F473451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 391 | 586 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10304096|rootH2_103040964 |
| Length | 109 |
| Sequence | MIQQESRLAVADNSGAKEVLCIRVLGGTKRRYASVGDKIVVAVKSAMPSGRTRKEVRRPDGSYIRFDDNACVILNQAGEMRGTRIFGPVARELRENNYMKIVSLAPEVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 5 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 6 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 7 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 8 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 9 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 10 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 11 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 12 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 13 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 14 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 15 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 16 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 17 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 18 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 19 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 20 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 21 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 22 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 23 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 24 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 25 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 26 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 27 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 28 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 29 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 30 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 31 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 32 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 33 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 34 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 35 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 36 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 37 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 38 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 39 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 40 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 41 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 42 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 43 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 44 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 45 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 46 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 47 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 48 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 49 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 50 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 51 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 52 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 53 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 54 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 55 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 56 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 57 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 58 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 59 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 60 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 61 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 62 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 63 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 64 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 65 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 66 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 67 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 68 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 69 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 70 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 71 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 72 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 73 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 74 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 75 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 76 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 77 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 78 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 79 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 80 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 81 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 82 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 83 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 104 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 106 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 108 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 109 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 110 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 122 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 123 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 157 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 203 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 206 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 218 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 219 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300038634 | Barley rhizosphere microbial communities from Potsdam, Germany - 563_E | Metagenome | Rhizosphere |
| 232 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 233 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 234 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 235 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 236 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 237 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 238 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 240 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 242 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 251 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 252 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 253 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 256 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 257 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 258 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 261 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 262 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 263 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 264 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 265 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 266 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 269 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 346 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 351 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 353 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 354 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 355 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 356 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 365 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 366 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 367 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 368 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 369 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 372 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 373 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 374 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 376 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 388 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 389 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 390 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 391 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.96 |
| Metatranscriptomes | 15.56 |
| Isolates | 11.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 3.32 |
| Nodule | 1.06 |
| Rhizoplane | 3.93 |
| Rhizosphere | 77.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_9243 | 2124908027 | Bacteria | 1912 |
| 2 | SwRhRL2b_contig_2038936 | 2162886007 | Bacteria | 3057 |
| 3 | 2214748000 | 2209111006 | Bacteria | 3522 |
| 4 | rootH2_10083556 | 3300003320 | Bacteria | 2754 |
| 5 | rootH2_10110587 | 3300003320 | Bacteria | 3748 |
| 6 | rootH2_10304096 | 3300003320 | Bacteria | 1735 |
| 7 | rootL2_10155965 | 3300003322 | Bacteria | 1972 |
| 8 | rootH1_10127399 | 3300003323 | Bacteria | 5374 |
| 9 | Ga0007409J51694_1126710 | 3300003575 | Bacteria | 1168 |
| 10 | Ga0006562J51391_1003423 | 3300003578 | Bacteria | 13910 |
| 11 | Ga0006562J51391_1011740 | 3300003578 | Bacteria | 7760 |
| 12 | Ga0055534_1007293 | 3300003784 | Bacteria | 2655 |
| 13 | Ga0058860_10114316 | 3300004801 | Bacteria | 13584 |
| 14 | Ga0058860_10170387 | 3300004801 | Bacteria | 957 |
| 15 | Ga0065717_1002035 | 3300005276 | Bacteria | 3353 |
| 16 | Ga0065716_1001819 | 3300005277 | Bacteria | 3222 |
| 17 | Ga0065714_10036549 | 3300005288 | Bacteria | 822 |
| 18 | Ga0065714_10237306 | 3300005288 | Bacteria | 803 |
| 19 | Ga0065714_10261165 | 3300005288 | Bacteria | 755 |
| 20 | Ga0065714_10358298 | 3300005288 | Bacteria | 628 |
| 21 | Ga0065704_10008398 | 3300005289 | Bacteria | 2521 |
| 22 | Ga0065704_10084598 | 3300005289 | Bacteria | 3318 |
| 23 | Ga0065704_10138917 | 3300005289 | Bacteria | 1539 |
| 24 | Ga0065715_10018272 | 3300005293 | Bacteria | 1911 |
| 25 | Ga0065715_10037423 | 3300005293 | Bacteria | 1069 |
| 26 | Ga0070658_10957732 | 3300005327 | Bacteria | 744 |
| 27 | Ga0070683_100016581 | 3300005329 | Bacteria | 6501 |
| 28 | Ga0070682_100000608 | 3300005337 | Bacteria | 21759 |
| 29 | Ga0070682_100016944 | 3300005337 | Bacteria | 4241 |
| 30 | Ga0070660_100252297 | 3300005339 | Bacteria | 1439 |
| 31 | Ga0070689_100788474 | 3300005340 | Bacteria | 835 |
| 32 | Ga0070661_101056208 | 3300005344 | Bacteria | 675 |
| 33 | Ga0070669_100383263 | 3300005353 | Bacteria | 1147 |
| 34 | Ga0070675_100504902 | 3300005354 | Bacteria | 1090 |
| 35 | Ga0070671_100350358 | 3300005355 | Bacteria | 1260 |
| 36 | Ga0070674_100131904 | 3300005356 | Bacteria | 1864 |
| 37 | Ga0070673_100611304 | 3300005364 | Bacteria | 995 |
| 38 | Ga0070688_100041948 | 3300005365 | Bacteria | 2812 |
| 39 | Ga0070659_100301071 | 3300005366 | Bacteria | 1337 |
| 40 | Ga0070667_100285431 | 3300005367 | Bacteria | 1483 |
| 41 | Ga0070663_100261729 | 3300005455 | Bacteria | 1372 |
| 42 | Ga0070662_101330865 | 3300005457 | Bacteria | 618 |
| 43 | Ga0068867_100658048 | 3300005459 | Bacteria | 920 |
| 44 | Ga0070685_10022774 | 3300005466 | Bacteria | 3420 |
| 45 | Ga0074259_10545377 | 3300005507 | Bacteria | 969 |
| 46 | Ga0070684_100178514 | 3300005535 | Bacteria | 1930 |
| 47 | Ga0068855_100186174 | 3300005563 | Bacteria | 2345 |
| 48 | Ga0068857_100024669 | 3300005577 | Bacteria | 5295 |
| 49 | Ga0068854_100767782 | 3300005578 | Bacteria | 838 |
| 50 | Ga0068856_100083761 | 3300005614 | Bacteria | 3167 |
| 51 | Ga0068852_100066769 | 3300005616 | Bacteria | 3142 |
| 52 | Ga0068852_100504381 | 3300005616 | Bacteria | 1205 |
| 53 | Ga0068861_100901267 | 3300005719 | Bacteria | 837 |
| 54 | Ga0068863_102010948 | 3300005841 | Bacteria | 588 |
| 55 | Ga0070715_10142688 | 3300006163 | Bacteria | 1165 |
