F473825

General Info

Members Datasets Scaffolds Average Seq Length
667 379 1334 287

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100317964|Ga0068855_1003179642
Length 315
Sequence VRYQFIKEQQEYFSLAALCRAMQVGRSGFYAWRQRQKSERQNQNEILTEQIRAAHEESDQTYGSPRIYSELQEAGIACSQKRVARLMRLSQISAMRPKRFVVTTDSDHALPVADNLLARLFTAEAPDTKWTADITYLWTGQGWLYLAVILDLFSRRIVGWAMDQTIDRTLVLSALDMAILGRKPASDLLCHSDRGSQYASGDYQHRLQEAGIVCSMSRRGNCWDNAPTESFFATLKKELVHRTHFESREQARGAVFRWIEVWYNRKRRHSTLGYLSPEAFERKQQQEQANARAVAASPLAETSRDASGVRYATAA

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
244 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
245 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
246 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
247 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
248 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
249 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
250 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
253 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
254 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
255 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
256 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
315 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
319 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
320 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
321 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
322 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
346 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
347 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
371 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
372 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
373 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
374 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
375 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
376 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
377 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
378 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
379 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0.15
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0.45
Rhizoplane 2.25
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100317964 3300005563 Bacteria 1721
2 CNBas_1002638 3300000531 Bacteria 990
3 JGI24741J21665_1005803 3300001915 Bacteria 2537
4 JGI24740J21852_10025202 3300001979 Bacteria 2008
5 JGI24739J22299_10083690 3300001989 Bacteria 977
6 JGI24737J22298_10037650 3300001990 Bacteria 1490
7 JGI24743J22301_10019782 3300001991 Bacteria 1280
8 JGI24735J21928_10039500 3300002067 Bacteria 1380
9 JGI24738J21930_10024634 3300002075 Bacteria 1238
10 JGI24744J21845_10020892 3300002077 Bacteria 1289
11 JGI24744J21845_10021155 3300002077 Bacteria 1281
12 JGI24742J22300_10014723 3300002244 Bacteria 1314
13 rootH1_10029653 3300003316 Bacteria 20520
14 rootH1_10059892 3300003323 Eukaryota 1195
15 rootH1_10248231 3300003323 Bacteria 1290
16 rootH1_10391056 3300003323 Bacteria 1398
17 JGI26145J50221_1006346 3300003371 Bacteria 989
18 JGI26141J51220_1001820 3300003503 Bacteria 1297
19 JGI25405J52794_10017414 3300003911 Bacteria 1426
20 JGI25405J52794_10021469 3300003911 Bacteria 1305
21 Ga0065707_10160727 3300005295 Bacteria 1566
22 Ga0065707_10173730 3300005295 Bacteria 1443
23 Ga0070658_10183794 3300005327 Bacteria 1760
24 Ga0070676_10218617 3300005328 Unclassified 1257
25 Ga0070676_10250729 3300005328 Bacteria 1181
26 Ga0070683_100168841 3300005329 Unclassified 2076
27 Ga0070683_100317363 3300005329 Bacteria 1483
28 Ga0070683_100318742 3300005329 Bacteria 1479
29 Ga0070683_100358735 3300005329 Bacteria 1388
30 Ga0070690_100188074 3300005330 Bacteria 1430
31 Ga0070690_100207414 3300005330 Bacteria 1366
32 Ga0070670_100471184 3300005331 Bacteria 1114
33 Ga0070666_10204314 3300005335 Bacteria 1390
34 Ga0070680_100079573 3300005336 Unclassified 2701
35 Ga0070680_100276299 3300005336 Bacteria 1423
36 Ga0070682_100125460 3300005337 Bacteria 1729
37 Ga0070682_100147062 3300005337 Bacteria 1613
38 Ga0070682_100491649 3300005337 Bacteria 949
39 Ga0068868_100129166 3300005338 Bacteria 2066
40 Ga0068868_100172496 3300005338 Bacteria 1791
41 Ga0068868_100184859 3300005338 Bacteria 1731
42 Ga0068868_100190815 3300005338 Bacteria 1704
43 Ga0068868_100291008 3300005338 Bacteria 1385
44 Ga0070660_100132895 3300005339 Bacteria 1992
45 Ga0070660_100192058 3300005339 Bacteria 1654
46 Ga0070660_100259530 3300005339 Bacteria 1418
47 Ga0070660_100312104 3300005339 Bacteria 1290
48 Ga0070689_100210802 3300005340 Bacteria 1590
49 Ga0070691_10064108 3300005341 Bacteria 1773
50 Ga0070691_10116319 3300005341 Bacteria 1342
51 Ga0070691_10186500 3300005341 Bacteria 1082
52 Ga0070687_100126837 3300005343 Bacteria 1468
53 Ga0070687_100164642 3300005343 Bacteria 1314
54 Ga0070661_100145554 3300005344 Bacteria 1788
55 Ga0070661_100213996 3300005344 Bacteria 1476
56 Ga0070661_100215194 3300005344 Bacteria 1472
57 Ga0070692_10091867 3300005345 Bacteria 1651
58 Ga0070692_10094811 3300005345 Bacteria 1627
59 Ga0070692_10132721 3300005345 Bacteria 1401
60 Ga0070669_100189284 3300005353 Bacteria 1614
61 Ga0070675_100274245 3300005354 Unclassified 1481
62 Ga0070671_100180470 3300005355 Bacteria 1787
63 Ga0070674_100015959 3300005356 Bacteria 4701
64 Ga0070674_100220218 3300005356 Bacteria 1476
65 Ga0070673_100262772 3300005364 Bacteria 1508
66 Ga0070659_100187007 3300005366 Bacteria 1701
67 Ga0070659_100259584 3300005366 Bacteria 1441
68 Ga0070659_100323052 3300005366 Bacteria 1290
69 Ga0070659_100333589 3300005366 Unclassified 1270
70 Ga0070659_100358509 3300005366 Bacteria 1224
71 Ga0070667_100205763 3300005367 Bacteria 1747
72 Ga0070667_100348544 3300005367 Bacteria 1340
73 Ga0070709_10084145 3300005434 Bacteria 2083
74 Ga0070709_10096897 3300005434 Bacteria 1957
75 Ga0070709_10152827 3300005434 Unclassified 1597
76 Ga0070709_10219681 3300005434 Bacteria 1355
77 Ga0070714_100306088 3300005435 Bacteria 1482
78 Ga0070713_100169760 3300005436 Unclassified 1953
79 Ga0070713_100419965 3300005436 Bacteria 1252
80 Ga0070710_10099664 3300005437 Unclassified 1728
81 Ga0070710_10291786 3300005437 Bacteria 1062
82 Ga0070701_10155292 3300005438 Unclassified 1321
83 Ga0070711_100072586 3300005439 Unclassified 2429
84 Ga0070711_100096984 3300005439 Bacteria 2137
85 Ga0070711_100151576 3300005439 Bacteria 1749
86 Ga0070694_100149795 3300005444 Unclassified 1703
87 Ga0070694_100228037 3300005444 Bacteria 1400
88 Ga0070663_100026679 3300005455 Bacteria 3915
89 Ga0070663_100186029 3300005455 Bacteria 1614
90 Ga0070678_100238638 3300005456 Bacteria 1519
91 Ga0070662_100085551 3300005457 Bacteria 2356
92 Ga0070662_100242101 3300005457 Bacteria 1447
93 Ga0070662_100255482 3300005457 Bacteria 1410
94 Ga0070662_100271478 3300005457 Bacteria 1369
95 Ga0070681_10004918 3300005458 Bacteria 12833
96 Ga0070681_10185153 3300005458 Bacteria 2003
97 Ga0068867_100000092 3300005459 Bacteria 57643
98 Ga0068867_100152423 3300005459 Bacteria 1817
99 Ga0068867_100171372 3300005459 Unclassified 1719
100 Ga0068867_100232293 3300005459 Bacteria 1491
101 Ga0070685_10164244 3300005466 Bacteria 1418
