F473451

General Info

Members Datasets Scaffolds Average Seq Length
662 391 586 121

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10304096|rootH2_103040964
Length 109
Sequence MIQQESRLAVADNSGAKEVLCIRVLGGTKRRYASVGDKIVVAVKSAMPSGRTRKEVRRPDGSYIRFDDNACVILNQAGEMRGTRIFGPVARELRENNYMKIVSLAPEVL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
5 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
6 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
7 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
8 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
9 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
10 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
11 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
12 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
13 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
14 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
15 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
16 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
17 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
18 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
19 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
20 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
21 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
22 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
23 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
24 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
25 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
26 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
27 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
28 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
29 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
30 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
31 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
32 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
33 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
34 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
35 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
36 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
37 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
38 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
39 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
40 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
41 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
42 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
43 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
44 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
45 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
46 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
47 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
48 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
49 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
50 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
51 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
52 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
53 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
54 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
55 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
56 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
57 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
58 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
59 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
60 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
61 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
62 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
63 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
64 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
65 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
66 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
67 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
68 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
69 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
70 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
71 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
72 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
73 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
74 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
75 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
76 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
77 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
78 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
79 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
80 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
81 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
82 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
83 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
84 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
91 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
94 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
97 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
98 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
99 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
100 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
103 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
104 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
105 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
106 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
122 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
123 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
187 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
203 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
218 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
219 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300038634 Barley rhizosphere microbial communities from Potsdam, Germany - 563_E Metagenome Rhizosphere
232 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
233 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
236 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
237 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
238 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
239 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
240 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
241 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
242 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
245 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
248 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
254 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
255 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
256 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
257 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
258 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
263 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
264 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
265 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
266 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
346 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
347 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
348 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
349 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
350 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
351 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
352 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
353 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
354 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
355 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
356 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
357 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
364 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
365 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
368 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
372 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
376 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
388 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
389 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
390 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
391 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.96
Metatranscriptomes 15.56
Isolates 11.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 3.32
Nodule 1.06
Rhizoplane 3.93
Rhizosphere 77.79
Stem 0
Stem Tuber 0
Unclassified 13.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_9243 2124908027 Bacteria 1912
2 SwRhRL2b_contig_2038936 2162886007 Bacteria 3057
3 2214748000 2209111006 Bacteria 3522
4 rootH2_10083556 3300003320 Bacteria 2754
5 rootH2_10110587 3300003320 Bacteria 3748
6 rootH2_10304096 3300003320 Bacteria 1735
7 rootL2_10155965 3300003322 Bacteria 1972
8 rootH1_10127399 3300003323 Bacteria 5374
9 Ga0007409J51694_1126710 3300003575 Bacteria 1168
10 Ga0006562J51391_1003423 3300003578 Bacteria 13910
11 Ga0006562J51391_1011740 3300003578 Bacteria 7760
12 Ga0055534_1007293 3300003784 Bacteria 2655
13 Ga0058860_10114316 3300004801 Bacteria 13584
14 Ga0058860_10170387 3300004801 Bacteria 957
15 Ga0065717_1002035 3300005276 Bacteria 3353
16 Ga0065716_1001819 3300005277 Bacteria 3222
17 Ga0065714_10036549 3300005288 Bacteria 822
18 Ga0065714_10237306 3300005288 Bacteria 803
19 Ga0065714_10261165 3300005288 Bacteria 755
20 Ga0065714_10358298 3300005288 Bacteria 628
21 Ga0065704_10008398 3300005289 Bacteria 2521
22 Ga0065704_10084598 3300005289 Bacteria 3318
23 Ga0065704_10138917 3300005289 Bacteria 1539
24 Ga0065715_10018272 3300005293 Bacteria 1911
25 Ga0065715_10037423 3300005293 Bacteria 1069
26 Ga0070658_10957732 3300005327 Bacteria 744
27 Ga0070683_100016581 3300005329 Bacteria 6501
28 Ga0070682_100000608 3300005337 Bacteria 21759
29 Ga0070682_100016944 3300005337 Bacteria 4241
30 Ga0070660_100252297 3300005339 Bacteria 1439
31 Ga0070689_100788474 3300005340 Bacteria 835
32 Ga0070661_101056208 3300005344 Bacteria 675
33 Ga0070669_100383263 3300005353 Bacteria 1147
34 Ga0070675_100504902 3300005354 Bacteria 1090
35 Ga0070671_100350358 3300005355 Bacteria 1260
36 Ga0070674_100131904 3300005356 Bacteria 1864
37 Ga0070673_100611304 3300005364 Bacteria 995
38 Ga0070688_100041948 3300005365 Bacteria 2812
39 Ga0070659_100301071 3300005366 Bacteria 1337
40 Ga0070667_100285431 3300005367 Bacteria 1483
41 Ga0070663_100261729 3300005455 Bacteria 1372
42 Ga0070662_101330865 3300005457 Bacteria 618
43 Ga0068867_100658048 3300005459 Bacteria 920
44 Ga0070685_10022774 3300005466 Bacteria 3420
45 Ga0074259_10545377 3300005507 Bacteria 969
46 Ga0070684_100178514 3300005535 Bacteria 1930
47 Ga0068855_100186174 3300005563 Bacteria 2345
48 Ga0068857_100024669 3300005577 Bacteria 5295
49 Ga0068854_100767782 3300005578 Bacteria 838
50 Ga0068856_100083761 3300005614 Bacteria 3167
51 Ga0068852_100066769 3300005616 Bacteria 3142
52 Ga0068852_100504381 3300005616 Bacteria 1205
53 Ga0068861_100901267 3300005719 Bacteria 837
54 Ga0068863_102010948 3300005841 Bacteria 588
55 Ga0070715_10142688 3300006163 Bacteria 1165
56 Ga0070716_100075957 3300006173 Bacteria 1990
57 Ga0075362_10023790 3300006177 Bacteria 2594
58 Ga0075427_10018603 3300006194 Bacteria 1091
59 Ga0097621_100105361 3300006237 Bacteria 2377
60 Ga0097621_100417199 3300006237 Bacteria 1204
61 Ga0075370_10445622 3300006353 Bacteria 779
62 Ga0068871_100017988 3300006358 Bacteria 5361
63 Ga0068871_101330227 3300006358 Bacteria 676
64 Ga0099824_1003374 3300006942 Bacteria 23361
65 Ga0079104_1000280 3300006946 Bacteria 65859
66 Ga0099826_10000125 3300006948 Bacteria 34471
67 Ga0105251_10027494 3300009011 Bacteria 2883
68 Ga0105244_10000005 3300009036 Bacteria 481412
69 Ga0105244_10017933 3300009036 Bacteria 3985
70 Ga0105250_10077236 3300009092 Bacteria 1348
71 Ga0105240_10552826 3300009093 Bacteria 1273
72 Ga0105245_10022092 3300009098 Bacteria 5586
73 Ga0105247_10162224 3300009101 Bacteria 1481
74 Ga0105243_10077834 3300009148 Bacteria 2699
75 Ga0105242_10023758 3300009176 Bacteria 4835
76 Ga0105242_10252045 3300009176 Bacteria 1591
77 Ga0105242_11557030 3300009176 Bacteria 693
78 Ga0105249_10027670 3300009553 Bacteria 5116
79 Ga0157339_1003659 3300012505 Bacteria 1123
80 Ga0157373_10001369 3300013100 Bacteria 18710
81 Ga0157373_10014797 3300013100 Bacteria 5716
82 Ga0157373_10318379 3300013100 Bacteria 1106
83 Ga0157373_10422990 3300013100 Bacteria 956
84 Ga0157371_10000091 3300013102 Bacteria 144664
85 Ga0157371_10001678 3300013102 Bacteria 22612
86 Ga0157371_10039874 3300013102 Bacteria 3357
87 Ga0157371_10130914 3300013102 Bacteria 1785
88 Ga0157370_10019865 3300013104 Bacteria 6722
89 Ga0157370_10082740 3300013104 Bacteria 3019
90 Ga0157370_10136293 3300013104 Bacteria 2288
91 Ga0157370_10282103 3300013104 Bacteria 1535
92 Ga0157370_10344176 3300013104 Bacteria 1374
93 Ga0157370_10976760 3300013104 Bacteria 767
94 Ga0157370_11150941 3300013104 Bacteria 700
95 Ga0157369_10000613 3300013105 Bacteria 46357
96 Ga0157369_10010007 3300013105 Bacteria 10831
97 Ga0157369_10134645 3300013105 Bacteria 2616
98 Ga0157369_10350632 3300013105 Bacteria 1533
99 Ga0157369_11148894 3300013105 Bacteria 793
100 Ga0157374_10109918 3300013296 Bacteria 2651
101 Ga0157374_11554346 3300013296 Bacteria 685
102 Ga0157378_10243176 3300013297 Bacteria 1720
103 Ga0157378_10398622 3300013297 Bacteria 1355
104 Ga0163162_10336575 3300013306 Bacteria 1642
105 Ga0157372_10000332 3300013307 Bacteria 51907
106 Ga0157372_10419322 3300013307 Bacteria 1560
107 Ga0157372_10693414 3300013307 Bacteria 1185
108 Ga0157375_10037032 3300013308 Bacteria 4671
109 Ga0157375_10069554 3300013308 Bacteria 3527
110 Ga0157375_10111014 3300013308 Bacteria 2840
111 Ga0157375_10170821 3300013308 Bacteria 2322
112 Ga0163163_10396542 3300014325 Bacteria 1438
113 Ga0163163_10851235 3300014325 Bacteria 975
114 Ga0157380_10000051 3300014326 Bacteria 68466
115 Ga0157380_10404335 3300014326 Bacteria 1296
116 Ga0157380_12415281 3300014326 Bacteria 591
117 Ga0157380_13443630 3300014326 Bacteria 506
118 Ga0182008_10000003 3300014497 Bacteria 456880
119 Ga0157377_11408202 3300014745 Bacteria 550
120 Ga0157376_10034767 3300014969 Bacteria 4072
121 Ga0157376_10337712 3300014969 Bacteria 1438
122 Ga0182006_1000001 3300015261 Bacteria 1091090
123 Ga0182006_1013176 3300015261 Bacteria 3594
124 Ga0163161_10000039 3300017792 Bacteria 148130
125 Ga0163161_10254078 3300017792 Bacteria 1371
126 Ga0163161_10260107 3300017792 Bacteria 1355
127 Ga0197907_10154472 3300020069 Bacteria 614
128 Ga0197907_10422521 3300020069 Bacteria 1505
129 Ga0206356_10849066 3300020070 Bacteria 1029
130 Ga0206356_11071775 3300020070 Bacteria 843
131 Ga0206351_10173698 3300020077 Bacteria 938
132 Ga0206354_11169306 3300020081 Bacteria 551
133 Ga0206354_11444727 3300020081 Bacteria 1198
134 Ga0213872_10169445 3300021361 Bacteria 947
135 Ga0224712_10000155 3300022467 Bacteria 11497
136 Ga0224712_10012850 3300022467 Bacteria 2649
137 Ga0256744_134753 3300023309 Bacteria 1048
138 Ga0209675_1000115 3300025291 Bacteria 111981
139 Ga0207655_1000016 3300025728 Bacteria 551476
140 Ga0207655_1000038 3300025728 Bacteria 348340
141 Ga0207713_1025586 3300025735 Bacteria 2721
142 Ga0207705_10903848 3300025909 Bacteria 684
143 Ga0207695_11149645 3300025913 Bacteria 656
144 Ga0207650_10566732 3300025925 Bacteria 953
145 Ga0207659_10706438 3300025926 Bacteria 863
146 Ga0207687_10040627 3300025927 Bacteria 3189
147 Ga0207644_10271630 3300025931 Bacteria 1359
148 Ga0207706_10345074 3300025933 Bacteria 1295
149 Ga0207686_10143611 3300025934 Bacteria 1653
150 Ga0207686_10311130 3300025934 Bacteria 1173
151 Ga0207709_10000084 3300025935 Bacteria 161002
152 Ga0207665_10009076 3300025939 Bacteria 6528
153 Ga0207665_10191290 3300025939 Bacteria 1487
154 Ga0207661_10011066 3300025944 Bacteria 6521
155 Ga0207667_10242056 3300025949 Bacteria 1846
156 Ga0207667_10965088 3300025949 Bacteria 841
157 Ga0207712_10050092 3300025961 Bacteria 2914
158 Ga0207668_10084113 3300025972 Bacteria 2317
159 Ga0207640_10320442 3300025981 Bacteria 1234
160 Ga0207658_11099338 3300025986 Bacteria 726
161 Ga0207639_10616274 3300026041 Bacteria 1002
162 Ga0207678_10276208 3300026067 Bacteria 1441
163 Ga0207702_10111476 3300026078 Bacteria 2433
164 Ga0207648_10334177 3300026089 Bacteria 1363
165 Ga0207648_10601554 3300026089 Bacteria 1013
166 Ga0207676_10521873 3300026095 Bacteria 1131
167 Ga0207674_10033610 3300026116 Bacteria 5367
168 Ga0207683_10546231 3300026121 Bacteria 1071
169 Ga0207698_10870094 3300026142 Bacteria 907
170 Ga0207698_11298122 3300026142 Bacteria 742
171 Ga0209281_1000337 3300027111 Bacteria 79938
172 Ga0209969_1029826 3300027360 Bacteria 832
173 Ga0209489_111364 3300027361 Bacteria 9138
174 Ga0209995_1006210 3300027471 Bacteria 1920
175 Ga0209982_1085430 3300027552 Bacteria 522
176 Ga0210002_1001591 3300027617 Bacteria 3225
177 Ga0209282_1028939 3300027666 Bacteria 3426
178 Ga0209971_1038687 3300027682 Bacteria 1149
179 Ga0209974_10026106 3300027876 Bacteria 1934
180 Ga0268265_11164139 3300028380 Bacteria 768
181 Ga0265319_1145650 3300028563 Bacteria 734
182 Ga0265334_10002690 3300028573 Bacteria 8214
183 Ga0265318_10075189 3300028577 Bacteria 1250
184 Ga0265322_10153338 3300028654 Bacteria 659
185 Ga0307517_10392082 3300028786 Bacteria 738
186 Ga0265327_10089061 3300031251 Bacteria 1508
187 Ga0265327_10108010 3300031251 Bacteria 1333
188 Ga0265316_10545136 3300031344 Bacteria 826
189 Ga0307408_100000648 3300031548 Bacteria 29197
190 Ga0307408_100008863 3300031548 Bacteria 6645
191 Ga0316575_10126011 3300031665 Bacteria 1049
192 Ga0316575_10135485 3300031665 Bacteria 1012
193 Ga0316579_10111616 3300031691 Bacteria 1312
194 Ga0316576_10001965 3300031727 Bacteria 11485
195 Ga0316576_10007854 3300031727 Bacteria 6745
196 Ga0316576_10022758 3300031727 Bacteria 4356
197 Ga0316576_10056945 3300031727 Bacteria 2856
198 Ga0316576_10079789 3300031727 Bacteria 2426
199 Ga0316576_10143122 3300031727 Bacteria 1800
200 Ga0316576_10195389 3300031727 Bacteria 1525
201 Ga0316576_10308688 3300031727 Bacteria 1181
202 Ga0316576_10440167 3300031727 Bacteria 963
203 Ga0316576_10471429 3300031727 Bacteria 926
204 Ga0316576_10590477 3300031727 Bacteria 811
205 Ga0316578_10040210 3300031728 Bacteria 2702
206 Ga0316578_10172214 3300031728 Bacteria 1305
207 Ga0316578_10191968 3300031728 Bacteria 1230
208 Ga0316578_10382861 3300031728 Bacteria 835
209 Ga0307516_10472537 3300031730 Bacteria 909
210 Ga0307405_10000005 3300031731 Bacteria 376536
211 Ga0307405_10002019 3300031731 Bacteria 8799
212 Ga0307405_10421117 3300031731 Bacteria 1051
213 Ga0316577_10008426 3300031733 Bacteria 5526
214 Ga0316577_10282184 3300031733 Bacteria 940
215 Ga0316577_10512789 3300031733 Bacteria 682
216 Ga0307413_10001014 3300031824 Bacteria 10155
217 Ga0307413_10001307 3300031824 Bacteria 9311
218 Ga0307413_10412951 3300031824 Bacteria 1061
219 Ga0307410_10000034 3300031852 Bacteria 48449
220 Ga0307406_10000004 3300031901 Bacteria 179772
221 Ga0307407_10000196 3300031903 Bacteria 18233
222 Ga0307412_10000088 3300031911 Bacteria 82058
223 Ga0307412_10048579 3300031911 Bacteria 2791
224 Ga0307412_10127716 3300031911 Bacteria 1841
225 Ga0307416_100000006 3300032002 Bacteria 466074
226 Ga0307416_100534132 3300032002 Bacteria 1243
227 Ga0307414_10000011 3300032004 Bacteria 338253
228 Ga0307414_10000030 3300032004 Bacteria 187373
229 Ga0307414_10000673 3300032004 Bacteria 17502
230 Ga0307414_10009268 3300032004 Bacteria 5644
231 Ga0307414_10011571 3300032004 Bacteria 5180
232 Ga0307411_10000004 3300032005 Bacteria 460327
233 Ga0307411_10001861 3300032005 Bacteria 8973
234 Ga0307411_10342908 3300032005 Bacteria 1215
235 Ga0316585_10002058 3300032137 Bacteria 5395
236 Ga0316580_10061015 3300032139 Bacteria 1158
237 Ga0316580_10191347 3300032139 Bacteria 630
238 Ga0316593_10000201 3300032168 Bacteria 9314
239 Ga0316593_10000279 3300032168 Bacteria 8591
240 Ga0316593_10008603 3300032168 Bacteria 2851
241 Ga0316593_10023936 3300032168 Bacteria 1932
242 Ga0316593_10034814 3300032168 Bacteria 1654
243 Ga0316593_10091142 3300032168 Bacteria 1073
244 Ga0316593_10144490 3300032168 Bacteria 863
245 Ga0316593_10185806 3300032168 Bacteria 765
246 Ga0316593_10255095 3300032168 Bacteria 657
247 Ga0316592_1000022 3300033524 Bacteria 11920
248 Ga0316592_1001616 3300033524 Bacteria 3695
249 Ga0316592_1002393 3300033524 Bacteria 3237
250 Ga0316592_1002839 3300033524 Bacteria 3046
251 Ga0316592_1070858 3300033524 Bacteria 788
252 Ga0316592_1083227 3300033524 Bacteria 729
253 Ga0316592_1085405 3300033524 Bacteria 720
254 Ga0316592_1106193 3300033524 Bacteria 648
255 Ga0316592_1163458 3300033524 Bacteria 528
256 Ga0316586_1000693 3300033527 Bacteria 3408
257 Ga0316586_1009017 3300033527 Bacteria 1488
258 Ga0316586_1018756 3300033527 Bacteria 1125
259 Ga0316588_1000386 3300033528 Bacteria 5801
260 Ga0316588_1015940 3300033528 Bacteria 1660
261 Ga0316588_1098096 3300033528 Bacteria 733
262 Ga0316588_1170596 3300033528 Bacteria 562
263 Ga0316596_1000106 3300033541 Bacteria 10634
264 Ga0316596_1001043 3300033541 Bacteria 5368
265 Ga0316596_1003921 3300033541 Bacteria 3297
266 Ga0316596_1010716 3300033541 Bacteria 2226
267 Ga0316596_1015079 3300033541 Bacteria 1923
268 Ga0316596_1016318 3300033541 Bacteria 1859
269 Ga0316596_1016886 3300033541 Bacteria 1830
270 Ga0316596_1017057 3300033541 Bacteria 1823
271 Ga0316596_1022402 3300033541 Bacteria 1615
272 Ga0316596_1025223 3300033541 Bacteria 1529
273 Ga0316596_1025532 3300033541 Bacteria 1520
274 Ga0316596_1033278 3300033541 Bacteria 1342
275 Ga0316596_1038943 3300033541 Bacteria 1247
276 Ga0316596_1085516 3300033541 Bacteria 849
277 Ga0316596_1120303 3300033541 Bacteria 715
278 Ga0316596_1123660 3300033541 Bacteria 705
279 Ga0316596_1149703 3300033541 Bacteria 641
280 Ga0316574_0007562 3300035398 Bacteria 5965
281 Ga0316574_0051935 3300035398 Bacteria 2556
282 Ga0316574_0065061 3300035398 Bacteria 2295
283 Ga0316574_0104645 3300035398 Bacteria 1812
284 Ga0316574_0114903 3300035398 Bacteria 1726
285 Ga0316574_0116099 3300035398 Bacteria 1717
286 Ga0316574_0129961 3300035398 Bacteria 1620
287 Ga0316574_0136060 3300035398 Bacteria 1582
288 Ga0316574_0247646 3300035398 Bacteria 1139
289 Ga0316574_0260030 3300035398 Bacteria 1108
290 Ga0316574_0287960 3300035398 Bacteria 1046
291 Ga0373937_0174104 3300036401 Bacteria 2020
292 Ga0373937_1690625 3300036401 Bacteria 580
293 Ga0316582_0032668 3300036647 Bacteria 3191
294 Ga0316582_0179690 3300036647 Bacteria 1439
295 Ga0316582_0884432 3300036647 Bacteria 611
296 Ga0316582_1094745 3300036647 Bacteria 543
297 Ga0316584_0015050 3300036712 Bacteria 5526
298 Ga0316584_0037517 3300036712 Bacteria 3601
299 Ga0316584_0315205 3300036712 Bacteria 1130
300 Ga0316584_0493162 3300036712 Bacteria 861
301 Ga0316584_0562441 3300036712 Bacteria 795
302 Ga0316584_0784661 3300036712 Bacteria 648
303 Ga0395899_0000673 3300037312 Bacteria 34566
304 Ga0395905_0000001 3300037471 Bacteria 2037079
305 Ga0395905_1230617 3300037471 Bacteria 652
306 Ga0395901_0045223 3300038443 Bacteria 4568
307 Ga0246641_01883 3300038634 Bacteria 531
308 Ga0400483_151094 3300039062 Bacteria 1144
309 Ga0400489_59783 3300039093 Bacteria 3534
310 Ga0400489_64897 3300039093 Bacteria 1094
311 Ga0400489_83287 3300039093 Bacteria 1093
312 Ga0400489_84188 3300039093 Bacteria 1194
313 Ga0436361_1216877 3300039447 Bacteria 1828
314 Ga0439447_000447 3300041407 Bacteria 15369
315 Ga0439466_0004165 3300041411 Bacteria 5582
316 Ga0439466_0057610 3300041411 Bacteria 1258
317 Ga0439465_0000032 3300041413 Bacteria 28481
318 Ga0451787_107116 3300041441 Bacteria 1506
319 Ga0451788_01017 3300041442 Bacteria 629
320 Ga0451789_1079854 3300041443 Bacteria 1013
321 Ga0451790_34212 3300041444 Bacteria 1648
322 Ga0451790_47773 3300041444 Bacteria 761
323 Ga0451791_1675939 3300041451 Bacteria 2636
324 Ga0451793_0652381 3300041452 Bacteria 1003
325 Ga0451795_0319454 3300041456 Bacteria 1156
326 Ga0451795_0547905 3300041456 Bacteria 1097
327 Ga0451795_0935357 3300041456 Bacteria 2876
328 Ga0451795_1028677 3300041456 Bacteria 991
329 Ga0451795_1130714 3300041456 Bacteria 1482
330 Ga0451795_1402022 3300041456 Bacteria 1160
331 Ga0451795_1545671 3300041456 Bacteria 828
332 Ga0451795_1714813 3300041456 Bacteria 1218
333 Ga0451798_0435092 3300041458 Bacteria 601
334 Ga0451800_1256493 3300041459 Bacteria 613
335 Ga0451802_0457191 3300041460 Bacteria 518
336 Ga0451805_017120 3300041461 Bacteria 742
337 Ga0451807_1997617 3300041486 Bacteria 749
338 Ga0451833_0933881 3300041491 Bacteria 528
339 Ga0451837_0125275 3300041494 Bacteria 605
340 Ga0451837_0568756 3300041494 Bacteria 1142
341 Ga0451837_1056715 3300041494 Bacteria 8321
342 Ga0451837_1777468 3300041494 Bacteria 559
343 Ga0451841_1428716 3300041498 Bacteria 2652
344 Ga0451847_0714976 3300041503 Bacteria 876
345 Ga0451849_1512452 3300041505 Bacteria 1002
346 Ga0451851_0977032 3300041507 Bacteria 1041
347 Ga0451852_01884 3300041508 Bacteria 1812
348 Ga0451852_06600 3300041508 Bacteria 1121
349 Ga0451852_28525 3300041508 Bacteria 1937
350 Ga0451843_0112769 3300041509 Bacteria 2212
351 Ga0451855_0000118 3300041511 Bacteria 662
352 Ga0451855_0331224 3300041511 Bacteria 585
353 Ga0451855_0405167 3300041511 Bacteria 759
354 Ga0451855_0436544 3300041511 Bacteria 611
355 Ga0451855_0737901 3300041511 Bacteria 986
356 Ga0451855_0887620 3300041511 Bacteria 795
357 Ga0451855_0898775 3300041511 Bacteria 828
358 Ga0451855_1113143 3300041511 Bacteria 522
359 Ga0451855_1478956 3300041511 Bacteria 579
360 Ga0451855_1705115 3300041511 Bacteria 739
361 Ga0451855_1986715 3300041511 Bacteria 565
362 Ga0451853_3298037 3300041512 Bacteria 1007
363 Ga0439445_0000090 3300042004 Bacteria 14230
364 Ga0439445_0001316 3300042004 Bacteria 5367
365 Ga0439432_088233 3300042006 Bacteria 935
366 Ga0450891_009933 3300042129 Bacteria 877
367 Ga0450906_044160 3300042145 Bacteria 787
368 Ga0439446_0111787 3300042156 Bacteria 872
369 Ga0439434_0048824 3300042435 Bacteria 1310
370 Ga0439435_0134617 3300042436 Bacteria 783
371 Ga0451577_0000092 3300042876 Bacteria 198898
372 Ga0451577_0000433 3300042876 Bacteria 74789
373 Ga0451577_0002272 3300042876 Bacteria 23243
374 Ga0451577_0005144 3300042876 Bacteria 13458
375 Ga0451577_0038846 3300042876 Bacteria 4280
376 Ga0451577_0080589 3300042876 Bacteria 2903
377 Ga0451577_0143230 3300042876 Bacteria 2148
378 Ga0451577_0175874 3300042876 Bacteria 1929
379 Ga0451577_0827693 3300042876 Bacteria 835
380 Ga0451577_1529325 3300042876 Bacteria 590
381 Ga0451577_1562636 3300042876 Bacteria 582
382 Ga0466972_0325270 3300044658 Bacteria 719
383 Ga0453683_0000055 3300044673 Bacteria 192588
384 Ga0453683_0000522 3300044673 Bacteria 43145
385 Ga0453683_0000935 3300044673 Bacteria 27791
386 Ga0453683_0007526 3300044673 Bacteria 7375
387 Ga0453683_0014569 3300044673 Bacteria 5101
388 Ga0453683_0037310 3300044673 Bacteria 3058
389 Ga0453683_0041330 3300044673 Bacteria 2895
390 Ga0453683_0056210 3300044673 Bacteria 2462
391 Ga0453683_0470008 3300044673 Bacteria 814
392 Ga0453684_0000506 3300044712 Bacteria 152143
393 Ga0453684_0001382 3300044712 Bacteria 70292
394 Ga0453684_0001549 3300044712 Bacteria 64220
395 Ga0453684_0012068 3300044712 Bacteria 14349
396 Ga0453684_0012598 3300044712 Bacteria 13911
397 Ga0453684_0025154 3300044712 Bacteria 8657
398 Ga0453684_0032953 3300044712 Bacteria 7234
399 Ga0453684_0055899 3300044712 Bacteria 5126
400 Ga0453684_0056141 3300044712 Bacteria 5111
401 Ga0453684_0108947 3300044712 Bacteria 3370
402 Ga0453684_0133883 3300044712 Bacteria 2970
403 Ga0453684_0172588 3300044712 Bacteria 2546
404 Ga0453684_0458320 3300044712 Bacteria 1418
405 Ga0453684_0466138 3300044712 Bacteria 1404
406 Ga0453684_0861326 3300044712 Bacteria 973
407 Ga0453684_0949818 3300044712 Bacteria 917
408 Ga0453684_1026756 3300044712 Bacteria 875
409 Ga0453684_1044859 3300044712 Bacteria 866
410 Ga0453684_1864412 3300044712 Bacteria 609
411 Ga0453684_2084091 3300044712 Bacteria 569
412 Ga0451576_0000003 3300045051 Bacteria 1550573
413 Ga0451576_0000113 3300045051 Bacteria 208644
414 Ga0451576_0000204 3300045051 Bacteria 149459
415 Ga0451576_0003461 3300045051 Bacteria 21644
416 Ga0451576_0005920 3300045051 Bacteria 15147
417 Ga0451576_0011813 3300045051 Bacteria 9886
418 Ga0451576_0017866 3300045051 Bacteria 7791
419 Ga0451576_0032623 3300045051 Bacteria 5541
420 Ga0451576_0034310 3300045051 Bacteria 5390
421 Ga0451576_0040065 3300045051 Bacteria 4960
422 Ga0451576_0053102 3300045051 Bacteria 4246
423 Ga0451576_0054946 3300045051 Bacteria 4167
424 Ga0451576_0056132 3300045051 Bacteria 4119
425 Ga0451576_0195911 3300045051 Bacteria 2110
426 Ga0451576_0271918 3300045051 Bacteria 1771
427 Ga0451576_0294905 3300045051 Bacteria 1695
428 Ga0451576_1353539 3300045051 Bacteria 741
429 Ga0495627_000022 3300046453 Bacteria 254672
430 Ga0495590_0009537 3300046457 Bacteria 3684
431 Ga0495664_0545738 3300046477 Bacteria 691
432 Ga0495596_0004903 3300046500 Bacteria 6419
433 Ga0495607_0239089 3300046501 Bacteria 879
434 Ga0495606_0021702 3300046507 Bacteria 4698
435 Ga0495606_0116963 3300046507 Bacteria 1600
436 Ga0495610_0000005 3300046512 Bacteria 924111
437 Ga0495610_0018640 3300046512 Bacteria 3912
438 Ga0495632_0007484 3300046519 Bacteria 6852
439 Ga0495643_0000294 3300046522 Bacteria 70329
440 Ga0495643_0219315 3300046522 Bacteria 903
441 Ga0495643_0287237 3300046522 Bacteria 754
442 Ga0495663_0001345 3300046525 Bacteria 7769
443 Ga0495663_0012337 3300046525 Bacteria 2380
444 Ga0495654_0000003 3300046530 Bacteria 863485
445 Ga0495654_0086898 3300046530 Bacteria 1456
446 Ga0495586_0299046 3300046535 Unclassified 922
447 Ga0495609_0000003 3300046538 Bacteria 711547
448 Ga0495645_0320880 3300046543 Bacteria 1006
449 Ga0495633_0003150 3300046558 Bacteria 11168
450 Ga0495633_0013345 3300046558 Bacteria 4333
451 Ga0495633_0014068 3300046558 Bacteria 4196
452 Ga0495634_0076813 3300046642 Bacteria 2192
453 Ga0495625_0000096 3300046660 Bacteria 142609
454 Ga0495625_0001933 3300046660 Bacteria 23424
455 Ga0495625_0041479 3300046660 Bacteria 3350
456 Ga0495647_0318605 3300046681 Bacteria 704
457 Ga0495658_0749816 3300046683 Bacteria 625
458 Ga0495671_0063109 3300046692 Bacteria 1825
459 Ga0495660_0024916 3300046810 Bacteria 3403
460 Ga0495660_0223215 3300046810 Bacteria 887
461 Ga0495686_0004601 3300047472 Bacteria 11246
462 Ga0495686_0469080 3300047472 Bacteria 666
463 Ga0496102_0035559 3300048905 Bacteria 4485
464 Ga0496104_0268649 3300048907 Bacteria 1618
465 Ga0496105_0160764 3300048908 Bacteria 1844
466 Ga0496113_0161385 3300048916 Bacteria 1772
467 Ga0496114_1047556 3300048917 Bacteria 700
468 Ga0496115_0068443 3300048918 Bacteria 2874
469 Ga0496116_0000024 3300048919 Bacteria 471420
470 Ga0496116_0000029 3300048919 Bacteria 422187
471 Ga0496117_0000007 3300048920 Bacteria 720505
472 Ga0496117_0120383 3300048920 Bacteria 1614
473 Ga0496118_0000252 3300048921 Bacteria 94470
474 Ga0496118_0033058 3300048921 Bacteria 4251
475 Ga0496118_0126896 3300048921 Bacteria 1648
476 Ga0496119_0000007 3300048922 Bacteria 475920
477 Ga0496120_0007422 3300048923 Bacteria 8154
478 Ga0496121_0014632 3300048924 Bacteria 8299
479 Ga0496121_0021047 3300048924 Bacteria 6413
480 Ga0496123_0041623 3300048926 Bacteria 3181
481 Ga0496124_0013719 3300048927 Bacteria 7890
482 Ga0496124_0035036 3300048927 Bacteria 4396
483 Ga0496124_0050411 3300048927 Bacteria 3547
484 Ga0496125_0000018 3300048928 Bacteria 482390
485 Ga0496125_0000031 3300048928 Bacteria 365156
486 Ga0496125_0032980 3300048928 Bacteria 4590
487 Ga0496125_0124107 3300048928 Bacteria 1834
488 Ga0496126_0115769 3300048929 Bacteria 2330
489 Ga0496126_0119349 3300048929 Bacteria 2288
490 Ga0496126_0924928 3300048929 Bacteria 659
491 Ga0501310_000150 3300049130 Bacteria 6818
492 Ga0501341_00021 3300049131 Bacteria 4532
493 Ga0501304_018390 3300049160 Bacteria 675
494 Ga0501307_002458 3300049162 Bacteria 1729
495 Ga0501314_000001 3300049530 Bacteria 13837
496 Ga0501317_000248 3300049533 Bacteria 3386
497 Ga0501319_000002 3300049535 Bacteria 13675
498 Ga0501319_000013 3300049535 Bacteria 7475
499 Ga0501320_000041 3300049536 Bacteria 6176
500 Ga0501321_000051 3300049537 Bacteria 5082
501 Ga0501321_010452 3300049537 Bacteria 1019
502 Ga0501322_000046 3300049538 Bacteria 4559
503 Ga0501323_000002 3300049539 Bacteria 14311
504 Ga0501323_000756 3300049539 Bacteria 2564
505 Ga0501323_004478 3300049539 Bacteria 1481
506 Ga0501324_000002 3300049540 Bacteria 14212
507 Ga0501325_000286 3300049541 Bacteria 2190
508 Ga0501326_00056 3300049542 Bacteria 3508
509 Ga0501328_00035 3300049544 Bacteria 2893
510 Ga0501329_00017 3300049545 Bacteria 3991
511 Ga0501330_000098 3300049546 Bacteria 2661
512 Ga0501331_00043 3300049547 Bacteria 3363
513 Ga0501334_00029 3300049550 Bacteria 4367
514 Ga0501334_00034 3300049550 Bacteria 4194
515 Ga0501335_000048 3300049551 Bacteria 4932
516 Ga0501335_000133 3300049551 Bacteria 3704
517 Ga0501337_000033 3300049553 Bacteria 5041
518 Ga0501031_0004470 3300049568 Bacteria 9067
519 Ga0501032_0002362 3300049569 Bacteria 14785
520 Ga0501032_0002936 3300049569 Bacteria 13262
521 Ga0501033_0000011 3300049570 Bacteria 259130
522 Ga0501034_0001265 3300049571 Bacteria 34324
523 Ga0501034_0232715 3300049571 Bacteria 1791
524 Ga0501036_0068307 3300049572 Bacteria 3007
525 Ga0501037_0003904 3300049573 Bacteria 10816
526 Ga0501038_0002395 3300049574 Bacteria 17463
527 Ga0501038_0108296 3300049574 Bacteria 2304
528 Ga0501039_0015938 3300049575 Bacteria 5754
529 Ga0501043_0000733 3300049579 Bacteria 29055
530 Ga0501047_0037417 3300049581 Bacteria 4693
531 Ga0501047_0046063 3300049581 Bacteria 4216
532 Ga0501048_0426916 3300049582 Bacteria 948
533 Ga0501067_0379480 3300049583 Bacteria 788
534 Ga0501070_0704969 3300049586 Bacteria 798
535 Ga0501074_0989645 3300049590 Bacteria 591
536 Ga0501198_026181 3300049649 Bacteria 951
537 Ga0501223_002029 3300049663 Bacteria 4544
538 Ga0501224_030889 3300049664 Bacteria 802
539 Ga0501235_087542 3300049669 Bacteria 749
540 Ga0501238_000015 3300049671 Bacteria 31964
541 Ga0501243_003419 3300049675 Bacteria 2351
542 Ga0501249_195692 3300049679 Bacteria 528
543 Ga0501251_005157 3300049681 Bacteria 1376
544 Ga0501241_000002 3300049758 Bacteria 194532
545 Ga0501241_000113 3300049758 Bacteria 17544
546 Ga0501241_002715 3300049758 Bacteria 3407
547 Ga0501262_009059 3300049759 Bacteria 1226
548 Ga0501266_000002 3300049763 Bacteria 459947
549 Ga0501269_000004 3300049766 Bacteria 91854
550 Ga0501269_001937 3300049766 Bacteria 2612
551 Ga0501280_000239 3300049776 Bacteria 13899
552 Ga0501280_093662 3300049776 Bacteria 569
553 Ga0501035_0009077 3300049822 Bacteria 9245
554 Ga0501035_0016384 3300049822 Bacteria 6837
555 Ga0501044_0001293 3300049823 Bacteria 29588
556 Ga0501045_0000053 3300049824 Bacteria 51403
557 nmdc:mga03683_18140_c1 3300050489 Bacteria 2672
558 nmdc:mga07m45_534682_c1 3300050496 Bacteria 678
559 Ga0500644_0020716 3300053088 Bacteria 1959
560 Ga0500646_0007145 3300053090 Bacteria 2848
561 Ga0500646_0009195 3300053090 Bacteria 2529
562 Ga0500647_0405990 3300053091 Bacteria 551
563 Ga0500651_0066629 3300053093 Bacteria 2243
564 Ga0500641_0000168 3300053096 Bacteria 24462
565 Ga0500641_0006404 3300053096 Bacteria 4180
566 Ga0500628_164640 3300053129 Bacteria 627
567 Ga0500658_0000002 3300053134 Bacteria 548440
568 Ga0500559_0010320 3300053136 Bacteria 4015
569 Ga0500573_0169794 3300053140 Bacteria 1180
570 Ga0500606_175726 3300053152 Bacteria 677
571 Ga0500622_0138338 3300053156 Bacteria 1164
572 Ga0500622_0317436 3300053156 Bacteria 658
573 Ga0500627_0306602 3300053158 Bacteria 692
574 Ga0500584_021185 3300053726 Bacteria 3019
575 Ga0587093_013795 3300059478 Bacteria 999
576 Ga0587066_019259 3300059490 Bacteria 1108
577 Ga0587070_005454 3300059491 Bacteria 1667
578 Ga0587077_013219 3300059493 Bacteria 1334
579 Ga0587077_083699 3300059493 Bacteria 737
580 Ga0587083_0019247 3300059505 Bacteria 1245
581 Ga0587092_046170 3300059512 Bacteria 774
582 Ga0587095_025185 3300059514 Bacteria 592
583 Ga0587117_009294 3300059627 Bacteria 1173
584 Ga0587068_000659 3300059641 Bacteria 3348
585 Ga0587076_051613 3300059645 Bacteria 803
586 Ga0587079_112190 3300059647 Bacteria 664

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10304096 rootH2_103040964 109
2 3300049131 Ga0501341_00021 Ga0501341_00021_3031_3360 109
3 3300031665 Ga0316575_10126011 Ga0316575_101260113 114
4 3300031691 Ga0316579_10111616 Ga0316579_101116162 114
5 3300031727 Ga0316576_10308688 Ga0316576_103086882 114
6 3300031728 Ga0316578_10191968 Ga0316578_101919682 114
7 3300031733 Ga0316577_10008426 Ga0316577_100084268 114
8 3300032137 Ga0316585_10002058 Ga0316585_100020588 114
9 3300032168 Ga0316593_10034814 Ga0316593_100348143 114
10 3300033524 Ga0316592_1085405 Ga0316592_10854052 114
11 3300033541 Ga0316596_1016886 Ga0316596_10168864 114
12 3300035398 Ga0316574_0116099 Ga0316574_0116099_922_1266 114
13 3300036712 Ga0316584_0493162 Ga0316584_0493162_388_732 114
14 iso_pu_bacteria 2511231000 2511231112 118
15 iso_pu_bacteria 2513020052 2513232374 118
16 iso_pu_bacteria 2519899754 2520879538 118
17 iso_pu_bacteria 2523533629 2524006234 118
18 iso_pu_bacteria 2582581278 2585143585 118
19 iso_pu_bacteria 2582581281 2585156574 118
20 iso_pu_bacteria 2582581282 2585160775 118
21 iso_pu_bacteria 2582581873 2585427015 118
22 iso_pu_bacteria 2585428045 2587679975 118
23 iso_pu_bacteria 2585428060 2587748633 118
24 iso_pu_bacteria 2585428061 2587753457 118
25 iso_pu_bacteria 2585428095 2587864985 118
26 iso_pu_bacteria 2585428115 2587945311 118
27 iso_pu_bacteria 2585428182 2588211490 118
28 iso_pu_bacteria 2585428183 2588215872 118
29 iso_pu_bacteria 2585428184 2588219294 118
30 iso_pu_bacteria 2585428185 2588224772 118
31 iso_pu_bacteria 2585428187 2588234607 118
32 iso_pu_bacteria 2588253712 2588447567 118
33 iso_pu_bacteria 2588254255 2590603194 118
34 iso_pu_bacteria 2588254257 2590610215 118
35 iso_pu_bacteria 2643221600 2644009199 118
36 iso_pu_bacteria 2643221667 2644373937 118
37 iso_pu_bacteria 2643221716 2644643931 118
38 iso_pu_bacteria 2643221725 2644681826 118
39 iso_pu_bacteria 2728369107 2729200757 118
40 iso_pu_bacteria 2738541273 2738698377 118
41 iso_pu_bacteria 2738541279 2738733061 118
42 iso_pu_bacteria 2738541285 2738765599 118
43 iso_pu_bacteria 2738543007 2739214642 118
44 iso_pu_bacteria 2738543014 2739252703 118
45 iso_pu_bacteria 2739367857 2740002842 118
46 iso_pu_bacteria 2739367858 2740007659 118
47 iso_pu_bacteria 2739367874 2740060429 118
48 iso_pu_bacteria 2751185877 2753674207 118
49 iso_pu_bacteria 2765235839 2765575679 118
50 iso_pu_bacteria 2772190705 2772605783 118
51 iso_pu_bacteria 2775506739 2775674339 118
52 iso_pu_bacteria 2802428842 2802655264 118
53 iso_pu_bacteria 2816332188 2816875525 118
54 iso_pu_bacteria 2816332280 2817413542 118
55 iso_pu_bacteria 2833640130 2833640616 118
56 iso_pu_bacteria 2842083920 2842086256 118
57 iso_pu_bacteria 2857613821 2857617055 118
58 iso_pu_bacteria 2857618242 2857619724 118
59 iso_pu_bacteria 2871720351 2871723605 118
60 iso_pu_bacteria 2881359912 2881364108 118
61 iso_pu_bacteria 2889290771 2889293817 118
62 iso_pu_bacteria 2890804823 2890807154 118
63 iso_pu_bacteria 2903895155 2903898667 118
64 iso_pu_bacteria 2904419702 2904422393 118
65 iso_pu_bacteria 2904555929 2904558501 118
66 iso_pu_bacteria 2905999023 2906001174 118
67 iso_pu_bacteria 2906799679 2906800166 118
68 iso_pu_bacteria 2919097161 2919097954 118
69 iso_pu_bacteria 2919191525 2919194226 118
70 iso_pu_bacteria 2919399522 2919403193 118
71 iso_pu_bacteria 2919509842 2919511831 118
72 iso_pu_bacteria 2919683626 2919684609 118
73 iso_pu_bacteria 2929150217 2929150598 118
74 iso_pu_bacteria 2945924605 2945924800 118
75 iso_pu_bacteria 2946019816 2946024086 118
76 iso_pu_bacteria 2958458903 2958461995 118
77 iso_pu_bacteria 2958512119 2958514504 118
78 iso_pu_bacteria 2965320100 2965321928 118
79 iso_pu_bacteria 2977243572 2977247753 118
80 iso_pu_bacteria 2977268062 2977272070 118
81 iso_pu_bacteria 2984572630 2984574451 118
82 iso_pu_bacteria 2984606641 2984607900 118
83 iso_pu_bacteria 2993372514 2993375102 118
84 iso_pu_bacteria 2993480792 2993481966 118
85 iso_pu_bacteria 8036736890 8036739259 118
86 iso_pu_bacteria 8054307821 8054311434 118
87 iso_pu_bacteria 8055419101 8055423577 118
88 iso_pu_bacteria 8055592153 8055595069 118
89 iso_pu_bacteria 8056440228 8056443512 118
90 3300028654 Ga0265322_10153338 Ga0265322_101533382 121
91 3300031251 Ga0265327_10089061 Ga0265327_100890613 121
92 3300031251 Ga0265327_10108010 Ga0265327_101080102 121
93 3300031344 Ga0265316_10545136 Ga0265316_105451362 121
94 3300031727 Ga0316576_10001965 Ga0316576_1000196516 121
95 3300031727 Ga0316576_10007854 Ga0316576_1000785413 121
96 3300031727 Ga0316576_10022758 Ga0316576_100227589 121
97 3300031727 Ga0316576_10056945 Ga0316576_100569453 121
98 3300031727 Ga0316576_10079789 Ga0316576_100797895 121
99 3300031727 Ga0316576_10143122 Ga0316576_101431224 121
100 3300031727 Ga0316576_10440167 Ga0316576_104401673 121
101 3300031727 Ga0316576_10471429 Ga0316576_104714292 121
102 3300031727 Ga0316576_10590477 Ga0316576_105904772 121
103 3300031728 Ga0316578_10040210 Ga0316578_100402106 121
104 3300031728 Ga0316578_10172214 Ga0316578_101722143 121
105 3300031728 Ga0316578_10382861 Ga0316578_103828611 121
106 3300031733 Ga0316577_10282184 Ga0316577_102821842 121
107 3300031733 Ga0316577_10512789 Ga0316577_105127892 121
108 3300032139 Ga0316580_10061015 Ga0316580_100610152 121
109 3300032139 Ga0316580_10191347 Ga0316580_101913472 121
110 3300032168 Ga0316593_10000201 Ga0316593_100002015 121
111 3300032168 Ga0316593_10000279 Ga0316593_100002798 121
112 3300032168 Ga0316593_10008603 Ga0316593_100086033 121
113 3300032168 Ga0316593_10023936 Ga0316593_100239364 121
114 3300032168 Ga0316593_10091142 Ga0316593_100911421 121
115 3300032168 Ga0316593_10144490 Ga0316593_101444903 121
116 3300032168 Ga0316593_10185806 Ga0316593_101858063 121
117 3300032168 Ga0316593_10255095 Ga0316593_102550951 121
118 3300033524 Ga0316592_1001616 Ga0316592_10016162 121
119 3300033524 Ga0316592_1002393 Ga0316592_10023935 121
120 3300033524 Ga0316592_1002839 Ga0316592_10028395 121
121 3300033524 Ga0316592_1070858 Ga0316592_10708582 121
122 3300033524 Ga0316592_1083227 Ga0316592_10832272 121
123 3300033524 Ga0316592_1106193 Ga0316592_11061931 121
124 3300033524 Ga0316592_1163458 Ga0316592_11634582 121
125 3300033527 Ga0316586_1018756 Ga0316586_10187563 121
126 3300033528 Ga0316588_1000386 Ga0316588_10003866 121
127 3300033528 Ga0316588_1015940 Ga0316588_10159403 121
128 3300033528 Ga0316588_1098096 Ga0316588_10980962 121
129 3300033528 Ga0316588_1170596 Ga0316588_11705961 121
130 3300033541 Ga0316596_1000106 Ga0316596_10001066 121
131 3300033541 Ga0316596_1001043 Ga0316596_10010435 121
132 3300033541 Ga0316596_1003921 Ga0316596_10039218 121
133 3300033541 Ga0316596_1010716 Ga0316596_10107164 121
134 3300033541 Ga0316596_1015079 Ga0316596_10150793 121
135 3300033541 Ga0316596_1016318 Ga0316596_10163185 121
136 3300033541 Ga0316596_1017057 Ga0316596_10170575 121
137 3300033541 Ga0316596_1025223 Ga0316596_10252235 121
138 3300033541 Ga0316596_1025532 Ga0316596_10255323 121
139 3300033541 Ga0316596_1033278 Ga0316596_10332783 121
140 3300033541 Ga0316596_1038943 Ga0316596_10389432 121
141 3300033541 Ga0316596_1085516 Ga0316596_10855162 121
142 3300033541 Ga0316596_1120303 Ga0316596_11203032 121
143 3300033541 Ga0316596_1123660 Ga0316596_11236601 121
144 3300033541 Ga0316596_1149703 Ga0316596_11497031 121
145 3300035398 Ga0316574_0051935 Ga0316574_0051935_1749_2114 121
146 3300035398 Ga0316574_0065061 Ga0316574_0065061_1630_1995 121
147 3300035398 Ga0316574_0104645 Ga0316574_0104645_80_445 121
148 3300035398 Ga0316574_0114903 Ga0316574_0114903_902_1267 121
149 3300035398 Ga0316574_0136060 Ga0316574_0136060_812_1177 121
150 3300035398 Ga0316574_0260030 Ga0316574_0260030_456_821 121
151 3300036647 Ga0316582_0032668 Ga0316582_0032668_2551_2916 121
152 3300036647 Ga0316582_0179690 Ga0316582_0179690_565_930 121
153 3300036647 Ga0316582_0884432 Ga0316582_0884432_74_439 121
154 3300036647 Ga0316582_1094745 Ga0316582_1094745_38_403 121
155 3300036712 Ga0316584_0015050 Ga0316584_0015050_3757_4122 121
156 3300036712 Ga0316584_0037517 Ga0316584_0037517_1612_1977 121
157 3300036712 Ga0316584_0315205 Ga0316584_0315205_55_420 121
158 3300036712 Ga0316584_0562441 Ga0316584_0562441_149_514 121
159 3300036712 Ga0316584_0784661 Ga0316584_0784661_211_576 121
160 3300039062 Ga0400483_151094 Ga0400483_151094_694_1059 121
161 3300039093 Ga0400489_59783 Ga0400489_59783_340_705 121
162 3300039093 Ga0400489_64897 Ga0400489_64897_465_830 121
163 3300039093 Ga0400489_83287 Ga0400489_83287_346_711 121
164 3300039093 Ga0400489_84188 Ga0400489_84188_216_581 121
165 3300041456 Ga0451795_0319454 Ga0451795_0319454_500_865 121
166 3300041456 Ga0451795_0547905 Ga0451795_0547905_635_1000 121
167 3300041456 Ga0451795_0935357 Ga0451795_0935357_1571_1936 121
168 3300041456 Ga0451795_1028677 Ga0451795_1028677_399_764 121
169 3300041456 Ga0451795_1130714 Ga0451795_1130714_25_390 121
170 3300041456 Ga0451795_1402022 Ga0451795_1402022_650_1015 121
171 3300041456 Ga0451795_1545671 Ga0451795_1545671_443_808 121
172 3300041456 Ga0451795_1714813 Ga0451795_1714813_732_1097 121
173 3300041503 Ga0451847_0714976 Ga0451847_0714976_23_388 121
174 3300041508 Ga0451852_01884 Ga0451852_01884_1073_1438 121
175 3300041508 Ga0451852_06600 Ga0451852_06600_329_694 121
176 3300041508 Ga0451852_28525 Ga0451852_28525_1348_1713 121
177 3300041511 Ga0451855_0000118 Ga0451855_0000118_153_518 121
178 3300041511 Ga0451855_0331224 Ga0451855_0331224_17_382 121
179 3300041511 Ga0451855_0405167 Ga0451855_0405167_212_577 121
180 3300041511 Ga0451855_0436544 Ga0451855_0436544_133_498 121
181 3300041511 Ga0451855_0887620 Ga0451855_0887620_51_416 121
182 3300041511 Ga0451855_0898775 Ga0451855_0898775_322_687 121
183 3300041511 Ga0451855_1113143 Ga0451855_1113143_51_416 121
184 3300041511 Ga0451855_1478956 Ga0451855_1478956_32_397 121
185 3300041511 Ga0451855_1705115 Ga0451855_1705115_352_717 121
186 3300041511 Ga0451855_1986715 Ga0451855_1986715_22_387 121
187 3300042876 Ga0451577_0000092 Ga0451577_0000092_146979_147344 121
188 3300042876 Ga0451577_0000433 Ga0451577_0000433_72024_72389 121
189 3300042876 Ga0451577_0005144 Ga0451577_0005144_11456_11821 121
190 3300042876 Ga0451577_0038846 Ga0451577_0038846_3231_3596 121
191 3300042876 Ga0451577_0080589 Ga0451577_0080589_1216_1581 121
192 3300042876 Ga0451577_0143230 Ga0451577_0143230_128_493 121
193 3300042876 Ga0451577_0175874 Ga0451577_0175874_597_962 121
194 3300042876 Ga0451577_0827693 Ga0451577_0827693_65_430 121
195 3300042876 Ga0451577_1529325 Ga0451577_1529325_76_441 121
196 3300042876 Ga0451577_1562636 Ga0451577_1562636_23_388 121
197 3300044673 Ga0453683_0000055 Ga0453683_0000055_73244_73609 121
198 3300044673 Ga0453683_0000522 Ga0453683_0000522_12287_12652 121
199 3300044673 Ga0453683_0000935 Ga0453683_0000935_442_807 121
200 3300044673 Ga0453683_0007526 Ga0453683_0007526_1594_1959 121
201 3300044673 Ga0453683_0014569 Ga0453683_0014569_2166_2531 121
202 3300044673 Ga0453683_0037310 Ga0453683_0037310_1423_1788 121
203 3300044673 Ga0453683_0041330 Ga0453683_0041330_1865_2230 121
204 3300044673 Ga0453683_0056210 Ga0453683_0056210_1656_2021 121
205 3300044673 Ga0453683_0470008 Ga0453683_0470008_417_782 121
206 3300044712 Ga0453684_0000506 Ga0453684_0000506_4800_5165 121
207 3300044712 Ga0453684_0001382 Ga0453684_0001382_4853_5218 121
208 3300044712 Ga0453684_0001549 Ga0453684_0001549_48211_48576 121
209 3300044712 Ga0453684_0012068 Ga0453684_0012068_719_1084 121
210 3300044712 Ga0453684_0012598 Ga0453684_0012598_1701_2066 121
211 3300044712 Ga0453684_0025154 Ga0453684_0025154_2641_3006 121
212 3300044712 Ga0453684_0032953 Ga0453684_0032953_2566_2931 121
213 3300044712 Ga0453684_0055899 Ga0453684_0055899_1394_1759 121
214 3300044712 Ga0453684_0056141 Ga0453684_0056141_1320_1685 121
215 3300044712 Ga0453684_0108947 Ga0453684_0108947_1235_1600 121
216 3300044712 Ga0453684_0133883 Ga0453684_0133883_1595_1960 121
217 3300044712 Ga0453684_0172588 Ga0453684_0172588_522_887 121
218 3300044712 Ga0453684_0458320 Ga0453684_0458320_937_1302 121
219 3300044712 Ga0453684_0861326 Ga0453684_0861326_93_458 121
220 3300044712 Ga0453684_0949818 Ga0453684_0949818_414_779 121
221 3300044712 Ga0453684_1026756 Ga0453684_1026756_479_844 121
222 3300044712 Ga0453684_2084091 Ga0453684_2084091_40_405 121
223 3300045051 Ga0451576_0000113 Ga0451576_0000113_175713_176078 121
224 3300045051 Ga0451576_0000204 Ga0451576_0000204_146979_147344 121
225 3300045051 Ga0451576_0003461 Ga0451576_0003461_947_1312 121
226 3300045051 Ga0451576_0005920 Ga0451576_0005920_2137_2502 121
227 3300045051 Ga0451576_0011813 Ga0451576_0011813_1963_2328 121
228 3300045051 Ga0451576_0032623 Ga0451576_0032623_4593_4958 121
229 3300045051 Ga0451576_0034310 Ga0451576_0034310_4990_5355 121
230 3300045051 Ga0451576_0053102 Ga0451576_0053102_2650_3015 121
231 3300045051 Ga0451576_0054946 Ga0451576_0054946_1055_1420 121
232 3300045051 Ga0451576_0056132 Ga0451576_0056132_1837_2202 121
233 3300045051 Ga0451576_0195911 Ga0451576_0195911_646_1011 121
234 3300045051 Ga0451576_0271918 Ga0451576_0271918_951_1316 121
235 3300045051 Ga0451576_0294905 Ga0451576_0294905_22_387 121
236 3300045051 Ga0451576_1353539 Ga0451576_1353539_243_608 121
237 2124908027 MRS2a_Contig_9243 MRS2a_00146690 122
238 2162886007 SwRhRL2b_contig_2038936 SwRhRL2b_0524.00001450 122
239 2209111006 2214748000 2213758773 122
240 3300003320 rootH2_10083556 rootH2_100835563 122
241 3300003320 rootH2_10110587 rootH2_101105876 122
242 3300003322 rootL2_10155965 rootL2_101559654 122
243 3300003323 rootH1_10127399 rootH1_101273994 122
244 3300003575 Ga0007409J51694_1126710 Ga0007409J51694_11267102 122
245 3300003578 Ga0006562J51391_1003423 Ga0006562J51391_100342311 122
246 3300003578 Ga0006562J51391_1011740 Ga0006562J51391_10117408 122
247 3300003784 Ga0055534_1007293 Ga0055534_10072934 122
248 3300004801 Ga0058860_10114316 Ga0058860_1011431617 122
249 3300004801 Ga0058860_10170387 Ga0058860_101703872 122
250 3300005276 Ga0065717_1002035 Ga0065717_10020357 122
251 3300005277 Ga0065716_1001819 Ga0065716_10018198 122
252 3300005288 Ga0065714_10036549 Ga0065714_100365492 122
253 3300005288 Ga0065714_10237306 Ga0065714_102373063 122
254 3300005288 Ga0065714_10261165 Ga0065714_102611652 122
255 3300005288 Ga0065714_10358298 Ga0065714_103582981 122
256 3300005289 Ga0065704_10008398 Ga0065704_100083982 122
257 3300005289 Ga0065704_10084598 Ga0065704_100845985 122
258 3300005289 Ga0065704_10138917 Ga0065704_101389173 122
259 3300005293 Ga0065715_10018272 Ga0065715_100182723 122
260 3300005293 Ga0065715_10037423 Ga0065715_100374234 122
261 3300005327 Ga0070658_10957732 Ga0070658_109577321 122
262 3300005329 Ga0070683_100016581 Ga0070683_1000165818 122
263 3300005337 Ga0070682_100000608 Ga0070682_10000060826 122
264 3300005337 Ga0070682_100016944 Ga0070682_1000169447 122
265 3300005339 Ga0070660_100252297 Ga0070660_1002522972 122
266 3300005340 Ga0070689_100788474 Ga0070689_1007884742 122
267 3300005344 Ga0070661_101056208 Ga0070661_1010562081 122
268 3300005353 Ga0070669_100383263 Ga0070669_1003832632 122
269 3300005354 Ga0070675_100504902 Ga0070675_1005049023 122
270 3300005355 Ga0070671_100350358 Ga0070671_1003503584 122
271 3300005356 Ga0070674_100131904 Ga0070674_1001319044 122
272 3300005364 Ga0070673_100611304 Ga0070673_1006113041 122
273 3300005365 Ga0070688_100041948 Ga0070688_1000419483 122
274 3300005366 Ga0070659_100301071 Ga0070659_1003010714 122
275 3300005367 Ga0070667_100285431 Ga0070667_1002854312 122
276 3300005455 Ga0070663_100261729 Ga0070663_1002617292 122
277 3300005457 Ga0070662_101330865 Ga0070662_1013308651 122
278 3300005459 Ga0068867_100658048 Ga0068867_1006580481 122
279 3300005466 Ga0070685_10022774 Ga0070685_100227742 122
280 3300005507 Ga0074259_10545377 Ga0074259_105453771 122
281 3300005535 Ga0070684_100178514 Ga0070684_1001785144 122
282 3300005563 Ga0068855_100186174 Ga0068855_1001861745 122
283 3300005577 Ga0068857_100024669 Ga0068857_1000246695 122
284 3300005578 Ga0068854_100767782 Ga0068854_1007677822 122
285 3300005614 Ga0068856_100083761 Ga0068856_1000837611 122
286 3300005616 Ga0068852_100066769 Ga0068852_1000667692 122
287 3300005616 Ga0068852_100504381 Ga0068852_1005043811 122
288 3300005719 Ga0068861_100901267 Ga0068861_1009012671 122
289 3300005841 Ga0068863_102010948 Ga0068863_1020109482 122
290 3300006163 Ga0070715_10142688 Ga0070715_101426881 122
291 3300006173 Ga0070716_100075957 Ga0070716_1000759574 122
292 3300006177 Ga0075362_10023790 Ga0075362_100237905 122
293 3300006194 Ga0075427_10018603 Ga0075427_100186032 122
294 3300006237 Ga0097621_100105361 Ga0097621_1001053616 122
295 3300006237 Ga0097621_100417199 Ga0097621_1004171993 122
296 3300006353 Ga0075370_10445622 Ga0075370_104456222 122
297 3300006358 Ga0068871_100017988 Ga0068871_10001798810 122
298 3300006358 Ga0068871_101330227 Ga0068871_1013302271 122
299 3300006942 Ga0099824_1003374 Ga0099824_10033746 122
300 3300006946 Ga0079104_1000280 Ga0079104_100028015 122
301 3300006948 Ga0099826_10000125 Ga0099826_1000012522 122
302 3300009011 Ga0105251_10027494 Ga0105251_100274944 122
303 3300009036 Ga0105244_10000005 Ga0105244_10000005440 122
304 3300009036 Ga0105244_10017933 Ga0105244_100179335 122
305 3300009092 Ga0105250_10077236 Ga0105250_100772363 122
306 3300009093 Ga0105240_10552826 Ga0105240_105528261 122
307 3300009098 Ga0105245_10022092 Ga0105245_1002209211 122
308 3300009101 Ga0105247_10162224 Ga0105247_101622241 122
309 3300009148 Ga0105243_10077834 Ga0105243_100778343 122
310 3300009176 Ga0105242_10023758 Ga0105242_100237588 122
311 3300009176 Ga0105242_10252045 Ga0105242_102520452 122
312 3300009176 Ga0105242_11557030 Ga0105242_115570302 122
313 3300009553 Ga0105249_10027670 Ga0105249_100276706 122
314 3300012505 Ga0157339_1003659 Ga0157339_10036592 122
315 3300013100 Ga0157373_10001369 Ga0157373_1000136921 122
316 3300013100 Ga0157373_10014797 Ga0157373_100147976 122
317 3300013100 Ga0157373_10318379 Ga0157373_103183794 122
318 3300013100 Ga0157373_10422990 Ga0157373_104229903 122
319 3300013102 Ga0157371_10000091 Ga0157371_1000009198 122
320 3300013102 Ga0157371_10001678 Ga0157371_1000167815 122
321 3300013102 Ga0157371_10039874 Ga0157371_100398747 122
322 3300013102 Ga0157371_10130914 Ga0157371_101309143 122
323 3300013104 Ga0157370_10019865 Ga0157370_1001986511 122
324 3300013104 Ga0157370_10082740 Ga0157370_100827404 122
325 3300013104 Ga0157370_10136293 Ga0157370_101362935 122
326 3300013104 Ga0157370_10282103 Ga0157370_102821032 122
327 3300013104 Ga0157370_10344176 Ga0157370_103441764 122
328 3300013104 Ga0157370_10976760 Ga0157370_109767602 122
329 3300013104 Ga0157370_11150941 Ga0157370_111509412 122
330 3300013105 Ga0157369_10000613 Ga0157369_1000061330 122
331 3300013105 Ga0157369_10010007 Ga0157369_1001000718 122
332 3300013105 Ga0157369_10134645 Ga0157369_101346454 122
333 3300013105 Ga0157369_10350632 Ga0157369_103506324 122
334 3300013105 Ga0157369_11148894 Ga0157369_111488941 122
335 3300013296 Ga0157374_10109918 Ga0157374_101099186 122
336 3300013296 Ga0157374_11554346 Ga0157374_115543461 122
337 3300013297 Ga0157378_10243176 Ga0157378_102431763 122
338 3300013297 Ga0157378_10398622 Ga0157378_103986223 122
339 3300013306 Ga0163162_10336575 Ga0163162_103365752 122
340 3300013307 Ga0157372_10000332 Ga0157372_1000033225 122
341 3300013307 Ga0157372_10419322 Ga0157372_104193224 122
342 3300013307 Ga0157372_10693414 Ga0157372_106934142 122
343 3300013308 Ga0157375_10037032 Ga0157375_1003703210 122
344 3300013308 Ga0157375_10069554 Ga0157375_100695544 122
345 3300013308 Ga0157375_10111014 Ga0157375_101110145 122
346 3300013308 Ga0157375_10170821 Ga0157375_101708215 122
347 3300014325 Ga0163163_10396542 Ga0163163_103965423 122
348 3300014325 Ga0163163_10851235 Ga0163163_108512352 122
349 3300014326 Ga0157380_10000051 Ga0157380_1000005115 122
350 3300014326 Ga0157380_10404335 Ga0157380_104043354 122
351 3300014326 Ga0157380_12415281 Ga0157380_124152812 122
352 3300014326 Ga0157380_13443630 Ga0157380_134436301 122
353 3300014497 Ga0182008_10000003 Ga0182008_10000003171 122
354 3300014745 Ga0157377_11408202 Ga0157377_114082022 122
355 3300014969 Ga0157376_10034767 Ga0157376_100347678 122
356 3300014969 Ga0157376_10337712 Ga0157376_103377123 122
357 3300015261 Ga0182006_1000001 Ga0182006_1000001859 122
358 3300015261 Ga0182006_1013176 Ga0182006_10131764 122
359 3300017792 Ga0163161_10000039 Ga0163161_1000003915 122
360 3300017792 Ga0163161_10254078 Ga0163161_102540784 122
361 3300017792 Ga0163161_10260107 Ga0163161_102601071 122
362 3300020069 Ga0197907_10154472 Ga0197907_101544721 122
363 3300020069 Ga0197907_10422521 Ga0197907_104225212 122
364 3300020070 Ga0206356_10849066 Ga0206356_108490662 122
365 3300020070 Ga0206356_11071775 Ga0206356_110717752 122
366 3300020077 Ga0206351_10173698 Ga0206351_101736982 122
367 3300020081 Ga0206354_11169306 Ga0206354_111693061 122
368 3300020081 Ga0206354_11444727 Ga0206354_114447273 122
369 3300021361 Ga0213872_10169445 Ga0213872_101694453 122
370 3300022467 Ga0224712_10000155 Ga0224712_1000015518 122
371 3300022467 Ga0224712_10012850 Ga0224712_100128506 122
372 3300023309 Ga0256744_134753 Ga0256744_1347533 122
373 3300025291 Ga0209675_1000115 Ga0209675_1000115100 122
374 3300025728 Ga0207655_1000016 Ga0207655_1000016439 122
375 3300025728 Ga0207655_1000038 Ga0207655_1000038198 122
376 3300025735 Ga0207713_1025586 Ga0207713_10255864 122
377 3300025909 Ga0207705_10903848 Ga0207705_109038481 122
378 3300025913 Ga0207695_11149645 Ga0207695_111496452 122
379 3300025925 Ga0207650_10566732 Ga0207650_105667322 122
380 3300025926 Ga0207659_10706438 Ga0207659_107064382 122
381 3300025927 Ga0207687_10040627 Ga0207687_100406273 122
382 3300025931 Ga0207644_10271630 Ga0207644_102716303 122
383 3300025933 Ga0207706_10345074 Ga0207706_103450741 122
384 3300025934 Ga0207686_10143611 Ga0207686_101436114 122
385 3300025934 Ga0207686_10311130 Ga0207686_103111302 122
386 3300025935 Ga0207709_10000084 Ga0207709_10000084115 122
387 3300025939 Ga0207665_10009076 Ga0207665_100090764 122
388 3300025939 Ga0207665_10191290 Ga0207665_101912903 122
389 3300025944 Ga0207661_10011066 Ga0207661_100110668 122
390 3300025949 Ga0207667_10242056 Ga0207667_102420561 122
391 3300025949 Ga0207667_10965088 Ga0207667_109650882 122
392 3300025961 Ga0207712_10050092 Ga0207712_100500926 122
393 3300025972 Ga0207668_10084113 Ga0207668_100841135 122
394 3300025981 Ga0207640_10320442 Ga0207640_103204422 122
395 3300025986 Ga0207658_11099338 Ga0207658_110993382 122
396 3300026041 Ga0207639_10616274 Ga0207639_106162743 122
397 3300026067 Ga0207678_10276208 Ga0207678_102762083 122
398 3300026078 Ga0207702_10111476 Ga0207702_101114765 122
399 3300026089 Ga0207648_10334177 Ga0207648_103341773 122
400 3300026089 Ga0207648_10601554 Ga0207648_106015543 122
401 3300026095 Ga0207676_10521873 Ga0207676_105218732 122
402 3300026116 Ga0207674_10033610 Ga0207674_100336109 122
403 3300026121 Ga0207683_10546231 Ga0207683_105462313 122
404 3300026142 Ga0207698_10870094 Ga0207698_108700943 122
405 3300026142 Ga0207698_11298122 Ga0207698_112981222 122
406 3300027111 Ga0209281_1000337 Ga0209281_100033726 122
407 3300027360 Ga0209969_1029826 Ga0209969_10298262 122
408 3300027361 Ga0209489_111364 Ga0209489_11136415 122
409 3300027471 Ga0209995_1006210 Ga0209995_10062105 122
410 3300027552 Ga0209982_1085430 Ga0209982_10854301 122
411 3300027617 Ga0210002_1001591 Ga0210002_10015917 122
412 3300027666 Ga0209282_1028939 Ga0209282_10289396 122
413 3300027682 Ga0209971_1038687 Ga0209971_10386874 122
414 3300027876 Ga0209974_10026106 Ga0209974_100261063 122
415 3300028380 Ga0268265_11164139 Ga0268265_111641392 122
416 3300028563 Ga0265319_1145650 Ga0265319_11456502 122
417 3300028573 Ga0265334_10002690 Ga0265334_100026908 122
418 3300028577 Ga0265318_10075189 Ga0265318_100751893 122
419 3300028786 Ga0307517_10392082 Ga0307517_103920822 122
420 3300031548 Ga0307408_100000648 Ga0307408_10000064813 122
421 3300031548 Ga0307408_100008863 Ga0307408_10000886313 122
422 3300031665 Ga0316575_10135485 Ga0316575_101354852 122
423 3300031727 Ga0316576_10195389 Ga0316576_101953893 122
424 3300031730 Ga0307516_10472537 Ga0307516_104725373 122
425 3300031731 Ga0307405_10000005 Ga0307405_10000005218 122
426 3300031731 Ga0307405_10002019 Ga0307405_1000201913 122
427 3300031731 Ga0307405_10421117 Ga0307405_104211172 122
428 3300031824 Ga0307413_10001014 Ga0307413_100010142 122
429 3300031824 Ga0307413_10001307 Ga0307413_1000130715 122
430 3300031824 Ga0307413_10412951 Ga0307413_104129512 122
431 3300031852 Ga0307410_10000034 Ga0307410_1000003427 122
432 3300031901 Ga0307406_10000004 Ga0307406_10000004117 122
433 3300031903 Ga0307407_10000196 Ga0307407_1000019619 122
434 3300031911 Ga0307412_10000088 Ga0307412_1000008880 122
435 3300031911 Ga0307412_10048579 Ga0307412_100485792 122
436 3300031911 Ga0307412_10127716 Ga0307412_101277164 122
437 3300032002 Ga0307416_100000006 Ga0307416_10000000684 122
438 3300032002 Ga0307416_100534132 Ga0307416_1005341324 122
439 3300032004 Ga0307414_10000011 Ga0307414_10000011339 122
440 3300032004 Ga0307414_10000030 Ga0307414_1000003028 122
441 3300032004 Ga0307414_10000673 Ga0307414_100006732 122
442 3300032004 Ga0307414_10009268 Ga0307414_100092684 122
443 3300032004 Ga0307414_10011571 Ga0307414_100115715 122
444 3300032005 Ga0307411_10000004 Ga0307411_1000000410 122
445 3300032005 Ga0307411_10001861 Ga0307411_1000186117 122
446 3300032005 Ga0307411_10342908 Ga0307411_103429082 122
447 3300033524 Ga0316592_1000022 Ga0316592_100002210 122
448 3300033527 Ga0316586_1000693 Ga0316586_10006935 122
449 3300033527 Ga0316586_1009017 Ga0316586_10090172 122
450 3300033541 Ga0316596_1022402 Ga0316596_10224025 122
451 3300035398 Ga0316574_0007562 Ga0316574_0007562_2473_2841 122
452 3300035398 Ga0316574_0129961 Ga0316574_0129961_74_442 122
453 3300035398 Ga0316574_0247646 Ga0316574_0247646_37_405 122
454 3300035398 Ga0316574_0287960 Ga0316574_0287960_60_428 122
455 3300036401 Ga0373937_0174104 Ga0373937_0174104_1327_1695 122
456 3300036401 Ga0373937_1690625 Ga0373937_1690625_28_396 122
457 3300037312 Ga0395899_0000673 Ga0395899_0000673_20228_20596 122
458 3300037471 Ga0395905_0000001 Ga0395905_0000001_270991_271359 122
459 3300037471 Ga0395905_1230617 Ga0395905_1230617_12_380 122
460 3300038443 Ga0395901_0045223 Ga0395901_0045223_113_481 122
461 3300038634 Ga0246641_01883 Ga0246641_01883_56_424 122
462 3300039447 Ga0436361_1216877 Ga0436361_1216877_431_799 122
463 3300041407 Ga0439447_000447 Ga0439447_000447_3158_3526 122
464 3300041411 Ga0439466_0004165 Ga0439466_0004165_2631_2999 122
465 3300041411 Ga0439466_0057610 Ga0439466_0057610_246_614 122
466 3300041413 Ga0439465_0000032 Ga0439465_0000032_25474_25842 122
467 3300041441 Ga0451787_107116 Ga0451787_107116_801_1169 122
468 3300041442 Ga0451788_01017 Ga0451788_01017_132_500 122
469 3300041443 Ga0451789_1079854 Ga0451789_1079854_74_442 122
470 3300041444 Ga0451790_34212 Ga0451790_34212_37_405 122
471 3300041444 Ga0451790_47773 Ga0451790_47773_355_723 122
472 3300041451 Ga0451791_1675939 Ga0451791_1675939_21_389 122
473 3300041452 Ga0451793_0652381 Ga0451793_0652381_342_710 122
474 3300041458 Ga0451798_0435092 Ga0451798_0435092_185_553 122
475 3300041459 Ga0451800_1256493 Ga0451800_1256493_84_452 122
476 3300041460 Ga0451802_0457191 Ga0451802_0457191_73_441 122
477 3300041461 Ga0451805_017120 Ga0451805_017120_128_496 122
478 3300041486 Ga0451807_1997617 Ga0451807_1997617_320_688 122
479 3300041491 Ga0451833_0933881 Ga0451833_0933881_129_497 122
480 3300041494 Ga0451837_0125275 Ga0451837_0125275_55_423 122
481 3300041494 Ga0451837_0568756 Ga0451837_0568756_478_846 122
482 3300041494 Ga0451837_1056715 Ga0451837_1056715_316_684 122
483 3300041494 Ga0451837_1777468 Ga0451837_1777468_96_464 122
484 3300041498 Ga0451841_1428716 Ga0451841_1428716_1483_1851 122
485 3300041505 Ga0451849_1512452 Ga0451849_1512452_380_748 122
486 3300041507 Ga0451851_0977032 Ga0451851_0977032_636_1004 122
487 3300041509 Ga0451843_0112769 Ga0451843_0112769_1456_1824 122
488 3300041511 Ga0451855_0737901 Ga0451855_0737901_147_515 122
489 3300041512 Ga0451853_3298037 Ga0451853_3298037_448_816 122
490 3300042004 Ga0439445_0000090 Ga0439445_0000090_6707_7075 122
491 3300042004 Ga0439445_0001316 Ga0439445_0001316_2792_3160 122
492 3300042006 Ga0439432_088233 Ga0439432_088233_334_702 122
493 3300042129 Ga0450891_009933 Ga0450891_009933_41_409 122
494 3300042145 Ga0450906_044160 Ga0450906_044160_147_515 122
495 3300042156 Ga0439446_0111787 Ga0439446_0111787_376_744 122
496 3300042435 Ga0439434_0048824 Ga0439434_0048824_775_1143 122
497 3300042436 Ga0439435_0134617 Ga0439435_0134617_200_568 122
498 3300042876 Ga0451577_0002272 Ga0451577_0002272_20832_21200 122
499 3300044658 Ga0466972_0325270 Ga0466972_0325270_282_650 122
500 3300044712 Ga0453684_0466138 Ga0453684_0466138_941_1309 122
501 3300044712 Ga0453684_1044859 Ga0453684_1044859_411_779 122
502 3300044712 Ga0453684_1864412 Ga0453684_1864412_192_560 122
503 3300045051 Ga0451576_0000003 Ga0451576_0000003_960243_960611 122
504 3300045051 Ga0451576_0017866 Ga0451576_0017866_1364_1732 122
505 3300045051 Ga0451576_0040065 Ga0451576_0040065_3045_3413 122
506 3300046453 Ga0495627_000022 Ga0495627_000022_191589_191957 122
507 3300046457 Ga0495590_0009537 Ga0495590_0009537_3251_3619 122
508 3300046477 Ga0495664_0545738 Ga0495664_0545738_59_427 122
509 3300046500 Ga0495596_0004903 Ga0495596_0004903_5888_6256 122
510 3300046501 Ga0495607_0239089 Ga0495607_0239089_167_535 122
511 3300046507 Ga0495606_0021702 Ga0495606_0021702_1229_1597 122
512 3300046507 Ga0495606_0116963 Ga0495606_0116963_1153_1521 122
513 3300046512 Ga0495610_0000005 Ga0495610_0000005_194644_195012 122
514 3300046512 Ga0495610_0018640 Ga0495610_0018640_514_882 122
515 3300046519 Ga0495632_0007484 Ga0495632_0007484_3565_3933 122
516 3300046522 Ga0495643_0000294 Ga0495643_0000294_47316_47684 122
517 3300046522 Ga0495643_0219315 Ga0495643_0219315_398_766 122
518 3300046522 Ga0495643_0287237 Ga0495643_0287237_172_540 122
519 3300046525 Ga0495663_0001345 Ga0495663_0001345_1729_2097 122
520 3300046525 Ga0495663_0012337 Ga0495663_0012337_1327_1695 122
521 3300046530 Ga0495654_0000003 Ga0495654_0000003_689580_689948 122
522 3300046530 Ga0495654_0086898 Ga0495654_0086898_539_907 122
523 3300046535 Ga0495586_0299046 Ga0495586_0299046_114_482 122
524 3300046538 Ga0495609_0000003 Ga0495609_0000003_675676_676044 122
525 3300046543 Ga0495645_0320880 Ga0495645_0320880_280_648 122
526 3300046558 Ga0495633_0003150 Ga0495633_0003150_8150_8518 122
527 3300046558 Ga0495633_0013345 Ga0495633_0013345_2129_2497 122
528 3300046558 Ga0495633_0014068 Ga0495633_0014068_1143_1511 122
529 3300046642 Ga0495634_0076813 Ga0495634_0076813_746_1114 122
530 3300046660 Ga0495625_0000096 Ga0495625_0000096_75829_76197 122
531 3300046660 Ga0495625_0001933 Ga0495625_0001933_9505_9873 122
532 3300046660 Ga0495625_0041479 Ga0495625_0041479_2464_2832 122
533 3300046681 Ga0495647_0318605 Ga0495647_0318605_213_581 122
534 3300046683 Ga0495658_0749816 Ga0495658_0749816_182_550 122
535 3300046692 Ga0495671_0063109 Ga0495671_0063109_127_495 122
536 3300046810 Ga0495660_0024916 Ga0495660_0024916_1109_1477 122
537 3300046810 Ga0495660_0223215 Ga0495660_0223215_12_380 122
538 3300047472 Ga0495686_0004601 Ga0495686_0004601_2340_2708 122
539 3300047472 Ga0495686_0469080 Ga0495686_0469080_204_572 122
540 3300048905 Ga0496102_0035559 Ga0496102_0035559_3895_4263 122
541 3300048907 Ga0496104_0268649 Ga0496104_0268649_977_1345 122
542 3300048908 Ga0496105_0160764 Ga0496105_0160764_635_1003 122
543 3300048916 Ga0496113_0161385 Ga0496113_0161385_671_1039 122
544 3300048917 Ga0496114_1047556 Ga0496114_1047556_265_633 122
545 3300048918 Ga0496115_0068443 Ga0496115_0068443_670_1038 122
546 3300048919 Ga0496116_0000024 Ga0496116_0000024_97208_97576 122
547 3300048919 Ga0496116_0000029 Ga0496116_0000029_79789_80157 122
548 3300048920 Ga0496117_0000007 Ga0496117_0000007_78167_78535 122
549 3300048920 Ga0496117_0120383 Ga0496117_0120383_1040_1408 122
550 3300048921 Ga0496118_0000252 Ga0496118_0000252_90700_91068 122
551 3300048921 Ga0496118_0033058 Ga0496118_0033058_1689_2057 122
552 3300048921 Ga0496118_0126896 Ga0496118_0126896_115_483 122
553 3300048922 Ga0496119_0000007 Ga0496119_0000007_78234_78602 122
554 3300048923 Ga0496120_0007422 Ga0496120_0007422_6180_6548 122
555 3300048924 Ga0496121_0014632 Ga0496121_0014632_6366_6734 122
556 3300048924 Ga0496121_0021047 Ga0496121_0021047_5993_6361 122
557 3300048926 Ga0496123_0041623 Ga0496123_0041623_2320_2688 122
558 3300048927 Ga0496124_0013719 Ga0496124_0013719_7376_7744 122
559 3300048927 Ga0496124_0035036 Ga0496124_0035036_3959_4327 122
560 3300048927 Ga0496124_0050411 Ga0496124_0050411_92_460 122
561 3300048928 Ga0496125_0000018 Ga0496125_0000018_382618_382986 122
562 3300048928 Ga0496125_0000031 Ga0496125_0000031_29583_29951 122
563 3300048928 Ga0496125_0032980 Ga0496125_0032980_3031_3399 122
564 3300048928 Ga0496125_0124107 Ga0496125_0124107_811_1179 122
565 3300048929 Ga0496126_0115769 Ga0496126_0115769_108_476 122
566 3300048929 Ga0496126_0119349 Ga0496126_0119349_1691_2059 122
567 3300048929 Ga0496126_0924928 Ga0496126_0924928_128_496 122
568 3300049130 Ga0501310_000150 Ga0501310_000150_1612_1980 122
569 3300049160 Ga0501304_018390 Ga0501304_018390_226_594 122
570 3300049162 Ga0501307_002458 Ga0501307_002458_303_671 122
571 3300049530 Ga0501314_000001 Ga0501314_000001_4839_5207 122
572 3300049533 Ga0501317_000248 Ga0501317_000248_2442_2810 122
573 3300049535 Ga0501319_000002 Ga0501319_000002_8484_8852 122
574 3300049535 Ga0501319_000013 Ga0501319_000013_2202_2570 122
575 3300049536 Ga0501320_000041 Ga0501320_000041_937_1305 122
576 3300049537 Ga0501321_000051 Ga0501321_000051_1121_1489 122
577 3300049537 Ga0501321_010452 Ga0501321_010452_100_468 122
578 3300049538 Ga0501322_000046 Ga0501322_000046_3103_3471 122
579 3300049539 Ga0501323_000002 Ga0501323_000002_9008_9376 122
580 3300049539 Ga0501323_000756 Ga0501323_000756_1308_1676 122
581 3300049539 Ga0501323_004478 Ga0501323_004478_938_1306 122
582 3300049540 Ga0501324_000002 Ga0501324_000002_4980_5348 122
583 3300049541 Ga0501325_000286 Ga0501325_000286_1610_1978 122
584 3300049542 Ga0501326_00056 Ga0501326_00056_1615_1983 122
585 3300049544 Ga0501328_00035 Ga0501328_00035_929_1297 122
586 3300049545 Ga0501329_00017 Ga0501329_00017_565_933 122
587 3300049546 Ga0501330_000098 Ga0501330_000098_611_979 122
588 3300049547 Ga0501331_00043 Ga0501331_00043_2442_2810 122
589 3300049550 Ga0501334_00029 Ga0501334_00029_910_1278 122
590 3300049550 Ga0501334_00034 Ga0501334_00034_1144_1512 122
591 3300049551 Ga0501335_000048 Ga0501335_000048_2758_3126 122
592 3300049551 Ga0501335_000133 Ga0501335_000133_1510_1878 122
593 3300049553 Ga0501337_000033 Ga0501337_000033_3067_3435 122
594 3300049568 Ga0501031_0004470 Ga0501031_0004470_8122_8490 122
595 3300049569 Ga0501032_0002362 Ga0501032_0002362_2670_3038 122
596 3300049569 Ga0501032_0002936 Ga0501032_0002936_1136_1504 122
597 3300049570 Ga0501033_0000011 Ga0501033_0000011_42370_42738 122
598 3300049571 Ga0501034_0001265 Ga0501034_0001265_12031_12399 122
599 3300049571 Ga0501034_0232715 Ga0501034_0232715_682_1050 122
600 3300049572 Ga0501036_0068307 Ga0501036_0068307_2565_2933 122
601 3300049573 Ga0501037_0003904 Ga0501037_0003904_705_1073 122
602 3300049574 Ga0501038_0002395 Ga0501038_0002395_11426_11794 122
603 3300049574 Ga0501038_0108296 Ga0501038_0108296_956_1324 122
604 3300049575 Ga0501039_0015938 Ga0501039_0015938_1031_1399 122
605 3300049579 Ga0501043_0000733 Ga0501043_0000733_5879_6247 122
606 3300049581 Ga0501047_0037417 Ga0501047_0037417_3121_3489 122
607 3300049581 Ga0501047_0046063 Ga0501047_0046063_1117_1485 122
608 3300049582 Ga0501048_0426916 Ga0501048_0426916_490_858 122
609 3300049583 Ga0501067_0379480 Ga0501067_0379480_41_409 122
610 3300049586 Ga0501070_0704969 Ga0501070_0704969_388_756 122
611 3300049590 Ga0501074_0989645 Ga0501074_0989645_57_425 122
612 3300049649 Ga0501198_026181 Ga0501198_026181_440_808 122
613 3300049663 Ga0501223_002029 Ga0501223_002029_2807_3175 122
614 3300049664 Ga0501224_030889 Ga0501224_030889_59_427 122
615 3300049669 Ga0501235_087542 Ga0501235_087542_330_698 122
616 3300049671 Ga0501238_000015 Ga0501238_000015_6919_7287 122
617 3300049675 Ga0501243_003419 Ga0501243_003419_623_991 122
618 3300049679 Ga0501249_195692 Ga0501249_195692_71_439 122
619 3300049681 Ga0501251_005157 Ga0501251_005157_123_491 122
620 3300049758 Ga0501241_000002 Ga0501241_000002_80775_81143 122
621 3300049758 Ga0501241_000113 Ga0501241_000113_4708_5076 122
622 3300049758 Ga0501241_002715 Ga0501241_002715_1769_2137 122
623 3300049759 Ga0501262_009059 Ga0501262_009059_54_422 122
624 3300049763 Ga0501266_000002 Ga0501266_000002_344481_344849 122
625 3300049766 Ga0501269_000004 Ga0501269_000004_26894_27262 122
626 3300049766 Ga0501269_001937 Ga0501269_001937_507_875 122
627 3300049776 Ga0501280_000239 Ga0501280_000239_8440_8808 122
628 3300049776 Ga0501280_093662 Ga0501280_093662_100_468 122
629 3300049822 Ga0501035_0009077 Ga0501035_0009077_8424_8792 122
630 3300049822 Ga0501035_0016384 Ga0501035_0016384_477_845 122
631 3300049823 Ga0501044_0001293 Ga0501044_0001293_5659_6027 122
632 3300049824 Ga0501045_0000053 Ga0501045_0000053_12163_12531 122
633 3300050489 nmdc:mga03683_18140_c1 nmdc:mga03683_18140_c1_2188_2556 122
634 3300050496 nmdc:mga07m45_534682_c1 nmdc:mga07m45_534682_c1_30_398 122
635 3300053088 Ga0500644_0020716 Ga0500644_0020716_670_1038 122
636 3300053090 Ga0500646_0007145 Ga0500646_0007145_302_670 122
637 3300053090 Ga0500646_0009195 Ga0500646_0009195_882_1250 122
638 3300053091 Ga0500647_0405990 Ga0500647_0405990_95_463 122
639 3300053093 Ga0500651_0066629 Ga0500651_0066629_614_982 122
640 3300053096 Ga0500641_0000168 Ga0500641_0000168_163_531 122
641 3300053096 Ga0500641_0006404 Ga0500641_0006404_671_1039 122
642 3300053129 Ga0500628_164640 Ga0500628_164640_171_539 122
643 3300053134 Ga0500658_0000002 Ga0500658_0000002_195845_196213 122
644 3300053136 Ga0500559_0010320 Ga0500559_0010320_1210_1578 122
645 3300053140 Ga0500573_0169794 Ga0500573_0169794_340_708 122
646 3300053152 Ga0500606_175726 Ga0500606_175726_77_445 122
647 3300053156 Ga0500622_0138338 Ga0500622_0138338_194_562 122
648 3300053156 Ga0500622_0317436 Ga0500622_0317436_150_518 122
649 3300053158 Ga0500627_0306602 Ga0500627_0306602_142_510 122
650 3300053726 Ga0500584_021185 Ga0500584_021185_1645_2013 122
651 3300059478 Ga0587093_013795 Ga0587093_013795_359_727 122
652 3300059490 Ga0587066_019259 Ga0587066_019259_698_1066 122
653 3300059491 Ga0587070_005454 Ga0587070_005454_764_1132 122
654 3300059493 Ga0587077_013219 Ga0587077_013219_203_571 122
655 3300059493 Ga0587077_083699 Ga0587077_083699_167_535 122
656 3300059505 Ga0587083_0019247 Ga0587083_0019247_637_1005 122
657 3300059512 Ga0587092_046170 Ga0587092_046170_109_477 122
658 3300059514 Ga0587095_025185 Ga0587095_025185_182_550 122
659 3300059627 Ga0587117_009294 Ga0587117_009294_764_1132 122
660 3300059641 Ga0587068_000659 Ga0587068_000659_2037_2405 122
661 3300059645 Ga0587076_051613 Ga0587076_051613_37_405 122
662 3300059647 Ga0587079_112190 Ga0587079_112190_257_625 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00238

Ribosomal_L14

Ribosomal protein L14p/L23e

1

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v9a-assembly1.cif.gz_BN crystal structure of the 70s ribosome with tetracycline. 0.9711 1 122
7jil-assembly1.cif.gz_K 70s ribosome flavobacterium johnsoniae 0.9678 1 121
6n1d-assembly2.cif.gz_BL14 x-ray crystal complex showing spontaneous ribosomal translocation of mrna and trnas into a chimeric hybrid state 0.9658 1 122
4xej-assembly1.cif.gz_AL14 ires bound to bacterial ribosome 0.9651 1 122
8fn2-assembly1.cif.gz_M the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9648 1 122
ID Description Score Start End Superfamily
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9476 2 121 2.40.150.20
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.94 2 121 2.40.150.20
3i1nK00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9369 1 121 2.40.150.20
1vw4I00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9325 1 122 2.40.150.20
af_C0H4F0_2_122_2.40.150.20 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9261 2 109 2.40.150.20
ID Description Score Start End GO Terms
AF-A0A537L638-F1-model_v4 Large ribosomal subunit protein uL14 0.9879 32 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7V2EDC6-F1-model_v4 50S ribosomal protein L14 0.9873 34 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7X7B8Y8-F1-model_v4 50S ribosomal protein L14 0.983 34 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A1M5LNT0-F1-model_v4 Large ribosomal subunit protein uL14 0.9821 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A0F7QZP6-F1-model_v4 Large ribosomal subunit protein uL14c 0.9821 1 122 GO:0003735
GO:0006412
GO:0009507
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
93.75 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map