| 56 | Ga0070716_100075957 | 3300006173 | Bacteria | 1990 |
| 57 | Ga0075362_10023790 | 3300006177 | Bacteria | 2594 |
| 58 | Ga0075427_10018603 | 3300006194 | Bacteria | 1091 |
| 59 | Ga0097621_100105361 | 3300006237 | Bacteria | 2377 |
| 60 | Ga0097621_100417199 | 3300006237 | Bacteria | 1204 |
| 61 | Ga0075370_10445622 | 3300006353 | Bacteria | 779 |
| 62 | Ga0068871_100017988 | 3300006358 | Bacteria | 5361 |
| 63 | Ga0068871_101330227 | 3300006358 | Bacteria | 676 |
| 64 | Ga0099824_1003374 | 3300006942 | Bacteria | 23361 |
| 65 | Ga0079104_1000280 | 3300006946 | Bacteria | 65859 |
| 66 | Ga0099826_10000125 | 3300006948 | Bacteria | 34471 |
| 67 | Ga0105251_10027494 | 3300009011 | Bacteria | 2883 |
| 68 | Ga0105244_10000005 | 3300009036 | Bacteria | 481412 |
| 69 | Ga0105244_10017933 | 3300009036 | Bacteria | 3985 |
| 70 | Ga0105250_10077236 | 3300009092 | Bacteria | 1348 |
| 71 | Ga0105240_10552826 | 3300009093 | Bacteria | 1273 |
| 72 | Ga0105245_10022092 | 3300009098 | Bacteria | 5586 |
| 73 | Ga0105247_10162224 | 3300009101 | Bacteria | 1481 |
| 74 | Ga0105243_10077834 | 3300009148 | Bacteria | 2699 |
| 75 | Ga0105242_10023758 | 3300009176 | Bacteria | 4835 |
| 76 | Ga0105242_10252045 | 3300009176 | Bacteria | 1591 |
| 77 | Ga0105242_11557030 | 3300009176 | Bacteria | 693 |
| 78 | Ga0105249_10027670 | 3300009553 | Bacteria | 5116 |
| 79 | Ga0157339_1003659 | 3300012505 | Bacteria | 1123 |
| 80 | Ga0157373_10001369 | 3300013100 | Bacteria | 18710 |
| 81 | Ga0157373_10014797 | 3300013100 | Bacteria | 5716 |
| 82 | Ga0157373_10318379 | 3300013100 | Bacteria | 1106 |
| 83 | Ga0157373_10422990 | 3300013100 | Bacteria | 956 |
| 84 | Ga0157371_10000091 | 3300013102 | Bacteria | 144664 |
| 85 | Ga0157371_10001678 | 3300013102 | Bacteria | 22612 |
| 86 | Ga0157371_10039874 | 3300013102 | Bacteria | 3357 |
| 87 | Ga0157371_10130914 | 3300013102 | Bacteria | 1785 |
| 88 | Ga0157370_10019865 | 3300013104 | Bacteria | 6722 |
| 89 | Ga0157370_10082740 | 3300013104 | Bacteria | 3019 |
| 90 | Ga0157370_10136293 | 3300013104 | Bacteria | 2288 |
| 91 | Ga0157370_10282103 | 3300013104 | Bacteria | 1535 |
| 92 | Ga0157370_10344176 | 3300013104 | Bacteria | 1374 |
| 93 | Ga0157370_10976760 | 3300013104 | Bacteria | 767 |
| 94 | Ga0157370_11150941 | 3300013104 | Bacteria | 700 |
| 95 | Ga0157369_10000613 | 3300013105 | Bacteria | 46357 |
| 96 | Ga0157369_10010007 | 3300013105 | Bacteria | 10831 |
| 97 | Ga0157369_10134645 | 3300013105 | Bacteria | 2616 |
| 98 | Ga0157369_10350632 | 3300013105 | Bacteria | 1533 |
| 99 | Ga0157369_11148894 | 3300013105 | Bacteria | 793 |
| 100 | Ga0157374_10109918 | 3300013296 | Bacteria | 2651 |
| 101 | Ga0157374_11554346 | 3300013296 | Bacteria | 685 |
| 102 | Ga0157378_10243176 | 3300013297 | Bacteria | 1720 |
| 103 | Ga0157378_10398622 | 3300013297 | Bacteria | 1355 |
| 104 | Ga0163162_10336575 | 3300013306 | Bacteria | 1642 |
| 105 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 106 | Ga0157372_10419322 | 3300013307 | Bacteria | 1560 |
| 107 | Ga0157372_10693414 | 3300013307 | Bacteria | 1185 |
| 108 | Ga0157375_10037032 | 3300013308 | Bacteria | 4671 |
| 109 | Ga0157375_10069554 | 3300013308 | Bacteria | 3527 |
| 110 | Ga0157375_10111014 | 3300013308 | Bacteria | 2840 |
| 111 | Ga0157375_10170821 | 3300013308 | Bacteria | 2322 |
| 112 | Ga0163163_10396542 | 3300014325 | Bacteria | 1438 |
| 113 | Ga0163163_10851235 | 3300014325 | Bacteria | 975 |
| 114 | Ga0157380_10000051 | 3300014326 | Bacteria | 68466 |
| 115 | Ga0157380_10404335 | 3300014326 | Bacteria | 1296 |
| 116 | Ga0157380_12415281 | 3300014326 | Bacteria | 591 |
| 117 | Ga0157380_13443630 | 3300014326 | Bacteria | 506 |
| 118 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 119 | Ga0157377_11408202 | 3300014745 | Bacteria | 550 |
| 120 | Ga0157376_10034767 | 3300014969 | Bacteria | 4072 |
| 121 | Ga0157376_10337712 | 3300014969 | Bacteria | 1438 |
| 122 | Ga0182006_1000001 | 3300015261 | Bacteria | 1091090 |
| 123 | Ga0182006_1013176 | 3300015261 | Bacteria | 3594 |
| 124 | Ga0163161_10000039 | 3300017792 | Bacteria | 148130 |
| 125 | Ga0163161_10254078 | 3300017792 | Bacteria | 1371 |
| 126 | Ga0163161_10260107 | 3300017792 | Bacteria | 1355 |
| 127 | Ga0197907_10154472 | 3300020069 | Bacteria | 614 |
| 128 | Ga0197907_10422521 | 3300020069 | Bacteria | 1505 |
| 129 | Ga0206356_10849066 | 3300020070 | Bacteria | 1029 |
| 130 | Ga0206356_11071775 | 3300020070 | Bacteria | 843 |
| 131 | Ga0206351_10173698 | 3300020077 | Bacteria | 938 |
| 132 | Ga0206354_11169306 | 3300020081 | Bacteria | 551 |
| 133 | Ga0206354_11444727 | 3300020081 | Bacteria | 1198 |
| 134 | Ga0213872_10169445 | 3300021361 | Bacteria | 947 |
| 135 | Ga0224712_10000155 | 3300022467 | Bacteria | 11497 |
| 136 | Ga0224712_10012850 | 3300022467 | Bacteria | 2649 |
| 137 | Ga0256744_134753 | 3300023309 | Bacteria | 1048 |
| 138 | Ga0209675_1000115 | 3300025291 | Bacteria | 111981 |
| 139 | Ga0207655_1000016 | 3300025728 | Bacteria | 551476 |
| 140 | Ga0207655_1000038 | 3300025728 | Bacteria | 348340 |
| 141 | Ga0207713_1025586 | 3300025735 | Bacteria | 2721 |
| 142 | Ga0207705_10903848 | 3300025909 | Bacteria | 684 |
| 143 | Ga0207695_11149645 | 3300025913 | Bacteria | 656 |
| 144 | Ga0207650_10566732 | 3300025925 | Bacteria | 953 |
| 145 | Ga0207659_10706438 | 3300025926 | Bacteria | 863 |
| 146 | Ga0207687_10040627 | 3300025927 | Bacteria | 3189 |
| 147 | Ga0207644_10271630 | 3300025931 | Bacteria | 1359 |
| 148 | Ga0207706_10345074 | 3300025933 | Bacteria | 1295 |
| 149 | Ga0207686_10143611 | 3300025934 | Bacteria | 1653 |
| 150 | Ga0207686_10311130 | 3300025934 | Bacteria | 1173 |
| 151 | Ga0207709_10000084 | 3300025935 | Bacteria | 161002 |
| 152 | Ga0207665_10009076 | 3300025939 | Bacteria | 6528 |
| 153 | Ga0207665_10191290 | 3300025939 | Bacteria | 1487 |
| 154 | Ga0207661_10011066 | 3300025944 | Bacteria | 6521 |
| 155 | Ga0207667_10242056 | 3300025949 | Bacteria | 1846 |
| 156 | Ga0207667_10965088 | 3300025949 | Bacteria | 841 |
| 157 | Ga0207712_10050092 | 3300025961 | Bacteria | 2914 |
| 158 | Ga0207668_10084113 | 3300025972 | Bacteria | 2317 |
| 159 | Ga0207640_10320442 | 3300025981 | Bacteria | 1234 |
| 160 | Ga0207658_11099338 | 3300025986 | Bacteria | 726 |
| 161 | Ga0207639_10616274 | 3300026041 | Bacteria | 1002 |
| 162 | Ga0207678_10276208 | 3300026067 | Bacteria | 1441 |
| 163 | Ga0207702_10111476 | 3300026078 | Bacteria | 2433 |
| 164 | Ga0207648_10334177 | 3300026089 | Bacteria | 1363 |
| 165 | Ga0207648_10601554 | 3300026089 | Bacteria | 1013 |
| 166 | Ga0207676_10521873 | 3300026095 | Bacteria | 1131 |
| 167 | Ga0207674_10033610 | 3300026116 | Bacteria | 5367 |
| 168 | Ga0207683_10546231 | 3300026121 | Bacteria | 1071 |
| 169 | Ga0207698_10870094 | 3300026142 | Bacteria | 907 |
| 170 | Ga0207698_11298122 | 3300026142 | Bacteria | 742 |
| 171 | Ga0209281_1000337 | 3300027111 | Bacteria | 79938 |
| 172 | Ga0209969_1029826 | 3300027360 | Bacteria | 832 |
| 173 | Ga0209489_111364 | 3300027361 | Bacteria | 9138 |
| 174 | Ga0209995_1006210 | 3300027471 | Bacteria | 1920 |
| 175 | Ga0209982_1085430 | 3300027552 | Bacteria | 522 |
| 176 | Ga0210002_1001591 | 3300027617 | Bacteria | 3225 |
| 177 | Ga0209282_1028939 | 3300027666 | Bacteria | 3426 |
| 178 | Ga0209971_1038687 | 3300027682 | Bacteria | 1149 |
| 179 | Ga0209974_10026106 | 3300027876 | Bacteria | 1934 |
| 180 | Ga0268265_11164139 | 3300028380 | Bacteria | 768 |
| 181 | Ga0265319_1145650 | 3300028563 | Bacteria | 734 |
| 182 | Ga0265334_10002690 | 3300028573 | Bacteria | 8214 |
| 183 | Ga0265318_10075189 | 3300028577 | Bacteria | 1250 |
| 184 | Ga0265322_10153338 | 3300028654 | Bacteria | 659 |
| 185 | Ga0307517_10392082 | 3300028786 | Bacteria | 738 |
| 186 | Ga0265327_10089061 | 3300031251 | Bacteria | 1508 |
| 187 | Ga0265327_10108010 | 3300031251 | Bacteria | 1333 |
| 188 | Ga0265316_10545136 | 3300031344 | Bacteria | 826 |
| 189 | Ga0307408_100000648 | 3300031548 | Bacteria | 29197 |
| 190 | Ga0307408_100008863 | 3300031548 | Bacteria | 6645 |
| 191 | Ga0316575_10126011 | 3300031665 | Bacteria | 1049 |
| 192 | Ga0316575_10135485 | 3300031665 | Bacteria | 1012 |
| 193 | Ga0316579_10111616 | 3300031691 | Bacteria | 1312 |
| 194 | Ga0316576_10001965 | 3300031727 | Bacteria | 11485 |
| 195 | Ga0316576_10007854 | 3300031727 | Bacteria | 6745 |
| 196 | Ga0316576_10022758 | 3300031727 | Bacteria | 4356 |
| 197 | Ga0316576_10056945 | 3300031727 | Bacteria | 2856 |
| 198 | Ga0316576_10079789 | 3300031727 | Bacteria | 2426 |
| 199 | Ga0316576_10143122 | 3300031727 | Bacteria | 1800 |
| 200 | Ga0316576_10195389 | 3300031727 | Bacteria | 1525 |
| 201 | Ga0316576_10308688 | 3300031727 | Bacteria | 1181 |
| 202 | Ga0316576_10440167 | 3300031727 | Bacteria | 963 |
| 203 | Ga0316576_10471429 | 3300031727 | Bacteria | 926 |
| 204 | Ga0316576_10590477 | 3300031727 | Bacteria | 811 |
| 205 | Ga0316578_10040210 | 3300031728 | Bacteria | 2702 |
| 206 | Ga0316578_10172214 | 3300031728 | Bacteria | 1305 |
| 207 | Ga0316578_10191968 | 3300031728 | Bacteria | 1230 |
| 208 | Ga0316578_10382861 | 3300031728 | Bacteria | 835 |
| 209 | Ga0307516_10472537 | 3300031730 | Bacteria | 909 |
| 210 | Ga0307405_10000005 | 3300031731 | Bacteria | 376536 |
| 211 | Ga0307405_10002019 | 3300031731 | Bacteria | 8799 |
| 212 | Ga0307405_10421117 | 3300031731 | Bacteria | 1051 |
| 213 | Ga0316577_10008426 | 3300031733 | Bacteria | 5526 |
| 214 | Ga0316577_10282184 | 3300031733 | Bacteria | 940 |
| 215 | Ga0316577_10512789 | 3300031733 | Bacteria | 682 |
| 216 | Ga0307413_10001014 | 3300031824 | Bacteria | 10155 |
| 217 | Ga0307413_10001307 | 3300031824 | Bacteria | 9311 |
| 218 | Ga0307413_10412951 | 3300031824 | Bacteria | 1061 |
| 219 | Ga0307410_10000034 | 3300031852 | Bacteria | 48449 |
| 220 | Ga0307406_10000004 | 3300031901 | Bacteria | 179772 |
| 221 | Ga0307407_10000196 | 3300031903 | Bacteria | 18233 |
| 222 | Ga0307412_10000088 | 3300031911 | Bacteria | 82058 |
| 223 | Ga0307412_10048579 | 3300031911 | Bacteria | 2791 |
| 224 | Ga0307412_10127716 | 3300031911 | Bacteria | 1841 |
| 225 | Ga0307416_100000006 | 3300032002 | Bacteria | 466074 |
| 226 | Ga0307416_100534132 | 3300032002 | Bacteria | 1243 |
| 227 | Ga0307414_10000011 | 3300032004 | Bacteria | 338253 |
| 228 | Ga0307414_10000030 | 3300032004 | Bacteria | 187373 |
| 229 | Ga0307414_10000673 | 3300032004 | Bacteria | 17502 |
| 230 | Ga0307414_10009268 | 3300032004 | Bacteria | 5644 |
| 231 | Ga0307414_10011571 | 3300032004 | Bacteria | 5180 |
| 232 | Ga0307411_10000004 | 3300032005 | Bacteria | 460327 |
| 233 | Ga0307411_10001861 | 3300032005 | Bacteria | 8973 |
| 234 | Ga0307411_10342908 | 3300032005 | Bacteria | 1215 |
| 235 | Ga0316585_10002058 | 3300032137 | Bacteria | 5395 |
| 236 | Ga0316580_10061015 | 3300032139 | Bacteria | 1158 |
| 237 | Ga0316580_10191347 | 3300032139 | Bacteria | 630 |
| 238 | Ga0316593_10000201 | 3300032168 | Bacteria | 9314 |
| 239 | Ga0316593_10000279 | 3300032168 | Bacteria | 8591 |
| 240 | Ga0316593_10008603 | 3300032168 | Bacteria | 2851 |
| 241 | Ga0316593_10023936 | 3300032168 | Bacteria | 1932 |
| 242 | Ga0316593_10034814 | 3300032168 | Bacteria | 1654 |
| 243 | Ga0316593_10091142 | 3300032168 | Bacteria | 1073 |
| 244 | Ga0316593_10144490 | 3300032168 | Bacteria | 863 |
| 245 | Ga0316593_10185806 | 3300032168 | Bacteria | 765 |
| 246 | Ga0316593_10255095 | 3300032168 | Bacteria | 657 |
| 247 | Ga0316592_1000022 | 3300033524 | Bacteria | 11920 |
| 248 | Ga0316592_1001616 | 3300033524 | Bacteria | 3695 |
| 249 | Ga0316592_1002393 | 3300033524 | Bacteria | 3237 |
| 250 | Ga0316592_1002839 | 3300033524 | Bacteria | 3046 |
| 251 | Ga0316592_1070858 | 3300033524 | Bacteria | 788 |
| 252 | Ga0316592_1083227 | 3300033524 | Bacteria | 729 |
| 253 | Ga0316592_1085405 | 3300033524 | Bacteria | 720 |
| 254 | Ga0316592_1106193 | 3300033524 | Bacteria | 648 |
| 255 | Ga0316592_1163458 | 3300033524 | Bacteria | 528 |
| 256 | Ga0316586_1000693 | 3300033527 | Bacteria | 3408 |
| 257 | Ga0316586_1009017 | 3300033527 | Bacteria | 1488 |
| 258 | Ga0316586_1018756 | 3300033527 | Bacteria | 1125 |
| 259 | Ga0316588_1000386 | 3300033528 | Bacteria | 5801 |
| 260 | Ga0316588_1015940 | 3300033528 | Bacteria | 1660 |
| 261 | Ga0316588_1098096 | 3300033528 | Bacteria | 733 |
| 262 | Ga0316588_1170596 | 3300033528 | Bacteria | 562 |
| 263 | Ga0316596_1000106 | 3300033541 | Bacteria | 10634 |
| 264 | Ga0316596_1001043 | 3300033541 | Bacteria | 5368 |
| 265 | Ga0316596_1003921 | 3300033541 | Bacteria | 3297 |
| 266 | Ga0316596_1010716 | 3300033541 | Bacteria | 2226 |
| 267 | Ga0316596_1015079 | 3300033541 | Bacteria | 1923 |
| 268 | Ga0316596_1016318 | 3300033541 | Bacteria | 1859 |
| 269 | Ga0316596_1016886 | 3300033541 | Bacteria | 1830 |
| 270 | Ga0316596_1017057 | 3300033541 | Bacteria | 1823 |
| 271 | Ga0316596_1022402 | 3300033541 | Bacteria | 1615 |
| 272 | Ga0316596_1025223 | 3300033541 | Bacteria | 1529 |
| 273 | Ga0316596_1025532 | 3300033541 | Bacteria | 1520 |
| 274 | Ga0316596_1033278 | 3300033541 | Bacteria | 1342 |
| 275 | Ga0316596_1038943 | 3300033541 | Bacteria | 1247 |
| 276 | Ga0316596_1085516 | 3300033541 | Bacteria | 849 |
| 277 | Ga0316596_1120303 | 3300033541 | Bacteria | 715 |
| 278 | Ga0316596_1123660 | 3300033541 | Bacteria | 705 |
| 279 | Ga0316596_1149703 | 3300033541 | Bacteria | 641 |
| 280 | Ga0316574_0007562 | 3300035398 | Bacteria | 5965 |
| 281 | Ga0316574_0051935 | 3300035398 | Bacteria | 2556 |
| 282 | Ga0316574_0065061 | 3300035398 | Bacteria | 2295 |
| 283 | Ga0316574_0104645 | 3300035398 | Bacteria | 1812 |
| 284 | Ga0316574_0114903 | 3300035398 | Bacteria | 1726 |
| 285 | Ga0316574_0116099 | 3300035398 | Bacteria | 1717 |
| 286 | Ga0316574_0129961 | 3300035398 | Bacteria | 1620 |
| 287 | Ga0316574_0136060 | 3300035398 | Bacteria | 1582 |
| 288 | Ga0316574_0247646 | 3300035398 | Bacteria | 1139 |
| 289 | Ga0316574_0260030 | 3300035398 | Bacteria | 1108 |
| 290 | Ga0316574_0287960 | 3300035398 | Bacteria | 1046 |
| 291 | Ga0373937_0174104 | 3300036401 | Bacteria | 2020 |
| 292 | Ga0373937_1690625 | 3300036401 | Bacteria | 580 |
| 293 | Ga0316582_0032668 | 3300036647 | Bacteria | 3191 |
| 294 | Ga0316582_0179690 | 3300036647 | Bacteria | 1439 |
| 295 | Ga0316582_0884432 | 3300036647 | Bacteria | 611 |
| 296 | Ga0316582_1094745 | 3300036647 | Bacteria | 543 |
| 297 | Ga0316584_0015050 | 3300036712 | Bacteria | 5526 |
| 298 | Ga0316584_0037517 | 3300036712 | Bacteria | 3601 |
| 299 | Ga0316584_0315205 | 3300036712 | Bacteria | 1130 |
| 300 | Ga0316584_0493162 | 3300036712 | Bacteria | 861 |
| 301 | Ga0316584_0562441 | 3300036712 | Bacteria | 795 |
| 302 | Ga0316584_0784661 | 3300036712 | Bacteria | 648 |
| 303 | Ga0395899_0000673 | 3300037312 | Bacteria | 34566 |
| 304 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 305 | Ga0395905_1230617 | 3300037471 | Bacteria | 652 |
| 306 | Ga0395901_0045223 | 3300038443 | Bacteria | 4568 |
| 307 | Ga0246641_01883 | 3300038634 | Bacteria | 531 |
| 308 | Ga0400483_151094 | 3300039062 | Bacteria | 1144 |
| 309 | Ga0400489_59783 | 3300039093 | Bacteria | 3534 |
| 310 | Ga0400489_64897 | 3300039093 | Bacteria | 1094 |
| 311 | Ga0400489_83287 | 3300039093 | Bacteria | 1093 |
| 312 | Ga0400489_84188 | 3300039093 | Bacteria | 1194 |
| 313 | Ga0436361_1216877 | 3300039447 | Bacteria | 1828 |
| 314 | Ga0439447_000447 | 3300041407 | Bacteria | 15369 |
| 315 | Ga0439466_0004165 | 3300041411 | Bacteria | 5582 |
| 316 | Ga0439466_0057610 | 3300041411 | Bacteria | 1258 |
| 317 | Ga0439465_0000032 | 3300041413 | Bacteria | 28481 |
| 318 | Ga0451787_107116 | 3300041441 | Bacteria | 1506 |
| 319 | Ga0451788_01017 | 3300041442 | Bacteria | 629 |
| 320 | Ga0451789_1079854 | 3300041443 | Bacteria | 1013 |
| 321 | Ga0451790_34212 | 3300041444 | Bacteria | 1648 |
| 322 | Ga0451790_47773 | 3300041444 | Bacteria | 761 |
| 323 | Ga0451791_1675939 | 3300041451 | Bacteria | 2636 |
| 324 | Ga0451793_0652381 | 3300041452 | Bacteria | 1003 |
| 325 | Ga0451795_0319454 | 3300041456 | Bacteria | 1156 |
| 326 | Ga0451795_0547905 | 3300041456 | Bacteria | 1097 |
| 327 | Ga0451795_0935357 | 3300041456 | Bacteria | 2876 |
| 328 | Ga0451795_1028677 | 3300041456 | Bacteria | 991 |
| 329 | Ga0451795_1130714 | 3300041456 | Bacteria | 1482 |
| 330 | Ga0451795_1402022 | 3300041456 | Bacteria | 1160 |
| 331 | Ga0451795_1545671 | 3300041456 | Bacteria | 828 |
| 332 | Ga0451795_1714813 | 3300041456 | Bacteria | 1218 |
| 333 | Ga0451798_0435092 | 3300041458 | Bacteria | 601 |
| 334 | Ga0451800_1256493 | 3300041459 | Bacteria | 613 |
| 335 | Ga0451802_0457191 | 3300041460 | Bacteria | 518 |
| 336 | Ga0451805_017120 | 3300041461 | Bacteria | 742 |
| 337 | Ga0451807_1997617 | 3300041486 | Bacteria | 749 |
| 338 | Ga0451833_0933881 | 3300041491 | Bacteria | 528 |
| 339 | Ga0451837_0125275 | 3300041494 | Bacteria | 605 |
| 340 | Ga0451837_0568756 | 3300041494 | Bacteria | 1142 |
| 341 | Ga0451837_1056715 | 3300041494 | Bacteria | 8321 |
| 342 | Ga0451837_1777468 | 3300041494 | Bacteria | 559 |
| 343 | Ga0451841_1428716 | 3300041498 | Bacteria | 2652 |
| 344 | Ga0451847_0714976 | 3300041503 | Bacteria | 876 |
| 345 | Ga0451849_1512452 | 3300041505 | Bacteria | 1002 |
| 346 | Ga0451851_0977032 | 3300041507 | Bacteria | 1041 |
| 347 | Ga0451852_01884 | 3300041508 | Bacteria | 1812 |
| 348 | Ga0451852_06600 | 3300041508 | Bacteria | 1121 |
| 349 | Ga0451852_28525 | 3300041508 | Bacteria | 1937 |
| 350 | Ga0451843_0112769 | 3300041509 | Bacteria | 2212 |
| 351 | Ga0451855_0000118 | 3300041511 | Bacteria | 662 |
| 352 | Ga0451855_0331224 | 3300041511 | Bacteria | 585 |
| 353 | Ga0451855_0405167 | 3300041511 | Bacteria | 759 |
| 354 | Ga0451855_0436544 | 3300041511 | Bacteria | 611 |
| 355 | Ga0451855_0737901 | 3300041511 | Bacteria | 986 |
| 356 | Ga0451855_0887620 | 3300041511 | Bacteria | 795 |
| 357 | Ga0451855_0898775 | 3300041511 | Bacteria | 828 |
| 358 | Ga0451855_1113143 | 3300041511 | Bacteria | 522 |
| 359 | Ga0451855_1478956 | 3300041511 | Bacteria | 579 |
| 360 | Ga0451855_1705115 | 3300041511 | Bacteria | 739 |
| 361 | Ga0451855_1986715 | 3300041511 | Bacteria | 565 |
| 362 | Ga0451853_3298037 | 3300041512 | Bacteria | 1007 |
| 363 | Ga0439445_0000090 | 3300042004 | Bacteria | 14230 |
| 364 | Ga0439445_0001316 | 3300042004 | Bacteria | 5367 |
| 365 | Ga0439432_088233 | 3300042006 | Bacteria | 935 |
| 366 | Ga0450891_009933 | 3300042129 | Bacteria | 877 |
| 367 | Ga0450906_044160 | 3300042145 | Bacteria | 787 |
| 368 | Ga0439446_0111787 | 3300042156 | Bacteria | 872 |
| 369 | Ga0439434_0048824 | 3300042435 | Bacteria | 1310 |
| 370 | Ga0439435_0134617 | 3300042436 | Bacteria | 783 |
| 371 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 372 | Ga0451577_0000433 | 3300042876 | Bacteria | 74789 |
| 373 | Ga0451577_0002272 | 3300042876 | Bacteria | 23243 |
| 374 | Ga0451577_0005144 | 3300042876 | Bacteria | 13458 |
| 375 | Ga0451577_0038846 | 3300042876 | Bacteria | 4280 |
| 376 | Ga0451577_0080589 | 3300042876 | Bacteria | 2903 |
| 377 | Ga0451577_0143230 | 3300042876 | Bacteria | 2148 |
| 378 | Ga0451577_0175874 | 3300042876 | Bacteria | 1929 |
| 379 | Ga0451577_0827693 | 3300042876 | Bacteria | 835 |
| 380 | Ga0451577_1529325 | 3300042876 | Bacteria | 590 |
| 381 | Ga0451577_1562636 | 3300042876 | Bacteria | 582 |
| 382 | Ga0466972_0325270 | 3300044658 | Bacteria | 719 |
| 383 | Ga0453683_0000055 | 3300044673 | Bacteria | 192588 |
| 384 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 385 | Ga0453683_0000935 | 3300044673 | Bacteria | 27791 |
| 386 | Ga0453683_0007526 | 3300044673 | Bacteria | 7375 |
| 387 | Ga0453683_0014569 | 3300044673 | Bacteria | 5101 |
| 388 | Ga0453683_0037310 | 3300044673 | Bacteria | 3058 |
| 389 | Ga0453683_0041330 | 3300044673 | Bacteria | 2895 |
| 390 | Ga0453683_0056210 | 3300044673 | Bacteria | 2462 |
| 391 | Ga0453683_0470008 | 3300044673 | Bacteria | 814 |
| 392 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 393 | Ga0453684_0001382 | 3300044712 | Bacteria | 70292 |
| 394 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 395 | Ga0453684_0012068 | 3300044712 | Bacteria | 14349 |
| 396 | Ga0453684_0012598 | 3300044712 | Bacteria | 13911 |
| 397 | Ga0453684_0025154 | 3300044712 | Bacteria | 8657 |
| 398 | Ga0453684_0032953 | 3300044712 | Bacteria | 7234 |
| 399 | Ga0453684_0055899 | 3300044712 | Bacteria | 5126 |
| 400 | Ga0453684_0056141 | 3300044712 | Bacteria | 5111 |
| 401 | Ga0453684_0108947 | 3300044712 | Bacteria | 3370 |
| 402 | Ga0453684_0133883 | 3300044712 | Bacteria | 2970 |
| 403 | Ga0453684_0172588 | 3300044712 | Bacteria | 2546 |
| 404 | Ga0453684_0458320 | 3300044712 | Bacteria | 1418 |
| 405 | Ga0453684_0466138 | 3300044712 | Bacteria | 1404 |
| 406 | Ga0453684_0861326 | 3300044712 | Bacteria | 973 |
| 407 | Ga0453684_0949818 | 3300044712 | Bacteria | 917 |
| 408 | Ga0453684_1026756 | 3300044712 | Bacteria | 875 |
| 409 | Ga0453684_1044859 | 3300044712 | Bacteria | 866 |
| 410 | Ga0453684_1864412 | 3300044712 | Bacteria | 609 |
| 411 | Ga0453684_2084091 | 3300044712 | Bacteria | 569 |
| 412 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 413 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 414 | Ga0451576_0000204 | 3300045051 | Bacteria | 149459 |
| 415 | Ga0451576_0003461 | 3300045051 | Bacteria | 21644 |
| 416 | Ga0451576_0005920 | 3300045051 | Bacteria | 15147 |
| 417 | Ga0451576_0011813 | 3300045051 | Bacteria | 9886 |
| 418 | Ga0451576_0017866 | 3300045051 | Bacteria | 7791 |
| 419 | Ga0451576_0032623 | 3300045051 | Bacteria | 5541 |
| 420 | Ga0451576_0034310 | 3300045051 | Bacteria | 5390 |
| 421 | Ga0451576_0040065 | 3300045051 | Bacteria | 4960 |
| 422 | Ga0451576_0053102 | 3300045051 | Bacteria | 4246 |
| 423 | Ga0451576_0054946 | 3300045051 | Bacteria | 4167 |
| 424 | Ga0451576_0056132 | 3300045051 | Bacteria | 4119 |
| 425 | Ga0451576_0195911 | 3300045051 | Bacteria | 2110 |
| 426 | Ga0451576_0271918 | 3300045051 | Bacteria | 1771 |
| 427 | Ga0451576_0294905 | 3300045051 | Bacteria | 1695 |
| 428 | Ga0451576_1353539 | 3300045051 | Bacteria | 741 |
| 429 | Ga0495627_000022 | 3300046453 | Bacteria | 254672 |
| 430 | Ga0495590_0009537 | 3300046457 | Bacteria | 3684 |
| 431 | Ga0495664_0545738 | 3300046477 | Bacteria | 691 |
| 432 | Ga0495596_0004903 | 3300046500 | Bacteria | 6419 |
| 433 | Ga0495607_0239089 | 3300046501 | Bacteria | 879 |
| 434 | Ga0495606_0021702 | 3300046507 | Bacteria | 4698 |
| 435 | Ga0495606_0116963 | 3300046507 | Bacteria | 1600 |
| 436 | Ga0495610_0000005 | 3300046512 | Bacteria | 924111 |
| 437 | Ga0495610_0018640 | 3300046512 | Bacteria | 3912 |
| 438 | Ga0495632_0007484 | 3300046519 | Bacteria | 6852 |
| 439 | Ga0495643_0000294 | 3300046522 | Bacteria | 70329 |
| 440 | Ga0495643_0219315 | 3300046522 | Bacteria | 903 |
| 441 | Ga0495643_0287237 | 3300046522 | Bacteria | 754 |
| 442 | Ga0495663_0001345 | 3300046525 | Bacteria | 7769 |
| 443 | Ga0495663_0012337 | 3300046525 | Bacteria | 2380 |
| 444 | Ga0495654_0000003 | 3300046530 | Bacteria | 863485 |
| 445 | Ga0495654_0086898 | 3300046530 | Bacteria | 1456 |
| 446 | Ga0495586_0299046 | 3300046535 | Unclassified | 922 |
| 447 | Ga0495609_0000003 | 3300046538 | Bacteria | 711547 |
| 448 | Ga0495645_0320880 | 3300046543 | Bacteria | 1006 |
| 449 | Ga0495633_0003150 | 3300046558 | Bacteria | 11168 |
| 450 | Ga0495633_0013345 | 3300046558 | Bacteria | 4333 |
| 451 | Ga0495633_0014068 | 3300046558 | Bacteria | 4196 |
| 452 | Ga0495634_0076813 | 3300046642 | Bacteria | 2192 |
| 453 | Ga0495625_0000096 | 3300046660 | Bacteria | 142609 |
| 454 | Ga0495625_0001933 | 3300046660 | Bacteria | 23424 |
| 455 | Ga0495625_0041479 | 3300046660 | Bacteria | 3350 |
| 456 | Ga0495647_0318605 | 3300046681 | Bacteria | 704 |
| 457 | Ga0495658_0749816 | 3300046683 | Bacteria | 625 |
| 458 | Ga0495671_0063109 | 3300046692 | Bacteria | 1825 |
| 459 | Ga0495660_0024916 | 3300046810 | Bacteria | 3403 |
| 460 | Ga0495660_0223215 | 3300046810 | Bacteria | 887 |
| 461 | Ga0495686_0004601 | 3300047472 | Bacteria | 11246 |
| 462 | Ga0495686_0469080 | 3300047472 | Bacteria | 666 |
| 463 | Ga0496102_0035559 | 3300048905 | Bacteria | 4485 |
| 464 | Ga0496104_0268649 | 3300048907 | Bacteria | 1618 |
| 465 | Ga0496105_0160764 | 3300048908 | Bacteria | 1844 |
| 466 | Ga0496113_0161385 | 3300048916 | Bacteria | 1772 |
| 467 | Ga0496114_1047556 | 3300048917 | Bacteria | 700 |
| 468 | Ga0496115_0068443 | 3300048918 | Bacteria | 2874 |
| 469 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 470 | Ga0496116_0000029 | 3300048919 | Bacteria | 422187 |
| 471 | Ga0496117_0000007 | 3300048920 | Bacteria | 720505 |
| 472 | Ga0496117_0120383 | 3300048920 | Bacteria | 1614 |
| 473 | Ga0496118_0000252 | 3300048921 | Bacteria | 94470 |
| 474 | Ga0496118_0033058 | 3300048921 | Bacteria | 4251 |
| 475 | Ga0496118_0126896 | 3300048921 | Bacteria | 1648 |
| 476 | Ga0496119_0000007 | 3300048922 | Bacteria | 475920 |
| 477 | Ga0496120_0007422 | 3300048923 | Bacteria | 8154 |
| 478 | Ga0496121_0014632 | 3300048924 | Bacteria | 8299 |
| 479 | Ga0496121_0021047 | 3300048924 | Bacteria | 6413 |
| 480 | Ga0496123_0041623 | 3300048926 | Bacteria | 3181 |
| 481 | Ga0496124_0013719 | 3300048927 | Bacteria | 7890 |
| 482 | Ga0496124_0035036 | 3300048927 | Bacteria | 4396 |
| 483 | Ga0496124_0050411 | 3300048927 | Bacteria | 3547 |
| 484 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 485 | Ga0496125_0000031 | 3300048928 | Bacteria | 365156 |
| 486 | Ga0496125_0032980 | 3300048928 | Bacteria | 4590 |
| 487 | Ga0496125_0124107 | 3300048928 | Bacteria | 1834 |
| 488 | Ga0496126_0115769 | 3300048929 | Bacteria | 2330 |
| 489 | Ga0496126_0119349 | 3300048929 | Bacteria | 2288 |
| 490 | Ga0496126_0924928 | 3300048929 | Bacteria | 659 |
| 491 | Ga0501310_000150 | 3300049130 | Bacteria | 6818 |
| 492 | Ga0501341_00021 | 3300049131 | Bacteria | 4532 |
| 493 | Ga0501304_018390 | 3300049160 | Bacteria | 675 |
| 494 | Ga0501307_002458 | 3300049162 | Bacteria | 1729 |
| 495 | Ga0501314_000001 | 3300049530 | Bacteria | 13837 |
| 496 | Ga0501317_000248 | 3300049533 | Bacteria | 3386 |
| 497 | Ga0501319_000002 | 3300049535 | Bacteria | 13675 |
| 498 | Ga0501319_000013 | 3300049535 | Bacteria | 7475 |
| 499 | Ga0501320_000041 | 3300049536 | Bacteria | 6176 |
| 500 | Ga0501321_000051 | 3300049537 | Bacteria | 5082 |
| 501 | Ga0501321_010452 | 3300049537 | Bacteria | 1019 |
| 502 | Ga0501322_000046 | 3300049538 | Bacteria | 4559 |
| 503 | Ga0501323_000002 | 3300049539 | Bacteria | 14311 |
| 504 | Ga0501323_000756 | 3300049539 | Bacteria | 2564 |
| 505 | Ga0501323_004478 | 3300049539 | Bacteria | 1481 |
| 506 | Ga0501324_000002 | 3300049540 | Bacteria | 14212 |
| 507 | Ga0501325_000286 | 3300049541 | Bacteria | 2190 |
| 508 | Ga0501326_00056 | 3300049542 | Bacteria | 3508 |
| 509 | Ga0501328_00035 | 3300049544 | Bacteria | 2893 |
| 510 | Ga0501329_00017 | 3300049545 | Bacteria | 3991 |
| 511 | Ga0501330_000098 | 3300049546 | Bacteria | 2661 |
| 512 | Ga0501331_00043 | 3300049547 | Bacteria | 3363 |
| 513 | Ga0501334_00029 | 3300049550 | Bacteria | 4367 |
| 514 | Ga0501334_00034 | 3300049550 | Bacteria | 4194 |
| 515 | Ga0501335_000048 | 3300049551 | Bacteria | 4932 |
| 516 | Ga0501335_000133 | 3300049551 | Bacteria | 3704 |
| 517 | Ga0501337_000033 | 3300049553 | Bacteria | 5041 |
| 518 | Ga0501031_0004470 | 3300049568 | Bacteria | 9067 |
| 519 | Ga0501032_0002362 | 3300049569 | Bacteria | 14785 |
| 520 | Ga0501032_0002936 | 3300049569 | Bacteria | 13262 |
| 521 | Ga0501033_0000011 | 3300049570 | Bacteria | 259130 |
| 522 | Ga0501034_0001265 | 3300049571 | Bacteria | 34324 |
| 523 | Ga0501034_0232715 | 3300049571 | Bacteria | 1791 |
| 524 | Ga0501036_0068307 | 3300049572 | Bacteria | 3007 |
| 525 | Ga0501037_0003904 | 3300049573 | Bacteria | 10816 |
| 526 | Ga0501038_0002395 | 3300049574 | Bacteria | 17463 |
| 527 | Ga0501038_0108296 | 3300049574 | Bacteria | 2304 |
| 528 | Ga0501039_0015938 | 3300049575 | Bacteria | 5754 |
| 529 | Ga0501043_0000733 | 3300049579 | Bacteria | 29055 |
| 530 | Ga0501047_0037417 | 3300049581 | Bacteria | 4693 |
| 531 | Ga0501047_0046063 | 3300049581 | Bacteria | 4216 |
| 532 | Ga0501048_0426916 | 3300049582 | Bacteria | 948 |
| 533 | Ga0501067_0379480 | 3300049583 | Bacteria | 788 |
| 534 | Ga0501070_0704969 | 3300049586 | Bacteria | 798 |
| 535 | Ga0501074_0989645 | 3300049590 | Bacteria | 591 |
| 536 | Ga0501198_026181 | 3300049649 | Bacteria | 951 |
| 537 | Ga0501223_002029 | 3300049663 | Bacteria | 4544 |
| 538 | Ga0501224_030889 | 3300049664 | Bacteria | 802 |
| 539 | Ga0501235_087542 | 3300049669 | Bacteria | 749 |
| 540 | Ga0501238_000015 | 3300049671 | Bacteria | 31964 |
| 541 | Ga0501243_003419 | 3300049675 | Bacteria | 2351 |
| 542 | Ga0501249_195692 | 3300049679 | Bacteria | 528 |
| 543 | Ga0501251_005157 | 3300049681 | Bacteria | 1376 |
| 544 | Ga0501241_000002 | 3300049758 | Bacteria | 194532 |
| 545 | Ga0501241_000113 | 3300049758 | Bacteria | 17544 |
| 546 | Ga0501241_002715 | 3300049758 | Bacteria | 3407 |
| 547 | Ga0501262_009059 | 3300049759 | Bacteria | 1226 |
| 548 | Ga0501266_000002 | 3300049763 | Bacteria | 459947 |
| 549 | Ga0501269_000004 | 3300049766 | Bacteria | 91854 |
| 550 | Ga0501269_001937 | 3300049766 | Bacteria | 2612 |
| 551 | Ga0501280_000239 | 3300049776 | Bacteria | 13899 |
| 552 | Ga0501280_093662 | 3300049776 | Bacteria | 569 |
| 553 | Ga0501035_0009077 | 3300049822 | Bacteria | 9245 |
| 554 | Ga0501035_0016384 | 3300049822 | Bacteria | 6837 |
| 555 | Ga0501044_0001293 | 3300049823 | Bacteria | 29588 |
| 556 | Ga0501045_0000053 | 3300049824 | Bacteria | 51403 |
| 557 | nmdc:mga03683_18140_c1 | 3300050489 | Bacteria | 2672 |
| 558 | nmdc:mga07m45_534682_c1 | 3300050496 | Bacteria | 678 |
| 559 | Ga0500644_0020716 | 3300053088 | Bacteria | 1959 |
| 560 | Ga0500646_0007145 | 3300053090 | Bacteria | 2848 |
| 561 | Ga0500646_0009195 | 3300053090 | Bacteria | 2529 |
| 562 | Ga0500647_0405990 | 3300053091 | Bacteria | 551 |
| 563 | Ga0500651_0066629 | 3300053093 | Bacteria | 2243 |
| 564 | Ga0500641_0000168 | 3300053096 | Bacteria | 24462 |
| 565 | Ga0500641_0006404 | 3300053096 | Bacteria | 4180 |
| 566 | Ga0500628_164640 | 3300053129 | Bacteria | 627 |
| 567 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 568 | Ga0500559_0010320 | 3300053136 | Bacteria | 4015 |
| 569 | Ga0500573_0169794 | 3300053140 | Bacteria | 1180 |
| 570 | Ga0500606_175726 | 3300053152 | Bacteria | 677 |
| 571 | Ga0500622_0138338 | 3300053156 | Bacteria | 1164 |
| 572 | Ga0500622_0317436 | 3300053156 | Bacteria | 658 |
| 573 | Ga0500627_0306602 | 3300053158 | Bacteria | 692 |
| 574 | Ga0500584_021185 | 3300053726 | Bacteria | 3019 |
| 575 | Ga0587093_013795 | 3300059478 | Bacteria | 999 |
| 576 | Ga0587066_019259 | 3300059490 | Bacteria | 1108 |
| 577 | Ga0587070_005454 | 3300059491 | Bacteria | 1667 |
| 578 | Ga0587077_013219 | 3300059493 | Bacteria | 1334 |
| 579 | Ga0587077_083699 | 3300059493 | Bacteria | 737 |
| 580 | Ga0587083_0019247 | 3300059505 | Bacteria | 1245 |
| 581 | Ga0587092_046170 | 3300059512 | Bacteria | 774 |
| 582 | Ga0587095_025185 | 3300059514 | Bacteria | 592 |
| 583 | Ga0587117_009294 | 3300059627 | Bacteria | 1173 |
| 584 | Ga0587068_000659 | 3300059641 | Bacteria | 3348 |
| 585 | Ga0587076_051613 | 3300059645 | Bacteria | 803 |
| 586 | Ga0587079_112190 | 3300059647 | Bacteria | 664 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003320 | rootH2_10304096 | rootH2_103040964 | 109 |
| 2 | 3300049131 | Ga0501341_00021 | Ga0501341_00021_3031_3360 | 109 |
| 3 | 3300031665 | Ga0316575_10126011 | Ga0316575_101260113 | 114 |
| 4 | 3300031691 | Ga0316579_10111616 | Ga0316579_101116162 | 114 |
| 5 | 3300031727 | Ga0316576_10308688 | Ga0316576_103086882 | 114 |
| 6 | 3300031728 | Ga0316578_10191968 | Ga0316578_101919682 | 114 |
| 7 | 3300031733 | Ga0316577_10008426 | Ga0316577_100084268 | 114 |
| 8 | 3300032137 | Ga0316585_10002058 | Ga0316585_100020588 | 114 |
| 9 | 3300032168 | Ga0316593_10034814 | Ga0316593_100348143 | 114 |
| 10 | 3300033524 | Ga0316592_1085405 | Ga0316592_10854052 | 114 |
| 11 | 3300033541 | Ga0316596_1016886 | Ga0316596_10168864 | 114 |
| 12 | 3300035398 | Ga0316574_0116099 | Ga0316574_0116099_922_1266 | 114 |
| 13 | 3300036712 | Ga0316584_0493162 | Ga0316584_0493162_388_732 | 114 |
| 14 | iso_pu_bacteria | 2511231000 | 2511231112 | 118 |
| 15 | iso_pu_bacteria | 2513020052 | 2513232374 | 118 |
| 16 | iso_pu_bacteria | 2519899754 | 2520879538 | 118 |
| 17 | iso_pu_bacteria | 2523533629 | 2524006234 | 118 |
| 18 | iso_pu_bacteria | 2582581278 | 2585143585 | 118 |
| 19 | iso_pu_bacteria | 2582581281 | 2585156574 | 118 |
| 20 | iso_pu_bacteria | 2582581282 | 2585160775 | 118 |
| 21 | iso_pu_bacteria | 2582581873 | 2585427015 | 118 |
| 22 | iso_pu_bacteria | 2585428045 | 2587679975 | 118 |
| 23 | iso_pu_bacteria | 2585428060 | 2587748633 | 118 |
| 24 | iso_pu_bacteria | 2585428061 | 2587753457 | 118 |
| 25 | iso_pu_bacteria | 2585428095 | 2587864985 | 118 |
| 26 | iso_pu_bacteria | 2585428115 | 2587945311 | 118 |
| 27 | iso_pu_bacteria | 2585428182 | 2588211490 | 118 |
| 28 | iso_pu_bacteria | 2585428183 | 2588215872 | 118 |
| 29 | iso_pu_bacteria | 2585428184 | 2588219294 | 118 |
| 30 | iso_pu_bacteria | 2585428185 | 2588224772 | 118 |
| 31 | iso_pu_bacteria | 2585428187 | 2588234607 | 118 |
| 32 | iso_pu_bacteria | 2588253712 | 2588447567 | 118 |
| 33 | iso_pu_bacteria | 2588254255 | 2590603194 | 118 |
| 34 | iso_pu_bacteria | 2588254257 | 2590610215 | 118 |
| 35 | iso_pu_bacteria | 2643221600 | 2644009199 | 118 |
| 36 | iso_pu_bacteria | 2643221667 | 2644373937 | 118 |
| 37 | iso_pu_bacteria | 2643221716 | 2644643931 | 118 |
| 38 | iso_pu_bacteria | 2643221725 | 2644681826 | 118 |
| 39 | iso_pu_bacteria | 2728369107 | 2729200757 | 118 |
| 40 | iso_pu_bacteria | 2738541273 | 2738698377 | 118 |
| 41 | iso_pu_bacteria | 2738541279 | 2738733061 | 118 |
| 42 | iso_pu_bacteria | 2738541285 | 2738765599 | 118 |
| 43 | iso_pu_bacteria | 2738543007 | 2739214642 | 118 |
| 44 | iso_pu_bacteria | 2738543014 | 2739252703 | 118 |
| 45 | iso_pu_bacteria | 2739367857 | 2740002842 | 118 |
| 46 | iso_pu_bacteria | 2739367858 | 2740007659 | 118 |
| 47 | iso_pu_bacteria | 2739367874 | 2740060429 | 118 |
| 48 | iso_pu_bacteria | 2751185877 | 2753674207 | 118 |
| 49 | iso_pu_bacteria | 2765235839 | 2765575679 | 118 |
| 50 | iso_pu_bacteria | 2772190705 | 2772605783 | 118 |
| 51 | iso_pu_bacteria | 2775506739 | 2775674339 | 118 |
| 52 | iso_pu_bacteria | 2802428842 | 2802655264 | 118 |
| 53 | iso_pu_bacteria | 2816332188 | 2816875525 | 118 |
| 54 | iso_pu_bacteria | 2816332280 | 2817413542 | 118 |
| 55 | iso_pu_bacteria | 2833640130 | 2833640616 | 118 |
| 56 | iso_pu_bacteria | 2842083920 | 2842086256 | 118 |
| 57 | iso_pu_bacteria | 2857613821 | 2857617055 | 118 |
| 58 | iso_pu_bacteria | 2857618242 | 2857619724 | 118 |
| 59 | iso_pu_bacteria | 2871720351 | 2871723605 | 118 |
| 60 | iso_pu_bacteria | 2881359912 | 2881364108 | 118 |
| 61 | iso_pu_bacteria | 2889290771 | 2889293817 | 118 |
| 62 | iso_pu_bacteria | 2890804823 | 2890807154 | 118 |
| 63 | iso_pu_bacteria | 2903895155 | 2903898667 | 118 |
| 64 | iso_pu_bacteria | 2904419702 | 2904422393 | 118 |
| 65 | iso_pu_bacteria | 2904555929 | 2904558501 | 118 |
| 66 | iso_pu_bacteria | 2905999023 | 2906001174 | 118 |
| 67 | iso_pu_bacteria | 2906799679 | 2906800166 | 118 |
| 68 | iso_pu_bacteria | 2919097161 | 2919097954 | 118 |
| 69 | iso_pu_bacteria | 2919191525 | 2919194226 | 118 |
| 70 | iso_pu_bacteria | 2919399522 | 2919403193 | 118 |
| 71 | iso_pu_bacteria | 2919509842 | 2919511831 | 118 |
| 72 | iso_pu_bacteria | 2919683626 | 2919684609 | 118 |
| 73 | iso_pu_bacteria | 2929150217 | 2929150598 | 118 |
| 74 | iso_pu_bacteria | 2945924605 | 2945924800 | 118 |
| 75 | iso_pu_bacteria | 2946019816 | 2946024086 | 118 |
| 76 | iso_pu_bacteria | 2958458903 | 2958461995 | 118 |
| 77 | iso_pu_bacteria | 2958512119 | 2958514504 | 118 |
| 78 | iso_pu_bacteria | 2965320100 | 2965321928 | 118 |
| 79 | iso_pu_bacteria | 2977243572 | 2977247753 | 118 |
| 80 | iso_pu_bacteria | 2977268062 | 2977272070 | 118 |
| 81 | iso_pu_bacteria | 2984572630 | 2984574451 | 118 |
| 82 | iso_pu_bacteria | 2984606641 | 2984607900 | 118 |
| 83 | iso_pu_bacteria | 2993372514 | 2993375102 | 118 |
| 84 | iso_pu_bacteria | 2993480792 | 2993481966 | 118 |
| 85 | iso_pu_bacteria | 8036736890 | 8036739259 | 118 |
| 86 | iso_pu_bacteria | 8054307821 | 8054311434 | 118 |
| 87 | iso_pu_bacteria | 8055419101 | 8055423577 | 118 |
| 88 | iso_pu_bacteria | 8055592153 | 8055595069 | 118 |
| 89 | iso_pu_bacteria | 8056440228 | 8056443512 | 118 |
| 90 | 3300028654 | Ga0265322_10153338 | Ga0265322_101533382 | 121 |
| 91 | 3300031251 | Ga0265327_10089061 | Ga0265327_100890613 | 121 |
| 92 | 3300031251 | Ga0265327_10108010 | Ga0265327_101080102 | 121 |
| 93 | 3300031344 | Ga0265316_10545136 | Ga0265316_105451362 | 121 |
| 94 | 3300031727 | Ga0316576_10001965 | Ga0316576_1000196516 | 121 |
| 95 | 3300031727 | Ga0316576_10007854 | Ga0316576_1000785413 | 121 |
| 96 | 3300031727 | Ga0316576_10022758 | Ga0316576_100227589 | 121 |
| 97 | 3300031727 | Ga0316576_10056945 | Ga0316576_100569453 | 121 |
| 98 | 3300031727 | Ga0316576_10079789 | Ga0316576_100797895 | 121 |
| 99 | 3300031727 | Ga0316576_10143122 | Ga0316576_101431224 | 121 |
| 100 | 3300031727 | Ga0316576_10440167 | Ga0316576_104401673 | 121 |
| 101 | 3300031727 | Ga0316576_10471429 | Ga0316576_104714292 | 121 |
| 102 | 3300031727 | Ga0316576_10590477 | Ga0316576_105904772 | 121 |
| 103 | 3300031728 | Ga0316578_10040210 | Ga0316578_100402106 | 121 |
| 104 | 3300031728 | Ga0316578_10172214 | Ga0316578_101722143 | 121 |
| 105 | 3300031728 | Ga0316578_10382861 | Ga0316578_103828611 | 121 |
| 106 | 3300031733 | Ga0316577_10282184 | Ga0316577_102821842 | 121 |
| 107 | 3300031733 | Ga0316577_10512789 | Ga0316577_105127892 | 121 |
| 108 | 3300032139 | Ga0316580_10061015 | Ga0316580_100610152 | 121 |
| 109 | 3300032139 | Ga0316580_10191347 | Ga0316580_101913472 | 121 |
| 110 | 3300032168 | Ga0316593_10000201 | Ga0316593_100002015 | 121 |
| 111 | 3300032168 | Ga0316593_10000279 | Ga0316593_100002798 | 121 |
| 112 | 3300032168 | Ga0316593_10008603 | Ga0316593_100086033 | 121 |
| 113 | 3300032168 | Ga0316593_10023936 | Ga0316593_100239364 | 121 |
| 114 | 3300032168 | Ga0316593_10091142 | Ga0316593_100911421 | 121 |
| 115 | 3300032168 | Ga0316593_10144490 | Ga0316593_101444903 | 121 |
| 116 | 3300032168 | Ga0316593_10185806 | Ga0316593_101858063 | 121 |
| 117 | 3300032168 | Ga0316593_10255095 | Ga0316593_102550951 | 121 |
| 118 | 3300033524 | Ga0316592_1001616 | Ga0316592_10016162 | 121 |
| 119 | 3300033524 | Ga0316592_1002393 | Ga0316592_10023935 | 121 |
| 120 | 3300033524 | Ga0316592_1002839 | Ga0316592_10028395 | 121 |
| 121 | 3300033524 | Ga0316592_1070858 | Ga0316592_10708582 | 121 |
| 122 | 3300033524 | Ga0316592_1083227 | Ga0316592_10832272 | 121 |
| 123 | 3300033524 | Ga0316592_1106193 | Ga0316592_11061931 | 121 |
| 124 | 3300033524 | Ga0316592_1163458 | Ga0316592_11634582 | 121 |
| 125 | 3300033527 | Ga0316586_1018756 | Ga0316586_10187563 | 121 |
| 126 | 3300033528 | Ga0316588_1000386 | Ga0316588_10003866 | 121 |
| 127 | 3300033528 | Ga0316588_1015940 | Ga0316588_10159403 | 121 |
| 128 | 3300033528 | Ga0316588_1098096 | Ga0316588_10980962 | 121 |
| 129 | 3300033528 | Ga0316588_1170596 | Ga0316588_11705961 | 121 |
| 130 | 3300033541 | Ga0316596_1000106 | Ga0316596_10001066 | 121 |
| 131 | 3300033541 | Ga0316596_1001043 | Ga0316596_10010435 | 121 |
| 132 | 3300033541 | Ga0316596_1003921 | Ga0316596_10039218 | 121 |
| 133 | 3300033541 | Ga0316596_1010716 | Ga0316596_10107164 | 121 |
| 134 | 3300033541 | Ga0316596_1015079 | Ga0316596_10150793 | 121 |
| 135 | 3300033541 | Ga0316596_1016318 | Ga0316596_10163185 | 121 |
| 136 | 3300033541 | Ga0316596_1017057 | Ga0316596_10170575 | 121 |
| 137 | 3300033541 | Ga0316596_1025223 | Ga0316596_10252235 | 121 |
| 138 | 3300033541 | Ga0316596_1025532 | Ga0316596_10255323 | 121 |
| 139 | 3300033541 | Ga0316596_1033278 | Ga0316596_10332783 | 121 |
| 140 | 3300033541 | Ga0316596_1038943 | Ga0316596_10389432 | 121 |
| 141 | 3300033541 | Ga0316596_1085516 | Ga0316596_10855162 | 121 |
| 142 | 3300033541 | Ga0316596_1120303 | Ga0316596_11203032 | 121 |
| 143 | 3300033541 | Ga0316596_1123660 | Ga0316596_11236601 | 121 |
| 144 | 3300033541 | Ga0316596_1149703 | Ga0316596_11497031 | 121 |
| 145 | 3300035398 | Ga0316574_0051935 | Ga0316574_0051935_1749_2114 | 121 |
| 146 | 3300035398 | Ga0316574_0065061 | Ga0316574_0065061_1630_1995 | 121 |
| 147 | 3300035398 | Ga0316574_0104645 | Ga0316574_0104645_80_445 | 121 |
| 148 | 3300035398 | Ga0316574_0114903 | Ga0316574_0114903_902_1267 | 121 |
| 149 | 3300035398 | Ga0316574_0136060 | Ga0316574_0136060_812_1177 | 121 |
| 150 | 3300035398 | Ga0316574_0260030 | Ga0316574_0260030_456_821 | 121 |
| 151 | 3300036647 | Ga0316582_0032668 | Ga0316582_0032668_2551_2916 | 121 |
| 152 | 3300036647 | Ga0316582_0179690 | Ga0316582_0179690_565_930 | 121 |
| 153 | 3300036647 | Ga0316582_0884432 | Ga0316582_0884432_74_439 | 121 |
| 154 | 3300036647 | Ga0316582_1094745 | Ga0316582_1094745_38_403 | 121 |
| 155 | 3300036712 | Ga0316584_0015050 | Ga0316584_0015050_3757_4122 | 121 |
| 156 | 3300036712 | Ga0316584_0037517 | Ga0316584_0037517_1612_1977 | 121 |
| 157 | 3300036712 | Ga0316584_0315205 | Ga0316584_0315205_55_420 | 121 |
| 158 | 3300036712 | Ga0316584_0562441 | Ga0316584_0562441_149_514 | 121 |
| 159 | 3300036712 | Ga0316584_0784661 | Ga0316584_0784661_211_576 | 121 |
| 160 | 3300039062 | Ga0400483_151094 | Ga0400483_151094_694_1059 | 121 |
| 161 | 3300039093 | Ga0400489_59783 | Ga0400489_59783_340_705 | 121 |
| 162 | 3300039093 | Ga0400489_64897 | Ga0400489_64897_465_830 | 121 |
| 163 | 3300039093 | Ga0400489_83287 | Ga0400489_83287_346_711 | 121 |
| 164 | 3300039093 | Ga0400489_84188 | Ga0400489_84188_216_581 | 121 |
| 165 | 3300041456 | Ga0451795_0319454 | Ga0451795_0319454_500_865 | 121 |
| 166 | 3300041456 | Ga0451795_0547905 | Ga0451795_0547905_635_1000 | 121 |
| 167 | 3300041456 | Ga0451795_0935357 | Ga0451795_0935357_1571_1936 | 121 |
| 168 | 3300041456 | Ga0451795_1028677 | Ga0451795_1028677_399_764 | 121 |
| 169 | 3300041456 | Ga0451795_1130714 | Ga0451795_1130714_25_390 | 121 |
| 170 | 3300041456 | Ga0451795_1402022 | Ga0451795_1402022_650_1015 | 121 |
| 171 | 3300041456 | Ga0451795_1545671 | Ga0451795_1545671_443_808 | 121 |
| 172 | 3300041456 | Ga0451795_1714813 | Ga0451795_1714813_732_1097 | 121 |
| 173 | 3300041503 | Ga0451847_0714976 | Ga0451847_0714976_23_388 | 121 |
| 174 | 3300041508 | Ga0451852_01884 | Ga0451852_01884_1073_1438 | 121 |
| 175 | 3300041508 | Ga0451852_06600 | Ga0451852_06600_329_694 | 121 |
| 176 | 3300041508 | Ga0451852_28525 | Ga0451852_28525_1348_1713 | 121 |
| 177 | 3300041511 | Ga0451855_0000118 | Ga0451855_0000118_153_518 | 121 |
| 178 | 3300041511 | Ga0451855_0331224 | Ga0451855_0331224_17_382 | 121 |
| 179 | 3300041511 | Ga0451855_0405167 | Ga0451855_0405167_212_577 | 121 |
| 180 | 3300041511 | Ga0451855_0436544 | Ga0451855_0436544_133_498 | 121 |
| 181 | 3300041511 | Ga0451855_0887620 | Ga0451855_0887620_51_416 | 121 |
| 182 | 3300041511 | Ga0451855_0898775 | Ga0451855_0898775_322_687 | 121 |
| 183 | 3300041511 | Ga0451855_1113143 | Ga0451855_1113143_51_416 | 121 |
| 184 | 3300041511 | Ga0451855_1478956 | Ga0451855_1478956_32_397 | 121 |
| 185 | 3300041511 | Ga0451855_1705115 | Ga0451855_1705115_352_717 | 121 |
| 186 | 3300041511 | Ga0451855_1986715 | Ga0451855_1986715_22_387 | 121 |
| 187 | 3300042876 | Ga0451577_0000092 | Ga0451577_0000092_146979_147344 | 121 |
| 188 | 3300042876 | Ga0451577_0000433 | Ga0451577_0000433_72024_72389 | 121 |
| 189 | 3300042876 | Ga0451577_0005144 | Ga0451577_0005144_11456_11821 | 121 |
| 190 | 3300042876 | Ga0451577_0038846 | Ga0451577_0038846_3231_3596 | 121 |
| 191 | 3300042876 | Ga0451577_0080589 | Ga0451577_0080589_1216_1581 | 121 |
| 192 | 3300042876 | Ga0451577_0143230 | Ga0451577_0143230_128_493 | 121 |
| 193 | 3300042876 | Ga0451577_0175874 | Ga0451577_0175874_597_962 | 121 |
| 194 | 3300042876 | Ga0451577_0827693 | Ga0451577_0827693_65_430 | 121 |
| 195 | 3300042876 | Ga0451577_1529325 | Ga0451577_1529325_76_441 | 121 |
| 196 | 3300042876 | Ga0451577_1562636 | Ga0451577_1562636_23_388 | 121 |
| 197 | 3300044673 | Ga0453683_0000055 | Ga0453683_0000055_73244_73609 | 121 |
| 198 | 3300044673 | Ga0453683_0000522 | Ga0453683_0000522_12287_12652 | 121 |
| 199 | 3300044673 | Ga0453683_0000935 | Ga0453683_0000935_442_807 | 121 |
| 200 | 3300044673 | Ga0453683_0007526 | Ga0453683_0007526_1594_1959 | 121 |
| 201 | 3300044673 | Ga0453683_0014569 | Ga0453683_0014569_2166_2531 | 121 |
| 202 | 3300044673 | Ga0453683_0037310 | Ga0453683_0037310_1423_1788 | 121 |
| 203 | 3300044673 | Ga0453683_0041330 | Ga0453683_0041330_1865_2230 | 121 |
| 204 | 3300044673 | Ga0453683_0056210 | Ga0453683_0056210_1656_2021 | 121 |
| 205 | 3300044673 | Ga0453683_0470008 | Ga0453683_0470008_417_782 | 121 |
| 206 | 3300044712 | Ga0453684_0000506 | Ga0453684_0000506_4800_5165 | 121 |
| 207 | 3300044712 | Ga0453684_0001382 | Ga0453684_0001382_4853_5218 | 121 |
| 208 | 3300044712 | Ga0453684_0001549 | Ga0453684_0001549_48211_48576 | 121 |
| 209 | 3300044712 | Ga0453684_0012068 | Ga0453684_0012068_719_1084 | 121 |
| 210 | 3300044712 | Ga0453684_0012598 | Ga0453684_0012598_1701_2066 | 121 |
| 211 | 3300044712 | Ga0453684_0025154 | Ga0453684_0025154_2641_3006 | 121 |
| 212 | 3300044712 | Ga0453684_0032953 | Ga0453684_0032953_2566_2931 | 121 |
| 213 | 3300044712 | Ga0453684_0055899 | Ga0453684_0055899_1394_1759 | 121 |
| 214 | 3300044712 | Ga0453684_0056141 | Ga0453684_0056141_1320_1685 | 121 |
| 215 | 3300044712 | Ga0453684_0108947 | Ga0453684_0108947_1235_1600 | 121 |
| 216 | 3300044712 | Ga0453684_0133883 | Ga0453684_0133883_1595_1960 | 121 |
| 217 | 3300044712 | Ga0453684_0172588 | Ga0453684_0172588_522_887 | 121 |
| 218 | 3300044712 | Ga0453684_0458320 | Ga0453684_0458320_937_1302 | 121 |
| 219 | 3300044712 | Ga0453684_0861326 | Ga0453684_0861326_93_458 | 121 |
| 220 | 3300044712 | Ga0453684_0949818 | Ga0453684_0949818_414_779 | 121 |
| 221 | 3300044712 | Ga0453684_1026756 | Ga0453684_1026756_479_844 | 121 |
| 222 | 3300044712 | Ga0453684_2084091 | Ga0453684_2084091_40_405 | 121 |
| 223 | 3300045051 | Ga0451576_0000113 | Ga0451576_0000113_175713_176078 | 121 |
| 224 | 3300045051 | Ga0451576_0000204 | Ga0451576_0000204_146979_147344 | 121 |
| 225 | 3300045051 | Ga0451576_0003461 | Ga0451576_0003461_947_1312 | 121 |
| 226 | 3300045051 | Ga0451576_0005920 | Ga0451576_0005920_2137_2502 | 121 |
| 227 | 3300045051 | Ga0451576_0011813 | Ga0451576_0011813_1963_2328 | 121 |
| 228 | 3300045051 | Ga0451576_0032623 | Ga0451576_0032623_4593_4958 | 121 |
| 229 | 3300045051 | Ga0451576_0034310 | Ga0451576_0034310_4990_5355 | 121 |
| 230 | 3300045051 | Ga0451576_0053102 | Ga0451576_0053102_2650_3015 | 121 |
| 231 | 3300045051 | Ga0451576_0054946 | Ga0451576_0054946_1055_1420 | 121 |
| 232 | 3300045051 | Ga0451576_0056132 | Ga0451576_0056132_1837_2202 | 121 |
| 233 | 3300045051 | Ga0451576_0195911 | Ga0451576_0195911_646_1011 | 121 |
| 234 | 3300045051 | Ga0451576_0271918 | Ga0451576_0271918_951_1316 | 121 |
| 235 | 3300045051 | Ga0451576_0294905 | Ga0451576_0294905_22_387 | 121 |
| 236 | 3300045051 | Ga0451576_1353539 | Ga0451576_1353539_243_608 | 121 |
| 237 | 2124908027 | MRS2a_Contig_9243 | MRS2a_00146690 | 122 |
| 238 | 2162886007 | SwRhRL2b_contig_2038936 | SwRhRL2b_0524.00001450 | 122 |
| 239 | 2209111006 | 2214748000 | 2213758773 | 122 |
| 240 | 3300003320 | rootH2_10083556 | rootH2_100835563 | 122 |
| 241 | 3300003320 | rootH2_10110587 | rootH2_101105876 | 122 |
| 242 | 3300003322 | rootL2_10155965 | rootL2_101559654 | 122 |
| 243 | 3300003323 | rootH1_10127399 | rootH1_101273994 | 122 |
| 244 | 3300003575 | Ga0007409J51694_1126710 | Ga0007409J51694_11267102 | 122 |
| 245 | 3300003578 | Ga0006562J51391_1003423 | Ga0006562J51391_100342311 | 122 |
| 246 | 3300003578 | Ga0006562J51391_1011740 | Ga0006562J51391_10117408 | 122 |
| 247 | 3300003784 | Ga0055534_1007293 | Ga0055534_10072934 | 122 |
| 248 | 3300004801 | Ga0058860_10114316 | Ga0058860_1011431617 | 122 |
| 249 | 3300004801 | Ga0058860_10170387 | Ga0058860_101703872 | 122 |
| 250 | 3300005276 | Ga0065717_1002035 | Ga0065717_10020357 | 122 |
| 251 | 3300005277 | Ga0065716_1001819 | Ga0065716_10018198 | 122 |
| 252 | 3300005288 | Ga0065714_10036549 | Ga0065714_100365492 | 122 |
| 253 | 3300005288 | Ga0065714_10237306 | Ga0065714_102373063 | 122 |
| 254 | 3300005288 | Ga0065714_10261165 | Ga0065714_102611652 | 122 |
| 255 | 3300005288 | Ga0065714_10358298 | Ga0065714_103582981 | 122 |
| 256 | 3300005289 | Ga0065704_10008398 | Ga0065704_100083982 | 122 |
| 257 | 3300005289 | Ga0065704_10084598 | Ga0065704_100845985 | 122 |
| 258 | 3300005289 | Ga0065704_10138917 | Ga0065704_101389173 | 122 |
| 259 | 3300005293 | Ga0065715_10018272 | Ga0065715_100182723 | 122 |
| 260 | 3300005293 | Ga0065715_10037423 | Ga0065715_100374234 | 122 |
| 261 | 3300005327 | Ga0070658_10957732 | Ga0070658_109577321 | 122 |
| 262 | 3300005329 | Ga0070683_100016581 | Ga0070683_1000165818 | 122 |
| 263 | 3300005337 | Ga0070682_100000608 | Ga0070682_10000060826 | 122 |
| 264 | 3300005337 | Ga0070682_100016944 | Ga0070682_1000169447 | 122 |
| 265 | 3300005339 | Ga0070660_100252297 | Ga0070660_1002522972 | 122 |
| 266 | 3300005340 | Ga0070689_100788474 | Ga0070689_1007884742 | 122 |
| 267 | 3300005344 | Ga0070661_101056208 | Ga0070661_1010562081 | 122 |
| 268 | 3300005353 | Ga0070669_100383263 | Ga0070669_1003832632 | 122 |
| 269 | 3300005354 | Ga0070675_100504902 | Ga0070675_1005049023 | 122 |
| 270 | 3300005355 | Ga0070671_100350358 | Ga0070671_1003503584 | 122 |
| 271 | 3300005356 | Ga0070674_100131904 | Ga0070674_1001319044 | 122 |
| 272 | 3300005364 | Ga0070673_100611304 | Ga0070673_1006113041 | 122 |
| 273 | 3300005365 | Ga0070688_100041948 | Ga0070688_1000419483 | 122 |
| 274 | 3300005366 | Ga0070659_100301071 | Ga0070659_1003010714 | 122 |
| 275 | 3300005367 | Ga0070667_100285431 | Ga0070667_1002854312 | 122 |
| 276 | 3300005455 | Ga0070663_100261729 | Ga0070663_1002617292 | 122 |
| 277 | 3300005457 | Ga0070662_101330865 | Ga0070662_1013308651 | 122 |
| 278 | 3300005459 | Ga0068867_100658048 | Ga0068867_1006580481 | 122 |
| 279 | 3300005466 | Ga0070685_10022774 | Ga0070685_100227742 | 122 |
| 280 | 3300005507 | Ga0074259_10545377 | Ga0074259_105453771 | 122 |
| 281 | 3300005535 | Ga0070684_100178514 | Ga0070684_1001785144 | 122 |
| 282 | 3300005563 | Ga0068855_100186174 | Ga0068855_1001861745 | 122 |
| 283 | 3300005577 | Ga0068857_100024669 | Ga0068857_1000246695 | 122 |
| 284 | 3300005578 | Ga0068854_100767782 | Ga0068854_1007677822 | 122 |
| 285 | 3300005614 | Ga0068856_100083761 | Ga0068856_1000837611 | 122 |
| 286 | 3300005616 | Ga0068852_100066769 | Ga0068852_1000667692 | 122 |
| 287 | 3300005616 | Ga0068852_100504381 | Ga0068852_1005043811 | 122 |
| 288 | 3300005719 | Ga0068861_100901267 | Ga0068861_1009012671 | 122 |
| 289 | 3300005841 | Ga0068863_102010948 | Ga0068863_1020109482 | 122 |
| 290 | 3300006163 | Ga0070715_10142688 | Ga0070715_101426881 | 122 |
| 291 | 3300006173 | Ga0070716_100075957 | Ga0070716_1000759574 | 122 |
| 292 | 3300006177 | Ga0075362_10023790 | Ga0075362_100237905 | 122 |
| 293 | 3300006194 | Ga0075427_10018603 | Ga0075427_100186032 | 122 |
| 294 | 3300006237 | Ga0097621_100105361 | Ga0097621_1001053616 | 122 |
| 295 | 3300006237 | Ga0097621_100417199 | Ga0097621_1004171993 | 122 |
| 296 | 3300006353 | Ga0075370_10445622 | Ga0075370_104456222 | 122 |
| 297 | 3300006358 | Ga0068871_100017988 | Ga0068871_10001798810 | 122 |
| 298 | 3300006358 | Ga0068871_101330227 | Ga0068871_1013302271 | 122 |
| 299 | 3300006942 | Ga0099824_1003374 | Ga0099824_10033746 | 122 |
| 300 | 3300006946 | Ga0079104_1000280 | Ga0079104_100028015 | 122 |
| 301 | 3300006948 | Ga0099826_10000125 | Ga0099826_1000012522 | 122 |
| 302 | 3300009011 | Ga0105251_10027494 | Ga0105251_100274944 | 122 |
| 303 | 3300009036 | Ga0105244_10000005 | Ga0105244_10000005440 | 122 |
| 304 | 3300009036 | Ga0105244_10017933 | Ga0105244_100179335 | 122 |
| 305 | 3300009092 | Ga0105250_10077236 | Ga0105250_100772363 | 122 |
| 306 | 3300009093 | Ga0105240_10552826 | Ga0105240_105528261 | 122 |
| 307 | 3300009098 | Ga0105245_10022092 | Ga0105245_1002209211 | 122 |
| 308 | 3300009101 | Ga0105247_10162224 | Ga0105247_101622241 | 122 |
| 309 | 3300009148 | Ga0105243_10077834 | Ga0105243_100778343 | 122 |
| 310 | 3300009176 | Ga0105242_10023758 | Ga0105242_100237588 | 122 |
| 311 | 3300009176 | Ga0105242_10252045 | Ga0105242_102520452 | 122 |
| 312 | 3300009176 | Ga0105242_11557030 | Ga0105242_115570302 | 122 |
| 313 | 3300009553 | Ga0105249_10027670 | Ga0105249_100276706 | 122 |
| 314 | 3300012505 | Ga0157339_1003659 | Ga0157339_10036592 | 122 |
| 315 | 3300013100 | Ga0157373_10001369 | Ga0157373_1000136921 | 122 |
| 316 | 3300013100 | Ga0157373_10014797 | Ga0157373_100147976 | 122 |
| 317 | 3300013100 | Ga0157373_10318379 | Ga0157373_103183794 | 122 |
| 318 | 3300013100 | Ga0157373_10422990 | Ga0157373_104229903 | 122 |
| 319 | 3300013102 | Ga0157371_10000091 | Ga0157371_1000009198 | 122 |
| 320 | 3300013102 | Ga0157371_10001678 | Ga0157371_1000167815 | 122 |
| 321 | 3300013102 | Ga0157371_10039874 | Ga0157371_100398747 | 122 |
| 322 | 3300013102 | Ga0157371_10130914 | Ga0157371_101309143 | 122 |
| 323 | 3300013104 | Ga0157370_10019865 | Ga0157370_1001986511 | 122 |
| 324 | 3300013104 | Ga0157370_10082740 | Ga0157370_100827404 | 122 |
| 325 | 3300013104 | Ga0157370_10136293 | Ga0157370_101362935 | 122 |
| 326 | 3300013104 | Ga0157370_10282103 | Ga0157370_102821032 | 122 |
| 327 | 3300013104 | Ga0157370_10344176 | Ga0157370_103441764 | 122 |
| 328 | 3300013104 | Ga0157370_10976760 | Ga0157370_109767602 | 122 |
| 329 | 3300013104 | Ga0157370_11150941 | Ga0157370_111509412 | 122 |
| 330 | 3300013105 | Ga0157369_10000613 | Ga0157369_1000061330 | 122 |
| 331 | 3300013105 | Ga0157369_10010007 | Ga0157369_1001000718 | 122 |
| 332 | 3300013105 | Ga0157369_10134645 | Ga0157369_101346454 | 122 |
| 333 | 3300013105 | Ga0157369_10350632 | Ga0157369_103506324 | 122 |
| 334 | 3300013105 | Ga0157369_11148894 | Ga0157369_111488941 | 122 |
| 335 | 3300013296 | Ga0157374_10109918 | Ga0157374_101099186 | 122 |
| 336 | 3300013296 | Ga0157374_11554346 | Ga0157374_115543461 | 122 |
| 337 | 3300013297 | Ga0157378_10243176 | Ga0157378_102431763 | 122 |
| 338 | 3300013297 | Ga0157378_10398622 | Ga0157378_103986223 | 122 |
| 339 | 3300013306 | Ga0163162_10336575 | Ga0163162_103365752 | 122 |
| 340 | 3300013307 | Ga0157372_10000332 | Ga0157372_1000033225 | 122 |
| 341 | 3300013307 | Ga0157372_10419322 | Ga0157372_104193224 | 122 |
| 342 | 3300013307 | Ga0157372_10693414 | Ga0157372_106934142 | 122 |
| 343 | 3300013308 | Ga0157375_10037032 | Ga0157375_1003703210 | 122 |
| 344 | 3300013308 | Ga0157375_10069554 | Ga0157375_100695544 | 122 |
| 345 | 3300013308 | Ga0157375_10111014 | Ga0157375_101110145 | 122 |
| 346 | 3300013308 | Ga0157375_10170821 | Ga0157375_101708215 | 122 |
| 347 | 3300014325 | Ga0163163_10396542 | Ga0163163_103965423 | 122 |
| 348 | 3300014325 | Ga0163163_10851235 | Ga0163163_108512352 | 122 |
| 349 | 3300014326 | Ga0157380_10000051 | Ga0157380_1000005115 | 122 |
| 350 | 3300014326 | Ga0157380_10404335 | Ga0157380_104043354 | 122 |
| 351 | 3300014326 | Ga0157380_12415281 | Ga0157380_124152812 | 122 |
| 352 | 3300014326 | Ga0157380_13443630 | Ga0157380_134436301 | 122 |
| 353 | 3300014497 | Ga0182008_10000003 | Ga0182008_10000003171 | 122 |
| 354 | 3300014745 | Ga0157377_11408202 | Ga0157377_114082022 | 122 |
| 355 | 3300014969 | Ga0157376_10034767 | Ga0157376_100347678 | 122 |
| 356 | 3300014969 | Ga0157376_10337712 | Ga0157376_103377123 | 122 |
| 357 | 3300015261 | Ga0182006_1000001 | Ga0182006_1000001859 | 122 |
| 358 | 3300015261 | Ga0182006_1013176 | Ga0182006_10131764 | 122 |
| 359 | 3300017792 | Ga0163161_10000039 | Ga0163161_1000003915 | 122 |
| 360 | 3300017792 | Ga0163161_10254078 | Ga0163161_102540784 | 122 |
| 361 | 3300017792 | Ga0163161_10260107 | Ga0163161_102601071 | 122 |
| 362 | 3300020069 | Ga0197907_10154472 | Ga0197907_101544721 | 122 |
| 363 | 3300020069 | Ga0197907_10422521 | Ga0197907_104225212 | 122 |
| 364 | 3300020070 | Ga0206356_10849066 | Ga0206356_108490662 | 122 |
| 365 | 3300020070 | Ga0206356_11071775 | Ga0206356_110717752 | 122 |
| 366 | 3300020077 | Ga0206351_10173698 | Ga0206351_101736982 | 122 |
| 367 | 3300020081 | Ga0206354_11169306 | Ga0206354_111693061 | 122 |
| 368 | 3300020081 | Ga0206354_11444727 | Ga0206354_114447273 | 122 |
| 369 | 3300021361 | Ga0213872_10169445 | Ga0213872_101694453 | 122 |
| 370 | 3300022467 | Ga0224712_10000155 | Ga0224712_1000015518 | 122 |
| 371 | 3300022467 | Ga0224712_10012850 | Ga0224712_100128506 | 122 |
| 372 | 3300023309 | Ga0256744_134753 | Ga0256744_1347533 | 122 |
| 373 | 3300025291 | Ga0209675_1000115 | Ga0209675_1000115100 | 122 |
| 374 | 3300025728 | Ga0207655_1000016 | Ga0207655_1000016439 | 122 |
| 375 | 3300025728 | Ga0207655_1000038 | Ga0207655_1000038198 | 122 |
| 376 | 3300025735 | Ga0207713_1025586 | Ga0207713_10255864 | 122 |
| 377 | 3300025909 | Ga0207705_10903848 | Ga0207705_109038481 | 122 |
| 378 | 3300025913 | Ga0207695_11149645 | Ga0207695_111496452 | 122 |
| 379 | 3300025925 | Ga0207650_10566732 | Ga0207650_105667322 | 122 |
| 380 | 3300025926 | Ga0207659_10706438 | Ga0207659_107064382 | 122 |
| 381 | 3300025927 | Ga0207687_10040627 | Ga0207687_100406273 | 122 |
| 382 | 3300025931 | Ga0207644_10271630 | Ga0207644_102716303 | 122 |
| 383 | 3300025933 | Ga0207706_10345074 | Ga0207706_103450741 | 122 |
| 384 | 3300025934 | Ga0207686_10143611 | Ga0207686_101436114 | 122 |
| 385 | 3300025934 | Ga0207686_10311130 | Ga0207686_103111302 | 122 |
| 386 | 3300025935 | Ga0207709_10000084 | Ga0207709_10000084115 | 122 |
| 387 | 3300025939 | Ga0207665_10009076 | Ga0207665_100090764 | 122 |
| 388 | 3300025939 | Ga0207665_10191290 | Ga0207665_101912903 | 122 |
| 389 | 3300025944 | Ga0207661_10011066 | Ga0207661_100110668 | 122 |
| 390 | 3300025949 | Ga0207667_10242056 | Ga0207667_102420561 | 122 |
| 391 | 3300025949 | Ga0207667_10965088 | Ga0207667_109650882 | 122 |
| 392 | 3300025961 | Ga0207712_10050092 | Ga0207712_100500926 | 122 |
| 393 | 3300025972 | Ga0207668_10084113 | Ga0207668_100841135 | 122 |
| 394 | 3300025981 | Ga0207640_10320442 | Ga0207640_103204422 | 122 |
| 395 | 3300025986 | Ga0207658_11099338 | Ga0207658_110993382 | 122 |
| 396 | 3300026041 | Ga0207639_10616274 | Ga0207639_106162743 | 122 |
| 397 | 3300026067 | Ga0207678_10276208 | Ga0207678_102762083 | 122 |
| 398 | 3300026078 | Ga0207702_10111476 | Ga0207702_101114765 | 122 |
| 399 | 3300026089 | Ga0207648_10334177 | Ga0207648_103341773 | 122 |
| 400 | 3300026089 | Ga0207648_10601554 | Ga0207648_106015543 | 122 |
| 401 | 3300026095 | Ga0207676_10521873 | Ga0207676_105218732 | 122 |
| 402 | 3300026116 | Ga0207674_10033610 | Ga0207674_100336109 | 122 |
| 403 | 3300026121 | Ga0207683_10546231 | Ga0207683_105462313 | 122 |
| 404 | 3300026142 | Ga0207698_10870094 | Ga0207698_108700943 | 122 |
| 405 | 3300026142 | Ga0207698_11298122 | Ga0207698_112981222 | 122 |
| 406 | 3300027111 | Ga0209281_1000337 | Ga0209281_100033726 | 122 |
| 407 | 3300027360 | Ga0209969_1029826 | Ga0209969_10298262 | 122 |
| 408 | 3300027361 | Ga0209489_111364 | Ga0209489_11136415 | 122 |
| 409 | 3300027471 | Ga0209995_1006210 | Ga0209995_10062105 | 122 |
| 410 | 3300027552 | Ga0209982_1085430 | Ga0209982_10854301 | 122 |
| 411 | 3300027617 | Ga0210002_1001591 | Ga0210002_10015917 | 122 |
| 412 | 3300027666 | Ga0209282_1028939 | Ga0209282_10289396 | 122 |
| 413 | 3300027682 | Ga0209971_1038687 | Ga0209971_10386874 | 122 |
| 414 | 3300027876 | Ga0209974_10026106 | Ga0209974_100261063 | 122 |
| 415 | 3300028380 | Ga0268265_11164139 | Ga0268265_111641392 | 122 |
| 416 | 3300028563 | Ga0265319_1145650 | Ga0265319_11456502 | 122 |
| 417 | 3300028573 | Ga0265334_10002690 | Ga0265334_100026908 | 122 |
| 418 | 3300028577 | Ga0265318_10075189 | Ga0265318_100751893 | 122 |
| 419 | 3300028786 | Ga0307517_10392082 | Ga0307517_103920822 | 122 |
| 420 | 3300031548 | Ga0307408_100000648 | Ga0307408_10000064813 | 122 |
| 421 | 3300031548 | Ga0307408_100008863 | Ga0307408_10000886313 | 122 |
| 422 | 3300031665 | Ga0316575_10135485 | Ga0316575_101354852 | 122 |
| 423 | 3300031727 | Ga0316576_10195389 | Ga0316576_101953893 | 122 |
| 424 | 3300031730 | Ga0307516_10472537 | Ga0307516_104725373 | 122 |
| 425 | 3300031731 | Ga0307405_10000005 | Ga0307405_10000005218 | 122 |
| 426 | 3300031731 | Ga0307405_10002019 | Ga0307405_1000201913 | 122 |
| 427 | 3300031731 | Ga0307405_10421117 | Ga0307405_104211172 | 122 |
| 428 | 3300031824 | Ga0307413_10001014 | Ga0307413_100010142 | 122 |
| 429 | 3300031824 | Ga0307413_10001307 | Ga0307413_1000130715 | 122 |
| 430 | 3300031824 | Ga0307413_10412951 | Ga0307413_104129512 | 122 |
| 431 | 3300031852 | Ga0307410_10000034 | Ga0307410_1000003427 | 122 |
| 432 | 3300031901 | Ga0307406_10000004 | Ga0307406_10000004117 | 122 |
| 433 | 3300031903 | Ga0307407_10000196 | Ga0307407_1000019619 | 122 |
| 434 | 3300031911 | Ga0307412_10000088 | Ga0307412_1000008880 | 122 |
| 435 | 3300031911 | Ga0307412_10048579 | Ga0307412_100485792 | 122 |
| 436 | 3300031911 | Ga0307412_10127716 | Ga0307412_101277164 | 122 |
| 437 | 3300032002 | Ga0307416_100000006 | Ga0307416_10000000684 | 122 |
| 438 | 3300032002 | Ga0307416_100534132 | Ga0307416_1005341324 | 122 |
| 439 | 3300032004 | Ga0307414_10000011 | Ga0307414_10000011339 | 122 |
| 440 | 3300032004 | Ga0307414_10000030 | Ga0307414_1000003028 | 122 |
| 441 | 3300032004 | Ga0307414_10000673 | Ga0307414_100006732 | 122 |
| 442 | 3300032004 | Ga0307414_10009268 | Ga0307414_100092684 | 122 |
| 443 | 3300032004 | Ga0307414_10011571 | Ga0307414_100115715 | 122 |
| 444 | 3300032005 | Ga0307411_10000004 | Ga0307411_1000000410 | 122 |
| 445 | 3300032005 | Ga0307411_10001861 | Ga0307411_1000186117 | 122 |
| 446 | 3300032005 | Ga0307411_10342908 | Ga0307411_103429082 | 122 |
| 447 | 3300033524 | Ga0316592_1000022 | Ga0316592_100002210 | 122 |
| 448 | 3300033527 | Ga0316586_1000693 | Ga0316586_10006935 | 122 |
| 449 | 3300033527 | Ga0316586_1009017 | Ga0316586_10090172 | 122 |
| 450 | 3300033541 | Ga0316596_1022402 | Ga0316596_10224025 | 122 |
| 451 | 3300035398 | Ga0316574_0007562 | Ga0316574_0007562_2473_2841 | 122 |
| 452 | 3300035398 | Ga0316574_0129961 | Ga0316574_0129961_74_442 | 122 |
| 453 | 3300035398 | Ga0316574_0247646 | Ga0316574_0247646_37_405 | 122 |
| 454 | 3300035398 | Ga0316574_0287960 | Ga0316574_0287960_60_428 | 122 |
| 455 | 3300036401 | Ga0373937_0174104 | Ga0373937_0174104_1327_1695 | 122 |
| 456 | 3300036401 | Ga0373937_1690625 | Ga0373937_1690625_28_396 | 122 |
| 457 | 3300037312 | Ga0395899_0000673 | Ga0395899_0000673_20228_20596 | 122 |
| 458 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_270991_271359 | 122 |
| 459 | 3300037471 | Ga0395905_1230617 | Ga0395905_1230617_12_380 | 122 |
| 460 | 3300038443 | Ga0395901_0045223 | Ga0395901_0045223_113_481 | 122 |
| 461 | 3300038634 | Ga0246641_01883 | Ga0246641_01883_56_424 | 122 |
| 462 | 3300039447 | Ga0436361_1216877 | Ga0436361_1216877_431_799 | 122 |
| 463 | 3300041407 | Ga0439447_000447 | Ga0439447_000447_3158_3526 | 122 |
| 464 | 3300041411 | Ga0439466_0004165 | Ga0439466_0004165_2631_2999 | 122 |
| 465 | 3300041411 | Ga0439466_0057610 | Ga0439466_0057610_246_614 | 122 |
| 466 | 3300041413 | Ga0439465_0000032 | Ga0439465_0000032_25474_25842 | 122 |
| 467 | 3300041441 | Ga0451787_107116 | Ga0451787_107116_801_1169 | 122 |
| 468 | 3300041442 | Ga0451788_01017 | Ga0451788_01017_132_500 | 122 |
| 469 | 3300041443 | Ga0451789_1079854 | Ga0451789_1079854_74_442 | 122 |
| 470 | 3300041444 | Ga0451790_34212 | Ga0451790_34212_37_405 | 122 |
| 471 | 3300041444 | Ga0451790_47773 | Ga0451790_47773_355_723 | 122 |
| 472 | 3300041451 | Ga0451791_1675939 | Ga0451791_1675939_21_389 | 122 |
| 473 | 3300041452 | Ga0451793_0652381 | Ga0451793_0652381_342_710 | 122 |
| 474 | 3300041458 | Ga0451798_0435092 | Ga0451798_0435092_185_553 | 122 |
| 475 | 3300041459 | Ga0451800_1256493 | Ga0451800_1256493_84_452 | 122 |
| 476 | 3300041460 | Ga0451802_0457191 | Ga0451802_0457191_73_441 | 122 |
| 477 | 3300041461 | Ga0451805_017120 | Ga0451805_017120_128_496 | 122 |
| 478 | 3300041486 | Ga0451807_1997617 | Ga0451807_1997617_320_688 | 122 |
| 479 | 3300041491 | Ga0451833_0933881 | Ga0451833_0933881_129_497 | 122 |
| 480 | 3300041494 | Ga0451837_0125275 | Ga0451837_0125275_55_423 | 122 |
| 481 | 3300041494 | Ga0451837_0568756 | Ga0451837_0568756_478_846 | 122 |
| 482 | 3300041494 | Ga0451837_1056715 | Ga0451837_1056715_316_684 | 122 |
| 483 | 3300041494 | Ga0451837_1777468 | Ga0451837_1777468_96_464 | 122 |
| 484 | 3300041498 | Ga0451841_1428716 | Ga0451841_1428716_1483_1851 | 122 |
| 485 | 3300041505 | Ga0451849_1512452 | Ga0451849_1512452_380_748 | 122 |
| 486 | 3300041507 | Ga0451851_0977032 | Ga0451851_0977032_636_1004 | 122 |
| 487 | 3300041509 | Ga0451843_0112769 | Ga0451843_0112769_1456_1824 | 122 |
| 488 | 3300041511 | Ga0451855_0737901 | Ga0451855_0737901_147_515 | 122 |
| 489 | 3300041512 | Ga0451853_3298037 | Ga0451853_3298037_448_816 | 122 |
| 490 | 3300042004 | Ga0439445_0000090 | Ga0439445_0000090_6707_7075 | 122 |
| 491 | 3300042004 | Ga0439445_0001316 | Ga0439445_0001316_2792_3160 | 122 |
| 492 | 3300042006 | Ga0439432_088233 | Ga0439432_088233_334_702 | 122 |
| 493 | 3300042129 | Ga0450891_009933 | Ga0450891_009933_41_409 | 122 |
| 494 | 3300042145 | Ga0450906_044160 | Ga0450906_044160_147_515 | 122 |
| 495 | 3300042156 | Ga0439446_0111787 | Ga0439446_0111787_376_744 | 122 |
| 496 | 3300042435 | Ga0439434_0048824 | Ga0439434_0048824_775_1143 | 122 |
| 497 | 3300042436 | Ga0439435_0134617 | Ga0439435_0134617_200_568 | 122 |
| 498 | 3300042876 | Ga0451577_0002272 | Ga0451577_0002272_20832_21200 | 122 |
| 499 | 3300044658 | Ga0466972_0325270 | Ga0466972_0325270_282_650 | 122 |
| 500 | 3300044712 | Ga0453684_0466138 | Ga0453684_0466138_941_1309 | 122 |
| 501 | 3300044712 | Ga0453684_1044859 | Ga0453684_1044859_411_779 | 122 |
| 502 | 3300044712 | Ga0453684_1864412 | Ga0453684_1864412_192_560 | 122 |
| 503 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_960243_960611 | 122 |
| 504 | 3300045051 | Ga0451576_0017866 | Ga0451576_0017866_1364_1732 | 122 |
| 505 | 3300045051 | Ga0451576_0040065 | Ga0451576_0040065_3045_3413 | 122 |
| 506 | 3300046453 | Ga0495627_000022 | Ga0495627_000022_191589_191957 | 122 |
| 507 | 3300046457 | Ga0495590_0009537 | Ga0495590_0009537_3251_3619 | 122 |
| 508 | 3300046477 | Ga0495664_0545738 | Ga0495664_0545738_59_427 | 122 |
| 509 | 3300046500 | Ga0495596_0004903 | Ga0495596_0004903_5888_6256 | 122 |
| 510 | 3300046501 | Ga0495607_0239089 | Ga0495607_0239089_167_535 | 122 |
| 511 | 3300046507 | Ga0495606_0021702 | Ga0495606_0021702_1229_1597 | 122 |
| 512 | 3300046507 | Ga0495606_0116963 | Ga0495606_0116963_1153_1521 | 122 |
| 513 | 3300046512 | Ga0495610_0000005 | Ga0495610_0000005_194644_195012 | 122 |
| 514 | 3300046512 | Ga0495610_0018640 | Ga0495610_0018640_514_882 | 122 |
| 515 | 3300046519 | Ga0495632_0007484 | Ga0495632_0007484_3565_3933 | 122 |
| 516 | 3300046522 | Ga0495643_0000294 | Ga0495643_0000294_47316_47684 | 122 |
| 517 | 3300046522 | Ga0495643_0219315 | Ga0495643_0219315_398_766 | 122 |
| 518 | 3300046522 | Ga0495643_0287237 | Ga0495643_0287237_172_540 | 122 |
| 519 | 3300046525 | Ga0495663_0001345 | Ga0495663_0001345_1729_2097 | 122 |
| 520 | 3300046525 | Ga0495663_0012337 | Ga0495663_0012337_1327_1695 | 122 |
| 521 | 3300046530 | Ga0495654_0000003 | Ga0495654_0000003_689580_689948 | 122 |
| 522 | 3300046530 | Ga0495654_0086898 | Ga0495654_0086898_539_907 | 122 |
| 523 | 3300046535 | Ga0495586_0299046 | Ga0495586_0299046_114_482 | 122 |
| 524 | 3300046538 | Ga0495609_0000003 | Ga0495609_0000003_675676_676044 | 122 |
| 525 | 3300046543 | Ga0495645_0320880 | Ga0495645_0320880_280_648 | 122 |
| 526 | 3300046558 | Ga0495633_0003150 | Ga0495633_0003150_8150_8518 | 122 |
| 527 | 3300046558 | Ga0495633_0013345 | Ga0495633_0013345_2129_2497 | 122 |
| 528 | 3300046558 | Ga0495633_0014068 | Ga0495633_0014068_1143_1511 | 122 |
| 529 | 3300046642 | Ga0495634_0076813 | Ga0495634_0076813_746_1114 | 122 |
| 530 | 3300046660 | Ga0495625_0000096 | Ga0495625_0000096_75829_76197 | 122 |
| 531 | 3300046660 | Ga0495625_0001933 | Ga0495625_0001933_9505_9873 | 122 |
| 532 | 3300046660 | Ga0495625_0041479 | Ga0495625_0041479_2464_2832 | 122 |
| 533 | 3300046681 | Ga0495647_0318605 | Ga0495647_0318605_213_581 | 122 |
| 534 | 3300046683 | Ga0495658_0749816 | Ga0495658_0749816_182_550 | 122 |
| 535 | 3300046692 | Ga0495671_0063109 | Ga0495671_0063109_127_495 | 122 |
| 536 | 3300046810 | Ga0495660_0024916 | Ga0495660_0024916_1109_1477 | 122 |
| 537 | 3300046810 | Ga0495660_0223215 | Ga0495660_0223215_12_380 | 122 |
| 538 | 3300047472 | Ga0495686_0004601 | Ga0495686_0004601_2340_2708 | 122 |
| 539 | 3300047472 | Ga0495686_0469080 | Ga0495686_0469080_204_572 | 122 |
| 540 | 3300048905 | Ga0496102_0035559 | Ga0496102_0035559_3895_4263 | 122 |
| 541 | 3300048907 | Ga0496104_0268649 | Ga0496104_0268649_977_1345 | 122 |
| 542 | 3300048908 | Ga0496105_0160764 | Ga0496105_0160764_635_1003 | 122 |
| 543 | 3300048916 | Ga0496113_0161385 | Ga0496113_0161385_671_1039 | 122 |
| 544 | 3300048917 | Ga0496114_1047556 | Ga0496114_1047556_265_633 | 122 |
| 545 | 3300048918 | Ga0496115_0068443 | Ga0496115_0068443_670_1038 | 122 |
| 546 | 3300048919 | Ga0496116_0000024 | Ga0496116_0000024_97208_97576 | 122 |
| 547 | 3300048919 | Ga0496116_0000029 | Ga0496116_0000029_79789_80157 | 122 |
| 548 | 3300048920 | Ga0496117_0000007 | Ga0496117_0000007_78167_78535 | 122 |
| 549 | 3300048920 | Ga0496117_0120383 | Ga0496117_0120383_1040_1408 | 122 |
| 550 | 3300048921 | Ga0496118_0000252 | Ga0496118_0000252_90700_91068 | 122 |
| 551 | 3300048921 | Ga0496118_0033058 | Ga0496118_0033058_1689_2057 | 122 |
| 552 | 3300048921 | Ga0496118_0126896 | Ga0496118_0126896_115_483 | 122 |
| 553 | 3300048922 | Ga0496119_0000007 | Ga0496119_0000007_78234_78602 | 122 |
| 554 | 3300048923 | Ga0496120_0007422 | Ga0496120_0007422_6180_6548 | 122 |
| 555 | 3300048924 | Ga0496121_0014632 | Ga0496121_0014632_6366_6734 | 122 |
| 556 | 3300048924 | Ga0496121_0021047 | Ga0496121_0021047_5993_6361 | 122 |
| 557 | 3300048926 | Ga0496123_0041623 | Ga0496123_0041623_2320_2688 | 122 |
| 558 | 3300048927 | Ga0496124_0013719 | Ga0496124_0013719_7376_7744 | 122 |
| 559 | 3300048927 | Ga0496124_0035036 | Ga0496124_0035036_3959_4327 | 122 |
| 560 | 3300048927 | Ga0496124_0050411 | Ga0496124_0050411_92_460 | 122 |
| 561 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_382618_382986 | 122 |
| 562 | 3300048928 | Ga0496125_0000031 | Ga0496125_0000031_29583_29951 | 122 |
| 563 | 3300048928 | Ga0496125_0032980 | Ga0496125_0032980_3031_3399 | 122 |
| 564 | 3300048928 | Ga0496125_0124107 | Ga0496125_0124107_811_1179 | 122 |
| 565 | 3300048929 | Ga0496126_0115769 | Ga0496126_0115769_108_476 | 122 |
| 566 | 3300048929 | Ga0496126_0119349 | Ga0496126_0119349_1691_2059 | 122 |
| 567 | 3300048929 | Ga0496126_0924928 | Ga0496126_0924928_128_496 | 122 |
| 568 | 3300049130 | Ga0501310_000150 | Ga0501310_000150_1612_1980 | 122 |
| 569 | 3300049160 | Ga0501304_018390 | Ga0501304_018390_226_594 | 122 |
| 570 | 3300049162 | Ga0501307_002458 | Ga0501307_002458_303_671 | 122 |
| 571 | 3300049530 | Ga0501314_000001 | Ga0501314_000001_4839_5207 | 122 |
| 572 | 3300049533 | Ga0501317_000248 | Ga0501317_000248_2442_2810 | 122 |
| 573 | 3300049535 | Ga0501319_000002 | Ga0501319_000002_8484_8852 | 122 |
| 574 | 3300049535 | Ga0501319_000013 | Ga0501319_000013_2202_2570 | 122 |
| 575 | 3300049536 | Ga0501320_000041 | Ga0501320_000041_937_1305 | 122 |
| 576 | 3300049537 | Ga0501321_000051 | Ga0501321_000051_1121_1489 | 122 |
| 577 | 3300049537 | Ga0501321_010452 | Ga0501321_010452_100_468 | 122 |
| 578 | 3300049538 | Ga0501322_000046 | Ga0501322_000046_3103_3471 | 122 |
| 579 | 3300049539 | Ga0501323_000002 | Ga0501323_000002_9008_9376 | 122 |
| 580 | 3300049539 | Ga0501323_000756 | Ga0501323_000756_1308_1676 | 122 |
| 581 | 3300049539 | Ga0501323_004478 | Ga0501323_004478_938_1306 | 122 |
| 582 | 3300049540 | Ga0501324_000002 | Ga0501324_000002_4980_5348 | 122 |
| 583 | 3300049541 | Ga0501325_000286 | Ga0501325_000286_1610_1978 | 122 |
| 584 | 3300049542 | Ga0501326_00056 | Ga0501326_00056_1615_1983 | 122 |
| 585 | 3300049544 | Ga0501328_00035 | Ga0501328_00035_929_1297 | 122 |
| 586 | 3300049545 | Ga0501329_00017 | Ga0501329_00017_565_933 | 122 |
| 587 | 3300049546 | Ga0501330_000098 | Ga0501330_000098_611_979 | 122 |
| 588 | 3300049547 | Ga0501331_00043 | Ga0501331_00043_2442_2810 | 122 |
| 589 | 3300049550 | Ga0501334_00029 | Ga0501334_00029_910_1278 | 122 |
| 590 | 3300049550 | Ga0501334_00034 | Ga0501334_00034_1144_1512 | 122 |
| 591 | 3300049551 | Ga0501335_000048 | Ga0501335_000048_2758_3126 | 122 |
| 592 | 3300049551 | Ga0501335_000133 | Ga0501335_000133_1510_1878 | 122 |
| 593 | 3300049553 | Ga0501337_000033 | Ga0501337_000033_3067_3435 | 122 |
| 594 | 3300049568 | Ga0501031_0004470 | Ga0501031_0004470_8122_8490 | 122 |
| 595 | 3300049569 | Ga0501032_0002362 | Ga0501032_0002362_2670_3038 | 122 |
| 596 | 3300049569 | Ga0501032_0002936 | Ga0501032_0002936_1136_1504 | 122 |
| 597 | 3300049570 | Ga0501033_0000011 | Ga0501033_0000011_42370_42738 | 122 |
| 598 | 3300049571 | Ga0501034_0001265 | Ga0501034_0001265_12031_12399 | 122 |
| 599 | 3300049571 | Ga0501034_0232715 | Ga0501034_0232715_682_1050 | 122 |
| 600 | 3300049572 | Ga0501036_0068307 | Ga0501036_0068307_2565_2933 | 122 |
| 601 | 3300049573 | Ga0501037_0003904 | Ga0501037_0003904_705_1073 | 122 |
| 602 | 3300049574 | Ga0501038_0002395 | Ga0501038_0002395_11426_11794 | 122 |
| 603 | 3300049574 | Ga0501038_0108296 | Ga0501038_0108296_956_1324 | 122 |
| 604 | 3300049575 | Ga0501039_0015938 | Ga0501039_0015938_1031_1399 | 122 |
| 605 | 3300049579 | Ga0501043_0000733 | Ga0501043_0000733_5879_6247 | 122 |
| 606 | 3300049581 | Ga0501047_0037417 | Ga0501047_0037417_3121_3489 | 122 |
| 607 | 3300049581 | Ga0501047_0046063 | Ga0501047_0046063_1117_1485 | 122 |
| 608 | 3300049582 | Ga0501048_0426916 | Ga0501048_0426916_490_858 | 122 |
| 609 | 3300049583 | Ga0501067_0379480 | Ga0501067_0379480_41_409 | 122 |
| 610 | 3300049586 | Ga0501070_0704969 | Ga0501070_0704969_388_756 | 122 |
| 611 | 3300049590 | Ga0501074_0989645 | Ga0501074_0989645_57_425 | 122 |
| 612 | 3300049649 | Ga0501198_026181 | Ga0501198_026181_440_808 | 122 |
| 613 | 3300049663 | Ga0501223_002029 | Ga0501223_002029_2807_3175 | 122 |
| 614 | 3300049664 | Ga0501224_030889 | Ga0501224_030889_59_427 | 122 |
| 615 | 3300049669 | Ga0501235_087542 | Ga0501235_087542_330_698 | 122 |
| 616 | 3300049671 | Ga0501238_000015 | Ga0501238_000015_6919_7287 | 122 |
| 617 | 3300049675 | Ga0501243_003419 | Ga0501243_003419_623_991 | 122 |
| 618 | 3300049679 | Ga0501249_195692 | Ga0501249_195692_71_439 | 122 |
| 619 | 3300049681 | Ga0501251_005157 | Ga0501251_005157_123_491 | 122 |
| 620 | 3300049758 | Ga0501241_000002 | Ga0501241_000002_80775_81143 | 122 |
| 621 | 3300049758 | Ga0501241_000113 | Ga0501241_000113_4708_5076 | 122 |
| 622 | 3300049758 | Ga0501241_002715 | Ga0501241_002715_1769_2137 | 122 |
| 623 | 3300049759 | Ga0501262_009059 | Ga0501262_009059_54_422 | 122 |
| 624 | 3300049763 | Ga0501266_000002 | Ga0501266_000002_344481_344849 | 122 |
| 625 | 3300049766 | Ga0501269_000004 | Ga0501269_000004_26894_27262 | 122 |
| 626 | 3300049766 | Ga0501269_001937 | Ga0501269_001937_507_875 | 122 |
| 627 | 3300049776 | Ga0501280_000239 | Ga0501280_000239_8440_8808 | 122 |
| 628 | 3300049776 | Ga0501280_093662 | Ga0501280_093662_100_468 | 122 |
| 629 | 3300049822 | Ga0501035_0009077 | Ga0501035_0009077_8424_8792 | 122 |
| 630 | 3300049822 | Ga0501035_0016384 | Ga0501035_0016384_477_845 | 122 |
| 631 | 3300049823 | Ga0501044_0001293 | Ga0501044_0001293_5659_6027 | 122 |
| 632 | 3300049824 | Ga0501045_0000053 | Ga0501045_0000053_12163_12531 | 122 |
| 633 | 3300050489 | nmdc:mga03683_18140_c1 | nmdc:mga03683_18140_c1_2188_2556 | 122 |
| 634 | 3300050496 | nmdc:mga07m45_534682_c1 | nmdc:mga07m45_534682_c1_30_398 | 122 |
| 635 | 3300053088 | Ga0500644_0020716 | Ga0500644_0020716_670_1038 | 122 |
| 636 | 3300053090 | Ga0500646_0007145 | Ga0500646_0007145_302_670 | 122 |
| 637 | 3300053090 | Ga0500646_0009195 | Ga0500646_0009195_882_1250 | 122 |
| 638 | 3300053091 | Ga0500647_0405990 | Ga0500647_0405990_95_463 | 122 |
| 639 | 3300053093 | Ga0500651_0066629 | Ga0500651_0066629_614_982 | 122 |
| 640 | 3300053096 | Ga0500641_0000168 | Ga0500641_0000168_163_531 | 122 |
| 641 | 3300053096 | Ga0500641_0006404 | Ga0500641_0006404_671_1039 | 122 |
| 642 | 3300053129 | Ga0500628_164640 | Ga0500628_164640_171_539 | 122 |
| 643 | 3300053134 | Ga0500658_0000002 | Ga0500658_0000002_195845_196213 | 122 |
| 644 | 3300053136 | Ga0500559_0010320 | Ga0500559_0010320_1210_1578 | 122 |
| 645 | 3300053140 | Ga0500573_0169794 | Ga0500573_0169794_340_708 | 122 |
| 646 | 3300053152 | Ga0500606_175726 | Ga0500606_175726_77_445 | 122 |
| 647 | 3300053156 | Ga0500622_0138338 | Ga0500622_0138338_194_562 | 122 |
| 648 | 3300053156 | Ga0500622_0317436 | Ga0500622_0317436_150_518 | 122 |
| 649 | 3300053158 | Ga0500627_0306602 | Ga0500627_0306602_142_510 | 122 |
| 650 | 3300053726 | Ga0500584_021185 | Ga0500584_021185_1645_2013 | 122 |
| 651 | 3300059478 | Ga0587093_013795 | Ga0587093_013795_359_727 | 122 |
| 652 | 3300059490 | Ga0587066_019259 | Ga0587066_019259_698_1066 | 122 |
| 653 | 3300059491 | Ga0587070_005454 | Ga0587070_005454_764_1132 | 122 |
| 654 | 3300059493 | Ga0587077_013219 | Ga0587077_013219_203_571 | 122 |
| 655 | 3300059493 | Ga0587077_083699 | Ga0587077_083699_167_535 | 122 |
| 656 | 3300059505 | Ga0587083_0019247 | Ga0587083_0019247_637_1005 | 122 |
| 657 | 3300059512 | Ga0587092_046170 | Ga0587092_046170_109_477 | 122 |
| 658 | 3300059514 | Ga0587095_025185 | Ga0587095_025185_182_550 | 122 |
| 659 | 3300059627 | Ga0587117_009294 | Ga0587117_009294_764_1132 | 122 |
| 660 | 3300059641 | Ga0587068_000659 | Ga0587068_000659_2037_2405 | 122 |
| 661 | 3300059645 | Ga0587076_051613 | Ga0587076_051613_37_405 | 122 |
| 662 | 3300059647 | Ga0587079_112190 | Ga0587079_112190_257_625 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v9a-assembly1.cif.gz_BN | crystal structure of the 70s ribosome with tetracycline. | 0.9711 | 1 | 122 |
| 7jil-assembly1.cif.gz_K | 70s ribosome flavobacterium johnsoniae | 0.9678 | 1 | 121 |
| 6n1d-assembly2.cif.gz_BL14 | x-ray crystal complex showing spontaneous ribosomal translocation of mrna and trnas into a chimeric hybrid state | 0.9658 | 1 | 122 |
| 4xej-assembly1.cif.gz_AL14 | ires bound to bacterial ribosome | 0.9651 | 1 | 122 |
| 8fn2-assembly1.cif.gz_M | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9648 | 1 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ddgW00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9476 | 2 | 121 | 2.40.150.20 |
| 6ddgW00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.94 | 2 | 121 | 2.40.150.20 |
| 3i1nK00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9369 | 1 | 121 | 2.40.150.20 |
| 1vw4I00 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9325 | 1 | 122 | 2.40.150.20 |
| af_C0H4F0_2_122_2.40.150.20 | Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 | 0.9261 | 2 | 109 | 2.40.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537L638-F1-model_v4 | Large ribosomal subunit protein uL14 | 0.9879 | 32 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7V2EDC6-F1-model_v4 | 50S ribosomal protein L14 | 0.9873 | 34 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7X7B8Y8-F1-model_v4 | 50S ribosomal protein L14 | 0.983 | 34 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A1M5LNT0-F1-model_v4 | Large ribosomal subunit protein uL14 | 0.9821 | 1 | 122 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A0F7QZP6-F1-model_v4 | Large ribosomal subunit protein uL14c | 0.9821 | 1 | 122 |
GO:0003735
GO:0006412 GO:0009507 GO:0022625 GO:0070180 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar