 3300048921 | Bacteria | 3451 |
| 611 | Ga0496118_0501017 | 3300048921 | Unclassified | 604 |
| 612 | Ga0496119_0000094 | 3300048922 | Bacteria | 130089 |
| 613 | Ga0496119_0002665 | 3300048922 | Bacteria | 19313 |
| 614 | Ga0496119_0006116 | 3300048922 | Bacteria | 11270 |
| 615 | Ga0496120_0000013 | 3300048923 | Bacteria | 331109 |
| 616 | Ga0496120_0001298 | 3300048923 | Bacteria | 31048 |
| 617 | Ga0496120_0018926 | 3300048923 | Bacteria | 4422 |
| 618 | Ga0496121_0000630 | 3300048924 | Bacteria | 65787 |
| 619 | Ga0496121_0027144 | 3300048924 | Bacteria | 5366 |
| 620 | Ga0496121_0032433 | 3300048924 | Bacteria | 4747 |
| 621 | Ga0496121_0585529 | 3300048924 | Bacteria | 691 |
| 622 | Ga0496122_0000379 | 3300048925 | Bacteria | 95139 |
| 623 | Ga0496122_0065289 | 3300048925 | Bacteria | 2640 |
| 624 | Ga0496123_0003291 | 3300048926 | Bacteria | 18304 |
| 625 | Ga0496124_0006411 | 3300048927 | Bacteria | 12827 |
| 626 | Ga0496124_0065842 | 3300048927 | Bacteria | 3020 |
| 627 | Ga0496125_0001082 | 3300048928 | Bacteria | 41965 |
| 628 | Ga0496125_0169769 | 3300048928 | Bacteria | 1468 |
| 629 | Ga0496126_0001676 | 3300048929 | Bacteria | 33222 |
| 630 | Ga0496126_0014304 | 3300048929 | Bacteria | 8028 |
| 631 | Ga0496126_0049035 | 3300048929 | Bacteria | 3856 |
| 632 | Ga0496126_0068561 | 3300048929 | Bacteria | 3166 |
| 633 | Ga0496126_0612825 | 3300048929 | Bacteria | 856 |
| 634 | Ga0496126_0791827 | 3300048929 | Bacteria | 728 |
| 635 | Ga0495678_046559 | 3300049459 | Bacteria | 1703 |
| 636 | Ga0495678_096185 | 3300049459 | Bacteria | 1034 |
| 637 | Ga0501031_0259915 | 3300049568 | Bacteria | 1128 |
| 638 | Ga0501032_0009975 | 3300049569 | Bacteria | 6859 |
| 639 | Ga0501032_0067653 | 3300049569 | Bacteria | 2386 |
| 640 | Ga0501032_0252333 | 3300049569 | Bacteria | 1145 |
| 641 | Ga0501033_0003839 | 3300049570 | Bacteria | 12218 |
| 642 | Ga0501034_0009841 | 3300049571 | Bacteria | 9996 |
| 643 | Ga0501034_0011634 | 3300049571 | Bacteria | 9110 |
| 644 | Ga0501034_0249743 | 3300049571 | Bacteria | 1718 |
| 645 | Ga0501034_0299721 | 3300049571 | Bacteria | 1544 |
| 646 | Ga0501034_0519096 | 3300049571 | Bacteria | 1103 |
| 647 | Ga0501036_0008146 | 3300049572 | Bacteria | 8589 |
| 648 | Ga0501036_0643676 | 3300049572 | Bacteria | 878 |
| 649 | Ga0501037_0413684 | 3300049573 | Bacteria | 924 |
| 650 | Ga0501038_0000610 | 3300049574 | Bacteria | 31817 |
| 651 | Ga0501039_0275574 | 3300049575 | Bacteria | 1322 |
| 652 | Ga0501039_0361831 | 3300049575 | Bacteria | 1140 |
| 653 | Ga0501043_0027305 | 3300049579 | Bacteria | 4482 |
| 654 | Ga0501043_0037923 | 3300049579 | Bacteria | 3791 |
| 655 | Ga0501047_0027284 | 3300049581 | Bacteria | 5501 |
| 656 | Ga0501047_0146890 | 3300049581 | Bacteria | 2234 |
| 657 | Ga0501047_0183554 | 3300049581 | Bacteria | 1958 |
| 658 | Ga0501047_1303742 | 3300049581 | Bacteria | 540 |
| 659 | Ga0501068_0050100 | 3300049584 | Bacteria | 2524 |
| 660 | Ga0501070_0753061 | 3300049586 | Bacteria | 767 |
| 661 | Ga0501071_0544692 | 3300049587 | Bacteria | 891 |
| 662 | Ga0501202_021938 | 3300049652 | Bacteria | 1280 |
| 663 | Ga0501206_030139 | 3300049653 | Bacteria | 804 |
| 664 | Ga0501216_070147 | 3300049660 | Bacteria | 723 |
| 665 | Ga0501217_106725 | 3300049661 | Bacteria | 801 |
| 666 | Ga0501223_027230 | 3300049663 | Bacteria | 1112 |
| 667 | Ga0501239_023745 | 3300049672 | Bacteria | 769 |
| 668 | Ga0501250_034087 | 3300049680 | Bacteria | 720 |
| 669 | Ga0501252_090248 | 3300049682 | Bacteria | 518 |
| 670 | Ga0501221_180543 | 3300049704 | Bacteria | 577 |
| 671 | Ga0501225_0026305 | 3300049705 | Bacteria | 1600 |
| 672 | Ga0501245_085779 | 3300049708 | Bacteria | 616 |
| 673 | Ga0501079_0900908 | 3300049741 | Bacteria | 697 |
| 674 | Ga0501080_0031762 | 3300049742 | Bacteria | 4920 |
| 675 | Ga0501241_107096 | 3300049758 | Bacteria | 608 |
| 676 | Ga0501263_002926 | 3300049760 | Bacteria | 1787 |
| 677 | Ga0501268_003743 | 3300049765 | Bacteria | 2103 |
| 678 | Ga0501268_027823 | 3300049765 | Bacteria | 1007 |
| 679 | Ga0501273_072832 | 3300049770 | Bacteria | 560 |
| 680 | Ga0501035_0005516 | 3300049822 | Bacteria | 11954 |
| 681 | Ga0501035_0269998 | 3300049822 | Bacteria | 1440 |
| 682 | Ga0501035_0289660 | 3300049822 | Bacteria | 1382 |
| 683 | Ga0501035_0330786 | 3300049822 | Bacteria | 1278 |
| 684 | Ga0501035_1420250 | 3300049822 | Bacteria | 531 |
| 685 | Ga0501044_0101688 | 3300049823 | Bacteria | 2891 |
| 686 | Ga0501044_0119435 | 3300049823 | Bacteria | 2638 |
| 687 | Ga0501044_0384203 | 3300049823 | Bacteria | 1319 |
| 688 | Ga0501044_0803523 | 3300049823 | Bacteria | 820 |
| 689 | Ga0501044_1081809 | 3300049823 | Bacteria | 672 |
| 690 | nmdc:mga03n38_667452_c1 | 3300050490 | Bacteria | 597 |
| 691 | nmdc:mga03n38_820072_c1 | 3300050490 | Bacteria | 543 |
| 692 | nmdc:mga00v17_3525_c1 | 3300050491 | Bacteria | 8086 |
| 693 | nmdc:mga06r32_850470_c1 | 3300050510 | Bacteria | 871 |
| 694 | Ga0500600_0152172 | 3300053149 | Bacteria | 1149 |
| 695 | Ga0500622_0189400 | 3300053156 | Bacteria | 944 |
| 696 | Ga0500634_0000111 | 3300053161 | Bacteria | 30297 |
| 697 | Ga0500611_091189 | 3300053727 | Bacteria | 776 |
| 698 | Ga0500565_010275 | 3300053734 | Bacteria | 952 |
| 699 | Ga0466962_0020737 | 3300061719 | Bacteria | 3158 |
| 700 | Ga0466962_0056725 | 3300061719 | Bacteria | 1870 |
| 701 | Ga0466962_0063464 | 3300061719 | Bacteria | 1763 |
| 702 | Ga0466962_0094702 | 3300061719 | Bacteria | 1431 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2687453130 | 2687581366 | 102 |
| 2 | iso_pu_bacteria | 2739367700 | 2739733644 | 102 |
| 3 | iso_pu_bacteria | 2884411467 | 2884411849 | 102 |
| 4 | iso_pu_bacteria | 2928963466 | 2928966167 | 102 |
| 5 | 3300026067 | Ga0207678_10066833 | Ga0207678_100668333 | 103 |
| 6 | 3300005327 | Ga0070658_10096605 | Ga0070658_100966053 | 104 |
| 7 | 3300005329 | Ga0070683_101483383 | Ga0070683_1014833832 | 104 |
| 8 | 3300005331 | Ga0070670_100115474 | Ga0070670_1001154742 | 104 |
| 9 | 3300005336 | Ga0070680_101853441 | Ga0070680_1018534411 | 104 |
| 10 | 3300005339 | Ga0070660_100030951 | Ga0070660_1000309514 | 104 |
| 11 | 3300005339 | Ga0070660_101642800 | Ga0070660_1016428001 | 104 |
| 12 | 3300005343 | Ga0070687_100538828 | Ga0070687_1005388282 | 104 |
| 13 | 3300005344 | Ga0070661_101369120 | Ga0070661_1013691201 | 104 |
| 14 | 3300005347 | Ga0070668_102080038 | Ga0070668_1020800381 | 104 |
| 15 | 3300005353 | Ga0070669_100081991 | Ga0070669_1000819912 | 104 |
| 16 | 3300005354 | Ga0070675_101265473 | Ga0070675_1012654731 | 104 |
| 17 | 3300005354 | Ga0070675_101279379 | Ga0070675_1012793792 | 104 |
| 18 | 3300005355 | Ga0070671_100351778 | Ga0070671_1003517781 | 104 |
| 19 | 3300005356 | Ga0070674_100258178 | Ga0070674_1002581782 | 104 |
| 20 | 3300005364 | Ga0070673_100401476 | Ga0070673_1004014762 | 104 |
| 21 | 3300005366 | Ga0070659_101520039 | Ga0070659_1015200392 | 104 |
| 22 | 3300005367 | Ga0070667_101840776 | Ga0070667_1018407761 | 104 |
| 23 | 3300005457 | Ga0070662_101052018 | Ga0070662_1010520182 | 104 |
| 24 | 3300005458 | Ga0070681_11007685 | Ga0070681_110076852 | 104 |
| 25 | 3300005530 | Ga0070679_100146755 | Ga0070679_1001467553 | 104 |
| 26 | 3300005543 | Ga0070672_100005743 | Ga0070672_1000057434 | 104 |
| 27 | 3300005548 | Ga0070665_102388953 | Ga0070665_1023889532 | 104 |
| 28 | 3300005563 | Ga0068855_101577595 | Ga0068855_1015775952 | 104 |
| 29 | 3300005564 | Ga0070664_100210219 | Ga0070664_1002102192 | 104 |
| 30 | 3300005564 | Ga0070664_100457157 | Ga0070664_1004571572 | 104 |
| 31 | 3300005564 | Ga0070664_101243865 | Ga0070664_1012438652 | 104 |
| 32 | 3300005616 | Ga0068852_100901881 | Ga0068852_1009018812 | 104 |
| 33 | 3300005616 | Ga0068852_101418060 | Ga0068852_1014180601 | 104 |
| 34 | 3300009176 | Ga0105242_11736573 | Ga0105242_117365731 | 104 |
| 35 | 3300013100 | Ga0157373_10028254 | Ga0157373_100282544 | 104 |
| 36 | 3300013102 | Ga0157371_10066305 | Ga0157371_100663052 | 104 |
| 37 | 3300013104 | Ga0157370_10624369 | Ga0157370_106243692 | 104 |
| 38 | 3300013105 | Ga0157369_10020750 | Ga0157369_100207507 | 104 |
| 39 | 3300013307 | Ga0157372_10303041 | Ga0157372_103030412 | 104 |
| 40 | 3300013307 | Ga0157372_10431109 | Ga0157372_104311093 | 104 |
| 41 | 3300013308 | Ga0157375_10158743 | Ga0157375_101587433 | 104 |
| 42 | 3300017792 | Ga0163161_10338107 | Ga0163161_103381072 | 104 |
| 43 | 3300025899 | Ga0207642_10325457 | Ga0207642_103254572 | 104 |
| 44 | 3300025908 | Ga0207643_10661549 | Ga0207643_106615491 | 104 |
| 45 | 3300025917 | Ga0207660_11047306 | Ga0207660_110473062 | 104 |
| 46 | 3300025918 | Ga0207662_10629092 | Ga0207662_106290922 | 104 |
| 47 | 3300025919 | Ga0207657_10011830 | Ga0207657_100118307 | 104 |
| 48 | 3300025919 | Ga0207657_10140190 | Ga0207657_101401903 | 104 |
| 49 | 3300025921 | Ga0207652_10339288 | Ga0207652_103392882 | 104 |
| 50 | 3300025923 | Ga0207681_10125182 | Ga0207681_101251822 | 104 |
| 51 | 3300025925 | Ga0207650_10476465 | Ga0207650_104764652 | 104 |
| 52 | 3300025926 | Ga0207659_10392983 | Ga0207659_103929832 | 104 |
| 53 | 3300025931 | Ga0207644_10491218 | Ga0207644_104912182 | 104 |
| 54 | 3300025933 | Ga0207706_10316533 | Ga0207706_103165332 | 104 |
| 55 | 3300025933 | Ga0207706_10487466 | Ga0207706_104874662 | 104 |
| 56 | 3300025934 | Ga0207686_10964471 | Ga0207686_109644711 | 104 |
| 57 | 3300025937 | Ga0207669_10230593 | Ga0207669_102305932 | 104 |
| 58 | 3300025940 | Ga0207691_10131251 | Ga0207691_101312513 | 104 |
| 59 | 3300025945 | Ga0207679_10067364 | Ga0207679_100673642 | 104 |
| 60 | 3300025945 | Ga0207679_10087256 | Ga0207679_100872562 | 104 |
| 61 | 3300025945 | Ga0207679_10326218 | Ga0207679_103262182 | 104 |
| 62 | 3300025960 | Ga0207651_10091042 | Ga0207651_100910423 | 104 |
| 63 | 3300026089 | Ga0207648_10165160 | Ga0207648_101651601 | 104 |
| 64 | 3300026116 | Ga0207674_10733770 | Ga0207674_107337702 | 104 |
| 65 | 3300026121 | Ga0207683_10244072 | Ga0207683_102440722 | 104 |
| 66 | 3300026142 | Ga0207698_10801184 | Ga0207698_108011842 | 104 |
| 67 | 3300037418 | Ga0395900_0180956 | Ga0395900_0180956_336_650 | 104 |
| 68 | 3300037466 | Ga0395898_0747058 | Ga0395898_0747058_306_620 | 104 |
| 69 | 3300037471 | Ga0395905_1168933 | Ga0395905_1168933_22_345 | 104 |
| 70 | 3300042006 | Ga0439432_061618 | Ga0439432_061618_571_885 | 104 |
| 71 | 3300042007 | Ga0439449_0044505 | Ga0439449_0044505_189_503 | 104 |
| 72 | 3300042012 | Ga0439455_0104683 | Ga0439455_0104683_302_625 | 104 |
| 73 | 3300046537 | Ga0495598_0011752 | Ga0495598_0011752_462_776 | 104 |
| 74 | 3300046539 | Ga0495621_0132257 | Ga0495621_0132257_262_576 | 104 |
| 75 | 3300048912 | Ga0496109_0789428 | Ga0496109_0789428_81_395 | 104 |
| 76 | 3300048914 | Ga0496111_1253664 | Ga0496111_1253664_174_488 | 104 |
| 77 | 3300001989 | JGI24739J22299_10002511 | JGI24739J22299_100025112 | 105 |
| 78 | 3300001990 | JGI24737J22298_10000898 | JGI24737J22298_100008989 | 105 |
| 79 | 3300001990 | JGI24737J22298_10012164 | JGI24737J22298_100121643 | 105 |
| 80 | 3300002067 | JGI24735J21928_10015344 | JGI24735J21928_100153445 | 105 |
| 81 | 3300002705 | JGI25156J39149_1002031 | JGI25156J39149_10020313 | 105 |
| 82 | 3300002705 | JGI25156J39149_1005020 | JGI25156J39149_10050202 | 105 |
| 83 | 3300002737 | JGI25162J39368_1000585 | JGI25162J39368_10005852 | 105 |
| 84 | 3300002737 | JGI25162J39368_1001345 | JGI25162J39368_10013452 | 105 |
| 85 | 3300002737 | JGI25162J39368_1001632 | JGI25162J39368_10016328 | 105 |
| 86 | 3300002741 | JGI25157J39369_1000258 | JGI25157J39369_100025834 | 105 |
| 87 | 3300002741 | JGI25157J39369_1000906 | JGI25157J39369_10009069 | 105 |
| 88 | 3300002741 | JGI25157J39369_1001632 | JGI25157J39369_10016323 | 105 |
| 89 | 3300002771 | JGI25163J39215_1000475 | JGI25163J39215_10004758 | 105 |
| 90 | 3300002772 | JGI25164J39214_1000004 | JGI25164J39214_1000004304 | 105 |
| 91 | 3300002772 | JGI25164J39214_1000677 | JGI25164J39214_10006772 | 105 |
| 92 | 3300003214 | JGI25165J46597_1000164 | JGI25165J46597_100016498 | 105 |
| 93 | 3300003214 | JGI25165J46597_1001357 | JGI25165J46597_10013572 | 105 |
| 94 | 3300003316 | rootH1_10021424 | rootH1_100214243 | 105 |
| 95 | 3300003320 | rootH2_10043016 | rootH2_100430163 | 105 |
| 96 | 3300003320 | rootH2_10189554 | rootH2_101895543 | 105 |
| 97 | 3300003322 | rootL2_10138739 | rootL2_101387393 | 105 |
| 98 | 3300003323 | rootH1_10190495 | rootH1_101904952 | 105 |
| 99 | 3300003751 | Ga0055538_1003048 | Ga0055538_10030481 | 105 |
| 100 | 3300003752 | Ga0055539_1001206 | Ga0055539_10012065 | 105 |
| 101 | 3300003756 | Ga0055533_1002415 | Ga0055533_10024154 | 105 |
| 102 | 3300003756 | Ga0055533_1005491 | Ga0055533_10054912 | 105 |
| 103 | 3300003759 | Ga0055525_1000293 | Ga0055525_100029338 | 105 |
| 104 | 3300003760 | Ga0055527_1000070 | Ga0055527_10000704 | 105 |
| 105 | 3300003760 | Ga0055527_1000077 | Ga0055527_10000772 | 105 |
| 106 | 3300003760 | Ga0055527_1016305 | Ga0055527_10163051 | 105 |
| 107 | 3300003761 | Ga0055535_1000117 | Ga0055535_10001174 | 105 |
| 108 | 3300003761 | Ga0055535_1000130 | Ga0055535_100013078 | 105 |
| 109 | 3300003761 | Ga0055535_1001093 | Ga0055535_10010932 | 105 |
| 110 | 3300003761 | Ga0055535_1001283 | Ga0055535_10012839 | 105 |
| 111 | 3300003761 | Ga0055535_1001578 | Ga0055535_10015783 | 105 |
| 112 | 3300003761 | Ga0055535_1011473 | Ga0055535_10114731 | 105 |
| 113 | 3300003761 | Ga0055535_1028561 | Ga0055535_10285612 | 105 |
| 114 | 3300003762 | Ga0055542_1000156 | Ga0055542_100015683 | 105 |
| 115 | 3300003762 | Ga0055542_1000174 | Ga0055542_100017478 | 105 |
| 116 | 3300003762 | Ga0055542_1000184 | Ga0055542_10001842 | 105 |
| 117 | 3300003762 | Ga0055542_1001071 | Ga0055542_10010713 | 105 |
| 118 | 3300003762 | Ga0055542_1001086 | Ga0055542_100108612 | 105 |
| 119 | 3300003762 | Ga0055542_1001273 | Ga0055542_10012732 | 105 |
| 120 | 3300003763 | Ga0055529_1000102 | Ga0055529_1000102124 | 105 |
| 121 | 3300003763 | Ga0055529_1000201 | Ga0055529_100020178 | 105 |
| 122 | 3300003763 | Ga0055529_1000353 | Ga0055529_100035346 | 105 |
| 123 | 3300003763 | Ga0055529_1001006 | Ga0055529_10010062 | 105 |
| 124 | 3300003773 | Ga0055537_1000572 | Ga0055537_100057211 | 105 |
| 125 | 3300003775 | Ga0055524_1000393 | Ga0055524_100039327 | 105 |
| 126 | 3300003784 | Ga0055534_1000527 | Ga0055534_100052711 | 105 |
| 127 | 3300003790 | Ga0055528_1000855 | Ga0055528_100085511 | 105 |
| 128 | 3300005262 | Ga0065165_1002561 | Ga0065165_10025612 | 105 |
| 129 | 3300005331 | Ga0070670_101505316 | Ga0070670_1015053161 | 105 |