102 Ga0070698_100199594 3300005471 Bacteria 1936
103 Ga0070698_100384543 3300005471 Unclassified 1336
104 Ga0070699_100217442 3300005518 Bacteria 1702
105 Ga0070699_100412463 3300005518 Bacteria 1222
106 Ga0070679_100059624 3300005530 Bacteria 3803
107 Ga0070679_100235909 3300005530 Bacteria 1788
108 Ga0070679_100306067 3300005530 Bacteria 1540
109 Ga0070684_100125322 3300005535 Unclassified 2313
110 Ga0070684_100153630 3300005535 Bacteria 2086
111 Ga0070684_100251844 3300005535 Bacteria 1614
112 Ga0068853_100100043 3300005539 Bacteria 2562
113 Ga0068853_100105605 3300005539 Unclassified 2495
114 Ga0068853_100232343 3300005539 Bacteria 1687
115 Ga0070672_100069536 3300005543 Bacteria 2795
116 Ga0070695_100191513 3300005545 Bacteria 1456
117 Ga0070695_100306078 3300005545 Unclassified 1176
118 Ga0070696_100340319 3300005546 Bacteria 1159
119 Ga0070693_100002524 3300005547 Bacteria 8435
120 Ga0070693_100054247 3300005547 Unclassified 2304
121 Ga0070704_100439631 3300005549 Bacteria 1121
122 Ga0068855_100294622 3300005563 Bacteria 1798
123 Ga0068855_100408803 3300005563 Bacteria 1486
124 Ga0070664_100164970 3300005564 Bacteria 1962
125 Ga0070664_100261432 3300005564 Bacteria 1557
126 Ga0070664_100267978 3300005564 Bacteria 1538
127 Ga0068857_100304205 3300005577 Bacteria 1470
128 Ga0068857_100394394 3300005577 Bacteria 1287
129 Ga0068854_100339570 3300005578 Bacteria 1226
130 Ga0068854_100349993 3300005578 Bacteria 1209
131 Ga0068856_100232665 3300005614 Bacteria 1858
132 Ga0068856_100272163 3300005614 Bacteria 1710
133 Ga0068856_100344568 3300005614 Bacteria 1508
134 Ga0068856_100359157 3300005614 Bacteria 1475
135 Ga0070702_100030974 3300005615 Bacteria 2922
136 Ga0070702_100095521 3300005615 Bacteria 1812
137 Ga0070702_100139576 3300005615 Unclassified 1542
138 Ga0068852_100221982 3300005616 Bacteria 1798
139 Ga0068852_100282052 3300005616 Bacteria 1602
140 Ga0068852_100282773 3300005616 Bacteria 1600
141 Ga0068852_100440671 3300005616 Bacteria 1288
142 Ga0068859_100846848 3300005617 Bacteria 1000
143 Ga0068864_100316268 3300005618 Unclassified 1465
144 Ga0068866_10010727 3300005718 Bacteria 3938
145 Ga0068866_10111213 3300005718 Bacteria 1529
146 Ga0068861_100069165 3300005719 Bacteria 2730
147 Ga0068861_100499640 3300005719 Bacteria 1099
148 Ga0068851_10072880 3300005834 Bacteria 1780
149 Ga0068851_10096108 3300005834 Bacteria 1566
150 Ga0068851_10136533 3300005834 Bacteria 1330
151 Ga0068851_10239521 3300005834 Bacteria 1025
152 Ga0068870_10233709 3300005840 Bacteria 1131
153 Ga0068863_100134970 3300005841 Bacteria 2357
154 Ga0068863_100246586 3300005841 Bacteria 1725
155 Ga0068858_100186731 3300005842 Bacteria 1958
156 Ga0068858_100187055 3300005842 Bacteria 1956
157 Ga0068858_100217470 3300005842 Bacteria 1809
158 Ga0068858_100297996 3300005842 Bacteria 1538
159 Ga0068860_100408175 3300005843 Bacteria 1345
160 Ga0068862_100236595 3300005844 Bacteria 1659
161 Ga0081455_10066448 3300005937 Bacteria 3011
162 Ga0070717_10267033 3300006028 Bacteria 1515
163 Ga0070715_10077569 3300006163 Bacteria 1500
164 Ga0070715_10163627 3300006163 Bacteria 1102
165 Ga0070712_100221608 3300006175 Unclassified 1498
166 Ga0070712_100253432 3300006175 Bacteria 1407
167 Ga0075366_10155556 3300006195 Bacteria 1385
168 Ga0097621_100334388 3300006237 Bacteria 1344
169 Ga0075370_10108619 3300006353 Bacteria 1610
170 Ga0068871_100197596 3300006358 Bacteria 1735
171 Ga0068871_100240403 3300006358 Bacteria 1574
172 Ga0068871_100251967 3300006358 Bacteria 1538
173 Ga0075428_100183714 3300006844 Bacteria 2263
174 Ga0075428_100493149 3300006844 Bacteria 1311
175 Ga0075430_100206264 3300006846 Bacteria 1631
176 Ga0075430_100222101 3300006846 Bacteria 1567
177 Ga0075430_100256084 3300006846 Bacteria 1450
178 Ga0075430_100278018 3300006846 Bacteria 1385
179 Ga0075430_100292650 3300006846 Unclassified 1347
180 Ga0075431_100246297 3300006847 Bacteria 1817
181 Ga0075431_100330821 3300006847 Bacteria 1534
182 Ga0075431_100380516 3300006847 Bacteria 1416
183 Ga0075434_100251736 3300006871 Bacteria 1786
184 Ga0075429_100194557 3300006880 Bacteria 1776
185 Ga0068865_100266311 3300006881 Bacteria 1359
186 Ga0097620_100846900 3300006931 Bacteria 1000
187 Ga0099795_10000009 3300007788 Bacteria 84256
188 Ga0105244_10063512 3300009036 Bacteria 1854
189 Ga0105240_10445628 3300009093 Bacteria 1450
190 Ga0105240_10540586 3300009093 Bacteria 1290
191 Ga0105240_10632522 3300009093 Bacteria 1175
192 Ga0111539_10257755 3300009094 Bacteria 2031
193 Ga0111539_10455551 3300009094 Bacteria 1490
194 Ga0111539_10517161 3300009094 Bacteria 1390
195 Ga0111539_10669306 3300009094 Bacteria 1209
196 Ga0111539_10738522 3300009094 Bacteria 1146
197 Ga0105245_10254127 3300009098 Bacteria 1708
198 Ga0105247_10171352 3300009101 Bacteria 1443
199 Ga0114129_10532608 3300009147 Bacteria 1530
200 Ga0114129_10563367 3300009147 Bacteria 1480
201 Ga0114129_10691524 3300009147 Bacteria 1312
202 Ga0105241_10104863 3300009174 Bacteria 2253
203 Ga0105241_10180118 3300009174 Bacteria 1752
204 Ga0105241_10436034 3300009174 Unclassified 1156
205 Ga0105241_10454181 3300009174 Bacteria 1134
206 Ga0105241_10514890 3300009174 Bacteria 1069
207 Ga0105242_10244489 3300009176 Bacteria 1615
208 Ga0105248_10326475 3300009177 Bacteria 1728
209 Ga0105248_10427552 3300009177 Bacteria 1491
210 Ga0105237_10003450 3300009545 Bacteria 18780
211 Ga0105237_10049120 3300009545 Bacteria 4242
212 Ga0105237_10104521 3300009545 Bacteria 2824
213 Ga0105237_10265354 3300009545 Bacteria 1720
214 Ga0105237_10362390 3300009545 Bacteria 1454
215 Ga0105238_10135481 3300009551 Bacteria 2440
216 Ga0105238_10177426 3300009551 Bacteria 2107
217 Ga0105238_10207818 3300009551 Bacteria 1933
218 Ga0105238_10446315 3300009551 Bacteria 1290
219 Ga0105249_10192017 3300009553 Bacteria 1994
220 Ga0099796_10000162 3300010159 Bacteria 9956
221 Ga0105239_10058193 3300010375 Unclassified 4241
222 Ga0105239_10097700 3300010375 Bacteria 3246
223 Ga0105239_10288856 3300010375 Bacteria 1847
224 Ga0105239_10385880 3300010375 Bacteria 1584
225 Ga0105239_10437645 3300010375 Bacteria 1482
226 Ga0105239_10569046 3300010375 Bacteria 1291
227 Ga0157373_10167746 3300013100 Bacteria 1545
228 Ga0157371_10096612 3300013102 Bacteria 2094
229 Ga0157370_10130890 3300013104 Bacteria 2340
230 Ga0157370_10472060 3300013104 Unclassified 1153
231 Ga0157369_10177149 3300013105 Unclassified 2244
232 Ga0157369_10225594 3300013105 Bacteria 1960
233 Ga0157369_10232651 3300013105 Bacteria 1926
234 Ga0157369_10477375 3300013105 Bacteria 1290
235 Ga0157369_10713887 3300013105 Bacteria 1032
236 Ga0157374_10233391 3300013296 Bacteria 1808
237 Ga0157374_10298247 3300013296 Unclassified 1594
238 Ga0157374_10330348 3300013296 Bacteria 1512
239 Ga0157378_10157640 3300013297 Bacteria 2120
240 Ga0157378_10298899 3300013297 Bacteria 1557
241 Ga0157378_10346644 3300013297 Bacteria 1450
242 Ga0163162_10337647 3300013306 Bacteria 1639
243 Ga0163162_10350361 3300013306 Bacteria 1609
244 Ga0157372_10228963 3300013307 Bacteria 2155
245 Ga0157372_10416366 3300013307 Bacteria 1566
246 Ga0157372_10484820 3300013307 Bacteria 1441
247 Ga0157372_10675236 3300013307 Bacteria 1203
248 Ga0157375_10143951 3300013308 Bacteria 2513
249 Ga0157375_10297652 3300013308 Bacteria 1777
250 Ga0163163_10089591 3300014325 Bacteria 3089
251 Ga0163163_10350124 3300014325 Bacteria 1533
252 Ga0157380_10261455 3300014326 Unclassified 1572
253 Ga0157380_10281063 3300014326 Bacteria 1523
254 Ga0157379_10195295 3300014968 Bacteria 1829
255 Ga0157379_10233053 3300014968 Bacteria 1669
256 Ga0157376_10221992 3300014969 Bacteria 1751
257 Ga0157376_10254462 3300014969 Bacteria 1642
258 Ga0213872_10050128 3300021361 Bacteria 1895
259 Ga0213874_10051151 3300021377 Bacteria 1268
260 Ga0207692_10065684 3300025898 Unclassified 1894
261 Ga0207692_10198163 3300025898 Bacteria 1179
262 Ga0207642_10119411 3300025899 Bacteria 1357
263 Ga0207642_10135458 3300025899 Bacteria 1291
264 Ga0207710_10183613 3300025900 Bacteria 1027
265 Ga0207688_10115291 3300025901 Bacteria 1563
266 Ga0207680_10249313 3300025903 Bacteria 1226
267 Ga0207647_10076554 3300025904 Bacteria 2012
268 Ga0207685_10070431 3300025905 Bacteria 1415
269 Ga0207685_10129244 3300025905 Unclassified 1119
270 Ga0207685_10139457 3300025905 Bacteria 1086
271 Ga0207699_10141716 3300025906 Bacteria 1581
272 Ga0207699_10143500 3300025906 Bacteria 1572
273 Ga0207699_10149521 3300025906 Bacteria 1544
274 Ga0207645_10077667 3300025907 Bacteria 2127
275 Ga0207643_10258039 3300025908 Bacteria 1075
276 Ga0207654_10156746 3300025911 Bacteria 1467
277 Ga0207654_10185498 3300025911 Unclassified 1360
278 Ga0207654_10246080 3300025911 Bacteria 1197
279 Ga0207654_10298489 3300025911 Bacteria 1095
280 Ga0207707_10017984 3300025912 Bacteria 6162
281 Ga0207707_10218679 3300025912 Bacteria 1658
282 Ga0207707_10307068 3300025912 Unclassified 1371
283 Ga0207707_10336471 3300025912 Bacteria 1302
284 Ga0207695_10129712 3300025913 Bacteria 2480
285 Ga0207671_10002638 3300025914 Bacteria 18848
286 Ga0207671_10226245 3300025914 Bacteria 1467
287 Ga0207671_10244099 3300025914 Bacteria 1411
288 Ga0207671_10291826 3300025914 Bacteria 1288
289 Ga0207671_10343981 3300025914 Bacteria 1182
290 Ga0207693_10068350 3300025915 Unclassified 2781
291 Ga0207693_10210923 3300025915 Bacteria 1527
292 Ga0207663_10105384 3300025916 Bacteria 1903
293 Ga0207663_10148028 3300025916 Bacteria 1644
294 Ga0207663_10218553 3300025916 Unclassified 1385
295 Ga0207660_10284464 3300025917 Bacteria 1313
296 Ga0207662_10126311 3300025918 Bacteria 1609
297 Ga0207662_10167120 3300025918 Bacteria 1409
298 Ga0207657_10111822 3300025919 Bacteria 2255
299 Ga0207657_10178827 3300025919 Bacteria 1716
300 Ga0207657_10190737 3300025919 Bacteria 1653
301 Ga0207657_10292886 3300025919 Bacteria 1290
302 Ga0207649_10119734 3300025920 Bacteria 1773
303 Ga0207649_10200015 3300025920 Bacteria 1411
304 Ga0207649_10333324 3300025920 Bacteria 1118
305 Ga0207652_10298214 3300025921 Bacteria 1455
306 Ga0207652_10336742 3300025921 Bacteria 1362
307 Ga0207652_10456783 3300025921 Bacteria 1151
308 Ga0207681_10227375 3300025923 Bacteria 1446
309 Ga0207694_10008021 3300025924 Bacteria 7987
310 Ga0207694_10267442 3300025924 Unclassified 1402
311 Ga0207694_10277939 3300025924 Bacteria 1375
312 Ga0207650_10148265 3300025925 Bacteria 1849
313 Ga0207650_10178853 3300025925 Bacteria 1690
314 Ga0207659_10255446 3300025926 Unclassified 1424
315 Ga0207687_10307270 3300025927 Bacteria 1279
316 Ga0207700_10267824 3300025928 Unclassified 1465
317 Ga0207664_10298288 3300025929 Bacteria 1417
318 Ga0207644_10299425 3300025931 Bacteria 1295
319 Ga0207690_10133384 3300025932 Bacteria 1821
320 Ga0207690_10216037 3300025932 Bacteria 1464
321 Ga0207690_10230850 3300025932 Bacteria 1420
322 Ga0207690_10283774 3300025932 Bacteria 1290
323 Ga0207706_10203899 3300025933 Bacteria 1734
324 Ga0207706_10241822 3300025933 Bacteria 1578
325 Ga0207686_10264577 3300025934 Bacteria 1262
326 Ga0207709_10002117 3300025935 Bacteria 12774
327 Ga0207709_10183751 3300025935 Bacteria 1479
328 Ga0207670_10434911 3300025936 Bacteria 1055
329 Ga0207669_10213526 3300025937 Bacteria 1410
330 Ga0207669_10446762 3300025937 Bacteria 1023
331 Ga0207704_10195331 3300025938 Bacteria 1476
332 Ga0207704_10210703 3300025938 Bacteria 1430
333 Ga0207691_10200332 3300025940 Bacteria 1738
334 Ga0207711_10409579 3300025941 Bacteria 1260
335 Ga0207689_10512686 3300025942 Bacteria 1005
336 Ga0207661_10077071 3300025944 Bacteria 2740
337 Ga0207661_10349869 3300025944 Bacteria 1333
338 Ga0207667_10087030 3300025949 Bacteria 3232
339 Ga0207667_10211428 3300025949 Bacteria 1988
340 Ga0207667_10292979 3300025949 Bacteria 1663
341 Ga0207667_10408632 3300025949 Bacteria 1382
342 Ga0207667_10434914 3300025949 Bacteria 1334
343 Ga0207667_10458789 3300025949 Bacteria 1294
344 Ga0207651_10215608 3300025960 Bacteria 1548
345 Ga0207712_10462716 3300025961 Bacteria 1078
346 Ga0207668_10106053 3300025972 Bacteria 2098
347 Ga0207640_10193085 3300025981 Bacteria 1536
348 Ga0207640_10382509 3300025981 Bacteria 1141
349 Ga0207658_10221653 3300025986 Bacteria 1591
350 Ga0207658_10258547 3300025986 Bacteria 1483
351 Ga0207658_10281564 3300025986 Bacteria 1425
352 Ga0207677_10110679 3300026023 Bacteria 2045
353 Ga0207677_10308518 3300026023 Bacteria 1310
354 Ga0207677_10309033 3300026023 Bacteria 1309
355 Ga0207703_10110406 3300026035 Bacteria 2346
356 Ga0207703_10285253 3300026035 Bacteria 1501
357 Ga0207703_10313561 3300026035 Bacteria 1434
358 Ga0207703_10349922 3300026035 Bacteria 1360
359 Ga0207703_10459594 3300026035 Bacteria 1190
360 Ga0207639_10205829 3300026041 Bacteria 1691
361 Ga0207639_10225738 3300026041 Unclassified 1620
362 Ga0207639_10252568 3300026041 Bacteria 1538
363 Ga0207639_10506932 3300026041 Bacteria 1103
364 Ga0207678_10137019 3300026067 Bacteria 2088
365 Ga0207678_10220643 3300026067 Bacteria 1623
366 Ga0207708_10032366 3300026075 Bacteria 3971
367 Ga0207702_10405653 3300026078 Bacteria 1315
368 Ga0207641_10186257 3300026088 Bacteria 1904
369 Ga0207648_10176324 3300026089 Bacteria 1891
370 Ga0207648_10298314 3300026089 Bacteria 1445
371 Ga0207676_10150376 3300026095 Bacteria 2004
372 Ga0207674_10184178 3300026116 Bacteria 2039
373 Ga0207674_10379639 3300026116 Bacteria 1366
374 Ga0207675_100067184 3300026118 Bacteria 3351
375 Ga0207683_10041047 3300026121 Bacteria 4039
376 Ga0207683_10208993 3300026121 Bacteria 1776
377 Ga0207698_10254165 3300026142 Bacteria 1610
378 Ga0207698_10311809 3300026142 Bacteria 1469
379 Ga0207698_10388633 3300026142 Bacteria 1330
380 Ga0207698_10434809 3300026142 Bacteria 1263
381 Ga0209973_1005262 3300027252 Bacteria 1369
382 Ga0209996_1008348 3300027395 Bacteria 1356
383 Ga0209984_1005731 3300027424 Bacteria 1503
384 Ga0209179_1000022 3300027512 Bacteria 42480
385 Ga0209982_1009183 3300027552 Bacteria 1458
386 Ga0210002_1007333 3300027617 Bacteria 1670
387 Ga0209971_1008241 3300027682 Bacteria 2471
388 Ga0209966_1007162 3300027695 Bacteria 1948
389 Ga0209974_10047139 3300027876 Bacteria 1443
390 Ga0268266_10361223 3300028379 Bacteria 1366
391 Ga0268266_10384585 3300028379 Bacteria 1324
392 Ga0268265_10362357 3300028380 Bacteria 1327
393 Ga0268264_10358609 3300028381 Bacteria 1390
394 Ga0265318_10061489 3300028577 Bacteria 1399
395 Ga0265336_10043637 3300028666 Bacteria 1366
396 Ga0307517_10148563 3300028786 Bacteria 1617
397 Ga0307515_10127724 3300028794 Bacteria 2826
398 Ga0307515_10301510 3300028794 Bacteria 1286
399 Ga0265338_10081877 3300028800 Unclassified 2704
400 Ga0265324_10028054 3300029957 Bacteria 1986
401 Ga0265324_10064071 3300029957 Bacteria 1254
402 Ga0265324_10064612 3300029957 Unclassified 1248
403 Ga0307512_10070122 3300030522 Bacteria 2613
404 Ga0265330_10083557 3300031235 Bacteria 1374
405 Ga0265328_10021886 3300031239 Bacteria 2436
406 Ga0265325_10046893 3300031241 Bacteria 2239
407 Ga0265325_10056059 3300031241 Bacteria 2013
408 Ga0265325_10114912 3300031241 Bacteria 1303
409 Ga0265329_10047522 3300031242 Bacteria 1369
410 Ga0265339_10136001 3300031249 Bacteria 1253
411 Ga0265331_10017709 3300031250 Bacteria 3709
412 Ga0265331_10094220 3300031250 Bacteria 1382
413 Ga0265327_10116504 3300031251 Bacteria 1270
414 Ga0265316_10203791 3300031344 Bacteria 1465
415 Ga0265316_10234789 3300031344 Bacteria 1349
416 Ga0307513_10264755 3300031456 Bacteria 1506
417 Ga0307513_10306462 3300031456 Bacteria 1352
418 Ga0307509_10173827 3300031507 Bacteria 2029
419 Ga0307509_10270565 3300031507 Bacteria 1467
420 Ga0307408_100003223 3300031548 Bacteria 11226
421 Ga0265313_10030417 3300031595 Bacteria 2780
422 Ga0265313_10085185 3300031595 Bacteria 1428
423 Ga0307508_10118771 3300031616 Bacteria 2246
424 Ga0307508_10189511 3300031616 Bacteria 1658
425 Ga0265314_10046776 3300031711 Bacteria 3051
426 Ga0265314_10136477 3300031711 Unclassified 1522
427 Ga0265314_10161212 3300031711 Bacteria 1364
428 Ga0265314_10190480 3300031711 Bacteria 1221
429 Ga0265342_10142082 3300031712 Bacteria 1339
430 Ga0307516_10000660 3300031730 Bacteria 46671
431 Ga0307410_10080397 3300031852 Bacteria 2286
432 Ga0307406_10220777 3300031901 Bacteria 1408
433 Ga0307406_10252946 3300031901 Bacteria 1328
434 Ga0307406_10279714 3300031901 Bacteria 1272
435 Ga0307407_10027806 3300031903 Bacteria 3015
436 Ga0307412_10295421 3300031911 Bacteria 1278
437 Ga0307409_100042009 3300031995 Bacteria 3420
438 Ga0307409_100149102 3300031995 Bacteria 2028
439 Ga0307416_100263084 3300032002 Bacteria 1687
440 Ga0307416_100405378 3300032002 Bacteria 1402
441 Ga0307414_10205032 3300032004 Bacteria 1607
442 Ga0307414_10532591 3300032004 Bacteria 1044
443 Ga0307411_10025149 3300032005 Bacteria 3562
444 Ga0307507_10145576 3300033179 Bacteria 1801
445 Ga0307507_10286316 3300033179 Unclassified 1025
446 Ga0373944_0021520 3300035089 Bacteria 1867
447 Ga0373952_0025613 3300035092 Unclassified 1275
448 Ga0373923_0053004 3300035111 Bacteria 1705
449 Ga0373923_0082961 3300035111 Bacteria 1392
450 Ga0373956_0185810 3300035119 Bacteria 983
451 Ga0373946_0107155 3300035171 Bacteria 1260
452 Ga0316574_0331582 3300035398 Bacteria 965
453 Ga0373924_0082400 3300035410 Bacteria 1369
454 Ga0373935_0123971 3300035692 Bacteria 1729
455 Ga0373935_0180177 3300035692 Bacteria 1450
456 Ga0373927_0078914 3300035695 Bacteria 2132
457 Ga0373927_0134993 3300035695 Bacteria 1612
458 Ga0373947_0192727 3300035725 Bacteria 1330
459 Ga0373937_0300217 3300036401 Bacteria 1518
460 Ga0373925_0131131 3300037068 Bacteria 1954
461 Ga0373925_0348852 3300037068 Bacteria 1201
462 Ga0395899_0076774 3300037312 Bacteria 2438
463 Ga0395900_0327600 3300037418 Bacteria 1510
464 Ga0395898_0344909 3300037466 Bacteria 1420
465 Ga0395905_0198221 3300037471 Bacteria 1882
466 Ga0395905_0198502 3300037471 Bacteria 1881
467 Ga0395905_0293056 3300037471 Bacteria 1514
468 Ga0400484_02357 3300038725 Bacteria 3009
469 Ga0400484_06571 3300038725 Bacteria 1706
470 Ga0400490_39490 3300038726 Bacteria 1385
471 Ga0400491_15066 3300038727 Bacteria 1052
472 Ga0400491_23471 3300038727 Bacteria 1353
473 Ga0400486_21577 3300038742 Bacteria 2494
474 Ga0400486_22799 3300038742 Bacteria 1193
475 Ga0242420_007389 3300038996 Bacteria 1761
476 Ga0400483_001262 3300039062 Bacteria 1079
477 Ga0400483_258315 3300039062 Bacteria 1218
478 Ga0400489_69284 3300039093 Bacteria 1025
479 Ga0400487_61262 3300039110 Bacteria 2124
480 Ga0436361_0641105 3300039447 Bacteria 2288
481 Ga0451807_2496734 3300041486 Bacteria 1608
482 Ga0451837_0182382 3300041494 Bacteria 1281
483 Ga0439448_0029127 3300042005 Bacteria 1746
484 Ga0439457_059644 3300042014 Bacteria 863
485 Ga0439459_0008968 3300042438 Bacteria 1721
486 Ga0439464_0055962 3300042439 Bacteria 1148
487 Ga0451577_0008226 3300042876 Bacteria 10168
488 Ga0451577_0023076 3300042876 Bacteria 5680
489 Ga0451577_0210650 3300042876 Unclassified 1755
490 Ga0451577_0313630 3300042876 Bacteria 1422
491 Ga0466969_0104078 3300044656 Bacteria 1333
492 Ga0466972_0108625 3300044658 Bacteria 1311
493 Ga0453683_0002187 3300044673 Bacteria 15548
494 Ga0453683_0057599 3300044673 Bacteria 2430
495 Ga0466965_0003458 3300044683 Bacteria 6925
496 Ga0466966_0012974 3300044684 Bacteria 5517
497 Ga0466966_0060383 3300044684 Bacteria 2393
498 Ga0466966_0148504 3300044684 Bacteria 1430
499 Ga0466961_0077503 3300044693 Bacteria 2105
500 Ga0453684_0001574 3300044712 Bacteria 63302
501 Ga0453684_0128920 3300044712 Bacteria 3038
502 Ga0453684_0258191 3300044712 Bacteria 1997
503 Ga0453684_0336106 3300044712 Bacteria 1707
504 Ga0453684_0549361 3300044712 Bacteria 1272
505 Ga0453684_0716089 3300044712 Bacteria 1086
506 Ga0453684_0804635 3300044712 Bacteria 1013
507 Ga0466971_0155608 3300044719 Bacteria 1068
508 Ga0466968_0035181 3300044735 Bacteria 2094
509 Ga0466970_0019810 3300044765 Bacteria 3491
510 Ga0466957_0067288 3300044842 Bacteria 2210
511 Ga0466960_0065436 3300044901 Bacteria 1795
512 Ga0466959_0178900 3300045049 Bacteria 1484
513 Ga0466959_0256694 3300045049 Bacteria 1204
514 Ga0451576_0249073 3300045051 Bacteria 1856
515 Ga0451576_0295910 3300045051 Bacteria 1692
516 Ga0466958_0038182 3300045836 Bacteria 2881
517 Ga0466958_0057895 3300045836 Bacteria 2355
518 Ga0495590_0062047 3300046457 Bacteria 1308
519 Ga0495629_0100139 3300046459 Bacteria 2022
520 Ga0495653_0141681 3300046463 Bacteria 1690
521 Ga0495650_0016521 3300046471 Bacteria 3736
522 Ga0495580_0196005 3300046472 Bacteria 1392
523 Ga0495582_0081116 3300046473 Bacteria 1801
524 Ga0495662_0041581 3300046476 Bacteria 2219
525 Ga0495664_0037323 3300046477 Bacteria 2867
526 Ga0495596_0060378 3300046500 Bacteria 1477
527 Ga0495606_0135373 3300046507 Bacteria 1460
528 Ga0495616_0180253 3300046513 Bacteria 939
529 Ga0495620_0077659 3300046515 Bacteria 1347
530 Ga0495666_0148480 3300046526 Bacteria 1091
531 Ga0495642_0093980 3300046528 Bacteria 1271
532 Ga0495665_0066204 3300046531 Bacteria 1907
533 Ga0495586_0070300 3300046535 Bacteria 1911
534 Ga0495587_0137132 3300046536 Bacteria 1397
535 Ga0495598_0040608 3300046537 Bacteria 1357
536 Ga0495656_0084814 3300046615 Bacteria 1437
537 Ga0495634_0250756 3300046642 Bacteria 1083
538 Ga0495657_0187461 3300046675 Bacteria 1266
539 Ga0495647_0060692 3300046681 Bacteria 1491
540 Ga0495658_0096024 3300046683 Bacteria 1762
541 Ga0495669_0101056 3300046684 Bacteria 1339
542 Ga0495613_0154291 3300046689 Bacteria 1636
543 Ga0495613_0188740 3300046689 Bacteria 1457
544 Ga0495649_0099736 3300046694 Bacteria 1544
545 Ga0495589_0074856 3300046794 Bacteria 1651
546 Ga0495660_0044603 3300046810 Bacteria 2438
547 Ga0495683_0018386 3300047323 Bacteria 3615
548 Ga0495615_0065179 3300048090 Bacteria 970
549 Ga0496100_0162501 3300048903 Bacteria 1602
550 Ga0496100_0180048 3300048903 Bacteria 1528
551 Ga0496103_0081119 3300048906 Bacteria 2040
552 Ga0496104_0360776 3300048907 Bacteria 1365
553 Ga0496105_0262153 3300048908 Bacteria 1397
554 Ga0496106_0175200 3300048909 Bacteria 1701
555 Ga0496106_0319348 3300048909 Bacteria 1246
556 Ga0496107_0184982 3300048910 Bacteria 1547
557 Ga0496107_0232918 3300048910 Bacteria 1370
558 Ga0496108_0222287 3300048911 Bacteria 1641
559 Ga0496109_0598698 3300048912 Bacteria 1038
560 Ga0496110_0283410 3300048913 Bacteria 1509
561 Ga0496110_0514666 3300048913 Bacteria 1089
562 Ga0496114_0300209 3300048917 Bacteria 1418
563 Ga0496117_0185351 3300048920 Bacteria 1191
564 Ga0496118_0084500 3300048921 Bacteria 2214
565 Ga0496118_0229833 3300048921 Bacteria 1071
566 Ga0496121_0000326 3300048924 Bacteria 99968
567 Ga0496121_0012521 3300048924 Bacteria 9235
568 Ga0496126_0313227 3300048929 Bacteria 1291
569 Ga0501290_009886 3300049513 Bacteria 1216
570 Ga0501294_004651 3300049517 Bacteria 1294
571 Ga0501297_013378 3300049520 Bacteria 962
572 Ga0501298_012861 3300049521 Bacteria 1473
573 Ga0501299_019428 3300049522 Bacteria 1229
574 Ga0501032_0024669 3300049569 Bacteria 4150
575 Ga0501032_0157370 3300049569 Bacteria 1492
576 Ga0501033_0038702 3300049570 Bacteria 3563
577 Ga0501033_0153283 3300049570 Bacteria 1661
578 Ga0501034_0368413 3300049571 Bacteria 1363
579 Ga0501034_0467782 3300049571 Unclassified 1177
580 Ga0501036_0187229 3300049572 Bacteria 1742
581 Ga0501037_0008132 3300049573 Bacteria 7685
582 Ga0501038_0010793 3300049574 Bacteria 8349
583 Ga0501038_0197055 3300049574 Bacteria 1618
584 Ga0501038_0218444 3300049574 Bacteria 1522
585 Ga0501039_0267668 3300049575 Bacteria 1343
586 Ga0501040_0214945 3300049576 Bacteria 1367
587 Ga0501043_0257002 3300049579 Bacteria 1344
588 Ga0501043_0288654 3300049579 Bacteria 1256
589 Ga0501043_0327235 3300049579 Bacteria 1168
590 Ga0501046_0154397 3300049580 Unclassified 1730
591 Ga0501047_0057461 3300049581 Bacteria 3762
592 Ga0501047_0143818 3300049581 Unclassified 2263
593 Ga0501048_0174117 3300049582 Bacteria 1525
594 Ga0501067_0214022 3300049583 Bacteria 1073
595 Ga0501068_0000978 3300049584 Bacteria 15011
596 Ga0501068_0162645 3300049584 Bacteria 1407
597 Ga0501068_0168532 3300049584 Bacteria 1381
598 Ga0501070_0156802 3300049586 Bacteria 1877
599 Ga0501070_0316335 3300049586 Bacteria 1270
600 Ga0501071_0303801 3300049587 Bacteria 1210
601 Ga0501072_0173848 3300049588 Bacteria 1718
602 Ga0501072_0270801 3300049588 Bacteria 1351
603 Ga0501072_0413398 3300049588 Bacteria 1070
604 Ga0501073_0038617 3300049589 Bacteria 3385
605 Ga0501074_0119992 3300049590 Bacteria 1880
606 Ga0501074_0241925 3300049590 Bacteria 1283
607 Ga0501075_0202838 3300049591 Bacteria 1512
608 Ga0501075_0259654 3300049591 Bacteria 1324
609 Ga0501076_0123046 3300049592 Bacteria 2101
610 Ga0501076_0167895 3300049592 Bacteria 1789
611 Ga0501076_0222008 3300049592 Bacteria 1544
612 Ga0501077_0174418 3300049593 Bacteria 1366
613 Ga0501077_0194467 3300049593 Bacteria 1289
614 Ga0501077_0219111 3300049593 Bacteria 1209
615 Ga0501249_027370 3300049679 Bacteria 1261
616 Ga0501259_016582 3300049688 Bacteria 1268
617 Ga0501261_012641 3300049690 Bacteria 1138
618 Ga0501079_0107326 3300049741 Bacteria 2167
619 Ga0501079_0258691 3300049741 Bacteria 1360
620 Ga0501079_0389066 3300049741 Bacteria 1093
621 Ga0501080_0071827 3300049742 Bacteria 3219
622 Ga0501080_0214093 3300049742 Unclassified 1765
623 Ga0501080_0237596 3300049742 Bacteria 1664
624 Ga0501081_0222922 3300049743 Bacteria 1371
625 Ga0501265_011146 3300049762 Bacteria 1106
626 Ga0501035_0076953 3300049822 Bacteria 2949
627 Ga0501044_0017260 3300049823 Bacteria 7742
628 nmdc:mga0k408_80709_c1 3300050493 Bacteria 1904
629 nmdc:mga07m45_7818_c1 3300050496 Bacteria 5471
630 nmdc:mga05p37_140182_c1 3300050507 Bacteria 2963
631 nmdc:mga05p37_286841_c1 3300050507 Bacteria 1961
632 nmdc:mga05p37_950187_c1 3300050507 Bacteria 920
633 nmdc:mga09592_215767_c1 3300050508 Bacteria 1663
634 nmdc:mga09592_505335_c1 3300050508 Bacteria 1040
635 nmdc:mga0qj67_217773_c1 3300050509 Bacteria 1550
636 nmdc:mga0qj67_265349_c1 3300050509 Bacteria 1393
637 nmdc:mga0qj67_265535_c1 3300050509 Bacteria 1392
638 nmdc:mga0qj67_74620_c1 3300050509 Bacteria 2710
639 nmdc:mga0qj67_92424_c1 3300050509 Bacteria 2433
640 nmdc:mga06r32_190467_c1 3300050510 Bacteria 2039
641 nmdc:mga06r32_312057_c1 3300050510 Bacteria 1558
642 nmdc:mga08y16_376574_c1 3300050511 Bacteria 1455
643 nmdc:mga08y16_397503_c1 3300050511 Bacteria 1411
644 nmdc:mga08y16_568392_c1 3300050511 Bacteria 1146
645 nmdc:mga0n895_270622_c1 3300050512 Bacteria 1723
646 Ga0495601_0323084 3300053077 Bacteria 1005
647 Ga0500554_015494 3300053102 Bacteria 1993
648 Ga0500593_043664 3300053117 Bacteria 2000
649 Ga0500559_0007464 3300053136 Bacteria 4842
650 Ga0501084_0208007 3300054114 Bacteria 1651
651 Ga0587079_016518 3300059647 Bacteria 1268
652 Ga0501082_0076466 3300060353 Bacteria 2886
653 Ga0466962_0007160 3300061719 Bacteria 5344
654 Ga0466962_0050529 3300061719 Bacteria 1987
655 Ga0530510_0203411 3300061734 Bacteria 1471
656 Ga0530510_0332460 3300061734 Bacteria 1140
657 Ga0530510_0371646 3300061734 Bacteria 1075
658 2513555387 2513237082 Bacteria 8640282
659 2585292471 2582581311 Bacteria 6763856
660 2817278787 2816332256 Bacteria 6891714
661 2817451863 2816332286 Bacteria 6853759
662 2870076038 2870068957 Bacteria 8925310
663 642596635 642555112 Bacteria 8676562
664 642596691 642555112 Bacteria 8676562
665 8020810623 8020807995 Bacteria 6801506
666 8040173264 8040167225 Bacteria 6542727
667 8040177193 8040173305 Bacteria 6827067
668 Ga0068855_100317964
669 CNBas_1002638
670 JGI24741J21665_1005803
671 JGI24740J21852_10025202
672 JGI24739J22299_10083690
673 JGI24737J22298_10037650
674 JGI24743J22301_10019782
675 JGI24735J21928_10039500
676 JGI24738J21930_10024634
677 JGI24744J21845_10020892
678 JGI24744J21845_10021155
679 JGI24742J22300_10014723
680 rootH1_10029653
681 rootH1_10059892
682 rootH1_10248231
683 rootH1_10391056
684 JGI26145J50221_1006346
685 JGI26141J51220_1001820
686 JGI25405J52794_10017414
687 JGI25405J52794_10021469
688 Ga0065707_10160727
689 Ga0065707_10173730
690 Ga0070658_10183794
691 Ga0070676_10218617
692 Ga0070676_10250729
693 Ga0070683_100168841
694 Ga0070683_100317363
695 Ga0070683_100318742
696 Ga0070683_100358735
697 Ga0070690_100188074
698 Ga0070690_100207414
699 Ga0070670_100471184
700 Ga0070666_10204314
701 Ga0070680_100079573
702 Ga0070680_100276299
703 Ga0070682_100125460
704 Ga0070682_100147062
705 Ga0070682_100491649
706 Ga0068868_100129166
707 Ga0068868_100172496
708 Ga0068868_100184859
709 Ga0068868_100190815
710 Ga0068868_100291008
711 Ga0070660_100132895
712 Ga0070660_100192058
713 Ga0070660_100259530
714 Ga0070660_100312104
715 Ga0070689_100210802
716 Ga0070691_10064108
717 Ga0070691_10116319
718 Ga0070691_10186500
719 Ga0070687_100126837
720 Ga0070687_100164642
721 Ga0070661_100145554
722 Ga0070661_100213996
723 Ga0070661_100215194
724 Ga0070692_10091867
725 Ga0070692_10094811
726 Ga0070692_10132721
727 Ga0070669_100189284
728 Ga0070675_100274245
729 Ga0070671_100180470
730 Ga0070674_100015959
731 Ga0070674_100220218
732 Ga0070673_100262772
733 Ga0070659_100187007
734 Ga0070659_100259584
735 Ga0070659_100323052
736 Ga0070659_100333589
737 Ga0070659_100358509
738 Ga0070667_100205763
739 Ga0070667_100348544
740 Ga0070709_10084145
741 Ga0070709_10096897
742 Ga0070709_10152827
743 Ga0070709_10219681
744 Ga0070714_100306088
745 Ga0070713_100169760
746 Ga0070713_100419965
747 Ga0070710_10099664
748 Ga0070710_10291786
749 Ga0070701_10155292
750 Ga0070711_100072586
751 Ga0070711_100096984
752 Ga0070711_100151576
753 Ga0070694_100149795
754 Ga0070694_100228037
755 Ga0070663_100026679
756 Ga0070663_100186029
757 Ga0070678_100238638
758 Ga0070662_100085551
759 Ga0070662_100242101
760 Ga0070662_100255482
761 Ga0070662_100271478
762 Ga0070681_10004918
763 Ga0070681_10185153
764 Ga0068867_100000092
765 Ga0068867_100152423
766 Ga0068867_100171372
767 Ga0068867_100232293
768 Ga0070685_10164244
769 Ga0070698_100199594
770 Ga0070698_100384543
771 Ga0070699_100217442
772 Ga0070699_100412463
773 Ga0070679_100059624
774 Ga0070679_100235909
775 Ga0070679_100306067
776 Ga0070684_100125322
777 Ga0070684_100153630
778 Ga0070684_100251844
779 Ga0068853_100100043
780 Ga0068853_100105605
781 Ga0068853_100232343
782 Ga0070672_100069536
783 Ga0070695_100191513
784 Ga0070695_100306078
785 Ga0070696_100340319
786 Ga0070693_100002524
787 Ga0070693_100054247
788 Ga0070704_100439631
789 Ga0068855_100294622
790 Ga0068855_100408803
791 Ga0070664_100164970
792 Ga0070664_100261432
793 Ga0070664_100267978
794 Ga0068857_100304205
795 Ga0068857_100394394
796 Ga0068854_100339570
797 Ga0068854_100349993
798 Ga0068856_100232665
799 Ga0068856_100272163
800 Ga0068856_100344568
801 Ga0068856_100359157
802 Ga0070702_100030974
803 Ga0070702_100095521
804 Ga0070702_100139576
805 Ga0068852_100221982
806 Ga0068852_100282052
807 Ga0068852_100282773
808 Ga0068852_100440671
809 Ga0068859_100846848
810 Ga0068864_100316268
811 Ga0068866_10010727
812 Ga0068866_10111213
813 Ga0068861_100069165
814 Ga0068861_100499640
815 Ga0068851_10072880
816 Ga0068851_10096108
817 Ga0068851_10136533
818 Ga0068851_10239521
819 Ga0068870_10233709
820 Ga0068863_100134970
821 Ga0068863_100246586
822 Ga0068858_100186731
823 Ga0068858_100187055
824 Ga0068858_100217470
825 Ga0068858_100297996
826 Ga0068860_100408175
827 Ga0068862_100236595
828 Ga0081455_10066448
829 Ga0070717_10267033
830 Ga0070715_10077569
831 Ga0070715_10163627
832 Ga0070712_100221608
833 Ga0070712_100253432
834 Ga0075366_10155556
835 Ga0097621_100334388
836 Ga0075370_10108619
837 Ga0068871_100197596
838 Ga0068871_100240403
839 Ga0068871_100251967
840 Ga0075428_100183714
841 Ga0075428_100493149
842 Ga0075430_100206264
843 Ga0075430_100222101
844 Ga0075430_100256084
845 Ga0075430_100278018
846 Ga0075430_100292650
847 Ga0075431_100246297
848 Ga0075431_100330821
849 Ga0075431_100380516
850 Ga0075434_100251736
851 Ga0075429_100194557
852 Ga0068865_100266311
853 Ga0097620_100846900
854 Ga0099795_10000009
855 Ga0105244_10063512
856 Ga0105240_10445628
857 Ga0105240_10540586
858 Ga0105240_10632522
859 Ga0111539_10257755
860 Ga0111539_10455551
861 Ga0111539_10517161
862 Ga0111539_10669306
863 Ga0111539_10738522
864 Ga0105245_10254127
865 Ga0105247_10171352
866 Ga0114129_10532608
867 Ga0114129_10563367
868 Ga0114129_10691524
869 Ga0105241_10104863
870 Ga0105241_10180118
871 Ga0105241_10436034
872 Ga0105241_10454181
873 Ga0105241_10514890
874 Ga0105242_10244489
875 Ga0105248_10326475
876 Ga0105248_10427552
877 Ga0105237_10003450
878 Ga0105237_10049120
879 Ga0105237_10104521
880 Ga0105237_10265354
881 Ga0105237_10362390
882 Ga0105238_10135481
883 Ga0105238_10177426
884 Ga0105238_10207818
885 Ga0105238_10446315
886 Ga0105249_10192017
887 Ga0099796_10000162
888 Ga0105239_10058193
889 Ga0105239_10097700
890 Ga0105239_10288856
891 Ga0105239_10385880
892 Ga0105239_10437645
893 Ga0105239_10569046
894 Ga0157373_10167746
895 Ga0157371_10096612
896 Ga0157370_10130890
897 Ga0157370_10472060
898 Ga0157369_10177149
899 Ga0157369_10225594
900 Ga0157369_10232651
901 Ga0157369_10477375
902 Ga0157369_10713887
903 Ga0157374_10233391
904 Ga0157374_10298247
905 Ga0157374_10330348
906 Ga0157378_10157640
907 Ga0157378_10298899
908 Ga0157378_10346644
909 Ga0163162_10337647
910 Ga0163162_10350361
911 Ga0157372_10228963
912 Ga0157372_10416366
913 Ga0157372_10484820
914 Ga0157372_10675236
915 Ga0157375_10143951
916 Ga0157375_10297652
917 Ga0163163_10089591
918 Ga0163163_10350124
919 Ga0157380_10261455
920 Ga0157380_10281063
921 Ga0157379_10195295
922 Ga0157379_10233053
923 Ga0157376_10221992
924 Ga0157376_10254462
925 Ga0213872_10050128
926 Ga0213874_10051151
927 Ga0207692_10065684
928 Ga0207692_10198163
929 Ga0207642_10119411
930 Ga0207642_10135458
931 Ga0207710_10183613
932 Ga0207688_10115291
933 Ga0207680_10249313
934 Ga0207647_10076554
935 Ga0207685_10070431
936 Ga0207685_10129244
937 Ga0207685_10139457
938 Ga0207699_10141716
939 Ga0207699_10143500
940 Ga0207699_10149521
941 Ga0207645_10077667
942 Ga0207643_10258039
943 Ga0207654_10156746
944 Ga0207654_10185498
945 Ga0207654_10246080
946 Ga0207654_10298489
947 Ga0207707_10017984
948 Ga0207707_10218679
949 Ga0207707_10307068
950 Ga0207707_10336471
951 Ga0207695_10129712
952 Ga0207671_10002638
953 Ga0207671_10226245
954 Ga0207671_10244099
955 Ga0207671_10291826
956 Ga0207671_10343981
957 Ga0207693_10068350
958 Ga0207693_10210923
959 Ga0207663_10105384
960 Ga0207663_10148028
961 Ga0207663_10218553
962 Ga0207660_10284464
963 Ga0207662_10126311
964 Ga0207662_10167120
965 Ga0207657_10111822
966 Ga0207657_10178827
967 Ga0207657_10190737
968 Ga0207657_10292886
969 Ga0207649_10119734
970 Ga0207649_10200015
971 Ga0207649_10333324
972 Ga0207652_10298214
973 Ga0207652_10336742
974 Ga0207652_10456783
975 Ga0207681_10227375
976 Ga0207694_10008021
977 Ga0207694_10267442
978 Ga0207694_10277939
979 Ga0207650_10148265
980 Ga0207650_10178853
981 Ga0207659_10255446
982 Ga0207687_10307270
983 Ga0207700_10267824
984 Ga0207664_10298288
985 Ga0207644_10299425
986 Ga0207690_10133384
987 Ga0207690_10216037
988 Ga0207690_10230850
989 Ga0207690_10283774
990 Ga0207706_10203899
991 Ga0207706_10241822
992 Ga0207686_10264577
993 Ga0207709_10002117
994 Ga0207709_10183751
995 Ga0207670_10434911
996 Ga0207669_10213526
997 Ga0207669_10446762
998 Ga0207704_10195331
999 Ga0207704_10210703
1000 Ga0207691_10200332
1001 Ga0207711_10409579
1002 Ga0207689_10512686
1003 Ga0207661_10077071
1004 Ga0207661_10349869
1005 Ga0207667_10087030
1006 Ga0207667_10211428
1007 Ga0207667_10292979
1008 Ga0207667_10408632
1009 Ga0207667_10434914
1010 Ga0207667_10458789
1011 Ga0207651_10215608
1012 Ga0207712_10462716
1013 Ga0207668_10106053
1014 Ga0207640_10193085
1015 Ga0207640_10382509
1016 Ga0207658_10221653
1017 Ga0207658_10258547
1018 Ga0207658_10281564
1019 Ga0207677_10110679
1020 Ga0207677_10308518
1021 Ga0207677_10309033
1022 Ga0207703_10110406
1023 Ga0207703_10285253
1024 Ga0207703_10313561
1025 Ga0207703_10349922
1026 Ga0207703_10459594
1027 Ga0207639_10205829
1028 Ga0207639_10225738
1029 Ga0207639_10252568
1030 Ga0207639_10506932
1031 Ga0207678_10137019
1032 Ga0207678_10220643
1033 Ga0207708_10032366
1034 Ga0207702_10405653
1035 Ga0207641_10186257
1036 Ga0207648_10176324
1037 Ga0207648_10298314
1038 Ga0207676_10150376
1039 Ga0207674_10184178
1040 Ga0207674_10379639
1041 Ga0207675_100067184
1042 Ga0207683_10041047
1043 Ga0207683_10208993
1044 Ga0207698_10254165
1045 Ga0207698_10311809
1046 Ga0207698_10388633
1047 Ga0207698_10434809
1048 Ga0209973_1005262
1049 Ga0209996_1008348
1050 Ga0209984_1005731
1051 Ga0209179_1000022
1052 Ga0209982_1009183
1053 Ga0210002_1007333
1054 Ga0209971_1008241
1055 Ga0209966_1007162
1056 Ga0209974_10047139
1057 Ga0268266_10361223
1058 Ga0268266_10384585
1059 Ga0268265_10362357
1060 Ga0268264_10358609
1061 Ga0265318_10061489
1062 Ga0265336_10043637
1063 Ga0307517_10148563
1064 Ga0307515_10127724
1065 Ga0307515_10301510
1066 Ga0265338_10081877
1067 Ga0265324_10028054
1068 Ga0265324_10064071
1069 Ga0265324_10064612
1070 Ga0307512_10070122
1071 Ga0265330_10083557
1072 Ga0265328_10021886
1073 Ga0265325_10046893
1074 Ga0265325_10056059
1075 Ga0265325_10114912
1076 Ga0265329_10047522
1077 Ga0265339_10136001
1078 Ga0265331_10017709
1079 Ga0265331_10094220
1080 Ga0265327_10116504
1081 Ga0265316_10203791
1082 Ga0265316_10234789
1083 Ga0307513_10264755
1084 Ga0307513_10306462
1085 Ga0307509_10173827
1086 Ga0307509_10270565
1087 Ga0307408_100003223
1088 Ga0265313_10030417
1089 Ga0265313_10085185
1090 Ga0307508_10118771
1091 Ga0307508_10189511
1092 Ga0265314_10046776
1093 Ga0265314_10136477
1094 Ga0265314_10161212
1095 Ga0265314_10190480
1096 Ga0265342_10142082
1097 Ga0307516_10000660
1098 Ga0307410_10080397
1099 Ga0307406_10220777
1100 Ga0307406_10252946
1101 Ga0307406_10279714
1102 Ga0307407_10027806
1103 Ga0307412_10295421
1104 Ga0307409_100042009
1105 Ga0307409_100149102
1106 Ga0307416_100263084
1107 Ga0307416_100405378
1108 Ga0307414_10205032
1109 Ga0307414_10532591
1110 Ga0307411_10025149
1111 Ga0307507_10145576
1112 Ga0307507_10286316
1113 Ga0373944_0021520
1114 Ga0373952_0025613
1115 Ga0373923_0053004
1116 Ga0373923_0082961
1117 Ga0373956_0185810
1118 Ga0373946_0107155
1119 Ga0316574_0331582
1120 Ga0373924_0082400
1121 Ga0373935_0123971
1122 Ga0373935_0180177
1123 Ga0373927_0078914
1124 Ga0373927_0134993
1125 Ga0373947_0192727
1126 Ga0373937_0300217
1127 Ga0373925_0131131
1128 Ga0373925_0348852
1129 Ga0395899_0076774
1130 Ga0395900_0327600
1131 Ga0395898_0344909
1132 Ga0395905_0198221
1133 Ga0395905_0198502
1134 Ga0395905_0293056
1135 Ga0400484_02357
1136 Ga0400484_06571
1137 Ga0400490_39490
1138 Ga0400491_15066
1139 Ga0400491_23471
1140 Ga0400486_21577
1141 Ga0400486_22799
1142 Ga0242420_007389
1143 Ga0400483_001262
1144 Ga0400483_258315
1145 Ga0400489_69284
1146 Ga0400487_61262
1147 Ga0436361_0641105
1148 Ga0451807_2496734
1149 Ga0451837_0182382
1150 Ga0439448_0029127
1151 Ga0439457_059644
1152 Ga0439459_0008968
1153 Ga0439464_0055962
1154 Ga0451577_0008226
1155 Ga0451577_0023076
1156 Ga0451577_0210650
1157 Ga0451577_0313630
1158 Ga0466969_0104078
1159 Ga0466972_0108625
1160 Ga0453683_0002187
1161 Ga0453683_0057599
1162 Ga0466965_0003458
1163 Ga0466966_0012974
1164 Ga0466966_0060383
1165 Ga0466966_0148504
1166 Ga0466961_0077503
1167 Ga0453684_0001574
1168 Ga0453684_0128920
1169 Ga0453684_0258191
1170 Ga0453684_0336106
1171 Ga0453684_0549361
1172 Ga0453684_0716089
1173 Ga0453684_0804635
1174 Ga0466971_0155608
1175 Ga0466968_0035181
1176 Ga0466970_0019810
1177 Ga0466957_0067288
1178 Ga0466960_0065436
1179 Ga0466959_0178900
1180 Ga0466959_0256694
1181 Ga0451576_0249073
1182 Ga0451576_0295910
1183 Ga0466958_0038182
1184 Ga0466958_0057895
1185 Ga0495590_0062047
1186 Ga0495629_0100139
1187 Ga0495653_0141681
1188 Ga0495650_0016521
1189 Ga0495580_0196005
1190 Ga0495582_0081116
1191 Ga0495662_0041581
1192 Ga0495664_0037323
1193 Ga0495596_0060378
1194 Ga0495606_0135373
1195 Ga0495616_0180253
1196 Ga0495620_0077659
1197 Ga0495666_0148480
1198 Ga0495642_0093980
1199 Ga0495665_0066204
1200 Ga0495586_0070300
1201 Ga0495587_0137132
1202 Ga0495598_0040608
1203 Ga0495656_0084814
1204 Ga0495634_0250756
1205 Ga0495657_0187461
1206 Ga0495647_0060692
1207 Ga0495658_0096024
1208 Ga0495669_0101056
1209 Ga0495613_0154291
1210 Ga0495613_0188740
1211 Ga0495649_0099736
1212 Ga0495589_0074856
1213 Ga0495660_0044603
1214 Ga0495683_0018386
1215 Ga0495615_0065179
1216 Ga0496100_0162501
1217 Ga0496100_0180048
1218 Ga0496103_0081119
1219 Ga0496104_0360776
1220 Ga0496105_0262153
1221 Ga0496106_0175200
1222 Ga0496106_0319348
1223 Ga0496107_0184982
1224 Ga0496107_0232918
1225 Ga0496108_0222287
1226 Ga0496109_0598698
1227 Ga0496110_0283410
1228 Ga0496110_0514666
1229 Ga0496114_0300209
1230 Ga0496117_0185351
1231 Ga0496118_0084500
1232 Ga0496118_0229833
1233 Ga0496121_0000326
1234 Ga0496121_0012521
1235 Ga0496126_0313227
1236 Ga0501290_009886
1237 Ga0501294_004651
1238 Ga0501297_013378
1239 Ga0501298_012861
1240 Ga0501299_019428
1241 Ga0501032_0024669
1242 Ga0501032_0157370
1243 Ga0501033_0038702
1244 Ga0501033_0153283
1245 Ga0501034_0368413
1246 Ga0501034_0467782
1247 Ga0501036_0187229
1248 Ga0501037_0008132
1249 Ga0501038_0010793
1250 Ga0501038_0197055
1251 Ga0501038_0218444
1252 Ga0501039_0267668
1253 Ga0501040_0214945
1254 Ga0501043_0257002
1255 Ga0501043_0288654
1256 Ga0501043_0327235
1257 Ga0501046_0154397
1258 Ga0501047_0057461
1259 Ga0501047_0143818
1260 Ga0501048_0174117
1261 Ga0501067_0214022
1262 Ga0501068_0000978
1263 Ga0501068_0162645
1264 Ga0501068_0168532
1265 Ga0501070_0156802
1266 Ga0501070_0316335
1267 Ga0501071_0303801
1268 Ga0501072_0173848
1269 Ga0501072_0270801
1270 Ga0501072_0413398
1271 Ga0501073_0038617
1272 Ga0501074_0119992
1273 Ga0501074_0241925
1274 Ga0501075_0202838
1275 Ga0501075_0259654
1276 Ga0501076_0123046
1277 Ga0501076_0167895
1278 Ga0501076_0222008
1279 Ga0501077_0174418
1280 Ga0501077_0194467
1281 Ga0501077_0219111
1282 Ga0501249_027370
1283 Ga0501259_016582
1284 Ga0501261_012641
1285 Ga0501079_0107326
1286 Ga0501079_0258691
1287 Ga0501079_0389066
1288 Ga0501080_0071827
1289 Ga0501080_0214093
1290 Ga0501080_0237596
1291 Ga0501081_0222922
1292 Ga0501265_011146
1293 Ga0501035_0076953
1294 Ga0501044_0017260
1295 nmdc:mga0k408_80709_c1
1296 nmdc:mga07m45_7818_c1
1297 nmdc:mga05p37_140182_c1
1298 nmdc:mga05p37_286841_c1
1299 nmdc:mga05p37_950187_c1
1300 nmdc:mga09592_215767_c1
1301 nmdc:mga09592_505335_c1
1302 nmdc:mga0qj67_217773_c1
1303 nmdc:mga0qj67_265349_c1
1304 nmdc:mga0qj67_265535_c1
1305 nmdc:mga0qj67_74620_c1
1306 nmdc:mga0qj67_92424_c1
1307 nmdc:mga06r32_190467_c1
1308 nmdc:mga06r32_312057_c1
1309 nmdc:mga08y16_376574_c1
1310 nmdc:mga08y16_397503_c1
1311 nmdc:mga08y16_568392_c1
1312 nmdc:mga0n895_270622_c1
1313 Ga0495601_0323084
1314 Ga0500554_015494
1315 Ga0500593_043664
1316 Ga0500559_0007464
1317 Ga0501084_0208007
1318 Ga0587079_016518
1319 Ga0501082_0076466
1320 Ga0466962_0007160
1321 Ga0466962_0050529
1322 Ga0530510_0203411
1323 Ga0530510_0332460
1324 Ga0530510_0371646
1325 2513555387
1326 2585292471
1327 2817278787
1328 2817451863
1329 2870076038
1330 642596635
1331 642596691
1332 8020810623
1333 8040173264
1334 8040177193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00665

rve

Integrase core domain

123

222

0.98

PF13683

rve_3

Integrase core domain

210

277

0.97

PF13333

rve_2

Integrase core domain

229

284

0.95

PF13276

HTH_21

HTH-like domain

41

100

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o03-assembly1.cif.gz_A-2 crystal structure of furb from m. tuberculosis- a zinc uptake regulator 0.8764 45 92
4mq3-assembly1.cif.gz_A the 1.1 angstrom structure of catalytic core domain of fiv integrase 0.8551 129 237
7ouf-assembly1.cif.gz_D structure of the stlv intasome:b56 complex bound to the strand-transfer inhibitor xz450 0.8397 124 236
3f2k-assembly2.cif.gz_B structure of the transposase domain of human histone-lysine n-methyltransferase setmar 0.8256 128 263
3oyi-assembly1.cif.gz_B crystal structure of the pfv s217q mutant intasome in complex with manganese 0.8192 124 282
ID Description Score Start End Superfamily
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9958 124 281 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9772 124 281 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9609 121 284 3.30.420.10
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9547 124 278 3.30.420.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9512 122 191 3.30.420.10
ID Description Score Start End GO Terms
AF-B4X0X2-F1-model_v4 Integrase catalytic domain-containing protein 0.9939 113 291 GO:0003676
GO:0015074
AF-A0A561FZN0-F1-model_v4 deleted 0.9902 113 292
AF-A0A2S7DTL5-F1-model_v4 IS3 family transposase 0.9892 116 226 GO:0003676
GO:0015074
AF-A0A0H2UZ75-F1-model_v4 IS600 ORF2 0.9866 133 289 GO:0003676
GO:0015074
AF-A0A4R2JZK9-F1-model_v4 Integrase-like protein 0.9855 127 291 GO:0003676
GO:0015074

Map