F471925

General Info

Members Datasets Scaffolds Average Seq Length
643 330 639 140

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10004185|JGI25407J50210_100041855
Length 160
Sequence MPARKRVAATVRLQLEAGQASPGKAGQALGPHGINLMAFVGAYNAASAAQRGMVVPVVVTVYDDRSFDLQLKTPPTSALLARAAGLGKGGDRPGDGPIAKLARDQLREVARAKLPDLNTDDLDAAERIVAGTARSMGIEVVDAVNQPRAPSVLPERRTPW

Samples

Sample ID Description Type Environment
1 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
2 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
3 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
196 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
197 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
198 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
225 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
228 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
232 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
233 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
234 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
235 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
330 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.47
Metatranscriptomes 5.91
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 1.24
Rhizosphere 95.33
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10028884 3300001991 Bacteria 1087
2 JGI24751J29686_10121017 3300002459 Bacteria 550
3 JGI26145J50221_1033850 3300003371 Bacteria 529
4 JGI25407J50210_10004185 3300003373 Bacteria 3511
5 Ga0058858_1299979 3300004785 Unclassified 551
6 Ga0058859_10054700 3300004798 Bacteria 2645
7 Ga0058859_10108115 3300004798 Bacteria 2373
8 Ga0058859_10131413 3300004798 Bacteria 1137
9 Ga0058859_11564291 3300004798 Bacteria 896
10 Ga0058861_11795149 3300004800 Bacteria 558
11 Ga0058860_10195543 3300004801 Bacteria 862
12 Ga0058862_10098853 3300004803 Bacteria 725
13 Ga0058862_12700650 3300004803 Bacteria 811
14 Ga0065715_10179465 3300005293 Bacteria 1411
15 Ga0065707_10598467 3300005295 Bacteria 691
16 Ga0070658_10020602 3300005327 Bacteria 5285
17 Ga0070683_100000118 3300005329 Bacteria 51816
18 Ga0070690_100028743 3300005330 Bacteria 3445
19 Ga0070690_100619142 3300005330 Bacteria 824
20 Ga0070690_100917987 3300005330 Unclassified 686
21 Ga0070670_100005117 3300005331 Bacteria 11035
22 Ga0070670_100136162 3300005331 Bacteria 2123
23 Ga0070670_100212412 3300005331 Bacteria 1682
24 Ga0070677_10204613 3300005333 Bacteria 955
25 Ga0068869_100144565 3300005334 Bacteria 1839
26 Ga0068869_101541980 3300005334 Bacteria 591
27 Ga0070680_101076595 3300005336 Bacteria 695
28 Ga0070680_101211617 3300005336 Bacteria 653
29 Ga0070682_100000004 3300005337 Bacteria 388780
30 Ga0070682_100287714 3300005337 Bacteria 1201
31 Ga0068868_100000927 3300005338 Bacteria 19963
32 Ga0070689_100002507 3300005340 Bacteria 12013
33 Ga0070689_100004116 3300005340 Bacteria 9793
34 Ga0070689_100074023 3300005340 Bacteria 2665
35 Ga0070689_100162060 3300005340 Bacteria 1808
36 Ga0070689_100166284 3300005340 Bacteria 1785
37 Ga0070687_100039402 3300005343 Bacteria 2374
38 Ga0070687_100124434 3300005343 Bacteria 1480
39 Ga0070661_101280450 3300005344 Bacteria 615
40 Ga0070692_10159911 3300005345 Bacteria 1290
41 Ga0070669_100440231 3300005353 Bacteria 1073
42 Ga0070675_100003283 3300005354 Bacteria 12267
43 Ga0070671_100497651 3300005355 Bacteria 1048
44 Ga0070671_100768595 3300005355 Bacteria 838
45 Ga0070688_100069163 3300005365 Bacteria 2253
46 Ga0070688_100084260 3300005365 Bacteria 2064
47 Ga0070688_100146702 3300005365 Bacteria 1608
48 Ga0070688_101334019 3300005365 Unclassified 580
49 Ga0070667_100787605 3300005367 Bacteria 882
50 Ga0070667_101365343 3300005367 Unclassified 664
51 Ga0070667_101483196 3300005367 Bacteria 637
52 Ga0070667_101564654 3300005367 Bacteria 619
53 Ga0070703_10165314 3300005406 Bacteria 843
54 Ga0070703_10586165 3300005406 Bacteria 513
55 Ga0070714_100205774 3300005435 Bacteria 1802
56 Ga0070713_100020740 3300005436 Bacteria 5044
57 Ga0070710_11097853 3300005437 Bacteria 584
58 Ga0070701_11107334 3300005438 Bacteria 558
59 Ga0070711_100016016 3300005439 Bacteria 4752
60 Ga0070705_101054307 3300005440 Bacteria 663
61 Ga0070700_100125572 3300005441 Bacteria 1725
62 Ga0070700_100312930 3300005441 Bacteria 1150
63 Ga0070700_101938246 3300005441 Bacteria 510
64 Ga0070694_100086832 3300005444 Bacteria 2187
65 Ga0070694_100136870 3300005444 Bacteria 1775
66 Ga0070694_100944466 3300005444 Bacteria 714
67 Ga0070694_101354336 3300005444 Bacteria 600
68 Ga0070708_100043823 3300005445 Bacteria 3932
69 Ga0070708_100520867 3300005445 Bacteria 1121
70 Ga0070708_101140576 3300005445 Bacteria 730
71 Ga0070678_100364847 3300005456 Bacteria 1245
72 Ga0070678_100603764 3300005456 Bacteria 980
73 Ga0068867_100760756 3300005459 Bacteria 860
74 Ga0070685_10006013 3300005466 Bacteria 6184
75 Ga0070706_100024463 3300005467 Bacteria 5560
76 Ga0070706_100042452 3300005467 Bacteria 4201
77 Ga0070706_100174116 3300005467 Bacteria 2009
78 Ga0070706_100980556 3300005467 Bacteria 780
79 Ga0070707_100057767 3300005468 Bacteria 3722
80 Ga0070707_100298445 3300005468 Bacteria 1565
81 Ga0070707_100500589 3300005468 Bacteria 1177
82 Ga0070707_101366960 3300005468 Bacteria 675
83 Ga0070698_100289130 3300005471 Bacteria 1570
84 Ga0070698_100981819 3300005471 Bacteria 791
85 Ga0070699_100042737 3300005518 Bacteria 3922
86 Ga0070699_100245148 3300005518 Bacteria 1600
87 Ga0070699_101311615 3300005518 Bacteria 664
88 Ga0070679_101472261 3300005530 Bacteria 628
89 Ga0070684_100004380 3300005535 Bacteria 10734
90 Ga0070697_100141520 3300005536 Bacteria 2023
91 Ga0070697_100159513 3300005536 Bacteria 1905
92 Ga0070697_100242721 3300005536 Bacteria 1538
93 Ga0070697_100430910 3300005536 Bacteria 1147
94 Ga0068853_100854765 3300005539 Bacteria 873
95 Ga0068853_102207801 3300005539 Bacteria 534
96 Ga0070672_100000645 3300005543 Bacteria 20439
97 Ga0070686_100015810 3300005544 Bacteria 4381
98 Ga0070686_100123070 3300005544 Bacteria 1783
99 Ga0070686_100618046 3300005544 Bacteria 856
100 Ga0070686_101441635 3300005544 Bacteria 579
101 Ga0070695_100006106 3300005545 Bacteria 7119
102 Ga0070695_100031080 3300005545 Bacteria 3327
103 Ga0070695_100151664 3300005545 Unclassified 1618
104 Ga0070693_100079597 3300005547 Bacteria 1950
105 Ga0070665_101768127 3300005548 Bacteria 625
106 Ga0070704_100045604 3300005549 Bacteria 3051
107 Ga0070704_100175096 3300005549 Bacteria 1710
108 Ga0070704_100210687 3300005549 Bacteria 1574
109 Ga0070704_100214293 3300005549 Bacteria 1562
110 Ga0070704_100319935 3300005549 Bacteria 1299
111 Ga0070704_100358563 3300005549 Bacteria 1233
112 Ga0070664_100151761 3300005564 Bacteria 2046
113 Ga0068857_100085364 3300005577 Bacteria 2821
114 Ga0068857_100415904 3300005577 Bacteria 1253
115 Ga0068857_101363645 3300005577 Bacteria 689
116 Ga0070702_100087415 3300005615 Bacteria 1882
117 Ga0070702_100159474 3300005615 Bacteria 1457
118 Ga0070702_100271565 3300005615 Bacteria 1160
119 Ga0070702_101355050 3300005615 Bacteria 580
120 Ga0068859_100096765 3300005617 Bacteria 3004
121 Ga0068859_100944974 3300005617 Bacteria 946
122 Ga0068859_101334740 3300005617 Bacteria 791
123 Ga0068864_100000025 3300005618 Bacteria 250062
124 Ga0068864_100118935 3300005618 Bacteria 2360
125 Ga0068864_100178104 3300005618 Bacteria 1942
126 Ga0068864_100683246 3300005618 Bacteria 1001
127 Ga0068861_100085703 3300005719 Bacteria 2475
128 Ga0068861_100260811 3300005719 Bacteria 1484
129 Ga0068870_10069881 3300005840 Bacteria 1912
130 Ga0068870_10134631 3300005840 Unclassified 1439
131 Ga0068863_100059485 3300005841 Bacteria 3614
132 Ga0068863_100422201 3300005841 Bacteria 1306
133 Ga0068863_100856962 3300005841 Bacteria 908
134 Ga0068858_100000126 3300005842 Bacteria 79740
135 Ga0068858_100945023 3300005842 Bacteria 844
136 Ga0068860_100237940 3300005843 Bacteria 1771
137 Ga0068860_100773714 3300005843 Bacteria 972
138 Ga0068860_100800955 3300005843 Bacteria 955
139 Ga0068862_100771770 3300005844 Bacteria 937
140 Ga0081538_10001550 3300005981 Bacteria 23554
141 Ga0081538_10002952 3300005981 Bacteria 16234
142 Ga0081538_10005210 3300005981 Bacteria 11747
143 Ga0081538_10012332 3300005981 Bacteria 6856
144 Ga0081538_10018001 3300005981 Bacteria 5332
145 Ga0081538_10019455 3300005981 Bacteria 5046
146 Ga0081538_10271366 3300005981 Bacteria 635
147 Ga0070717_10000358 3300006028 Bacteria 29359
148 Ga0075364_10020198 3300006051 Bacteria 4189
149 Ga0075432_10039752 3300006058 Bacteria 1641
150 Ga0070715_10182770 3300006163 Bacteria 1053
151 Ga0070716_100562939 3300006173 Bacteria 852
152 Ga0070716_101489893 3300006173 Bacteria 553
153 Ga0075362_10012980 3300006177 Bacteria 3323
154 Ga0068871_100883353 3300006358 Bacteria 828
155 Ga0075428_100031483 3300006844 Bacteria 5862
156 Ga0075428_100205418 3300006844 Bacteria 2129
157 Ga0075428_100275866 3300006844 Bacteria 1809
158 Ga0075428_100438204 3300006844 Bacteria 1400
159 Ga0075428_100450526 3300006844 Unclassified 1379
160 Ga0075428_100839747 3300006844 Bacteria 975
161 Ga0075430_100093180 3300006846 Bacteria 2518
162 Ga0075430_100787156 3300006846 Bacteria 784
163 Ga0075430_100972839 3300006846 Bacteria 699
164 Ga0075433_10033580 3300006852 Bacteria 4400
165 Ga0075433_10311866 3300006852 Bacteria 1392
166 Ga0075433_10375920 3300006852 Bacteria 1255
167 Ga0075433_11042784 3300006852 Bacteria 712
168 Ga0075433_11233138 3300006852 Bacteria 649
169 Ga0075434_100044962 3300006871 Bacteria 4380
170 Ga0075434_100172980 3300006871 Bacteria 2179
171 Ga0075434_100218166 3300006871 Bacteria 1927
172 Ga0075434_100426703 3300006871 Bacteria 1347
173 Ga0075434_100557290 3300006871 Bacteria 1166
174 Ga0075434_101240785 3300006871 Bacteria 757
175 Ga0075434_101465951 3300006871 Bacteria 692
176 Ga0075429_100074346 3300006880 Bacteria 2960
177 Ga0075429_100236303 3300006880 Bacteria 1601
178 Ga0075429_100387597 3300006880 Bacteria 1223
179 Ga0068865_100792684 3300006881 Bacteria 817
180 Ga0075436_100015219 3300006914 Bacteria 5268
181 Ga0075436_100595619 3300006914 Bacteria 814
182 Ga0097620_100096764 3300006931 Bacteria 3004
183 Ga0097620_100945002 3300006931 Bacteria 946
184 Ga0097620_101334672 3300006931 Bacteria 791
185 Ga0075435_100019811 3300007076 Bacteria 5145
186 Ga0075435_100024698 3300007076 Bacteria 4667
187 Ga0075435_100129015 3300007076 Bacteria 2115
188 Ga0099795_10127105 3300007788 Bacteria 1025
189 Ga0099795_10216423 3300007788 Bacteria 814
190 Ga0111539_10000254 3300009094 Bacteria 64117
191 Ga0111539_10051057 3300009094 Bacteria 4926
192 Ga0111539_10066486 3300009094 Bacteria 4258
193 Ga0111539_10166012 3300009094 Bacteria 2581
194 Ga0111539_11000809 3300009094 Bacteria 972
195 Ga0111539_11295652 3300009094 Bacteria 846
196 Ga0111539_13044178 3300009094 Bacteria 541
197 Ga0105245_10002811 3300009098 Bacteria 15656
198 Ga0105245_10003274 3300009098 Bacteria 14536
199 Ga0105245_10687991 3300009098 Bacteria 1055
200 Ga0105247_10027881 3300009101 Bacteria 3415
201 Ga0114129_10001925 3300009147 Bacteria 28355
202 Ga0114129_10037064 3300009147 Bacteria 6885
203 Ga0114129_10063727 3300009147 Bacteria 5145
204 Ga0114129_10242045 3300009147 Bacteria 2425
205 Ga0114129_10307432 3300009147 Bacteria 2111
206 Ga0114129_10441641 3300009147 Bacteria 1708
207 Ga0114129_10924990 3300009147 Bacteria 1103
208 Ga0105243_10187817 3300009148 Bacteria 1802
209 Ga0105243_11019192 3300009148 Bacteria 832
210 Ga0105242_10907429 3300009176 Unclassified 882
211 Ga0105248_10306898 3300009177 Bacteria 1787
212 Ga0105248_11656144 3300009177 Bacteria 725
213 Ga0105237_10512613 3300009545 Bacteria 1206
214 Ga0105237_10969923 3300009545 Unclassified 857
215 Ga0105238_10000002 3300009551 Bacteria 772711
216 Ga0105249_10101204 3300009553 Bacteria 2710
217 Ga0105246_10340070 3300011119 Bacteria 1226
218 Ga0157369_10000363 3300013105 Bacteria 60464
219 Ga0157374_10000016 3300013296 Bacteria 293656
220 Ga0157378_10094801 3300013297 Bacteria 2717
221 Ga0157378_10190755 3300013297 Bacteria 1933
222 Ga0157378_10214534 3300013297 Bacteria 1826
223 Ga0157378_10528396 3300013297 Bacteria 1182
224 Ga0157378_11308407 3300013297 Bacteria 766
225 Ga0163162_10086032 3300013306 Bacteria 3221
226 Ga0157372_12109992 3300013307 Bacteria 647
227 Ga0157375_10001186 3300013308 Bacteria 22482
228 Ga0157375_10004506 3300013308 Bacteria 12112
229 Ga0157375_10061602 3300013308 Bacteria 3726
230 Ga0157375_10062738 3300013308 Bacteria 3694
231 Ga0163163_10274144 3300014325 Bacteria 1738
232 Ga0163163_10284597 3300014325 Bacteria 1705
233 Ga0157380_10023433 3300014326 Bacteria 4657
234 Ga0157380_10944054 3300014326 Bacteria 892
235 Ga0157377_10000026 3300014745 Bacteria 138648
236 Ga0157377_10000370 3300014745 Bacteria 20086
237 Ga0157377_10311529 3300014745 Bacteria 1043
238 Ga0157379_10267528 3300014968 Bacteria 1554
239 Ga0157376_10000018 3300014969 Bacteria 259397
240 Ga0213876_10000009 3300021384 Bacteria 496136
241 Ga0207666_1056695 3300025271 Bacteria 625
242 Ga0207653_10134987 3300025885 Bacteria 898
243 Ga0207653_10250572 3300025885 Bacteria 679
244 Ga0207642_10216726 3300025899 Bacteria 1067
245 Ga0207685_10025056 3300025905 Bacteria 2054
246 Ga0207643_10063001 3300025908 Bacteria 2119
247 Ga0207705_10037305 3300025909 Bacteria 3478
248 Ga0207684_10028407 3300025910 Bacteria 4766
249 Ga0207684_10569815 3300025910 Bacteria 968
250 Ga0207684_10853056 3300025910 Bacteria 768
251 Ga0207707_10936340 3300025912 Bacteria 714
252 Ga0207695_10157699 3300025913 Bacteria 2203
253 Ga0207662_10001242 3300025918 Bacteria 12237
254 Ga0207662_10170677 3300025918 Bacteria 1395
255 Ga0207649_11305117 3300025920 Bacteria 574
256 Ga0207646_10051275 3300025922 Bacteria 3693
257 Ga0207646_10185373 3300025922 Bacteria 1879
258 Ga0207681_11511968 3300025923 Bacteria 563
259 Ga0207694_10000001 3300025924 Bacteria 4078485
260 Ga0207650_10001851 3300025925 Bacteria 14917
261 Ga0207650_10040019 3300025925 Bacteria 3428
262 Ga0207687_10000009 3300025927 Bacteria 443946
263 Ga0207687_10002004 3300025927 Bacteria 14005
264 Ga0207687_10306291 3300025927 Bacteria 1281
265 Ga0207700_10014828 3300025928 Bacteria 5119
266 Ga0207664_10348206 3300025929 Bacteria 1311
267 Ga0207706_11219705 3300025933 Bacteria 624
268 Ga0207670_10001935 3300025936 Bacteria 10844
269 Ga0207670_10003762 3300025936 Bacteria 8063
270 Ga0207670_10032517 3300025936 Bacteria 3355
271 Ga0207670_10058309 3300025936 Bacteria 2622
272 Ga0207704_10745347 3300025938 Bacteria 814
273 Ga0207665_10473843 3300025939 Bacteria 964
274 Ga0207691_10002381 3300025940 Bacteria 18401
275 Ga0207711_10097299 3300025941 Bacteria 2599
276 Ga0207711_10113179 3300025941 Bacteria 2416
277 Ga0207689_10067295 3300025942 Bacteria 2944
278 Ga0207661_10000015 3300025944 Bacteria 318960
279 Ga0207651_10110630 3300025960 Bacteria 2061
280 Ga0207640_10182284 3300025981 Bacteria 1575
281 Ga0207677_10000017 3300026023 Bacteria 140155
282 Ga0207703_10000653 3300026035 Bacteria 34790
283 Ga0207703_11086094 3300026035 Bacteria 768
284 Ga0207703_11384905 3300026035 Bacteria 676
285 Ga0207639_10354827 3300026041 Bacteria 1311
286 Ga0207639_10618394 3300026041 Bacteria 1000
287 Ga0207708_10117850 3300026075 Bacteria 2067
288 Ga0207708_10274129 3300026075 Bacteria 1365
289 Ga0207708_10621444 3300026075 Bacteria 917
290 Ga0207708_11373612 3300026075 Bacteria 620
291 Ga0207641_10046806 3300026088 Bacteria 3646
292 Ga0207641_10248171 3300026088 Bacteria 1661
293 Ga0207641_10360078 3300026088 Bacteria 1389
294 Ga0207648_10166559 3300026089 Bacteria 1948
295 Ga0207676_10000002 3300026095 Bacteria 1198607
296 Ga0207676_10076472 3300026095 Bacteria 2705
297 Ga0207676_10134261 3300026095 Bacteria 2109
298 Ga0207674_10029202 3300026116 Bacteria 5808
299 Ga0207674_10146828 3300026116 Bacteria 2317
300 Ga0207675_100014908 3300026118 Bacteria 7255
301 Ga0207675_100046541 3300026118 Bacteria 4053
302 Ga0207675_100267296 3300026118 Bacteria 1659
303 Ga0207675_100861274 3300026118 Bacteria 921
304 Ga0209973_1006677 3300027252 Bacteria 1267
305 Ga0209984_1018238 3300027424 Bacteria 947
306 Ga0209970_1005151 3300027614 Bacteria 2161
307 Ga0209983_1001726 3300027665 Bacteria 4834
308 Ga0209983_1051038 3300027665 Bacteria 905
309 Ga0209971_1065664 3300027682 Bacteria 879
310 Ga0209974_10007726 3300027876 Bacteria 3697
311 Ga0209974_10015791 3300027876 Bacteria 2507
312 Ga0207428_10032114 3300027907 Bacteria 4322
313 Ga0207428_10039117 3300027907 Bacteria 3850
314 Ga0207428_10162506 3300027907 Bacteria 1695
315 Ga0268265_10661570 3300028380 Bacteria 1005
316 Ga0268265_12207380 3300028380 Bacteria 557
317 Ga0268264_10345792 3300028381 Bacteria 1414
318 Ga0268264_11288247 3300028381 Bacteria 741
319 Ga0265337_1001292 3300028556 Bacteria 12533
320 Ga0265337_1019126 3300028556 Bacteria 2165
321 Ga0265337_1084813 3300028556 Bacteria 865
322 Ga0265326_10001534 3300028558 Bacteria 8079
323 Ga0265326_10020830 3300028558 Bacteria 1879
324 Ga0265319_1000077 3300028563 Bacteria 75962
325 Ga0265319_1000371 3300028563 Bacteria 32428
326 Ga0265319_1044267 3300028563 Bacteria 1492
327 Ga0265334_10000696 3300028573 Bacteria 16863
328 Ga0265334_10004850 3300028573 Bacteria 5914
329 Ga0265334_10124182 3300028573 Bacteria 921
330 Ga0265334_10237244 3300028573 Bacteria 629
331 Ga0265318_10002615 3300028577 Bacteria 9508
332 Ga0265323_10000672 3300028653 Bacteria 18620
333 Ga0265322_10000375 3300028654 Bacteria 18550
334 Ga0265322_10007514 3300028654 Bacteria 3178
335 Ga0265336_10000066 3300028666 Bacteria 95677
336 Ga0265338_10013819 3300028800 Bacteria 9072
337 Ga0265338_10024383 3300028800 Bacteria 6180
338 Ga0265338_10026142 3300028800 Bacteria 5897
339 Ga0265338_10029761 3300028800 Bacteria 5404
340 Ga0265338_10062691 3300028800 Bacteria 3247
341 Ga0265338_10071531 3300028800 Bacteria 2966
342 Ga0265324_10000243 3300029957 Bacteria 41268
343 Ga0265324_10002496 3300029957 Bacteria 9339
344 Ga0265324_10020439 3300029957 Bacteria 2379
345 Ga0265324_10143898 3300029957 Bacteria 809
346 Ga0307511_10009343 3300030521 Bacteria 9771
347 Ga0265330_10000067 3300031235 Bacteria 91033
348 Ga0265330_10022116 3300031235 Bacteria 2897
349 Ga0265332_10000513 3300031238 Bacteria 26432
350 Ga0265332_10014669 3300031238 Bacteria 3462
351 Ga0265332_10074846 3300031238 Bacteria 1440
352 Ga0265328_10002334 3300031239 Bacteria 8555
353 Ga0265320_10000644 3300031240 Bacteria 26646
354 Ga0265320_10000896 3300031240 Bacteria 22415
355 Ga0265320_10057827 3300031240 Bacteria 1859
356 Ga0265325_10034126 3300031241 Bacteria 2710
357 Ga0265329_10000849 3300031242 Bacteria 15450
358 Ga0265340_10002520 3300031247 Bacteria 10399
359 Ga0265340_10009287 3300031247 Bacteria 5281
360 Ga0265339_10001501 3300031249 Bacteria 17252
361 Ga0265339_10103030 3300031249 Bacteria 1483
362 Ga0265339_10224012 3300031249 Bacteria 918
363 Ga0265331_10000271 3300031250 Bacteria 57462
364 Ga0265316_10001501 3300031344 Bacteria 25011
365 Ga0265316_10002576 3300031344 Bacteria 18724
366 Ga0265316_10077876 3300031344 Bacteria 2546
367 Ga0307513_10918868 3300031456 Bacteria 583
368 Ga0265313_10052053 3300031595 Bacteria 1956
369 Ga0265313_10084728 3300031595 Bacteria 1433
370 Ga0316575_10011870 3300031665 Bacteria 3231
371 Ga0316579_10002337 3300031691 Bacteria 7164
372 Ga0265314_10001618 3300031711 Bacteria 24701
373 Ga0265314_10068153 3300031711 Bacteria 2393
374 Ga0265314_10451807 3300031711 Bacteria 684
375 Ga0265342_10001108 3300031712 Bacteria 25815
376 Ga0265342_10003238 3300031712 Bacteria 13514
377 Ga0316576_10044407 3300031727 Bacteria 3210
378 Ga0316576_10052632 3300031727 Bacteria 2965
379 Ga0316576_10077995 3300031727 Bacteria 2454
380 Ga0316576_10203206 3300031727 Bacteria 1492
381 Ga0316576_10967833 3300031727 Bacteria 607
382 Ga0316578_10070350 3300031728 Bacteria 2071
383 Ga0316578_10312920 3300031728 Bacteria 938
384 Ga0316578_10350764 3300031728 Bacteria 878
385 Ga0307405_11192659 3300031731 Bacteria 658
386 Ga0316577_10040071 3300031733 Bacteria 2620
387 Ga0316577_10311058 3300031733 Bacteria 893
388 Ga0316577_10851103 3300031733 Bacteria 517
389 Ga0307413_10770933 3300031824 Bacteria 806
390 Ga0307407_10296565 3300031903 Bacteria 1126
391 Ga0307412_10106226 3300031911 Bacteria 1996
392 Ga0307409_101317614 3300031995 Bacteria 747
393 Ga0307416_100016235 3300032002 Bacteria 5168
394 Ga0307416_100053927 3300032002 Bacteria 3229
395 Ga0307416_100201671 3300032002 Bacteria 1888
396 Ga0307411_10428838 3300032005 Bacteria 1100
397 Ga0316583_10156928 3300032133 Bacteria 792
398 Ga0316585_10053256 3300032137 Bacteria 1301
399 Ga0316580_10039922 3300032139 Bacteria 1450
400 Ga0316593_10002170 3300032168 Bacteria 4579
401 Ga0316593_10003594 3300032168 Bacteria 3873
402 Ga0316593_10004215 3300032168 Bacteria 3668
403 Ga0316593_10010852 3300032168 Bacteria 2629
404 Ga0316593_10020465 3300032168 Bacteria 2057
405 Ga0316593_10023609 3300032168 Bacteria 1943
406 Ga0316593_10026649 3300032168 Bacteria 1849
407 Ga0316593_10027077 3300032168 Bacteria 1837
408 Ga0316593_10033657 3300032168 Bacteria 1679
409 Ga0316593_10255291 3300032168 Bacteria 657
410 Ga0316593_10309901 3300032168 Unclassified 599
411 Ga0316593_10336039 3300032168 Bacteria 576
412 Ga0316592_1034995 3300033524 Bacteria 1101
413 Ga0316587_1097974 3300033529 Bacteria 563
414 Ga0316596_1002322 3300033541 Bacteria 4044
415 Ga0316596_1002914 3300033541 Bacteria 3707
416 Ga0316596_1005115 3300033541 Bacteria 2982
417 Ga0316596_1018195 3300033541 Bacteria 1774
418 Ga0316596_1156428 3300033541 Bacteria 627
419 Ga0373926_0147578 3300035083 Bacteria 895
420 Ga0373934_0000155 3300035086 Bacteria 24945
421 Ga0373923_0044713 3300035111 Bacteria 1837
422 Ga0373932_0000892 3300035112 Bacteria 8739
423 Ga0373936_0019872 3300035113 Bacteria 2606
424 Ga0373941_0145218 3300035115 Bacteria 866
425 Ga0373953_0022062 3300035117 Bacteria 2396
426 Ga0373953_0203965 3300035117 Bacteria 855
427 Ga0373953_0247432 3300035117 Bacteria 774
428 Ga0373953_0249874 3300035117 Bacteria 771
429 Ga0373954_0041553 3300035118 Bacteria 2144
430 Ga0373956_0002379 3300035119 Bacteria 7684
431 Ga0373956_0020785 3300035119 Bacteria 2797
432 Ga0373956_0078131 3300035119 Bacteria 1516
433 Ga0373957_0048347 3300035120 Bacteria 1620
434 Ga0373943_0038288 3300035170 Bacteria 2305
435 Ga0373955_0019792 3300035172 Bacteria 3370
436 Ga0373955_0195991 3300035172 Bacteria 1202
437 Ga0373955_0246256 3300035172 Bacteria 1071
438 Ga0373955_0278103 3300035172 Bacteria 1007
439 Ga0373955_0279704 3300035172 Bacteria 1004
440 Ga0316574_0307400 3300035398 Bacteria 1008
441 Ga0316574_0930433 3300035398 Bacteria 525
442 Ga0373924_0046997 3300035410 Bacteria 1780
443 Ga0373935_0044888 3300035692 Bacteria 2787
444 Ga0373933_0037442 3300035724 Bacteria 2845
445 Ga0373933_0072052 3300035724 Bacteria 2104
446 Ga0373933_0898410 3300035724 Bacteria 583
447 Ga0373947_0310249 3300035725 Bacteria 1053
448 Ga0373937_0011530 3300036401 Bacteria 7759
449 Ga0373937_0018806 3300036401 Bacteria 6175
450 Ga0373937_0116858 3300036401 Bacteria 2484
451 Ga0373937_0132405 3300036401 Bacteria 2329
452 Ga0373937_0368737 3300036401 Bacteria 1361
453 Ga0373937_0483504 3300036401 Bacteria 1176
454 Ga0316582_0009633 3300036647 Bacteria 5250
455 Ga0316582_0093009 3300036647 Bacteria 1988
456 Ga0316584_0044037 3300036712 Bacteria 3328
457 Ga0316584_0114634 3300036712 Bacteria 2016
458 Ga0316584_0280418 3300036712 Unclassified 1211
459 Ga0316584_0317936 3300036712 Bacteria 1124
460 Ga0316584_0343974 3300036712 Bacteria 1072
461 Ga0395899_0153009 3300037312 Bacteria 1634
462 Ga0395905_1043845 3300037471 Bacteria 720
463 Ga0316581_0195927 3300037588 Bacteria 622
464 Ga0400490_24938 3300038726 Bacteria 1738
465 Ga0400483_229260 3300039062 Bacteria 1781
466 Ga0400489_87136 3300039093 Bacteria 2558
467 Ga0400487_12922 3300039110 Bacteria 1326
468 Ga0436365_0605606 3300039437 Bacteria 64934
469 Ga0436365_0745504 3300039437 Bacteria 1100
470 Ga0436362_0309166 3300039453 Bacteria 15196
471 Ga0451787_518704 3300041441 Bacteria 671
472 Ga0451795_0162296 3300041456 Bacteria 2237
473 Ga0451804_1046854 3300041463 Bacteria 951
474 Ga0451852_31128 3300041508 Unclassified 684
475 Ga0451855_0111700 3300041511 Bacteria 1241
476 Ga0451855_0685541 3300041511 Bacteria 1013
477 Ga0451853_2311330 3300041512 Bacteria 608
478 Ga0439434_0081741 3300042435 Bacteria 1026
479 Ga0439434_0138557 3300042435 Bacteria 801
480 Ga0439434_0218463 3300042435 Bacteria 646
481 Ga0451577_0020815 3300042876 Bacteria 6013
482 Ga0451577_0021214 3300042876 Bacteria 5948
483 Ga0451577_0024271 3300042876 Bacteria 5517
484 Ga0451577_0103544 3300042876 Bacteria 2544
485 Ga0466969_0142709 3300044656 Bacteria 1106
486 Ga0466972_0048700 3300044658 Bacteria 2047
487 Ga0453683_0184982 3300044673 Bacteria 1322
488 Ga0453683_0382406 3300044673 Bacteria 906
489 Ga0453684_0010849 3300044712 Bacteria 15438
490 Ga0453684_0116274 3300044712 Bacteria 3239
491 Ga0453684_0165439 3300044712 Bacteria 2611
492 Ga0451576_0005783 3300045051 Bacteria 15385
493 Ga0451576_0021519 3300045051 Bacteria 7010
494 Ga0451576_0382538 3300045051 Bacteria 1475
495 Ga0451576_0595133 3300045051 Bacteria 1162
496 Ga0451576_0706757 3300045051 Bacteria 1059
497 Ga0451576_0900274 3300045051 Bacteria 928
498 Ga0451576_1318978 3300045051 Bacteria 752
499 Ga0451576_2232852 3300045051 Bacteria 561
500 Ga0495627_141526 3300046453 Bacteria 674
501 Ga0495592_0048815 3300046454 Bacteria 3147
502 Ga0495592_0275824 3300046454 Bacteria 1101
503 Ga0495629_0530198 3300046459 Bacteria 792
504 Ga0495629_0746192 3300046459 Bacteria 648
505 Ga0495651_0124692 3300046462 Bacteria 1887
506 Ga0495653_0132982 3300046463 Bacteria 1758
507 Ga0495582_0291481 3300046473 Bacteria 938
508 Ga0495662_0109503 3300046476 Bacteria 1353
509 Ga0495608_0010081 3300046511 Bacteria 6592
510 Ga0495618_0000743 3300046514 Bacteria 22768
511 Ga0495618_0065314 3300046514 Bacteria 2313
512 Ga0495618_0635888 3300046514 Bacteria 632
513 Ga0495628_0038502 3300046516 Bacteria 3827
514 Ga0495628_0101738 3300046516 Bacteria 2217
515 Ga0495630_0775938 3300046517 Bacteria 732
516 Ga0495630_1364538 3300046517 Bacteria 533
517 Ga0495666_0140166 3300046526 Bacteria 1128
518 Ga0495665_0705069 3300046531 Bacteria 500
519 Ga0495640_0071361 3300046533 Bacteria 2331
520 Ga0495587_0015907 3300046536 Bacteria 4686
521 Ga0495667_0006622 3300046559 Bacteria 7865
522 Ga0495634_0334981 3300046642 Bacteria 909
523 Ga0495634_0441993 3300046642 Bacteria 768
524 Ga0495635_0033708 3300046663 Bacteria 3552
525 Ga0495635_0124070 3300046663 Bacteria 1761
526 Ga0495657_0062591 3300046675 Bacteria 2457
527 Ga0495599_0082939 3300046678 Bacteria 2002
528 Ga0495658_0011409 3300046683 Bacteria 4469
529 Ga0495658_0167078 3300046683 Bacteria 1360
530 Ga0495669_0421559 3300046684 Bacteria 647
531 Ga0495669_0617450 3300046684 Bacteria 527
532 Ga0495670_0015230 3300046691 Bacteria 3781
533 Ga0495600_0027945 3300046809 Bacteria 3648
534 Ga0495581_0096460 3300047315 Bacteria 1717
535 Ga0495604_0677604 3300047317 Bacteria 656
536 Ga0495674_0369381 3300047319 Bacteria 1162
537 Ga0495680_0434824 3300047322 Bacteria 900
538 Ga0495680_0834128 3300047322 Bacteria 600
539 Ga0495675_0058692 3300047444 Bacteria 2439
540 Ga0495684_0292235 3300047471 Bacteria 1173
541 Ga0495684_0737051 3300047471 Bacteria 650
542 Ga0495615_0012508 3300048090 Bacteria 1751
543 Ga0496105_0835958 3300048908 Bacteria 698
544 Ga0496109_1018480 3300048912 Bacteria 766
545 Ga0496113_0141000 3300048916 Bacteria 1897
546 Ga0496113_0408800 3300048916 Bacteria 1090
547 Ga0496115_1028825 3300048918 Bacteria 628
548 Ga0501308_027163 3300049128 Bacteria 751
549 Ga0501307_007917 3300049162 Bacteria 1183
550 Ga0501312_043040 3300049528 Bacteria 743
551 Ga0501317_046332 3300049533 Bacteria 679
552 Ga0501031_0210635 3300049568 Bacteria 1266
553 Ga0501032_0525370 3300049569 Bacteria 755
554 Ga0501033_0280476 3300049570 Bacteria 1176
555 Ga0501033_0892794 3300049570 Bacteria 598
556 Ga0501034_0599636 3300049571 Bacteria 1007
557 Ga0501036_0044160 3300049572 Bacteria 3775
558 Ga0501036_0235815 3300049572 Bacteria 1535
559 Ga0501036_1133746 3300049572 Bacteria 638
560 Ga0501037_0201791 3300049573 Bacteria 1405
561 Ga0501039_0186094 3300049575 Bacteria 1633
562 Ga0501039_1024618 3300049575 Bacteria 641
563 Ga0501040_0531260 3300049576 Bacteria 848
564 Ga0501041_0007558 3300049577 Bacteria 6382
565 Ga0501043_0432547 3300049579 Bacteria 991
566 Ga0501046_0176815 3300049580 Bacteria 1598
567 Ga0501048_0334924 3300049582 Bacteria 1078
568 Ga0501069_0622504 3300049585 Bacteria 649
569 Ga0501070_1033437 3300049586 Bacteria 636
570 Ga0501071_0085167 3300049587 Bacteria 2317
571 Ga0501071_0820900 3300049587 Bacteria 717
572 Ga0501073_0228778 3300049589 Bacteria 1285
573 Ga0501075_0016329 3300049591 Bacteria 5345
574 Ga0501075_0292130 3300049591 Bacteria 1242
575 Ga0501076_0220653 3300049592 Bacteria 1549
576 Ga0501076_1164313 3300049592 Bacteria 635
577 Ga0501077_0091102 3300049593 Bacteria 1932
578 Ga0501238_054121 3300049671 Bacteria 605
579 Ga0501079_0073172 3300049741 Bacteria 2649
580 Ga0501079_0954480 3300049741 Bacteria 675
581 Ga0501080_0151123 3300049742 Bacteria 2146
582 Ga0501081_0080260 3300049743 Bacteria 2283
583 Ga0501045_0103757 3300049824 Bacteria 2106
584 nmdc:mga05p37_122849_c2 3300050507 Bacteria 1685
585 nmdc:mga05p37_122920_c1 3300050507 Bacteria 3188
586 nmdc:mga05p37_145535_c1 3300050507 Bacteria 2902
587 nmdc:mga05p37_681234_c1 3300050507 Bacteria 1146
588 nmdc:mga05p37_69189_c1 3300050507 Bacteria 4342
589 nmdc:mga05p37_929992_c1 3300050507 Bacteria 933
590 nmdc:mga09592_20930_c1 3300050508 Bacteria 5386
591 nmdc:mga09592_2536_c1 3300050508 Bacteria 14783
592 nmdc:mga0qj67_249961_c1 3300050509 Bacteria 1439
593 nmdc:mga0qj67_398697_c1 3300050509 Bacteria 1110
594 nmdc:mga06r32_257390_c1 3300050510 Bacteria 1733
595 nmdc:mga06r32_269558_c1 3300050510 Bacteria 1690
596 nmdc:mga06r32_428015_c1 3300050510 Bacteria 1304
597 nmdc:mga08y16_1109369_c1 3300050511 Bacteria 766
598 nmdc:mga08y16_148621_c1 3300050511 Bacteria 2436
599 nmdc:mga08y16_1871379_c1 3300050511 Bacteria 552
600 nmdc:mga08y16_192941_c1 3300050511 Bacteria 2112
601 nmdc:mga08y16_2039663_c1 3300050511 Bacteria 522
602 nmdc:mga08y16_296_c1 3300050511 Bacteria 44778
603 nmdc:mga08y16_52626_c1 3300050511 Bacteria 4259
604 nmdc:mga08y16_560141_c1 3300050511 Bacteria 1156
605 nmdc:mga0n895_1167423_c1 3300050512 Bacteria 745
606 nmdc:mga0n895_547849_c1 3300050512 Bacteria 1163
607 nmdc:mga0n895_6816_c1 3300050512 Bacteria 9752
608 nmdc:mga0n895_94929_c1 3300050512 Bacteria 2987
609 nmdc:mga0n895_952059_c1 3300050512 Bacteria 842
610 nmdc:mga0n895_978469_c1 3300050512 Bacteria 828
611 nmdc:mga0rr50_155917_c1 3300050513 Bacteria 1849
612 nmdc:mga0rr50_161_c1 3300050513 Bacteria 36290
613 nmdc:mga0rr50_293289_c1 3300050513 Bacteria 1359
614 nmdc:mga0rr50_302456_c1 3300050513 Bacteria 1338
615 nmdc:mga0rr50_8536_c1 3300050513 Bacteria 6382
616 nmdc:mga08x19_12478_c1 3300050514 Bacteria 5121
617 nmdc:mga08x19_164879_c1 3300050514 Bacteria 1506
618 nmdc:mga08x19_458603_c1 3300050514 Bacteria 897
619 nmdc:mga08x19_70185_c1 3300050514 Bacteria 2282
620 nmdc:mga0a205_48594_c1 3300050515 Bacteria 4095
621 nmdc:mga0a205_799934_c1 3300050515 Bacteria 791
622 Ga0495595_0002299 3300053084 Bacteria 7449
623 Ga0495619_0156748 3300053085 Bacteria 1571
624 Ga0495619_0300763 3300053085 Bacteria 1111
625 Ga0501084_0182708 3300054114 Bacteria 1770
626 Ga0501084_1290496 3300054114 Bacteria 612
627 Ga0590071_000996 3300059421 Bacteria 7735
628 Ga0590074_089481 3300059423 Bacteria 594
629 Ga0590075_014748 3300059424 Bacteria 1912
630 Ga0590077_006869 3300059426 Bacteria 2331
631 Ga0587070_136153 3300059491 Bacteria 602
632 Ga0587077_056032 3300059493 Bacteria 840
633 Ga0587062_030255 3300059639 Bacteria 825
634 Ga0587072_137844 3300059643 Bacteria 580
635 Ga0587110_039101 3300059654 Bacteria 604
636 Ga0501082_0022686 3300060353 Bacteria 5405
637 Ga0501082_0777342 3300060353 Bacteria 838
638 Ga0530510_0103782 3300061734 Bacteria 2079
639 Ga0530510_1112046 3300061734 Bacteria 605

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004803 Ga0058862_10098853 Ga0058862_100988531 110
2 3300009094 Ga0111539_10000254 Ga0111539_1000025438 112
3 3300046459 Ga0495629_0530198 Ga0495629_0530198_401_757 112
4 3300047317 Ga0495604_0677604 Ga0495604_0677604_12_368 112
5 3300011119 Ga0105246_10340070 Ga0105246_103400702 113
6 3300032168 Ga0316593_10002170 Ga0316593_100021706 113
7 3300005539 Ga0068853_102207801 Ga0068853_1022078011 114
8 3300005549 Ga0070704_100358563 Ga0070704_1003585632 115
9 3300046684 Ga0495669_0617450 Ga0495669_0617450_68_493 116
10 3300048912 Ga0496109_1018480 Ga0496109_1018480_232_678 118
11 3300032168 Ga0316593_10003594 Ga0316593_100035945 120
12 3300044658 Ga0466972_0048700 Ga0466972_0048700_152_595 120
13 3300049671 Ga0501238_054121 Ga0501238_054121_120_563 120
14 3300009177 Ga0105248_11656144 Ga0105248_116561441 122
15 3300035117 Ga0373953_0249874 Ga0373953_0249874_304_729 123
16 3300046476 Ga0495662_0109503 Ga0495662_0109503_275_700 124
17 3300005459 Ga0068867_100760756 Ga0068867_1007607561 125
18 3300031235 Ga0265330_10022116 Ga0265330_100221167 125
19 3300033541 Ga0316596_1156428 Ga0316596_11564281 125
20 3300035117 Ga0373953_0247432 Ga0373953_0247432_358_759 125
21 3300035119 Ga0373956_0078131 Ga0373956_0078131_19_420 125
22 3300046531 Ga0495665_0705069 Ga0495665_0705069_26_427 125
23 3300005471 Ga0070698_100289130 Ga0070698_1002891303 127
24 3300005545 Ga0070695_100031080 Ga0070695_1000310805 127
25 3300046516 Ga0495628_0101738 Ga0495628_0101738_11_412 127
26 3300049592 Ga0501076_1164313 Ga0501076_1164313_217_621 127
27 3300050513 nmdc:mga0rr50_155917_c1 nmdc:mga0rr50_155917_c1_1047_1448 127
28 3300004800 Ga0058861_11795149 Ga0058861_117951491 128
29 3300005333 Ga0070677_10204613 Ga0070677_102046132 128
30 3300005367 Ga0070667_101483196 Ga0070667_1014831961 128
31 3300005438 Ga0070701_11107334 Ga0070701_111073341 128
32 3300005444 Ga0070694_100086832 Ga0070694_1000868321 128
33 3300005444 Ga0070694_100944466 Ga0070694_1009444661 128
34 3300005456 Ga0070678_100603764 Ga0070678_1006037642 128
35 3300005719 Ga0068861_100260811 Ga0068861_1002608112 128
36 3300006051 Ga0075364_10020198 Ga0075364_100201985 128
37 3300006177 Ga0075362_10012980 Ga0075362_100129805 128
38 3300006844 Ga0075428_100839747 Ga0075428_1008397472 128
39 3300006852 Ga0075433_11042784 Ga0075433_110427841 128
40 3300009094 Ga0111539_10066486 Ga0111539_100664866 128
41 3300009147 Ga0114129_10001925 Ga0114129_100019255 128
42 3300009147 Ga0114129_10037064 Ga0114129_1003706411 128
43 3300009148 Ga0105243_11019192 Ga0105243_110191922 128
44 3300025913 Ga0207695_10157699 Ga0207695_101576992 128
45 3300025933 Ga0207706_11219705 Ga0207706_112197051 128
46 3300026118 Ga0207675_100861274 Ga0207675_1008612742 128
47 3300031911 Ga0307412_10106226 Ga0307412_101062261 128
48 3300032002 Ga0307416_100016235 Ga0307416_1000162355 128
49 3300035172 Ga0373955_0279704 Ga0373955_0279704_12_416 128
50 3300042876 Ga0451577_0020815 Ga0451577_0020815_5362_5766 128
51 3300045051 Ga0451576_0021519 Ga0451576_0021519_5343_5747 128
52 3300045051 Ga0451576_2232852 Ga0451576_2232852_18_422 128
53 3300046473 Ga0495582_0291481 Ga0495582_0291481_281_685 128
54 3300046514 Ga0495618_0000743 Ga0495618_0000743_21038_21442 128
55 3300046663 Ga0495635_0033708 Ga0495635_0033708_90_494 128
56 3300047322 Ga0495680_0834128 Ga0495680_0834128_10_414 128
57 3300050507 nmdc:mga05p37_69189_c1 nmdc:mga05p37_69189_c1_2726_3130 128
58 3300050511 nmdc:mga08y16_1871379_c1 nmdc:mga08y16_1871379_c1_14_418 128
59 3300050511 nmdc:mga08y16_52626_c1 nmdc:mga08y16_52626_c1_808_1212 128
60 3300050512 nmdc:mga0n895_6816_c1 nmdc:mga0n895_6816_c1_1405_1809 128
61 3300050513 nmdc:mga0rr50_302456_c1 nmdc:mga0rr50_302456_c1_193_597 128
62 3300050515 nmdc:mga0a205_48594_c1 nmdc:mga0a205_48594_c1_2395_2799 128
63 3300053085 Ga0495619_0300763 Ga0495619_0300763_189_593 128
64 3300059421 Ga0590071_000996 Ga0590071_000996_125_529 128
65 3300059423 Ga0590074_089481 Ga0590074_089481_104_508 128
66 3300059424 Ga0590075_014748 Ga0590075_014748_1381_1785 128
67 3300059426 Ga0590077_006869 Ga0590077_006869_1865_2269 128
68 3300060353 Ga0501082_0777342 Ga0501082_0777342_23_427 128
69 3300061734 Ga0530510_1112046 Ga0530510_1112046_189_593 128
70 3300003371 JGI26145J50221_1033850 JGI26145J50221_10338501 129
71 3300005406 Ga0070703_10586165 Ga0070703_105861651 129
72 3300005530 Ga0070679_101472261 Ga0070679_1014722611 129
73 3300005548 Ga0070665_101768127 Ga0070665_1017681272 129
74 3300005564 Ga0070664_100151761 Ga0070664_1001517613 129
75 3300026041 Ga0207639_10618394 Ga0207639_106183941 129
76 3300026075 Ga0207708_10274129 Ga0207708_102741292 129
77 3300026088 Ga0207641_10360078 Ga0207641_103600782 129
78 3300026116 Ga0207674_10146828 Ga0207674_101468282 129
79 3300027665 Ga0209983_1051038 Ga0209983_10510382 129
80 3300027876 Ga0209974_10007726 Ga0209974_100077265 129
81 3300032002 Ga0307416_100201671 Ga0307416_1002016713 129
82 3300033524 Ga0316592_1034995 Ga0316592_10349952 129
83 3300033541 Ga0316596_1018195 Ga0316596_10181952 129
84 3300037471 Ga0395905_1043845 Ga0395905_1043845_95_520 129
85 3300048908 Ga0496105_0835958 Ga0496105_0835958_129_554 129
86 3300048916 Ga0496113_0141000 Ga0496113_0141000_701_1126 129
87 iso_pu_bacteria 2523533628 2524003000 131
88 iso_pu_bacteria 2554235469 2556065811 131
89 iso_pu_bacteria 2711768088 2712198851 131
90 iso_pu_bacteria 8007371054 8007374829 131
91 3300031456 Ga0307513_10918868 Ga0307513_109188681 132
92 3300048090 Ga0495615_0012508 Ga0495615_0012508_1252_1695 132
93 3300049162 Ga0501307_007917 Ga0501307_007917_401_823 132
94 3300005435 Ga0070714_100205774 Ga0070714_1002057742 133
95 3300025929 Ga0207664_10348206 Ga0207664_103482062 133
96 3300041441 Ga0451787_518704 Ga0451787_518704_186_626 133
97 3300041463 Ga0451804_1046854 Ga0451804_1046854_364_804 133
98 3300041512 Ga0451853_2311330 Ga0451853_2311330_84_524 133
99 3300049128 Ga0501308_027163 Ga0501308_027163_178_618 133
100 3300049533 Ga0501317_046332 Ga0501317_046332_176_616 133
101 3300059639 Ga0587062_030255 Ga0587062_030255_134_574 133
102 3300003373 JGI25407J50210_10004185 JGI25407J50210_100041855 134
103 3300005340 Ga0070689_100004116 Ga0070689_1000041162 134
104 3300005367 Ga0070667_100787605 Ga0070667_1007876052 134
105 3300005367 Ga0070667_101564654 Ga0070667_1015646541 134
106 3300005437 Ga0070710_11097853 Ga0070710_110978531 134
107 3300005444 Ga0070694_100136870 Ga0070694_1001368702 134
108 3300005445 Ga0070708_100520867 Ga0070708_1005208672 134
109 3300005445 Ga0070708_101140576 Ga0070708_1011405761 134
110 3300005456 Ga0070678_100364847 Ga0070678_1003648472 134
111 3300005467 Ga0070706_100024463 Ga0070706_1000244634 134
112 3300005467 Ga0070706_100042452 Ga0070706_1000424525 134
113 3300005468 Ga0070707_100057767 Ga0070707_1000577672 134
114 3300005471 Ga0070698_100981819 Ga0070698_1009818192 134
115 3300005518 Ga0070699_100042737 Ga0070699_1000427372 134
116 3300005518 Ga0070699_101311615 Ga0070699_1013116151 134
117 3300005536 Ga0070697_100141520 Ga0070697_1001415201 134
118 3300005536 Ga0070697_100159513 Ga0070697_1001595133 134
119 3300005536 Ga0070697_100242721 Ga0070697_1002427212 134
120 3300005539 Ga0068853_100854765 Ga0068853_1008547652 134
121 3300005543 Ga0070672_100000645 Ga0070672_1000006455 134
122 3300005545 Ga0070695_100006106 Ga0070695_1000061066 134
123 3300005618 Ga0068864_100000025 Ga0068864_100000025241 134
124 3300005841 Ga0068863_100856962 Ga0068863_1008569622 134
125 3300005842 Ga0068858_100000126 Ga0068858_10000012679 134
126 3300005981 Ga0081538_10001550 Ga0081538_1000155013 134
127 3300005981 Ga0081538_10002952 Ga0081538_1000295212 134
128 3300005981 Ga0081538_10005210 Ga0081538_100052109 134
129 3300005981 Ga0081538_10012332 Ga0081538_1001233212 134
130 3300005981 Ga0081538_10018001 Ga0081538_100180014 134
131 3300005981 Ga0081538_10019455 Ga0081538_100194553 134
132 3300006173 Ga0070716_101489893 Ga0070716_1014898932 134
133 3300006871 Ga0075434_100172980 Ga0075434_1001729804 134
134 3300006881 Ga0068865_100792684 Ga0068865_1007926842 134
135 3300006914 Ga0075436_100015219 Ga0075436_1000152193 134
136 3300007076 Ga0075435_100019811 Ga0075435_1000198115 134
137 3300009094 Ga0111539_10051057 Ga0111539_100510575 134
138 3300009094 Ga0111539_11000809 Ga0111539_110008092 134
139 3300009098 Ga0105245_10003274 Ga0105245_1000327413 134
140 3300009147 Ga0114129_10441641 Ga0114129_104416413 134
141 3300009177 Ga0105248_10306898 Ga0105248_103068981 134
142 3300013297 Ga0157378_10190755 Ga0157378_101907556 134
143 3300013297 Ga0157378_11308407 Ga0157378_113084071 134
144 3300013308 Ga0157375_10001186 Ga0157375_100011867 134
145 3300014326 Ga0157380_10023433 Ga0157380_100234335 134
146 3300014745 Ga0157377_10311529 Ga0157377_103115292 134
147 3300025899 Ga0207642_10216726 Ga0207642_102167261 134
148 3300025910 Ga0207684_10028407 Ga0207684_1002840710 134
149 3300025920 Ga0207649_11305117 Ga0207649_113051171 134
150 3300025922 Ga0207646_10051275 Ga0207646_100512755 134
151 3300025927 Ga0207687_10002004 Ga0207687_100020044 134
152 3300025936 Ga0207670_10001935 Ga0207670_100019355 134
153 3300025938 Ga0207704_10745347 Ga0207704_107453472 134
154 3300025940 Ga0207691_10002381 Ga0207691_1000238114 134
155 3300025941 Ga0207711_10113179 Ga0207711_101131792 134
156 3300026035 Ga0207703_10000653 Ga0207703_100006537 134
157 3300026035 Ga0207703_11086094 Ga0207703_110860941 134
158 3300026089 Ga0207648_10166559 Ga0207648_101665591 134
159 3300026095 Ga0207676_10000002 Ga0207676_100000021073 134
160 3300031665 Ga0316575_10011870 Ga0316575_100118703 134
161 3300031691 Ga0316579_10002337 Ga0316579_100023373 134
162 3300031727 Ga0316576_10077995 Ga0316576_100779955 134
163 3300031727 Ga0316576_10203206 Ga0316576_102032062 134
164 3300031727 Ga0316576_10967833 Ga0316576_109678331 134
165 3300031728 Ga0316578_10070350 Ga0316578_100703502 134
166 3300031728 Ga0316578_10350764 Ga0316578_103507642 134
167 3300031733 Ga0316577_10040071 Ga0316577_100400715 134
168 3300031733 Ga0316577_10311058 Ga0316577_103110582 134
169 3300031824 Ga0307413_10770933 Ga0307413_107709332 134
170 3300031903 Ga0307407_10296565 Ga0307407_102965652 134
171 3300031995 Ga0307409_101317614 Ga0307409_1013176142 134
172 3300032002 Ga0307416_100053927 Ga0307416_1000539273 134
173 3300032005 Ga0307411_10428838 Ga0307411_104288382 134
174 3300032133 Ga0316583_10156928 Ga0316583_101569282 134
175 3300032137 Ga0316585_10053256 Ga0316585_100532563 134
176 3300032139 Ga0316580_10039922 Ga0316580_100399222 134
177 3300032168 Ga0316593_10004215 Ga0316593_100042156 134
178 3300032168 Ga0316593_10010852 Ga0316593_100108521 134
179 3300032168 Ga0316593_10020465 Ga0316593_100204653 134
180 3300032168 Ga0316593_10023609 Ga0316593_100236093 134
181 3300032168 Ga0316593_10027077 Ga0316593_100270772 134
182 3300033529 Ga0316587_1097974 Ga0316587_10979741 134
183 3300033541 Ga0316596_1002322 Ga0316596_10023224 134
184 3300033541 Ga0316596_1002914 Ga0316596_10029144 134
185 3300033541 Ga0316596_1005115 Ga0316596_10051155 134
186 3300035398 Ga0316574_0930433 Ga0316574_0930433_24_446 134
187 3300036647 Ga0316582_0009633 Ga0316582_0009633_4290_4712 134
188 3300036712 Ga0316584_0044037 Ga0316584_0044037_2359_2781 134
189 3300036712 Ga0316584_0114634 Ga0316584_0114634_643_1065 134
190 3300036712 Ga0316584_0280418 Ga0316584_0280418_349_771 134
191 3300036712 Ga0316584_0317936 Ga0316584_0317936_397_819 134
192 3300039093 Ga0400489_87136 Ga0400489_87136_965_1387 134
193 3300039110 Ga0400487_12922 Ga0400487_12922_732_1154 134
194 3300039437 Ga0436365_0745504 Ga0436365_0745504_643_1065 134
195 3300048918 Ga0496115_1028825 Ga0496115_1028825_34_456 134
196 3300049528 Ga0501312_043040 Ga0501312_043040_278_706 134
197 3300049589 Ga0501073_0228778 Ga0501073_0228778_223_645 134
198 3300050507 nmdc:mga05p37_145535_c1 nmdc:mga05p37_145535_c1_2408_2830 134
199 3300050511 nmdc:mga08y16_1109369_c1 nmdc:mga08y16_1109369_c1_198_620 134
200 3300050511 nmdc:mga08y16_192941_c1 nmdc:mga08y16_192941_c1_644_1066 134
201 3300050513 nmdc:mga0rr50_161_c1 nmdc:mga0rr50_161_c1_6125_6547 134
202 3300050514 nmdc:mga08x19_12478_c1 nmdc:mga08x19_12478_c1_3947_4369 134
203 3300001991 JGI24743J22301_10028884 JGI24743J22301_100288841 135
204 3300002459 JGI24751J29686_10121017 JGI24751J29686_101210171 135
205 3300004785 Ga0058858_1299979 Ga0058858_12999791 135
206 3300004798 Ga0058859_10054700 Ga0058859_100547003 135
207 3300004798 Ga0058859_10108115 Ga0058859_101081152 135
208 3300004798 Ga0058859_10131413 Ga0058859_101314132 135
209 3300004798 Ga0058859_11564291 Ga0058859_115642911 135
210 3300004801 Ga0058860_10195543 Ga0058860_101955431 135
211 3300004803 Ga0058862_12700650 Ga0058862_127006501 135
212 3300005293 Ga0065715_10179465 Ga0065715_101794653 135
213 3300005295 Ga0065707_10598467 Ga0065707_105984671 135
214 3300005327 Ga0070658_10020602 Ga0070658_1002060210 135
215 3300005329 Ga0070683_100000118 Ga0070683_10000011833 135
216 3300005330 Ga0070690_100028743 Ga0070690_1000287435 135
217 3300005330 Ga0070690_100619142 Ga0070690_1006191421 135
218 3300005330 Ga0070690_100917987 Ga0070690_1009179871 135
219 3300005331 Ga0070670_100005117 Ga0070670_10000511717 135
220 3300005331 Ga0070670_100136162 Ga0070670_1001361624 135
221 3300005331 Ga0070670_100212412 Ga0070670_1002124122 135
222 3300005334 Ga0068869_100144565 Ga0068869_1001445655 135
223 3300005334 Ga0068869_101541980 Ga0068869_1015419801 135
224 3300005336 Ga0070680_101076595 Ga0070680_1010765951 135
225 3300005336 Ga0070680_101211617 Ga0070680_1012116172 135
226 3300005337 Ga0070682_100000004 Ga0070682_1000000049 135
227 3300005337 Ga0070682_100287714 Ga0070682_1002877141 135
228 3300005338 Ga0068868_100000927 Ga0068868_10000092724 135
229 3300005340 Ga0070689_100002507 Ga0070689_1000025078 135
230 3300005340 Ga0070689_100074023 Ga0070689_1000740232 135
231 3300005340 Ga0070689_100162060 Ga0070689_1001620603 135
232 3300005340 Ga0070689_100166284 Ga0070689_1001662843 135
233 3300005343 Ga0070687_100039402 Ga0070687_1000394026 135
234 3300005343 Ga0070687_100124434 Ga0070687_1001244342 135
235 3300005344 Ga0070661_101280450 Ga0070661_1012804501 135
236 3300005345 Ga0070692_10159911 Ga0070692_101599112 135
237 3300005353 Ga0070669_100440231 Ga0070669_1004402312 135
238 3300005354 Ga0070675_100003283 Ga0070675_10000328315 135
239 3300005355 Ga0070671_100497651 Ga0070671_1004976512 135
240 3300005355 Ga0070671_100768595 Ga0070671_1007685951 135
241 3300005365 Ga0070688_100069163 Ga0070688_1000691634 135
242 3300005365 Ga0070688_100084260 Ga0070688_1000842605 135
243 3300005365 Ga0070688_100146702 Ga0070688_1001467022 135
244 3300005365 Ga0070688_101334019 Ga0070688_1013340191 135
245 3300005367 Ga0070667_101365343 Ga0070667_1013653432 135
246 3300005406 Ga0070703_10165314 Ga0070703_101653142 135
247 3300005436 Ga0070713_100020740 Ga0070713_10002074010 135
248 3300005439 Ga0070711_100016016 Ga0070711_1000160165 135
249 3300005440 Ga0070705_101054307 Ga0070705_1010543071 135
250 3300005441 Ga0070700_100125572 Ga0070700_1001255721 135
251 3300005441 Ga0070700_100312930 Ga0070700_1003129301 135
252 3300005441 Ga0070700_101938246 Ga0070700_1019382461 135
253 3300005444 Ga0070694_101354336 Ga0070694_1013543361 135
254 3300005445 Ga0070708_100043823 Ga0070708_1000438235 135
255 3300005466 Ga0070685_10006013 Ga0070685_100060133 135
256 3300005467 Ga0070706_100174116 Ga0070706_1001741162 135
257 3300005467 Ga0070706_100980556 Ga0070706_1009805561 135
258 3300005468 Ga0070707_100298445 Ga0070707_1002984452 135
259 3300005468 Ga0070707_100500589 Ga0070707_1005005891 135
260 3300005468 Ga0070707_101366960 Ga0070707_1013669601 135
261 3300005518 Ga0070699_100245148 Ga0070699_1002451482 135
262 3300005535 Ga0070684_100004380 Ga0070684_1000043805 135
263 3300005536 Ga0070697_100430910 Ga0070697_1004309101 135
264 3300005544 Ga0070686_100015810 Ga0070686_1000158104 135
265 3300005544 Ga0070686_100123070 Ga0070686_1001230705 135
266 3300005544 Ga0070686_100618046 Ga0070686_1006180462 135
267 3300005544 Ga0070686_101441635 Ga0070686_1014416351 135
268 3300005545 Ga0070695_100151664 Ga0070695_1001516643 135
269 3300005547 Ga0070693_100079597 Ga0070693_1000795972 135
270 3300005549 Ga0070704_100045604 Ga0070704_1000456046 135
271 3300005549 Ga0070704_100175096 Ga0070704_1001750962 135
272 3300005549 Ga0070704_100210687 Ga0070704_1002106872 135
273 3300005549 Ga0070704_100214293 Ga0070704_1002142933 135
274 3300005549 Ga0070704_100319935 Ga0070704_1003199351 135
275 3300005577 Ga0068857_100085364 Ga0068857_1000853642 135
276 3300005577 Ga0068857_100415904 Ga0068857_1004159042 135
277 3300005577 Ga0068857_101363645 Ga0068857_1013636452 135
278 3300005615 Ga0070702_100087415 Ga0070702_1000874152 135
279 3300005615 Ga0070702_100159474 Ga0070702_1001594744 135
280 3300005615 Ga0070702_100271565 Ga0070702_1002715652 135
281 3300005615 Ga0070702_101355050 Ga0070702_1013550501 135
282 3300005617 Ga0068859_100096765 Ga0068859_1000967652 135
283 3300005617 Ga0068859_100944974 Ga0068859_1009449742 135
284 3300005617 Ga0068859_101334740 Ga0068859_1013347402 135
285 3300005618 Ga0068864_100118935 Ga0068864_1001189354 135
286 3300005618 Ga0068864_100178104 Ga0068864_1001781042 135
287 3300005618 Ga0068864_100683246 Ga0068864_1006832461 135
288 3300005719 Ga0068861_100085703 Ga0068861_1000857035 135
289 3300005840 Ga0068870_10069881 Ga0068870_100698815 135
290 3300005840 Ga0068870_10134631 Ga0068870_101346313 135
291 3300005841 Ga0068863_100059485 Ga0068863_1000594856 135
292 3300005841 Ga0068863_100422201 Ga0068863_1004222013 135
293 3300005842 Ga0068858_100945023 Ga0068858_1009450232 135
294 3300005843 Ga0068860_100237940 Ga0068860_1002379403 135
295 3300005843 Ga0068860_100773714 Ga0068860_1007737142 135
296 3300005843 Ga0068860_100800955 Ga0068860_1008009552 135
297 3300005844 Ga0068862_100771770 Ga0068862_1007717701 135
298 3300005981 Ga0081538_10271366 Ga0081538_102713662 135
299 3300006028 Ga0070717_10000358 Ga0070717_1000035827 135
300 3300006058 Ga0075432_10039752 Ga0075432_100397521 135
301 3300006163 Ga0070715_10182770 Ga0070715_101827702 135
302 3300006173 Ga0070716_100562939 Ga0070716_1005629392 135
303 3300006358 Ga0068871_100883353 Ga0068871_1008833532 135
304 3300006844 Ga0075428_100031483 Ga0075428_1000314836 135
305 3300006844 Ga0075428_100205418 Ga0075428_1002054182 135
306 3300006844 Ga0075428_100275866 Ga0075428_1002758662 135
307 3300006844 Ga0075428_100438204 Ga0075428_1004382042 135
308 3300006844 Ga0075428_100450526 Ga0075428_1004505262 135
309 3300006846 Ga0075430_100093180 Ga0075430_1000931803 135
310 3300006846 Ga0075430_100787156 Ga0075430_1007871562 135
311 3300006846 Ga0075430_100972839 Ga0075430_1009728391 135
312 3300006852 Ga0075433_10033580 Ga0075433_100335806 135
313 3300006852 Ga0075433_10311866 Ga0075433_103118662 135
314 3300006852 Ga0075433_10375920 Ga0075433_103759202 135
315 3300006852 Ga0075433_11233138 Ga0075433_112331381 135
316 3300006871 Ga0075434_100044962 Ga0075434_1000449626 135
317 3300006871 Ga0075434_100218166 Ga0075434_1002181662 135
318 3300006871 Ga0075434_100426703 Ga0075434_1004267032 135
319 3300006871 Ga0075434_100557290 Ga0075434_1005572902 135
320 3300006871 Ga0075434_101240785 Ga0075434_1012407852 135
321 3300006871 Ga0075434_101465951 Ga0075434_1014659512 135
322 3300006880 Ga0075429_100074346 Ga0075429_1000743465 135
323 3300006880 Ga0075429_100236303 Ga0075429_1002363033 135
324 3300006880 Ga0075429_100387597 Ga0075429_1003875973 135
325 3300006914 Ga0075436_100595619 Ga0075436_1005956192 135
326 3300006931 Ga0097620_100096764 Ga0097620_1000967642 135
327 3300006931 Ga0097620_100945002 Ga0097620_1009450022 135
328 3300006931 Ga0097620_101334672 Ga0097620_1013346722 135
329 3300007076 Ga0075435_100024698 Ga0075435_1000246986 135
330 3300007076 Ga0075435_100129015 Ga0075435_1001290152 135
331 3300007788 Ga0099795_10127105 Ga0099795_101271052 135
332 3300007788 Ga0099795_10216423 Ga0099795_102164231 135
333 3300009094 Ga0111539_10166012 Ga0111539_101660123 135
334 3300009094 Ga0111539_11295652 Ga0111539_112956521 135
335 3300009094 Ga0111539_13044178 Ga0111539_130441781 135
336 3300009098 Ga0105245_10002811 Ga0105245_100028115 135
337 3300009098 Ga0105245_10687991 Ga0105245_106879912 135
338 3300009101 Ga0105247_10027881 Ga0105247_100278815 135
339 3300009147 Ga0114129_10063727 Ga0114129_100637275 135
340 3300009147 Ga0114129_10242045 Ga0114129_102420455 135
341 3300009147 Ga0114129_10307432 Ga0114129_103074323 135
342 3300009147 Ga0114129_10924990 Ga0114129_109249902 135
343 3300009148 Ga0105243_10187817 Ga0105243_101878174 135
344 3300009176 Ga0105242_10907429 Ga0105242_109074292 135
345 3300009545 Ga0105237_10512613 Ga0105237_105126132 135
346 3300009545 Ga0105237_10969923 Ga0105237_109699232 135
347 3300009551 Ga0105238_10000002 Ga0105238_10000002368 135
348 3300009553 Ga0105249_10101204 Ga0105249_101012042 135
349 3300013105 Ga0157369_10000363 Ga0157369_100003637 135
350 3300013296 Ga0157374_10000016 Ga0157374_1000001643 135
351 3300013297 Ga0157378_10094801 Ga0157378_100948012 135
352 3300013297 Ga0157378_10214534 Ga0157378_102145344 135
353 3300013297 Ga0157378_10528396 Ga0157378_105283963 135
354 3300013306 Ga0163162_10086032 Ga0163162_100860323 135
355 3300013307 Ga0157372_12109992 Ga0157372_121099922 135
356 3300013308 Ga0157375_10004506 Ga0157375_1000450618 135
357 3300013308 Ga0157375_10061602 Ga0157375_100616024 135
358 3300013308 Ga0157375_10062738 Ga0157375_100627385 135
359 3300014325 Ga0163163_10274144 Ga0163163_102741442 135
360 3300014325 Ga0163163_10284597 Ga0163163_102845971 135
361 3300014326 Ga0157380_10944054 Ga0157380_109440541 135
362 3300014745 Ga0157377_10000026 Ga0157377_100000262 135
363 3300014745 Ga0157377_10000370 Ga0157377_100003706 135
364 3300014968 Ga0157379_10267528 Ga0157379_102675281 135
365 3300014969 Ga0157376_10000018 Ga0157376_1000001823 135
366 3300021384 Ga0213876_10000009 Ga0213876_1000000981 135
367 3300025271 Ga0207666_1056695 Ga0207666_10566951 135
368 3300025885 Ga0207653_10134987 Ga0207653_101349872 135
369 3300025885 Ga0207653_10250572 Ga0207653_102505722 135
370 3300025905 Ga0207685_10025056 Ga0207685_100250566 135
371 3300025908 Ga0207643_10063001 Ga0207643_100630014 135
372 3300025909 Ga0207705_10037305 Ga0207705_100373052 135
373 3300025910 Ga0207684_10569815 Ga0207684_105698152 135
374 3300025910 Ga0207684_10853056 Ga0207684_108530561 135
375 3300025912 Ga0207707_10936340 Ga0207707_109363402 135
376 3300025918 Ga0207662_10001242 Ga0207662_100012426 135
377 3300025918 Ga0207662_10170677 Ga0207662_101706772 135
378 3300025922 Ga0207646_10185373 Ga0207646_101853732 135
379 3300025923 Ga0207681_11511968 Ga0207681_115119681 135
380 3300025924 Ga0207694_10000001 Ga0207694_10000001369 135
381 3300025925 Ga0207650_10001851 Ga0207650_1000185113 135
382 3300025925 Ga0207650_10040019 Ga0207650_100400192 135
383 3300025927 Ga0207687_10000009 Ga0207687_10000009181 135
384 3300025927 Ga0207687_10306291 Ga0207687_103062912 135
385 3300025928 Ga0207700_10014828 Ga0207700_100148285 135
386 3300025936 Ga0207670_10003762 Ga0207670_100037621 135
387 3300025936 Ga0207670_10032517 Ga0207670_100325173 135
388 3300025936 Ga0207670_10058309 Ga0207670_100583091 135
389 3300025939 Ga0207665_10473843 Ga0207665_104738432 135
390 3300025941 Ga0207711_10097299 Ga0207711_100972994 135
391 3300025942 Ga0207689_10067295 Ga0207689_100672951 135
392 3300025944 Ga0207661_10000015 Ga0207661_10000015217 135
393 3300025960 Ga0207651_10110630 Ga0207651_101106302 135
394 3300025981 Ga0207640_10182284 Ga0207640_101822842 135
395 3300026023 Ga0207677_10000017 Ga0207677_10000017128 135
396 3300026035 Ga0207703_11384905 Ga0207703_113849051 135
397 3300026041 Ga0207639_10354827 Ga0207639_103548273 135
398 3300026075 Ga0207708_10117850 Ga0207708_101178504 135
399 3300026075 Ga0207708_10621444 Ga0207708_106214441 135
400 3300026075 Ga0207708_11373612 Ga0207708_113736121 135
401 3300026088 Ga0207641_10046806 Ga0207641_100468066 135
402 3300026088 Ga0207641_10248171 Ga0207641_102481712 135
403 3300026095 Ga0207676_10076472 Ga0207676_100764726 135
404 3300026095 Ga0207676_10134261 Ga0207676_101342614 135
405 3300026116 Ga0207674_10029202 Ga0207674_100292025 135
406 3300026118 Ga0207675_100014908 Ga0207675_1000149085 135
407 3300026118 Ga0207675_100046541 Ga0207675_1000465412 135
408 3300026118 Ga0207675_100267296 Ga0207675_1002672962 135
409 3300027252 Ga0209973_1006677 Ga0209973_10066772 135
410 3300027424 Ga0209984_1018238 Ga0209984_10182382 135
411 3300027614 Ga0209970_1005151 Ga0209970_10051512 135
412 3300027665 Ga0209983_1001726 Ga0209983_10017262 135
413 3300027682 Ga0209971_1065664 Ga0209971_10656642 135
414 3300027876 Ga0209974_10015791 Ga0209974_100157916 135
415 3300027907 Ga0207428_10032114 Ga0207428_100321146 135
416 3300027907 Ga0207428_10039117 Ga0207428_100391175 135
417 3300027907 Ga0207428_10162506 Ga0207428_101625063 135
418 3300028380 Ga0268265_10661570 Ga0268265_106615702 135
419 3300028380 Ga0268265_12207380 Ga0268265_122073801 135
420 3300028381 Ga0268264_10345792 Ga0268264_103457922 135
421 3300028381 Ga0268264_11288247 Ga0268264_112882472 135
422 3300028556 Ga0265337_1001292 Ga0265337_10012926 135
423 3300028556 Ga0265337_1019126 Ga0265337_10191263 135
424 3300028556 Ga0265337_1084813 Ga0265337_10848132 135
425 3300028558 Ga0265326_10001534 Ga0265326_100015347 135
426 3300028558 Ga0265326_10020830 Ga0265326_100208301 135
427 3300028563 Ga0265319_1000077 Ga0265319_100007728 135
428 3300028563 Ga0265319_1000371 Ga0265319_100037140 135
429 3300028563 Ga0265319_1044267 Ga0265319_10442672 135
430 3300028573 Ga0265334_10000696 Ga0265334_1000069610 135
431 3300028573 Ga0265334_10004850 Ga0265334_100048505 135
432 3300028573 Ga0265334_10124182 Ga0265334_101241822 135
433 3300028573 Ga0265334_10237244 Ga0265334_102372441 135
434 3300028577 Ga0265318_10002615 Ga0265318_1000261512 135
435 3300028653 Ga0265323_10000672 Ga0265323_1000067214 135
436 3300028654 Ga0265322_10000375 Ga0265322_100003755 135
437 3300028654 Ga0265322_10007514 Ga0265322_100075142 135
438 3300028666 Ga0265336_10000066 Ga0265336_1000006655 135
439 3300028800 Ga0265338_10013819 Ga0265338_100138198 135
440 3300028800 Ga0265338_10024383 Ga0265338_100243836 135
441 3300028800 Ga0265338_10026142 Ga0265338_100261425 135
442 3300028800 Ga0265338_10029761 Ga0265338_100297616 135
443 3300028800 Ga0265338_10062691 Ga0265338_100626913 135
444 3300028800 Ga0265338_10071531 Ga0265338_100715312 135
445 3300029957 Ga0265324_10000243 Ga0265324_1000024324 135
446 3300029957 Ga0265324_10002496 Ga0265324_100024966 135
447 3300029957 Ga0265324_10020439 Ga0265324_100204392 135
448 3300029957 Ga0265324_10143898 Ga0265324_101438982 135
449 3300030521 Ga0307511_10009343 Ga0307511_100093437 135
450 3300031235 Ga0265330_10000067 Ga0265330_1000006760 135
451 3300031238 Ga0265332_10000513 Ga0265332_100005139 135
452 3300031238 Ga0265332_10014669 Ga0265332_100146692 135
453 3300031238 Ga0265332_10074846 Ga0265332_100748462 135
454 3300031239 Ga0265328_10002334 Ga0265328_100023345 135
455 3300031240 Ga0265320_10000644 Ga0265320_100006445 135
456 3300031240 Ga0265320_10000896 Ga0265320_100008964 135
457 3300031240 Ga0265320_10057827 Ga0265320_100578272 135
458 3300031241 Ga0265325_10034126 Ga0265325_100341263 135
459 3300031242 Ga0265329_10000849 Ga0265329_100008497 135
460 3300031247 Ga0265340_10002520 Ga0265340_100025205 135
461 3300031247 Ga0265340_10009287 Ga0265340_100092876 135
462 3300031249 Ga0265339_10001501 Ga0265339_1000150118 135
463 3300031249 Ga0265339_10103030 Ga0265339_101030301 135
464 3300031249 Ga0265339_10224012 Ga0265339_102240122 135
465 3300031250 Ga0265331_10000271 Ga0265331_100002712 135
466 3300031344 Ga0265316_10001501 Ga0265316_100015015 135
467 3300031344 Ga0265316_10002576 Ga0265316_100025767 135
468 3300031344 Ga0265316_10077876 Ga0265316_100778762 135
469 3300031595 Ga0265313_10052053 Ga0265313_100520533 135
470 3300031595 Ga0265313_10084728 Ga0265313_100847282 135
471 3300031711 Ga0265314_10001618 Ga0265314_100016185 135
472 3300031711 Ga0265314_10068153 Ga0265314_100681532 135
473 3300031711 Ga0265314_10451807 Ga0265314_104518072 135
474 3300031712 Ga0265342_10001108 Ga0265342_100011088 135
475 3300031712 Ga0265342_10003238 Ga0265342_100032388 135
476 3300031727 Ga0316576_10044407 Ga0316576_100444076 135
477 3300031727 Ga0316576_10052632 Ga0316576_100526324 135
478 3300031728 Ga0316578_10312920 Ga0316578_103129201 135
479 3300031731 Ga0307405_11192659 Ga0307405_111926592 135
480 3300031733 Ga0316577_10851103 Ga0316577_108511031 135
481 3300032168 Ga0316593_10026649 Ga0316593_100266493 135
482 3300032168 Ga0316593_10033657 Ga0316593_100336571 135
483 3300032168 Ga0316593_10255291 Ga0316593_102552912 135
484 3300032168 Ga0316593_10309901 Ga0316593_103099011 135
485 3300032168 Ga0316593_10336039 Ga0316593_103360391 135
486 3300035083 Ga0373926_0147578 Ga0373926_0147578_151_582 135
487 3300035086 Ga0373934_0000155 Ga0373934_0000155_14133_14558 135
488 3300035111 Ga0373923_0044713 Ga0373923_0044713_340_765 135
489 3300035112 Ga0373932_0000892 Ga0373932_0000892_1724_2149 135
490 3300035113 Ga0373936_0019872 Ga0373936_0019872_1480_1905 135
491 3300035115 Ga0373941_0145218 Ga0373941_0145218_119_544 135
492 3300035117 Ga0373953_0022062 Ga0373953_0022062_1397_1822 135
493 3300035117 Ga0373953_0203965 Ga0373953_0203965_330_755 135
494 3300035118 Ga0373954_0041553 Ga0373954_0041553_310_735 135
495 3300035119 Ga0373956_0002379 Ga0373956_0002379_1366_1791 135
496 3300035119 Ga0373956_0020785 Ga0373956_0020785_2262_2687 135
497 3300035120 Ga0373957_0048347 Ga0373957_0048347_986_1411 135
498 3300035170 Ga0373943_0038288 Ga0373943_0038288_859_1284 135
499 3300035172 Ga0373955_0019792 Ga0373955_0019792_1543_1968 135
500 3300035172 Ga0373955_0195991 Ga0373955_0195991_762_1190 135
501 3300035172 Ga0373955_0246256 Ga0373955_0246256_588_1013 135
502 3300035172 Ga0373955_0278103 Ga0373955_0278103_126_551 135
503 3300035398 Ga0316574_0307400 Ga0316574_0307400_354_779 135
504 3300035410 Ga0373924_0046997 Ga0373924_0046997_875_1300 135
505 3300035692 Ga0373935_0044888 Ga0373935_0044888_157_582 135
506 3300035724 Ga0373933_0037442 Ga0373933_0037442_770_1195 135
507 3300035724 Ga0373933_0072052 Ga0373933_0072052_742_1167 135
508 3300035724 Ga0373933_0898410 Ga0373933_0898410_93_518 135
509 3300035725 Ga0373947_0310249 Ga0373947_0310249_333_758 135
510 3300036401 Ga0373937_0011530 Ga0373937_0011530_6490_6915 135
511 3300036401 Ga0373937_0018806 Ga0373937_0018806_4329_4754 135
512 3300036401 Ga0373937_0116858 Ga0373937_0116858_162_587 135
513 3300036401 Ga0373937_0132405 Ga0373937_0132405_1173_1598 135
514 3300036401 Ga0373937_0368737 Ga0373937_0368737_350_775 135
515 3300036401 Ga0373937_0483504 Ga0373937_0483504_492_917 135
516 3300036647 Ga0316582_0093009 Ga0316582_0093009_1348_1773 135
517 3300036712 Ga0316584_0343974 Ga0316584_0343974_462_887 135
518 3300037312 Ga0395899_0153009 Ga0395899_0153009_804_1229 135
519 3300037588 Ga0316581_0195927 Ga0316581_0195927_53_478 135
520 3300038726 Ga0400490_24938 Ga0400490_24938_605_1033 135
521 3300039062 Ga0400483_229260 Ga0400483_229260_1164_1589 135
522 3300039437 Ga0436365_0605606 Ga0436365_0605606_55420_55845 135
523 3300039453 Ga0436362_0309166 Ga0436362_0309166_10902_11327 135
524 3300041456 Ga0451795_0162296 Ga0451795_0162296_1258_1683 135
525 3300041508 Ga0451852_31128 Ga0451852_31128_136_564 135
526 3300041511 Ga0451855_0111700 Ga0451855_0111700_753_1178 135
527 3300041511 Ga0451855_0685541 Ga0451855_0685541_212_637 135
528 3300042435 Ga0439434_0081741 Ga0439434_0081741_455_883 135
529 3300042435 Ga0439434_0138557 Ga0439434_0138557_43_471 135
530 3300042435 Ga0439434_0218463 Ga0439434_0218463_79_507 135
531 3300042876 Ga0451577_0021214 Ga0451577_0021214_3031_3456 135
532 3300042876 Ga0451577_0024271 Ga0451577_0024271_621_1046 135
533 3300042876 Ga0451577_0103544 Ga0451577_0103544_1226_1651 135
534 3300044656 Ga0466969_0142709 Ga0466969_0142709_249_686 135
535 3300044673 Ga0453683_0184982 Ga0453683_0184982_700_1125 135
536 3300044673 Ga0453683_0382406 Ga0453683_0382406_335_760 135
537 3300044712 Ga0453684_0010849 Ga0453684_0010849_11331_11756 135
538 3300044712 Ga0453684_0116274 Ga0453684_0116274_511_951 135
539 3300044712 Ga0453684_0165439 Ga0453684_0165439_2171_2596 135
540 3300045051 Ga0451576_0005783 Ga0451576_0005783_13712_14137 135
541 3300045051 Ga0451576_0382538 Ga0451576_0382538_565_990 135
542 3300045051 Ga0451576_0595133 Ga0451576_0595133_251_676 135
543 3300045051 Ga0451576_0706757 Ga0451576_0706757_40_471 135
544 3300045051 Ga0451576_0900274 Ga0451576_0900274_201_626 135
545 3300045051 Ga0451576_1318978 Ga0451576_1318978_192_617 135
546 3300046453 Ga0495627_141526 Ga0495627_141526_62_487 135
547 3300046454 Ga0495592_0048815 Ga0495592_0048815_1336_1761 135
548 3300046454 Ga0495592_0275824 Ga0495592_0275824_569_994 135
549 3300046459 Ga0495629_0746192 Ga0495629_0746192_204_638 135
550 3300046462 Ga0495651_0124692 Ga0495651_0124692_1237_1662 135
551 3300046463 Ga0495653_0132982 Ga0495653_0132982_798_1223 135
552 3300046511 Ga0495608_0010081 Ga0495608_0010081_1394_1819 135
553 3300046514 Ga0495618_0065314 Ga0495618_0065314_1140_1565 135
554 3300046514 Ga0495618_0635888 Ga0495618_0635888_183_608 135
555 3300046516 Ga0495628_0038502 Ga0495628_0038502_2904_3329 135
556 3300046517 Ga0495630_0775938 Ga0495630_0775938_234_659 135
557 3300046517 Ga0495630_1364538 Ga0495630_1364538_75_500 135
558 3300046526 Ga0495666_0140166 Ga0495666_0140166_342_767 135
559 3300046533 Ga0495640_0071361 Ga0495640_0071361_1095_1520 135
560 3300046536 Ga0495587_0015907 Ga0495587_0015907_1412_1837 135
561 3300046559 Ga0495667_0006622 Ga0495667_0006622_2143_2568 135
562 3300046642 Ga0495634_0334981 Ga0495634_0334981_226_651 135
563 3300046642 Ga0495634_0441993 Ga0495634_0441993_140_565 135
564 3300046663 Ga0495635_0124070 Ga0495635_0124070_375_800 135
565 3300046675 Ga0495657_0062591 Ga0495657_0062591_1422_1847 135
566 3300046678 Ga0495599_0082939 Ga0495599_0082939_1347_1772 135
567 3300046683 Ga0495658_0011409 Ga0495658_0011409_2591_3112 135
568 3300046683 Ga0495658_0167078 Ga0495658_0167078_171_596 135
569 3300046684 Ga0495669_0421559 Ga0495669_0421559_114_596 135
570 3300046691 Ga0495670_0015230 Ga0495670_0015230_2697_3122 135
571 3300046809 Ga0495600_0027945 Ga0495600_0027945_1024_1449 135
572 3300047315 Ga0495581_0096460 Ga0495581_0096460_1040_1465 135
573 3300047319 Ga0495674_0369381 Ga0495674_0369381_140_565 135
574 3300047322 Ga0495680_0434824 Ga0495680_0434824_194_619 135
575 3300047444 Ga0495675_0058692 Ga0495675_0058692_610_1035 135
576 3300047471 Ga0495684_0292235 Ga0495684_0292235_293_718 135
577 3300047471 Ga0495684_0737051 Ga0495684_0737051_133_558 135
578 3300048916 Ga0496113_0408800 Ga0496113_0408800_520_945 135
579 3300049568 Ga0501031_0210635 Ga0501031_0210635_98_523 135
580 3300049569 Ga0501032_0525370 Ga0501032_0525370_286_711 135
581 3300049570 Ga0501033_0280476 Ga0501033_0280476_700_1125 135
582 3300049570 Ga0501033_0892794 Ga0501033_0892794_59_484 135
583 3300049571 Ga0501034_0599636 Ga0501034_0599636_310_735 135
584 3300049572 Ga0501036_0044160 Ga0501036_0044160_2312_2737 135
585 3300049572 Ga0501036_0235815 Ga0501036_0235815_975_1403 135
586 3300049572 Ga0501036_1133746 Ga0501036_1133746_43_471 135
587 3300049573 Ga0501037_0201791 Ga0501037_0201791_502_927 135
588 3300049575 Ga0501039_0186094 Ga0501039_0186094_957_1382 135
589 3300049575 Ga0501039_1024618 Ga0501039_1024618_75_503 135
590 3300049576 Ga0501040_0531260 Ga0501040_0531260_174_599 135
591 3300049577 Ga0501041_0007558 Ga0501041_0007558_4921_5346 135
592 3300049579 Ga0501043_0432547 Ga0501043_0432547_44_469 135
593 3300049580 Ga0501046_0176815 Ga0501046_0176815_826_1251 135
594 3300049582 Ga0501048_0334924 Ga0501048_0334924_54_479 135
595 3300049585 Ga0501069_0622504 Ga0501069_0622504_157_585 135
596 3300049586 Ga0501070_1033437 Ga0501070_1033437_188_613 135
597 3300049587 Ga0501071_0085167 Ga0501071_0085167_855_1280 135
598 3300049587 Ga0501071_0820900 Ga0501071_0820900_104_532 135
599 3300049591 Ga0501075_0016329 Ga0501075_0016329_3986_4411 135
600 3300049591 Ga0501075_0292130 Ga0501075_0292130_648_1076 135
601 3300049592 Ga0501076_0220653 Ga0501076_0220653_975_1400 135
602 3300049593 Ga0501077_0091102 Ga0501077_0091102_942_1367 135
603 3300049741 Ga0501079_0073172 Ga0501079_0073172_1586_2011 135
604 3300049741 Ga0501079_0954480 Ga0501079_0954480_195_620 135
605 3300049742 Ga0501080_0151123 Ga0501080_0151123_1371_1796 135
606 3300049743 Ga0501081_0080260 Ga0501081_0080260_689_1114 135
607 3300049824 Ga0501045_0103757 Ga0501045_0103757_1279_1704 135
608 3300050507 nmdc:mga05p37_122849_c2 nmdc:mga05p37_122849_c2_776_1201 135
609 3300050507 nmdc:mga05p37_122920_c1 nmdc:mga05p37_122920_c1_908_1333 135
610 3300050507 nmdc:mga05p37_681234_c1 nmdc:mga05p37_681234_c1_66_491 135
611 3300050507 nmdc:mga05p37_929992_c1 nmdc:mga05p37_929992_c1_371_796 135
612 3300050508 nmdc:mga09592_20930_c1 nmdc:mga09592_20930_c1_3139_3564 135
613 3300050508 nmdc:mga09592_2536_c1 nmdc:mga09592_2536_c1_14101_14526 135
614 3300050509 nmdc:mga0qj67_249961_c1 nmdc:mga0qj67_249961_c1_58_483 135
615 3300050509 nmdc:mga0qj67_398697_c1 nmdc:mga0qj67_398697_c1_494_919 135
616 3300050510 nmdc:mga06r32_257390_c1 nmdc:mga06r32_257390_c1_864_1289 135
617 3300050510 nmdc:mga06r32_269558_c1 nmdc:mga06r32_269558_c1_335_763 135
618 3300050510 nmdc:mga06r32_428015_c1 nmdc:mga06r32_428015_c1_222_647 135
619 3300050511 nmdc:mga08y16_148621_c1 nmdc:mga08y16_148621_c1_355_780 135
620 3300050511 nmdc:mga08y16_2039663_c1 nmdc:mga08y16_2039663_c1_85_510 135
621 3300050511 nmdc:mga08y16_296_c1 nmdc:mga08y16_296_c1_28492_28917 135
622 3300050511 nmdc:mga08y16_560141_c1 nmdc:mga08y16_560141_c1_375_800 135
623 3300050512 nmdc:mga0n895_1167423_c1 nmdc:mga0n895_1167423_c1_74_499 135
624 3300050512 nmdc:mga0n895_547849_c1 nmdc:mga0n895_547849_c1_277_702 135
625 3300050512 nmdc:mga0n895_94929_c1 nmdc:mga0n895_94929_c1_369_794 135
626 3300050512 nmdc:mga0n895_952059_c1 nmdc:mga0n895_952059_c1_108_533 135
627 3300050512 nmdc:mga0n895_978469_c1 nmdc:mga0n895_978469_c1_143_568 135
628 3300050513 nmdc:mga0rr50_293289_c1 nmdc:mga0rr50_293289_c1_552_977 135
629 3300050513 nmdc:mga0rr50_8536_c1 nmdc:mga0rr50_8536_c1_4591_5016 135
630 3300050514 nmdc:mga08x19_164879_c1 nmdc:mga08x19_164879_c1_65_490 135
631 3300050514 nmdc:mga08x19_458603_c1 nmdc:mga08x19_458603_c1_308_733 135
632 3300050514 nmdc:mga08x19_70185_c1 nmdc:mga08x19_70185_c1_295_720 135
633 3300050515 nmdc:mga0a205_799934_c1 nmdc:mga0a205_799934_c1_176_601 135
634 3300053084 Ga0495595_0002299 Ga0495595_0002299_6015_6440 135
635 3300053085 Ga0495619_0156748 Ga0495619_0156748_929_1354 135
636 3300054114 Ga0501084_0182708 Ga0501084_0182708_1139_1564 135
637 3300054114 Ga0501084_1290496 Ga0501084_1290496_139_567 135
638 3300059491 Ga0587070_136153 Ga0587070_136153_105_530 135
639 3300059493 Ga0587077_056032 Ga0587077_056032_328_759 135
640 3300059643 Ga0587072_137844 Ga0587072_137844_31_456 135
641 3300059654 Ga0587110_039101 Ga0587110_039101_74_523 135
642 3300060353 Ga0501082_0022686 Ga0501082_0022686_4063_4488 135
643 3300061734 Ga0530510_0103782 Ga0530510_0103782_319_744 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

72

140

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

11

67

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9877 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9762 3 78
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9606 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9517 3 78
2bcw-assembly1.cif.gz_A coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex 0.944 9 72
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9828 3 67 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9762 3 78 3.30.1550.10
4v19K01 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9588 6 70 3.30.1550.10
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9519 72 133 1.10.10.250
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9517 3 78 3.30.1550.10
ID Description Score Start End GO Terms
AF-A0A7J4E0X6-F1-model_v4 deleted 1.006 1 70
AF-A0A2N2LDD6-F1-model_v4 50S ribosomal protein L11 1.004 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 1.004 1 71 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A5K0WVA7-F1-model_v4 Large ribosomal subunit protein uL11 N-terminal domain-containing protein 1.001 6 62 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7W1H7B9-F1-model_v4 Large ribosomal subunit protein uL11 N-terminal domain-containing protein 0.9951 7 60 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
89.81 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map