| 130 | 3300005337 | Ga0070682_101406370 | Ga0070682_1014063702 | 105 |
| 131 | 3300005340 | Ga0070689_100003754 | Ga0070689_1000037548 | 105 |
| 132 | 3300005344 | Ga0070661_100217132 | Ga0070661_1002171322 | 105 |
| 133 | 3300005355 | Ga0070671_100101724 | Ga0070671_1001017243 | 105 |
| 134 | 3300005365 | Ga0070688_100067733 | Ga0070688_1000677332 | 105 |
| 135 | 3300005436 | Ga0070713_101934787 | Ga0070713_1019347871 | 105 |
| 136 | 3300005455 | Ga0070663_100051543 | Ga0070663_1000515433 | 105 |
| 137 | 3300005455 | Ga0070663_100232870 | Ga0070663_1002328702 | 105 |
| 138 | 3300005455 | Ga0070663_100246127 | Ga0070663_1002461273 | 105 |
| 139 | 3300005458 | Ga0070681_10579391 | Ga0070681_105793912 | 105 |
| 140 | 3300005466 | Ga0070685_10020697 | Ga0070685_100206972 | 105 |
| 141 | 3300005539 | Ga0068853_100640281 | Ga0068853_1006402812 | 105 |
| 142 | 3300005548 | Ga0070665_100851210 | Ga0070665_1008512102 | 105 |
| 143 | 3300005563 | Ga0068855_100071681 | Ga0068855_1000716813 | 105 |
| 144 | 3300005563 | Ga0068855_100361813 | Ga0068855_1003618132 | 105 |
| 145 | 3300005564 | Ga0070664_100295361 | Ga0070664_1002953612 | 105 |
| 146 | 3300005577 | Ga0068857_100047656 | Ga0068857_1000476563 | 105 |
| 147 | 3300005577 | Ga0068857_100324915 | Ga0068857_1003249153 | 105 |
| 148 | 3300005578 | Ga0068854_100025861 | Ga0068854_1000258613 | 105 |
| 149 | 3300005578 | Ga0068854_100193082 | Ga0068854_1001930822 | 105 |
| 150 | 3300005614 | Ga0068856_100000909 | Ga0068856_1000009093 | 105 |
| 151 | 3300005616 | Ga0068852_100191949 | Ga0068852_1001919492 | 105 |
| 152 | 3300005617 | Ga0068859_100121970 | Ga0068859_1001219703 | 105 |
| 153 | 3300005618 | Ga0068864_102236860 | Ga0068864_1022368602 | 105 |
| 154 | 3300005834 | Ga0068851_10023851 | Ga0068851_100238513 | 105 |
| 155 | 3300005842 | Ga0068858_100071997 | Ga0068858_1000719972 | 105 |
| 156 | 3300005843 | Ga0068860_100017659 | Ga0068860_1000176594 | 105 |
| 157 | 3300005844 | Ga0068862_100378023 | Ga0068862_1003780232 | 105 |
| 158 | 3300006931 | Ga0097620_100121970 | Ga0097620_1001219703 | 105 |
| 159 | 3300009093 | Ga0105240_10053139 | Ga0105240_100531393 | 105 |
| 160 | 3300009093 | Ga0105240_10069096 | Ga0105240_100690963 | 105 |
| 161 | 3300009093 | Ga0105240_10078089 | Ga0105240_100780893 | 105 |
| 162 | 3300009093 | Ga0105240_10080210 | Ga0105240_100802103 | 105 |
| 163 | 3300009174 | Ga0105241_10259256 | Ga0105241_102592562 | 105 |
| 164 | 3300009545 | Ga0105237_10000097 | Ga0105237_1000009795 | 105 |
| 165 | 3300009545 | Ga0105237_10880354 | Ga0105237_108803542 | 105 |
| 166 | 3300009551 | Ga0105238_10248899 | Ga0105238_102488992 | 105 |
| 167 | 3300009553 | Ga0105249_11530538 | Ga0105249_115305382 | 105 |
| 168 | 3300010375 | Ga0105239_10001059 | Ga0105239_1000105928 | 105 |
| 169 | 3300010375 | Ga0105239_10171871 | Ga0105239_101718713 | 105 |
| 170 | 3300012473 | Ga0157340_1007427 | Ga0157340_10074272 | 105 |
| 171 | 3300012497 | Ga0157319_1036975 | Ga0157319_10369752 | 105 |
| 172 | 3300012498 | Ga0157345_1046811 | Ga0157345_10468112 | 105 |
| 173 | 3300012500 | Ga0157314_1000048 | Ga0157314_10000489 | 105 |
| 174 | 3300012502 | Ga0157347_1046055 | Ga0157347_10460552 | 105 |
| 175 | 3300012505 | Ga0157339_1004456 | Ga0157339_10044562 | 105 |
| 176 | 3300013100 | Ga0157373_10381905 | Ga0157373_103819052 | 105 |
| 177 | 3300013102 | Ga0157371_10522053 | Ga0157371_105220532 | 105 |
| 178 | 3300013105 | Ga0157369_10031050 | Ga0157369_100310504 | 105 |
| 179 | 3300013105 | Ga0157369_10110365 | Ga0157369_101103653 | 105 |
| 180 | 3300013105 | Ga0157369_10127335 | Ga0157369_101273352 | 105 |
| 181 | 3300013306 | Ga0163162_10762579 | Ga0163162_107625792 | 105 |
| 182 | 3300013307 | Ga0157372_10325770 | Ga0157372_103257702 | 105 |
| 183 | 3300013307 | Ga0157372_10452587 | Ga0157372_104525872 | 105 |
| 184 | 3300014325 | Ga0163163_10163739 | Ga0163163_101637392 | 105 |
| 185 | 3300014497 | Ga0182008_10231576 | Ga0182008_102315761 | 105 |
| 186 | 3300014497 | Ga0182008_10516346 | Ga0182008_105163461 | 105 |
| 187 | 3300015265 | Ga0182005_1194366 | Ga0182005_11943662 | 105 |
| 188 | 3300015685 | Ga0183369_1019 | Ga0183369_10193 | 105 |
| 189 | 3300015687 | Ga0183368_1007 | Ga0183368_1007360 | 105 |
| 190 | 3300025207 | Ga0209760_101412 | Ga0209760_1014122 | 105 |
| 191 | 3300025224 | Ga0209784_100544 | Ga0209784_1005449 | 105 |
| 192 | 3300025225 | Ga0209566_106220 | Ga0209566_1062203 | 105 |
| 193 | 3300025225 | Ga0209566_106838 | Ga0209566_1068382 | 105 |
| 194 | 3300025226 | Ga0209674_100037 | Ga0209674_1000373 | 105 |
| 195 | 3300025226 | Ga0209674_100299 | Ga0209674_10029930 | 105 |
| 196 | 3300025228 | Ga0209672_100070 | Ga0209672_1000703 | 105 |
| 197 | 3300025228 | Ga0209672_100084 | Ga0209672_1000843 | 105 |
| 198 | 3300025228 | Ga0209672_100099 | Ga0209672_1000993 | 105 |
| 199 | 3300025228 | Ga0209672_100381 | Ga0209672_10038118 | 105 |
| 200 | 3300025228 | Ga0209672_101575 | Ga0209672_1015753 | 105 |
| 201 | 3300025228 | Ga0209672_106816 | Ga0209672_1068162 | 105 |
| 202 | 3300025230 | Ga0209563_100174 | Ga0209563_1001743 | 105 |
| 203 | 3300025231 | Ga0207427_100031 | Ga0207427_1000313 | 105 |
| 204 | 3300025231 | Ga0207427_100831 | Ga0207427_1008319 | 105 |
| 205 | 3300025231 | Ga0207427_103488 | Ga0207427_1034883 | 105 |
| 206 | 3300025231 | Ga0207427_108173 | Ga0207427_1081732 | 105 |
| 207 | 3300025233 | Ga0209437_100061 | Ga0209437_100061302 | 105 |
| 208 | 3300025233 | Ga0209437_100123 | Ga0209437_100123153 | 105 |
| 209 | 3300025233 | Ga0209437_100323 | Ga0209437_10032358 | 105 |
| 210 | 3300025233 | Ga0209437_131123 | Ga0209437_1311232 | 105 |
| 211 | 3300025242 | Ga0209258_100054 | Ga0209258_100054294 | 105 |
| 212 | 3300025242 | Ga0209258_100104 | Ga0209258_100104176 | 105 |
| 213 | 3300025242 | Ga0209258_100188 | Ga0209258_100188120 | 105 |
| 214 | 3300025242 | Ga0209258_100218 | Ga0209258_1002183 | 105 |
| 215 | 3300025242 | Ga0209258_100281 | Ga0209258_10028170 | 105 |
| 216 | 3300025242 | Ga0209258_100923 | Ga0209258_10092310 | 105 |
| 217 | 3300025242 | Ga0209258_106372 | Ga0209258_1063722 | 105 |
| 218 | 3300025246 | Ga0209646_1000619 | Ga0209646_10006194 | 105 |
| 219 | 3300025246 | Ga0209646_1007923 | Ga0209646_10079232 | 105 |
| 220 | 3300025246 | Ga0209646_1012880 | Ga0209646_10128801 | 105 |
| 221 | 3300025250 | Ga0209026_1000171 | Ga0209026_100017192 | 105 |
| 222 | 3300025250 | Ga0209026_1000550 | Ga0209026_10005503 | 105 |
| 223 | 3300025250 | Ga0209026_1001022 | Ga0209026_10010229 | 105 |
| 224 | 3300025253 | Ga0209677_101680 | Ga0209677_1016803 | 105 |
| 225 | 3300025253 | Ga0209677_132389 | Ga0209677_1323891 | 105 |
| 226 | 3300025254 | Ga0209148_1000063 | Ga0209148_1000063299 | 105 |
| 227 | 3300025254 | Ga0209148_1000066 | Ga0209148_1000066294 | 105 |
| 228 | 3300025254 | Ga0209148_1000106 | Ga0209148_1000106177 | 105 |
| 229 | 3300025254 | Ga0209148_1000196 | Ga0209148_10001963 | 105 |
| 230 | 3300025254 | Ga0209148_1000252 | Ga0209148_10002522 | 105 |
| 231 | 3300025254 | Ga0209148_1001272 | Ga0209148_10012729 | 105 |
| 232 | 3300025256 | Ga0209759_1000137 | Ga0209759_1000137115 | 105 |
| 233 | 3300025256 | Ga0209759_1000487 | Ga0209759_10004874 | 105 |
| 234 | 3300025256 | Ga0209759_1001414 | Ga0209759_10014149 | 105 |
| 235 | 3300025256 | Ga0209759_1003274 | Ga0209759_10032746 | 105 |
| 236 | 3300025258 | Ga0209129_1006938 | Ga0209129_10069384 | 105 |
| 237 | 3300025261 | Ga0209233_1000076 | Ga0209233_10000763 | 105 |
| 238 | 3300025261 | Ga0209233_1000136 | Ga0209233_1000136153 | 105 |
| 239 | 3300025261 | Ga0209233_1012259 | Ga0209233_10122592 | 105 |
| 240 | 3300025263 | Ga0209565_1000001 | Ga0209565_100000111 | 105 |
| 241 | 3300025272 | Ga0209455_1000146 | Ga0209455_10001463 | 105 |
| 242 | 3300025272 | Ga0209455_1000173 | Ga0209455_10001733 | 105 |
| 243 | 3300025272 | Ga0209455_1000831 | Ga0209455_100083111 | 105 |
| 244 | 3300025272 | Ga0209455_1001041 | Ga0209455_10010419 | 105 |
| 245 | 3300025272 | Ga0209455_1008836 | Ga0209455_10088363 | 105 |
| 246 | 3300025272 | Ga0209455_1010273 | Ga0209455_10102735 | 105 |
| 247 | 3300025273 | Ga0209673_1000001 | Ga0209673_100000111 | 105 |
| 248 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000012521 | 105 |
| 249 | 3300025294 | Ga0209025_1000030 | Ga0209025_100003015 | 105 |
| 250 | 3300025294 | Ga0209025_1103958 | Ga0209025_11039582 | 105 |
| 251 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000012683 | 105 |
| 252 | 3300025297 | Ga0209758_1017138 | Ga0209758_10171382 | 105 |
| 253 | 3300025297 | Ga0209758_1019182 | Ga0209758_10191822 | 105 |
| 254 | 3300025299 | Ga0209256_1000006 | Ga0209256_10000061119 | 105 |
| 255 | 3300025321 | Ga0207656_10022662 | Ga0207656_100226622 | 105 |
| 256 | 3300025904 | Ga0207647_10003619 | Ga0207647_100036192 | 105 |
| 257 | 3300025904 | Ga0207647_10004339 | Ga0207647_100043392 | 105 |
| 258 | 3300025904 | Ga0207647_10102547 | Ga0207647_101025472 | 105 |
| 259 | 3300025911 | Ga0207654_10153932 | Ga0207654_101539322 | 105 |
| 260 | 3300025912 | Ga0207707_10317991 | Ga0207707_103179912 | 105 |
| 261 | 3300025913 | Ga0207695_10010112 | Ga0207695_100101123 | 105 |
| 262 | 3300025913 | Ga0207695_10017110 | Ga0207695_100171107 | 105 |
| 263 | 3300025913 | Ga0207695_10034917 | Ga0207695_100349175 | 105 |
| 264 | 3300025913 | Ga0207695_10058395 | Ga0207695_100583953 | 105 |
| 265 | 3300025914 | Ga0207671_10000119 | Ga0207671_1000011994 | 105 |
| 266 | 3300025920 | Ga0207649_10246167 | Ga0207649_102461672 | 105 |
| 267 | 3300025924 | Ga0207694_10210265 | Ga0207694_102102652 | 105 |
| 268 | 3300025924 | Ga0207694_10919745 | Ga0207694_109197452 | 105 |
| 269 | 3300025925 | Ga0207650_11710214 | Ga0207650_117102141 | 105 |
| 270 | 3300025931 | Ga0207644_10192433 | Ga0207644_101924332 | 105 |
| 271 | 3300025936 | Ga0207670_10002189 | Ga0207670_100021898 | 105 |
| 272 | 3300025945 | Ga0207679_10296996 | Ga0207679_102969962 | 105 |
| 273 | 3300025949 | Ga0207667_10001947 | Ga0207667_100019472 | 105 |
| 274 | 3300025949 | Ga0207667_10253217 | Ga0207667_102532172 | 105 |
| 275 | 3300025981 | Ga0207640_10003313 | Ga0207640_100033137 | 105 |
| 276 | 3300025981 | Ga0207640_10019106 | Ga0207640_100191062 | 105 |
| 277 | 3300026035 | Ga0207703_10287005 | Ga0207703_102870052 | 105 |
| 278 | 3300026067 | Ga0207678_10069102 | Ga0207678_100691023 | 105 |
| 279 | 3300026067 | Ga0207678_10102487 | Ga0207678_101024872 | 105 |
| 280 | 3300026067 | Ga0207678_10129759 | Ga0207678_101297592 | 105 |
| 281 | 3300026078 | Ga0207702_10001326 | Ga0207702_1000132619 | 105 |
| 282 | 3300026116 | Ga0207674_10001298 | Ga0207674_100012982 | 105 |
| 283 | 3300026142 | Ga0207698_10202276 | Ga0207698_102022763 | 105 |
| 284 | 3300028379 | Ga0268266_10702354 | Ga0268266_107023542 | 105 |
| 285 | 3300028380 | Ga0268265_10925022 | Ga0268265_109250222 | 105 |
| 286 | 3300028381 | Ga0268264_10121773 | Ga0268264_101217733 | 105 |
| 287 | 3300028800 | Ga0265338_10221083 | Ga0265338_102210832 | 105 |
| 288 | 3300030745 | Ga0316182_1288570 | Ga0316182_12885703 | 105 |
| 289 | 3300031548 | Ga0307408_100388434 | Ga0307408_1003884342 | 105 |
| 290 | 3300031548 | Ga0307408_100514605 | Ga0307408_1005146051 | 105 |
| 291 | 3300031824 | Ga0307413_10236922 | Ga0307413_102369222 | 105 |
| 292 | 3300031852 | Ga0307410_10092428 | Ga0307410_100924281 | 105 |
| 293 | 3300031911 | Ga0307412_10010200 | Ga0307412_100102004 | 105 |
| 294 | 3300031995 | Ga0307409_102416732 | Ga0307409_1024167321 | 105 |
| 295 | 3300032002 | Ga0307416_100392983 | Ga0307416_1003929831 | 105 |
| 296 | 3300032005 | Ga0307411_10565188 | Ga0307411_105651882 | 105 |
| 297 | 3300032126 | Ga0307415_100135850 | Ga0307415_1001358503 | 105 |
| 298 | 3300037312 | Ga0395899_0000146 | Ga0395899_0000146_105925_106248 | 105 |
| 299 | 3300037312 | Ga0395899_0012324 | Ga0395899_0012324_943_1275 | 105 |
| 300 | 3300037312 | Ga0395899_0060457 | Ga0395899_0060457_765_1088 | 105 |
| 301 | 3300037312 | Ga0395899_0112438 | Ga0395899_0112438_597_920 | 105 |
| 302 | 3300037312 | Ga0395899_0127101 | Ga0395899_0127101_1159_1482 | 105 |
| 303 | 3300037312 | Ga0395899_0212266 | Ga0395899_0212266_523_846 | 105 |
| 304 | 3300037312 | Ga0395899_0762455 | Ga0395899_0762455_109_426 | 105 |
| 305 | 3300037418 | Ga0395900_0000272 | Ga0395900_0000272_77328_77651 | 105 |
| 306 | 3300037418 | Ga0395900_0000706 | Ga0395900_0000706_43186_43509 | 105 |
| 307 | 3300037418 | Ga0395900_0005525 | Ga0395900_0005525_1113_1436 | 105 |
| 308 | 3300037418 | Ga0395900_0156726 | Ga0395900_0156726_1010_1333 | 105 |
| 309 | 3300037418 | Ga0395900_0211976 | Ga0395900_0211976_495_818 | 105 |
| 310 | 3300037466 | Ga0395898_0000329 | Ga0395898_0000329_1024_1347 | 105 |
| 311 | 3300037466 | Ga0395898_0000387 | Ga0395898_0000387_958_1290 | 105 |
| 312 | 3300037466 | Ga0395898_0006340 | Ga0395898_0006340_1387_1710 | 105 |
| 313 | 3300037466 | Ga0395898_0051318 | Ga0395898_0051318_577_894 | 105 |
| 314 | 3300037466 | Ga0395898_0100309 | Ga0395898_0100309_1096_1419 | 105 |
| 315 | 3300037466 | Ga0395898_0117860 | Ga0395898_0117860_1212_1535 | 105 |
| 316 | 3300037466 | Ga0395898_0516582 | Ga0395898_0516582_267_590 | 105 |
| 317 | 3300037471 | Ga0395905_1057310 | Ga0395905_1057310_263_586 | 105 |
| 318 | 3300038443 | Ga0395901_0080818 | Ga0395901_0080818_1109_1432 | 105 |
| 319 | 3300038443 | Ga0395901_0086604 | Ga0395901_0086604_1068_1391 | 105 |
| 320 | 3300038443 | Ga0395901_0100329 | Ga0395901_0100329_1704_2027 | 105 |
| 321 | 3300038443 | Ga0395901_0114438 | Ga0395901_0114438_2145_2468 | 105 |
| 322 | 3300038443 | Ga0395901_0178598 | Ga0395901_0178598_1096_1419 | 105 |
| 323 | 3300038443 | Ga0395901_0265101 | Ga0395901_0265101_1052_1369 | 105 |
| 324 | 3300038443 | Ga0395901_0574668 | Ga0395901_0574668_366_689 | 105 |
| 325 | 3300042005 | Ga0439448_0022066 | Ga0439448_0022066_535_861 | 105 |
| 326 | 3300042007 | Ga0439449_0006005 | Ga0439449_0006005_1077_1394 | 105 |
| 327 | 3300044656 | Ga0466969_0042827 | Ga0466969_0042827_1219_1542 | 105 |
| 328 | 3300044656 | Ga0466969_0044980 | Ga0466969_0044980_988_1314 | 105 |
| 329 | 3300044656 | Ga0466969_0068577 | Ga0466969_0068577_906_1229 | 105 |
| 330 | 3300044656 | Ga0466969_0123395 | Ga0466969_0123395_790_1113 | 105 |
| 331 | 3300044658 | Ga0466972_0120151 | Ga0466972_0120151_106_432 | 105 |
| 332 | 3300044661 | Ga0466975_0328806 | Ga0466975_0328806_624_947 | 105 |
| 333 | 3300044663 | Ga0466989_0052329 | Ga0466989_0052329_137_460 | 105 |
| 334 | 3300044672 | Ga0466982_0000238 | Ga0466982_0000238_1269_1595 | 105 |
| 335 | 3300044683 | Ga0466965_0057434 | Ga0466965_0057434_939_1262 | 105 |
| 336 | 3300044683 | Ga0466965_0245410 | Ga0466965_0245410_412_735 | 105 |
| 337 | 3300044684 | Ga0466966_0025895 | Ga0466966_0025895_2256_2579 | 105 |
| 338 | 3300044684 | Ga0466966_0055894 | Ga0466966_0055894_993_1316 | 105 |
| 339 | 3300044684 | Ga0466966_0112713 | Ga0466966_0112713_1084_1410 | 105 |
| 340 | 3300044684 | Ga0466966_0168758 | Ga0466966_0168758_855_1178 | 105 |
| 341 | 3300044693 | Ga0466961_0000454 | Ga0466961_0000454_997_1320 | 105 |
| 342 | 3300044693 | Ga0466961_0002186 | Ga0466961_0002186_11519_11842 | 105 |
| 343 | 3300044693 | Ga0466961_0003288 | Ga0466961_0003288_9736_10059 | 105 |
| 344 | 3300044693 | Ga0466961_0029207 | Ga0466961_0029207_1210_1533 | 105 |
| 345 | 3300044693 | Ga0466961_0151176 | Ga0466961_0151176_1115_1438 | 105 |
| 346 | 3300044693 | Ga0466961_0309044 | Ga0466961_0309044_335_661 | 105 |
| 347 | 3300044694 | Ga0466963_0110736 | Ga0466963_0110736_809_1132 | 105 |
| 348 | 3300044694 | Ga0466963_0345233 | Ga0466963_0345233_376_699 | 105 |
| 349 | 3300044694 | Ga0466963_0390656 | Ga0466963_0390656_370_693 | 105 |
| 350 | 3300044706 | Ga0466964_0022882 | Ga0466964_0022882_1142_1468 | 105 |
| 351 | 3300044706 | Ga0466964_0066792 | Ga0466964_0066792_135_458 | 105 |
| 352 | 3300044706 | Ga0466964_0143546 | Ga0466964_0143546_294_617 | 105 |
| 353 | 3300044719 | Ga0466971_0009727 | Ga0466971_0009727_2938_3261 | 105 |
| 354 | 3300044719 | Ga0466971_0050142 | Ga0466971_0050142_1038_1364 | 105 |
| 355 | 3300044719 | Ga0466971_0083049 | Ga0466971_0083049_337_660 | 105 |
| 356 | 3300044735 | Ga0466968_0086903 | Ga0466968_0086903_756_1082 | 105 |
| 357 | 3300044735 | Ga0466968_0331966 | Ga0466968_0331966_319_642 | 105 |
| 358 | 3300044765 | Ga0466970_0003933 | Ga0466970_0003933_1008_1331 | 105 |
| 359 | 3300044765 | Ga0466970_0014932 | Ga0466970_0014932_139_462 | 105 |
| 360 | 3300044765 | Ga0466970_0169208 | Ga0466970_0169208_291_617 | 105 |
| 361 | 3300044842 | Ga0466957_0004779 | Ga0466957_0004779_5738_6061 | 105 |
| 362 | 3300044842 | Ga0466957_0345444 | Ga0466957_0345444_197_520 | 105 |
| 363 | 3300044842 | Ga0466957_0775841 | Ga0466957_0775841_334_657 | 105 |
| 364 | 3300044842 | Ga0466957_0964500 | Ga0466957_0964500_208_531 | 105 |
| 365 | 3300045049 | Ga0466959_0073069 | Ga0466959_0073069_937_1260 | 105 |
| 366 | 3300045049 | Ga0466959_0148968 | Ga0466959_0148968_838_1161 | 105 |
| 367 | 3300045049 | Ga0466959_0150644 | Ga0466959_0150644_1032_1355 | 105 |
| 368 | 3300045049 | Ga0466959_0173452 | Ga0466959_0173452_977_1300 | 105 |
| 369 | 3300045049 | Ga0466959_0216063 | Ga0466959_0216063_974_1300 | 105 |
| 370 | 3300045049 | Ga0466959_0744362 | Ga0466959_0744362_144_476 | 105 |
| 371 | 3300045836 | Ga0466958_0050066 | Ga0466958_0050066_482_805 | 105 |
| 372 | 3300045836 | Ga0466958_0075745 | Ga0466958_0075745_76_399 | 105 |
| 373 | 3300045836 | Ga0466958_0089371 | Ga0466958_0089371_162_485 | 105 |
| 374 | 3300045836 | Ga0466958_0115612 | Ga0466958_0115612_329_661 | 105 |
| 375 | 3300045976 | Ga0466967_0212702 | Ga0466967_0212702_34_357 | 105 |
| 376 | 3300045976 | Ga0466967_0938100 | Ga0466967_0938100_482_805 | 105 |
| 377 | 3300046460 | Ga0495638_0000081 | Ga0495638_0000081_153080_153403 | 105 |
| 378 | 3300046460 | Ga0495638_0000127 | Ga0495638_0000127_122042_122365 | 105 |
| 379 | 3300046460 | Ga0495638_0000275 | Ga0495638_0000275_1211_1534 | 105 |
| 380 | 3300046471 | Ga0495650_0000409 | Ga0495650_0000409_68825_69148 | 105 |
| 381 | 3300046507 | Ga0495606_0001687 | Ga0495606_0001687_27249_27572 | 105 |
| 382 | 3300046660 | Ga0495625_0108062 | Ga0495625_0108062_352_675 | 105 |
| 383 | 3300046660 | Ga0495625_0254744 | Ga0495625_0254744_734_1057 | 105 |
| 384 | 3300046694 | Ga0495649_0017115 | Ga0495649_0017115_788_1111 | 105 |
| 385 | 3300048904 | Ga0496101_0020503 | Ga0496101_0020503_1537_1869 | 105 |
| 386 | 3300048904 | Ga0496101_0025773 | Ga0496101_0025773_1601_1918 | 105 |
| 387 | 3300048904 | Ga0496101_0797256 | Ga0496101_0797256_77_394 | 105 |
| 388 | 3300048907 | Ga0496104_0187426 | Ga0496104_0187426_873_1205 | 105 |
| 389 | 3300048907 | Ga0496104_0287955 | Ga0496104_0287955_634_957 | 105 |
| 390 | 3300048907 | Ga0496104_0649075 | Ga0496104_0649075_430_753 | 105 |
| 391 | 3300048908 | Ga0496105_0012987 | Ga0496105_0012987_459_791 | 105 |
| 392 | 3300048908 | Ga0496105_0635880 | Ga0496105_0635880_353_670 | 105 |
| 393 | 3300048910 | Ga0496107_0048218 | Ga0496107_0048218_1407_1739 | 105 |
| 394 | 3300048910 | Ga0496107_1293593 | Ga0496107_1293593_145_462 | 105 |
| 395 | 3300048911 | Ga0496108_0098974 | Ga0496108_0098974_74_391 | 105 |
| 396 | 3300048912 | Ga0496109_0110210 | Ga0496109_0110210_1494_1811 | 105 |
| 397 | 3300048915 | Ga0496112_0123874 | Ga0496112_0123874_1781_2104 | 105 |
| 398 | 3300048915 | Ga0496112_0560102 | Ga0496112_0560102_725_1042 | 105 |
| 399 | 3300048916 | Ga0496113_0432274 | Ga0496113_0432274_702_1019 | 105 |
| 400 | 3300048916 | Ga0496113_0546180 | Ga0496113_0546180_472_795 | 105 |
| 401 | 3300048917 | Ga0496114_0297297 | Ga0496114_0297297_880_1203 | 105 |
| 402 | 3300048918 | Ga0496115_0000117 | Ga0496115_0000117_70909_71232 | 105 |
| 403 | 3300048918 | Ga0496115_0000190 | Ga0496115_0000190_968_1291 | 105 |
| 404 | 3300048918 | Ga0496115_0004084 | Ga0496115_0004084_9213_9545 | 105 |
| 405 | 3300048918 | Ga0496115_0043165 | Ga0496115_0043165_759_1082 | 105 |
| 406 | 3300048918 | Ga0496115_0157922 | Ga0496115_0157922_933_1256 | 105 |
| 407 | 3300048919 | Ga0496116_0261368 | Ga0496116_0261368_101_433 | 105 |
| 408 | 3300048920 | Ga0496117_0013031 | Ga0496117_0013031_6732_7064 | 105 |
| 409 | 3300048920 | Ga0496117_0022259 | Ga0496117_0022259_323_655 | 105 |
| 410 | 3300048921 | Ga0496118_0032824 | Ga0496118_0032824_858_1190 | 105 |
| 411 | 3300048921 | Ga0496118_0501017 | Ga0496118_0501017_235_558 | 105 |
| 412 | 3300048922 | Ga0496119_0000094 | Ga0496119_0000094_810_1142 | 105 |
| 413 | 3300048922 | Ga0496119_0002665 | Ga0496119_0002665_1181_1513 | 105 |
| 414 | 3300048923 | Ga0496120_0000013 | Ga0496120_0000013_329924_330256 | 105 |
| 415 | 3300048923 | Ga0496120_0018926 | Ga0496120_0018926_2877_3209 | 105 |
| 416 | 3300048924 | Ga0496121_0000630 | Ga0496121_0000630_63929_64252 | 105 |
| 417 | 3300048924 | Ga0496121_0027144 | Ga0496121_0027144_517_849 | 105 |
| 418 | 3300048924 | Ga0496121_0032433 | Ga0496121_0032433_1457_1783 | 105 |
| 419 | 3300048924 | Ga0496121_0585529 | Ga0496121_0585529_38_370 | 105 |
| 420 | 3300048928 | Ga0496125_0001082 | Ga0496125_0001082_40643_40969 | 105 |
| 421 | 3300048929 | Ga0496126_0001676 | Ga0496126_0001676_1419_1751 | 105 |
| 422 | 3300048929 | Ga0496126_0014304 | Ga0496126_0014304_1082_1414 | 105 |
| 423 | 3300048929 | Ga0496126_0049035 | Ga0496126_0049035_961_1284 | 105 |
| 424 | 3300048929 | Ga0496126_0068561 | Ga0496126_0068561_1967_2290 | 105 |
| 425 | 3300048929 | Ga0496126_0791827 | Ga0496126_0791827_145_471 | 105 |
| 426 | 3300049459 | Ga0495678_046559 | Ga0495678_046559_787_1110 | 105 |
| 427 | 3300049459 | Ga0495678_096185 | Ga0495678_096185_373_696 | 105 |
| 428 | 3300049568 | Ga0501031_0259915 | Ga0501031_0259915_457_780 | 105 |
| 429 | 3300049569 | Ga0501032_0067653 | Ga0501032_0067653_724_1047 | 105 |
| 430 | 3300049570 | Ga0501033_0003839 | Ga0501033_0003839_5905_6237 | 105 |
| 431 | 3300049571 | Ga0501034_0299721 | Ga0501034_0299721_911_1234 | 105 |
| 432 | 3300049571 | Ga0501034_0519096 | Ga0501034_0519096_426_749 | 105 |
| 433 | 3300049572 | Ga0501036_0643676 | Ga0501036_0643676_453_785 | 105 |
| 434 | 3300049573 | Ga0501037_0413684 | Ga0501037_0413684_544_867 | 105 |
| 435 | 3300049575 | Ga0501039_0361831 | Ga0501039_0361831_588_911 | 105 |
| 436 | 3300049579 | Ga0501043_0027305 | Ga0501043_0027305_1450_1773 | 105 |
| 437 | 3300049581 | Ga0501047_0146890 | Ga0501047_0146890_619_942 | 105 |
| 438 | 3300049581 | Ga0501047_0183554 | Ga0501047_0183554_1496_1822 | 105 |
| 439 | 3300049581 | Ga0501047_1303742 | Ga0501047_1303742_77_409 | 105 |
| 440 | 3300049652 | Ga0501202_021938 | Ga0501202_021938_202_519 | 105 |
| 441 | 3300049653 | Ga0501206_030139 | Ga0501206_030139_276_593 | 105 |
| 442 | 3300049660 | Ga0501216_070147 | Ga0501216_070147_282_599 | 105 |
| 443 | 3300049663 | Ga0501223_027230 | Ga0501223_027230_268_585 | 105 |
| 444 | 3300049672 | Ga0501239_023745 | Ga0501239_023745_115_432 | 105 |
| 445 | 3300049680 | Ga0501250_034087 | Ga0501250_034087_115_432 | 105 |
| 446 | 3300049682 | Ga0501252_090248 | Ga0501252_090248_182_499 | 105 |
| 447 | 3300049704 | Ga0501221_180543 | Ga0501221_180543_61_378 | 105 |
| 448 | 3300049705 | Ga0501225_0026305 | Ga0501225_0026305_994_1311 | 105 |
| 449 | 3300049708 | Ga0501245_085779 | Ga0501245_085779_247_564 | 105 |
| 450 | 3300049758 | Ga0501241_107096 | Ga0501241_107096_99_416 | 105 |
| 451 | 3300049765 | Ga0501268_003743 | Ga0501268_003743_1201_1518 | 105 |
| 452 | 3300049822 | Ga0501035_0269998 | Ga0501035_0269998_1051_1374 | 105 |
| 453 | 3300049822 | Ga0501035_0289660 | Ga0501035_0289660_481_813 | 105 |
| 454 | 3300049822 | Ga0501035_0330786 | Ga0501035_0330786_495_818 | 105 |
| 455 | 3300049822 | Ga0501035_1420250 | Ga0501035_1420250_141_464 | 105 |
| 456 | 3300049823 | Ga0501044_0101688 | Ga0501044_0101688_1260_1583 | 105 |
| 457 | 3300049823 | Ga0501044_0803523 | Ga0501044_0803523_476_799 | 105 |
| 458 | 3300049823 | Ga0501044_1081809 | Ga0501044_1081809_22_345 | 105 |
| 459 | 3300053149 | Ga0500600_0152172 | Ga0500600_0152172_169_495 | 105 |
| 460 | 3300061719 | Ga0466962_0020737 | Ga0466962_0020737_2231_2554 | 105 |
| 461 | 3300061719 | Ga0466962_0056725 | Ga0466962_0056725_115_438 | 105 |
| 462 | 3300061719 | Ga0466962_0063464 | Ga0466962_0063464_924_1250 | 105 |
| 463 | 3300061719 | Ga0466962_0094702 | Ga0466962_0094702_934_1257 | 105 |
| 464 | 2010549000 | RicEn_C2318 | RicEn_42670 | 106 |
| 465 | 2162886007 | SwRhRL2b_contig_3083456 | SwRhRL2b_0168.00000170 | 106 |
| 466 | 3300002773 | JGI25152J39213_1000312 | JGI25152J39213_100031231 | 106 |
| 467 | 3300002774 | JGI25150J39212_1000221 | JGI25150J39212_10002212 | 106 |
| 468 | 3300003187 | JGI25151J46595_10000093 | JGI25151J46595_1000009338 | 106 |
| 469 | 3300003215 | JGI25153J46596_10000061 | JGI25153J46596_1000006144 | 106 |
| 470 | 3300003781 | Ga0055536_1005416 | Ga0055536_10054165 | 106 |
| 471 | 3300003781 | Ga0055536_1008638 | Ga0055536_10086385 | 106 |
| 472 | 3300003781 | Ga0055536_1024198 | Ga0055536_10241982 | 106 |
| 473 | 3300003791 | Ga0055530_10001682 | Ga0055530_100016823 | 106 |
| 474 | 3300003794 | Ga0055531_10008817 | Ga0055531_100088171 | 106 |
| 475 | 3300003794 | Ga0055531_10013482 | Ga0055531_100134824 | 106 |
| 476 | 3300003794 | Ga0055531_10022842 | Ga0055531_100228423 | 106 |
| 477 | 3300003794 | Ga0055531_10049384 | Ga0055531_100493842 | 106 |
| 478 | 3300005331 | Ga0070670_100005341 | Ga0070670_1000053416 | 106 |
| 479 | 3300005331 | Ga0070670_101108685 | Ga0070670_1011086852 | 106 |
| 480 | 3300005331 | Ga0070670_101769652 | Ga0070670_1017696521 | 106 |
| 481 | 3300005344 | Ga0070661_100244792 | Ga0070661_1002447922 | 106 |
| 482 | 3300005367 | Ga0070667_100077353 | Ga0070667_1000773532 | 106 |
| 483 | 3300005539 | Ga0068853_100032189 | Ga0068853_1000321894 | 106 |
| 484 | 3300005539 | Ga0068853_100130498 | Ga0068853_1001304982 | 106 |
| 485 | 3300005548 | Ga0070665_100814868 | Ga0070665_1008148682 | 106 |
| 486 | 3300005578 | Ga0068854_100431674 | Ga0068854_1004316741 | 106 |
| 487 | 3300005616 | Ga0068852_100153318 | Ga0068852_1001533182 | 106 |
| 488 | 3300005617 | Ga0068859_100393341 | Ga0068859_1003933413 | 106 |
| 489 | 3300005844 | Ga0068862_101549252 | Ga0068862_1015492522 | 106 |
| 490 | 3300006051 | Ga0075364_10000261 | Ga0075364_100002616 | 106 |
| 491 | 3300006195 | Ga0075366_10319580 | Ga0075366_103195801 | 106 |
| 492 | 3300006847 | Ga0075431_100761496 | Ga0075431_1007614961 | 106 |
| 493 | 3300006931 | Ga0097620_100393304 | Ga0097620_1003933043 | 106 |
| 494 | 3300009011 | Ga0105251_10001882 | Ga0105251_100018828 | 106 |
| 495 | 3300009148 | Ga0105243_10000720 | Ga0105243_100007202 | 106 |
| 496 | 3300010375 | Ga0105239_10507271 | Ga0105239_105072712 | 106 |
| 497 | 3300011119 | Ga0105246_11891163 | Ga0105246_118911631 | 106 |
| 498 | 3300013297 | Ga0157378_10831220 | Ga0157378_108312202 | 106 |
| 499 | 3300015261 | Ga0182006_1006577 | Ga0182006_10065773 | 106 |
| 500 | 3300015265 | Ga0182005_1001273 | Ga0182005_10012734 | 106 |
| 501 | 3300017792 | Ga0163161_10730561 | Ga0163161_107305612 | 106 |
| 502 | 3300025245 | Ga0207425_1000015 | Ga0207425_1000015358 | 106 |
| 503 | 3300025258 | Ga0209129_1000131 | Ga0209129_100013155 | 106 |
| 504 | 3300025273 | Ga0209673_1006434 | Ga0209673_10064344 | 106 |
| 505 | 3300025284 | Ga0209130_1005216 | Ga0209130_10052163 | 106 |
| 506 | 3300025291 | Ga0209675_1003612 | Ga0209675_10036124 | 106 |
| 507 | 3300025292 | Ga0209676_1001795 | Ga0209676_100179510 | 106 |
| 508 | 3300025292 | Ga0209676_1002044 | Ga0209676_100204414 | 106 |
| 509 | 3300025292 | Ga0209676_1007405 | Ga0209676_10074055 | 106 |
| 510 | 3300025292 | Ga0209676_1008414 | Ga0209676_10084141 | 106 |
| 511 | 3300025292 | Ga0209676_1009197 | Ga0209676_10091973 | 106 |
| 512 | 3300025294 | Ga0209025_1000002 | Ga0209025_10000021256 | 106 |
| 513 | 3300025294 | Ga0209025_1005191 | Ga0209025_100519110 | 106 |
| 514 | 3300025294 | Ga0209025_1030021 | Ga0209025_10300212 | 106 |
| 515 | 3300025297 | Ga0209758_1000003 | Ga0209758_10000031263 | 106 |
| 516 | 3300025298 | Ga0209050_1000429 | Ga0209050_100042952 | 106 |
| 517 | 3300025299 | Ga0209256_1002127 | Ga0209256_10021275 | 106 |
| 518 | 3300025299 | Ga0209256_1007777 | Ga0209256_10077773 | 106 |
| 519 | 3300025299 | Ga0209256_1008339 | Ga0209256_10083394 | 106 |
| 520 | 3300025302 | Ga0207426_1064789 | Ga0207426_10647892 | 106 |
| 521 | 3300025303 | Ga0209051_1029247 | Ga0209051_10292472 | 106 |
| 522 | 3300025304 | Ga0209257_1000336 | Ga0209257_100033621 | 106 |
| 523 | 3300025304 | Ga0209257_1001853 | Ga0209257_10018538 | 106 |
| 524 | 3300025304 | Ga0209257_1001936 | Ga0209257_10019367 | 106 |
| 525 | 3300025304 | Ga0209257_1002007 | Ga0209257_10020079 | 106 |
| 526 | 3300025304 | Ga0209257_1006315 | Ga0209257_10063152 | 106 |
| 527 | 3300025735 | Ga0207713_1003029 | Ga0207713_10030298 | 106 |
| 528 | 3300025920 | Ga0207649_10291108 | Ga0207649_102911082 | 106 |
| 529 | 3300025925 | Ga0207650_10004256 | Ga0207650_100042567 | 106 |
| 530 | 3300025925 | Ga0207650_10654661 | Ga0207650_106546612 | 106 |
| 531 | 3300025935 | Ga0207709_10001168 | Ga0207709_100011682 | 106 |
| 532 | 3300025936 | Ga0207670_10668341 | Ga0207670_106683412 | 106 |
| 533 | 3300025972 | Ga0207668_10061007 | Ga0207668_100610072 | 106 |
| 534 | 3300025981 | Ga0207640_10302021 | Ga0207640_103020212 | 106 |
| 535 | 3300026023 | Ga0207677_10211592 | Ga0207677_102115922 | 106 |
| 536 | 3300026041 | Ga0207639_10107968 | Ga0207639_101079684 | 106 |
| 537 | 3300026041 | Ga0207639_10203853 | Ga0207639_102038533 | 106 |
| 538 | 3300026041 | Ga0207639_11190600 | Ga0207639_111906001 | 106 |
| 539 | 3300027312 | Ga0209371_1000025 | Ga0209371_1000025376 | 106 |
| 540 | 3300027424 | Ga0209984_1069063 | Ga0209984_10690631 | 106 |
| 541 | 3300027543 | Ga0209999_1003170 | Ga0209999_10031703 | 106 |
| 542 | 3300027552 | Ga0209982_1004176 | Ga0209982_10041763 | 106 |
| 543 | 3300027614 | Ga0209970_1023780 | Ga0209970_10237802 | 106 |
| 544 | 3300027665 | Ga0209983_1002053 | Ga0209983_10020532 | 106 |
| 545 | 3300027682 | Ga0209971_1004182 | Ga0209971_10041822 | 106 |
| 546 | 3300027876 | Ga0209974_10012492 | Ga0209974_100124924 | 106 |
| 547 | 3300027876 | Ga0209974_10143883 | Ga0209974_101438832 | 106 |
| 548 | 3300028380 | Ga0268265_11867393 | Ga0268265_118673932 | 106 |
| 549 | 3300028794 | Ga0307515_10222018 | Ga0307515_102220182 | 106 |
| 550 | 3300030500 | Ga0268256_1000027 | Ga0268256_1000027376 | 106 |
| 551 | 3300030732 | Ga0316176_1093772 | Ga0316176_10937721 | 106 |
| 552 | 3300030733 | Ga0314311_1024079 | Ga0314311_10240795 | 106 |
| 553 | 3300030735 | Ga0316178_1070040 | Ga0316178_10700402 | 106 |
| 554 | 3300031456 | Ga0307513_10001910 | Ga0307513_100019106 | 106 |
| 555 | 3300031456 | Ga0307513_10180614 | Ga0307513_101806142 | 106 |
| 556 | 3300031456 | Ga0307513_10217896 | Ga0307513_102178963 | 106 |
| 557 | 3300031548 | Ga0307408_100882533 | Ga0307408_1008825332 | 106 |
| 558 | 3300031548 | Ga0307408_100944790 | Ga0307408_1009447902 | 106 |
| 559 | 3300031731 | Ga0307405_10051058 | Ga0307405_100510583 | 106 |
| 560 | 3300031731 | Ga0307405_10540874 | Ga0307405_105408742 | 106 |
| 561 | 3300031824 | Ga0307413_10180981 | Ga0307413_101809811 | 106 |
| 562 | 3300031824 | Ga0307413_10609843 | Ga0307413_106098433 | 106 |
| 563 | 3300031901 | Ga0307406_10294410 | Ga0307406_102944102 | 106 |
| 564 | 3300031901 | Ga0307406_11800255 | Ga0307406_118002551 | 106 |
| 565 | 3300031903 | Ga0307407_10300183 | Ga0307407_103001832 | 106 |
| 566 | 3300031911 | Ga0307412_10319964 | Ga0307412_103199642 | 106 |
| 567 | 3300031911 | Ga0307412_10342889 | Ga0307412_103428892 | 106 |
| 568 | 3300031995 | Ga0307409_100925890 | Ga0307409_1009258902 | 106 |
| 569 | 3300032002 | Ga0307416_100097588 | Ga0307416_1000975883 | 106 |
| 570 | 3300032004 | Ga0307414_10006203 | Ga0307414_100062033 | 106 |
| 571 | 3300032004 | Ga0307414_10257343 | Ga0307414_102573432 | 106 |
| 572 | 3300032004 | Ga0307414_10910731 | Ga0307414_109107311 | 106 |
| 573 | 3300032126 | Ga0307415_100137324 | Ga0307415_1001373243 | 106 |
| 574 | 3300037471 | Ga0395905_1462927 | Ga0395905_1462927_56_412 | 106 |
| 575 | 3300038705 | Ga0237819_00236 | Ga0237819_00236_8963_9283 | 106 |
| 576 | 3300041404 | Ga0439436_0005936 | Ga0439436_0005936_3281_3601 | 106 |
| 577 | 3300041404 | Ga0439436_0057950 | Ga0439436_0057950_517_837 | 106 |
| 578 | 3300041406 | Ga0439439_0042318 | Ga0439439_0042318_162_482 | 106 |
| 579 | 3300041406 | Ga0439439_0128463 | Ga0439439_0128463_131_463 | 106 |
| 580 | 3300041413 | Ga0439465_0347867 | Ga0439465_0347867_193_528 | 106 |
| 581 | 3300041441 | Ga0451787_607498 | Ga0451787_607498_816_1136 | 106 |
| 582 | 3300041451 | Ga0451791_1078979 | Ga0451791_1078979_1024_1344 | 106 |
| 583 | 3300041451 | Ga0451791_1601619 | Ga0451791_1601619_295_615 | 106 |
| 584 | 3300041452 | Ga0451793_0499790 | Ga0451793_0499790_102_422 | 106 |
| 585 | 3300041452 | Ga0451793_0935961 | Ga0451793_0935961_281_601 | 106 |
| 586 | 3300041452 | Ga0451793_1186641 | Ga0451793_1186641_197_517 | 106 |
| 587 | 3300041453 | Ga0451797_0296971 | Ga0451797_0296971_520_840 | 106 |
| 588 | 3300041453 | Ga0451797_0309277 | Ga0451797_0309277_189_509 | 106 |
| 589 | 3300041453 | Ga0451797_0487859 | Ga0451797_0487859_228_548 | 106 |
| 590 | 3300041459 | Ga0451800_0738262 | Ga0451800_0738262_7051_7371 | 106 |
| 591 | 3300041459 | Ga0451800_1647684 | Ga0451800_1647684_39_359 | 106 |
| 592 | 3300041460 | Ga0451802_1263235 | Ga0451802_1263235_977_1297 | 106 |
| 593 | 3300041460 | Ga0451802_1631226 | Ga0451802_1631226_112_432 | 106 |
| 594 | 3300041462 | Ga0451806_250174 | Ga0451806_250174_711_1031 | 106 |
| 595 | 3300041463 | Ga0451804_0352159 | Ga0451804_0352159_133_453 | 106 |
| 596 | 3300041463 | Ga0451804_0831922 | Ga0451804_0831922_6710_7030 | 106 |
| 597 | 3300041486 | Ga0451807_0161263 | Ga0451807_0161263_38_358 | 106 |
| 598 | 3300041486 | Ga0451807_0330082 | Ga0451807_0330082_78_398 | 106 |
| 599 | 3300041486 | Ga0451807_0683873 | Ga0451807_0683873_133_453 | 106 |
| 600 | 3300041486 | Ga0451807_1108932 | Ga0451807_1108932_7052_7372 | 106 |
| 601 | 3300041486 | Ga0451807_1270057 | Ga0451807_1270057_277_597 | 106 |
| 602 | 3300041486 | Ga0451807_2641394 | Ga0451807_2641394_36_356 | 106 |
| 603 | 3300041491 | Ga0451833_1485257 | Ga0451833_1485257_86_406 | 106 |
| 604 | 3300041494 | Ga0451837_0563368 | Ga0451837_0563368_201_521 | 106 |
| 605 | 3300041494 | Ga0451837_1261700 | Ga0451837_1261700_289_609 | 106 |
| 606 | 3300041496 | Ga0451839_1008954 | Ga0451839_1008954_337_657 | 106 |
| 607 | 3300041509 | Ga0451843_0940890 | Ga0451843_0940890_26_349 | 106 |
| 608 | 3300041509 | Ga0451843_1204386 | Ga0451843_1204386_10_330 | 106 |
| 609 | 3300041509 | Ga0451843_1305810 | Ga0451843_1305810_519_839 | 106 |
| 610 | 3300041509 | Ga0451843_1349917 | Ga0451843_1349917_158_478 | 106 |
| 611 | 3300041512 | Ga0451853_2568479 | Ga0451853_2568479_172_492 | 106 |
| 612 | 3300041512 | Ga0451853_2783524 | Ga0451853_2783524_84_404 | 106 |
| 613 | 3300041512 | Ga0451853_3065596 | Ga0451853_3065596_1517_1840 | 106 |
| 614 | 3300041997 | Ga0439431_0024710 | Ga0439431_0024710_304_624 | 106 |
| 615 | 3300041999 | Ga0439433_0013143 | Ga0439433_0013143_379_702 | 106 |
| 616 | 3300041999 | Ga0439433_0014237 | Ga0439433_0014237_241_561 | 106 |
| 617 | 3300041999 | Ga0439433_0052184 | Ga0439433_0052184_251_571 | 106 |
| 618 | 3300042004 | Ga0439445_0181258 | Ga0439445_0181258_89_412 | 106 |
| 619 | 3300042006 | Ga0439432_048250 | Ga0439432_048250_747_1070 | 106 |
| 620 | 3300042006 | Ga0439432_058718 | Ga0439432_058718_383_703 | 106 |
| 621 | 3300042006 | Ga0439432_125989 | Ga0439432_125989_204_524 | 106 |
| 622 | 3300042007 | Ga0439449_0004794 | Ga0439449_0004794_2733_3053 | 106 |
| 623 | 3300042007 | Ga0439449_0023675 | Ga0439449_0023675_1312_1632 | 106 |
| 624 | 3300042007 | Ga0439449_0062623 | Ga0439449_0062623_575_895 | 106 |
| 625 | 3300042007 | Ga0439449_0212730 | Ga0439449_0212730_205_528 | 106 |
| 626 | 3300042014 | Ga0439457_036129 | Ga0439457_036129_654_974 | 106 |
| 627 | 3300042015 | Ga0439462_0011336 | Ga0439462_0011336_1868_2203 | 106 |
| 628 | 3300042015 | Ga0439462_0036505 | Ga0439462_0036505_230_550 | 106 |
| 629 | 3300042015 | Ga0439462_0054119 | Ga0439462_0054119_562_882 | 106 |
| 630 | 3300042142 | Ga0450905_000985 | Ga0450905_000985_3058_3378 | 106 |
| 631 | 3300042435 | Ga0439434_0036439 | Ga0439434_0036439_1156_1476 | 106 |
| 632 | 3300042876 | Ga0451577_0004886 | Ga0451577_0004886_4170_4490 | 106 |
| 633 | 3300044712 | Ga0453684_0279891 | Ga0453684_0279891_331_651 | 106 |
| 634 | 3300046460 | Ga0495638_0286280 | Ga0495638_0286280_446_766 | 106 |
| 635 | 3300046460 | Ga0495638_0292617 | Ga0495638_0292617_275_595 | 106 |
| 636 | 3300046471 | Ga0495650_0145613 | Ga0495650_0145613_247_570 | 106 |
| 637 | 3300046474 | Ga0495605_0144241 | Ga0495605_0144241_703_1026 | 106 |
| 638 | 3300046501 | Ga0495607_0082582 | Ga0495607_0082582_780_1103 | 106 |
| 639 | 3300046507 | Ga0495606_0017638 | Ga0495606_0017638_2535_2858 | 106 |
| 640 | 3300046513 | Ga0495616_0021918 | Ga0495616_0021918_1667_1990 | 106 |
| 641 | 3300046513 | Ga0495616_0031168 | Ga0495616_0031168_776_1096 | 106 |
| 642 | 3300046522 | Ga0495643_0166093 | Ga0495643_0166093_184_504 | 106 |
| 643 | 3300046525 | Ga0495663_0002500 | Ga0495663_0002500_1460_1780 | 106 |
| 644 | 3300046525 | Ga0495663_0213148 | Ga0495663_0213148_56_376 | 106 |
| 645 | 3300046530 | Ga0495654_0393459 | Ga0495654_0393459_135_455 | 106 |
| 646 | 3300046537 | Ga0495598_0055897 | Ga0495598_0055897_477_797 | 106 |
| 647 | 3300046539 | Ga0495621_0000158 | Ga0495621_0000158_6810_7130 | 106 |
| 648 | 3300046539 | Ga0495621_0007280 | Ga0495621_0007280_283_603 | 106 |
| 649 | 3300046558 | Ga0495633_0024292 | Ga0495633_0024292_73_393 | 106 |
| 650 | 3300046558 | Ga0495633_0314442 | Ga0495633_0314442_240_563 | 106 |
| 651 | 3300046615 | Ga0495656_0031151 | Ga0495656_0031151_15_335 | 106 |
| 652 | 3300046615 | Ga0495656_0037849 | Ga0495656_0037849_1598_1918 | 106 |
| 653 | 3300046664 | Ga0495659_0171417 | Ga0495659_0171417_237_557 | 106 |
| 654 | 3300046691 | Ga0495670_0040546 | Ga0495670_0040546_68_388 | 106 |
| 655 | 3300046691 | Ga0495670_0239982 | Ga0495670_0239982_132_452 | 106 |
| 656 | 3300046692 | Ga0495671_0053288 | Ga0495671_0053288_1582_1902 | 106 |
| 657 | 3300046810 | Ga0495660_0244951 | Ga0495660_0244951_253_576 | 106 |
| 658 | 3300047318 | Ga0495636_0114366 | Ga0495636_0114366_171_491 | 106 |
| 659 | 3300047318 | Ga0495636_0115863 | Ga0495636_0115863_123_443 | 106 |
| 660 | 3300047318 | Ga0495636_0232019 | Ga0495636_0232019_132_452 | 106 |
| 661 | 3300047470 | Ga0495681_0029027 | Ga0495681_0029027_1833_2156 | 106 |
| 662 | 3300047472 | Ga0495686_0014996 | Ga0495686_0014996_4509_4829 | 106 |
| 663 | 3300048911 | Ga0496108_0247334 | Ga0496108_0247334_1021_1362 | 106 |
| 664 | 3300048912 | Ga0496109_0455885 | Ga0496109_0455885_478_819 | 106 |
| 665 | 3300048919 | Ga0496116_0051347 | Ga0496116_0051347_1067_1387 | 106 |
| 666 | 3300048920 | Ga0496117_0004489 | Ga0496117_0004489_14588_14908 | 106 |
| 667 | 3300048921 | Ga0496118_0044969 | Ga0496118_0044969_1282_1602 | 106 |
| 668 | 3300048922 | Ga0496119_0006116 | Ga0496119_0006116_1638_1958 | 106 |
| 669 | 3300048923 | Ga0496120_0001298 | Ga0496120_0001298_8804_9124 | 106 |
| 670 | 3300048925 | Ga0496122_0000379 | Ga0496122_0000379_86003_86323 | 106 |
| 671 | 3300048925 | Ga0496122_0065289 | Ga0496122_0065289_655_975 | 106 |
| 672 | 3300048926 | Ga0496123_0003291 | Ga0496123_0003291_9584_9904 | 106 |
| 673 | 3300048927 | Ga0496124_0006411 | Ga0496124_0006411_3325_3645 | 106 |
| 674 | 3300048927 | Ga0496124_0065842 | Ga0496124_0065842_1637_1957 | 106 |
| 675 | 3300048928 | Ga0496125_0169769 | Ga0496125_0169769_520_840 | 106 |
| 676 | 3300048929 | Ga0496126_0612825 | Ga0496126_0612825_31_351 | 106 |
| 677 | 3300049569 | Ga0501032_0009975 | Ga0501032_0009975_542_916 | 106 |
| 678 | 3300049569 | Ga0501032_0252333 | Ga0501032_0252333_233_553 | 106 |
| 679 | 3300049571 | Ga0501034_0009841 | Ga0501034_0009841_1351_1725 | 106 |
| 680 | 3300049571 | Ga0501034_0011634 | Ga0501034_0011634_4677_5000 | 106 |
| 681 | 3300049571 | Ga0501034_0249743 | Ga0501034_0249743_905_1225 | 106 |
| 682 | 3300049572 | Ga0501036_0008146 | Ga0501036_0008146_7622_7996 | 106 |
| 683 | 3300049574 | Ga0501038_0000610 | Ga0501038_0000610_7533_7907 | 106 |
| 684 | 3300049575 | Ga0501039_0275574 | Ga0501039_0275574_969_1289 | 106 |
| 685 | 3300049579 | Ga0501043_0037923 | Ga0501043_0037923_537_911 | 106 |
| 686 | 3300049581 | Ga0501047_0027284 | Ga0501047_0027284_4574_4948 | 106 |
| 687 | 3300049584 | Ga0501068_0050100 | Ga0501068_0050100_81_455 | 106 |
| 688 | 3300049586 | Ga0501070_0753061 | Ga0501070_0753061_16_390 | 106 |
| 689 | 3300049587 | Ga0501071_0544692 | Ga0501071_0544692_73_393 | 106 |
| 690 | 3300049661 | Ga0501217_106725 | Ga0501217_106725_283_603 | 106 |
| 691 | 3300049741 | Ga0501079_0900908 | Ga0501079_0900908_310_684 | 106 |
| 692 | 3300049742 | Ga0501080_0031762 | Ga0501080_0031762_4313_4687 | 106 |
| 693 | 3300049760 | Ga0501263_002926 | Ga0501263_002926_1172_1492 | 106 |
| 694 | 3300049765 | Ga0501268_027823 | Ga0501268_027823_379_699 | 106 |
| 695 | 3300049770 | Ga0501273_072832 | Ga0501273_072832_152_538 | 106 |
| 696 | 3300049822 | Ga0501035_0005516 | Ga0501035_0005516_4975_5349 | 106 |
| 697 | 3300049823 | Ga0501044_0119435 | Ga0501044_0119435_1131_1505 | 106 |
| 698 | 3300049823 | Ga0501044_0384203 | Ga0501044_0384203_428_748 | 106 |
| 699 | 3300050490 | nmdc:mga03n38_667452_c1 | nmdc:mga03n38_667452_c1_46_366 | 106 |
| 700 | 3300050490 | nmdc:mga03n38_820072_c1 | nmdc:mga03n38_820072_c1_46_366 | 106 |
| 701 | 3300050491 | nmdc:mga00v17_3525_c1 | nmdc:mga00v17_3525_c1_2941_3261 | 106 |
| 702 | 3300050510 | nmdc:mga06r32_850470_c1 | nmdc:mga06r32_850470_c1_51_371 | 106 |
| 703 | 3300053156 | Ga0500622_0189400 | Ga0500622_0189400_429_752 | 106 |
| 704 | 3300053161 | Ga0500634_0000111 | Ga0500634_0000111_26887_27207 | 106 |
| 705 | 3300053727 | Ga0500611_091189 | Ga0500611_091189_404_724 | 106 |
| 706 | 3300053734 | Ga0500565_010275 | Ga0500565_010275_375_695 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7og8-assembly1.cif.gz_A | wild-type hfq protein from neisseria meningitidis | 0.7666 | 4 | 80 |
| 3m4g-assembly2.cif.gz_G | h57a hfq from pseudomonas aeruginosa | 0.7599 | 3 | 80 |
| 8p91-assembly1.cif.gz_A | hfq from chromobacterium haemolyticum; a p6 space group monomer | 0.754 | 4 | 83 |
| 7ogw-assembly1.cif.gz_A | q9a mutant of hfq protein from neisseria meningitidis | 0.7507 | 4 | 83 |
| 5uk7-assembly1.cif.gz_B | escherichia coli hfq bound to dsdna | 0.7482 | 3 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWX7_36_130_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7419 | 5 | 76 | 2.30.29.30 |
| af_Q2FYZ1_1_77_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.7323 | 3 | 83 | 2.30.30.100 |
| 4nl2F00 | Mainly Beta;Roll;SH3 type barrels.; | 0.7216 | 3 | 83 | 2.30.30.100 |
| af_Q2G2D3_87_153_2.30.30.180 | Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain | 0.6972 | 3 | 78 | 2.30.30.180 |
| 3hsbD00 | Mainly Beta;Roll;SH3 type barrels.; | 0.696 | 4 | 83 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G7UW60-F1-model_v4 | DUF1820 family protein | 0.9203 | 1 | 106 |
|
| AF-A0A656YHN7-F1-model_v4 | deleted | 0.9161 | 1 | 89 |
|
| AF-G7UW60-F1-model_v4 | DUF1820 family protein | 0.9121 | 1 | 106 |
|
| AF-A0A2G6C9Y0-F1-model_v4 | DUF1820 domain-containing protein | 0.9008 | 2 | 82 |
|
| AF-A0A661PST2-F1-model_v4 | DUF1820 family protein | 0.8963 | 3 | 80 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar