F471925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 643 | 330 | 639 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300003373|JGI25407J50210_10004185|JGI25407J50210_100041855 |
| Length | 160 |
| Sequence | MPARKRVAATVRLQLEAGQASPGKAGQALGPHGINLMAFVGAYNAASAAQRGMVVPVVVTVYDDRSFDLQLKTPPTSALLARAAGLGKGGDRPGDGPIAKLARDQLREVARAKLPDLNTDDLDAAERIVAGTARSMGIEVVDAVNQPRAPSVLPERRTPW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 2 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 3 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 182 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 186 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 196 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 197 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 198 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 225 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 228 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 235 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 330 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.47 |
| Metatranscriptomes | 5.91 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 1.24 |
| Rhizosphere | 95.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10028884 | 3300001991 | Bacteria | 1087 |
| 2 | JGI24751J29686_10121017 | 3300002459 | Bacteria | 550 |
| 3 | JGI26145J50221_1033850 | 3300003371 | Bacteria | 529 |
| 4 | JGI25407J50210_10004185 | 3300003373 | Bacteria | 3511 |
| 5 | Ga0058858_1299979 | 3300004785 | Unclassified | 551 |
| 6 | Ga0058859_10054700 | 3300004798 | Bacteria | 2645 |
| 7 | Ga0058859_10108115 | 3300004798 | Bacteria | 2373 |
| 8 | Ga0058859_10131413 | 3300004798 | Bacteria | 1137 |
| 9 | Ga0058859_11564291 | 3300004798 | Bacteria | 896 |
| 10 | Ga0058861_11795149 | 3300004800 | Bacteria | 558 |
| 11 | Ga0058860_10195543 | 3300004801 | Bacteria | 862 |
| 12 | Ga0058862_10098853 | 3300004803 | Bacteria | 725 |
| 13 | Ga0058862_12700650 | 3300004803 | Bacteria | 811 |
| 14 | Ga0065715_10179465 | 3300005293 | Bacteria | 1411 |
| 15 | Ga0065707_10598467 | 3300005295 | Bacteria | 691 |
| 16 | Ga0070658_10020602 | 3300005327 | Bacteria | 5285 |
| 17 | Ga0070683_100000118 | 3300005329 | Bacteria | 51816 |
| 18 | Ga0070690_100028743 | 3300005330 | Bacteria | 3445 |
| 19 | Ga0070690_100619142 | 3300005330 | Bacteria | 824 |
| 20 | Ga0070690_100917987 | 3300005330 | Unclassified | 686 |
| 21 | Ga0070670_100005117 | 3300005331 | Bacteria | 11035 |
| 22 | Ga0070670_100136162 | 3300005331 | Bacteria | 2123 |
| 23 | Ga0070670_100212412 | 3300005331 | Bacteria | 1682 |
| 24 | Ga0070677_10204613 | 3300005333 | Bacteria | 955 |
| 25 | Ga0068869_100144565 | 3300005334 | Bacteria | 1839 |
| 26 | Ga0068869_101541980 | 3300005334 | Bacteria | 591 |
| 27 | Ga0070680_101076595 | 3300005336 | Bacteria | 695 |
| 28 | Ga0070680_101211617 | 3300005336 | Bacteria | 653 |
| 29 | Ga0070682_100000004 | 3300005337 | Bacteria | 388780 |
| 30 | Ga0070682_100287714 | 3300005337 | Bacteria | 1201 |
| 31 | Ga0068868_100000927 | 3300005338 | Bacteria | 19963 |
| 32 | Ga0070689_100002507 | 3300005340 | Bacteria | 12013 |
| 33 | Ga0070689_100004116 | 3300005340 | Bacteria | 9793 |
| 34 | Ga0070689_100074023 | 3300005340 | Bacteria | 2665 |
| 35 | Ga0070689_100162060 | 3300005340 | Bacteria | 1808 |
| 36 | Ga0070689_100166284 | 3300005340 | Bacteria | 1785 |
| 37 | Ga0070687_100039402 | 3300005343 | Bacteria | 2374 |
| 38 | Ga0070687_100124434 | 3300005343 | Bacteria | 1480 |
| 39 | Ga0070661_101280450 | 3300005344 | Bacteria | 615 |
| 40 | Ga0070692_10159911 | 3300005345 | Bacteria | 1290 |
| 41 | Ga0070669_100440231 | 3300005353 | Bacteria | 1073 |
| 42 | Ga0070675_100003283 | 3300005354 | Bacteria | 12267 |
| 43 | Ga0070671_100497651 | 3300005355 | Bacteria | 1048 |
| 44 | Ga0070671_100768595 | 3300005355 | Bacteria | 838 |
| 45 | Ga0070688_100069163 | 3300005365 | Bacteria | 2253 |
| 46 | Ga0070688_100084260 | 3300005365 | Bacteria | 2064 |
| 47 | Ga0070688_100146702 | 3300005365 | Bacteria | 1608 |
| 48 | Ga0070688_101334019 | 3300005365 | Unclassified | 580 |
| 49 | Ga0070667_100787605 | 3300005367 | Bacteria | 882 |
| 50 | Ga0070667_101365343 | 3300005367 | Unclassified | 664 |
| 51 | Ga0070667_101483196 | 3300005367 | Bacteria | 637 |
| 52 | Ga0070667_101564654 | 3300005367 | Bacteria | 619 |
| 53 | Ga0070703_10165314 | 3300005406 | Bacteria | 843 |
| 54 | Ga0070703_10586165 | 3300005406 | Bacteria | 513 |
| 55 | Ga0070714_100205774 | 3300005435 | Bacteria | 1802 |
| 56 | Ga0070713_100020740 | 3300005436 | Bacteria | 5044 |
| 57 | Ga0070710_11097853 | 3300005437 | Bacteria | 584 |
| 58 | Ga0070701_11107334 | 3300005438 | Bacteria | 558 |
| 59 | Ga0070711_100016016 | 3300005439 | Bacteria | 4752 |
| 60 | Ga0070705_101054307 | 3300005440 | Bacteria | 663 |
| 61 | Ga0070700_100125572 | 3300005441 | Bacteria | 1725 |
| 62 | Ga0070700_100312930 | 3300005441 | Bacteria | 1150 |
| 63 | Ga0070700_101938246 | 3300005441 | Bacteria | 510 |
| 64 | Ga0070694_100086832 | 3300005444 | Bacteria | 2187 |
| 65 | Ga0070694_100136870 | 3300005444 | Bacteria | 1775 |
| 66 | Ga0070694_100944466 | 3300005444 | Bacteria | 714 |
| 67 | Ga0070694_101354336 | 3300005444 | Bacteria | 600 |
| 68 | Ga0070708_100043823 | 3300005445 | Bacteria | 3932 |
| 69 | Ga0070708_100520867 | 3300005445 | Bacteria | 1121 |
| 70 | Ga0070708_101140576 | 3300005445 | Bacteria | 730 |
| 71 | Ga0070678_100364847 | 3300005456 | Bacteria | 1245 |
| 72 | Ga0070678_100603764 | 3300005456 | Bacteria | 980 |
| 73 | Ga0068867_100760756 | 3300005459 | Bacteria | 860 |
| 74 | Ga0070685_10006013 | 3300005466 | Bacteria | 6184 |
| 75 | Ga0070706_100024463 | 3300005467 | Bacteria | 5560 |
| 76 | Ga0070706_100042452 | 3300005467 | Bacteria | 4201 |
| 77 | Ga0070706_100174116 | 3300005467 | Bacteria | 2009 |
| 78 | Ga0070706_100980556 | 3300005467 | Bacteria | 780 |
| 79 | Ga0070707_100057767 | 3300005468 | Bacteria | 3722 |
| 80 | Ga0070707_100298445 | 3300005468 | Bacteria | 1565 |
| 81 | Ga0070707_100500589 | 3300005468 | Bacteria | 1177 |
| 82 | Ga0070707_101366960 | 3300005468 | Bacteria | 675 |
| 83 | Ga0070698_100289130 | 3300005471 | Bacteria | 1570 |
| 84 | Ga0070698_100981819 | 3300005471 | Bacteria | 791 |
| 85 | Ga0070699_100042737 | 3300005518 | Bacteria | 3922 |
| 86 | Ga0070699_100245148 | 3300005518 | Bacteria | 1600 |
| 87 | Ga0070699_101311615 | 3300005518 | Bacteria | 664 |
| 88 | Ga0070679_101472261 | 3300005530 | Bacteria | 628 |
| 89 | Ga0070684_100004380 | 3300005535 | Bacteria | 10734 |
| 90 | Ga0070697_100141520 | 3300005536 | Bacteria | 2023 |
| 91 | Ga0070697_100159513 | 3300005536 | Bacteria | 1905 |
| 92 | Ga0070697_100242721 | 3300005536 | Bacteria | 1538 |
| 93 | Ga0070697_100430910 | 3300005536 | Bacteria | 1147 |
| 94 | Ga0068853_100854765 | 3300005539 | Bacteria | 873 |
| 95 | Ga0068853_102207801 | 3300005539 | Bacteria | 534 |
| 96 | Ga0070672_100000645 | 3300005543 | Bacteria | 20439 |
| 97 | Ga0070686_100015810 | 3300005544 | Bacteria | 4381 |
| 98 | Ga0070686_100123070 | 3300005544 | Bacteria | 1783 |
| 99 | Ga0070686_100618046 | 3300005544 | Bacteria | 856 |
| 100 | Ga0070686_101441635 | 3300005544 | Bacteria | 579 |
| 101 | Ga0070695_100006106 | 3300005545 | Bacteria | 7119 |
| 102 | Ga0070695_100031080 | 3300005545 | Bacteria | 3327 |
| 103 | Ga0070695_100151664 | 3300005545 | Unclassified | 1618 |
| 104 | Ga0070693_100079597 | 3300005547 | Bacteria | 1950 |
| 105 | Ga0070665_101768127 | 3300005548 | Bacteria | 625 |
| 106 | Ga0070704_100045604 | 3300005549 | Bacteria | 3051 |
| 107 | Ga0070704_100175096 | 3300005549 | Bacteria | 1710 |
| 108 | Ga0070704_100210687 | 3300005549 | Bacteria | 1574 |
| 109 | Ga0070704_100214293 | 3300005549 | Bacteria | 1562 |
| 110 | Ga0070704_100319935 | 3300005549 | Bacteria | 1299 |
| 111 | Ga0070704_100358563 | 3300005549 | Bacteria | 1233 |
| 112 | Ga0070664_100151761 | 3300005564 | Bacteria | 2046 |
| 113 | Ga0068857_100085364 | 3300005577 | Bacteria | 2821 |
| 114 | Ga0068857_100415904 | 3300005577 | Bacteria | 1253 |
| 115 | Ga0068857_101363645 | 3300005577 | Bacteria | 689 |
| 116 | Ga0070702_100087415 | 3300005615 | Bacteria | 1882 |
| 117 | Ga0070702_100159474 | 3300005615 | Bacteria | 1457 |
| 118 | Ga0070702_100271565 | 3300005615 | Bacteria | 1160 |
| 119 | Ga0070702_101355050 | 3300005615 | Bacteria | 580 |
| 120 | Ga0068859_100096765 | 3300005617 | Bacteria | 3004 |
| 121 | Ga0068859_100944974 | 3300005617 | Bacteria | 946 |
| 122 | Ga0068859_101334740 | 3300005617 | Bacteria | 791 |
| 123 | Ga0068864_100000025 | 3300005618 | Bacteria | 250062 |
| 124 | Ga0068864_100118935 | 3300005618 | Bacteria | 2360 |
| 125 | Ga0068864_100178104 | 3300005618 | Bacteria | 1942 |
| 126 | Ga0068864_100683246 | 3300005618 | Bacteria | 1001 |
| 127 | Ga0068861_100085703 | 3300005719 | Bacteria | 2475 |
| 128 | Ga0068861_100260811 | 3300005719 | Bacteria | 1484 |
| 129 | Ga0068870_10069881 | 3300005840 | Bacteria | 1912 |
| 130 | Ga0068870_10134631 | 3300005840 | Unclassified | 1439 |
| 131 | Ga0068863_100059485 | 3300005841 | Bacteria | 3614 |
| 132 | Ga0068863_100422201 | 3300005841 | Bacteria | 1306 |
| 133 | Ga0068863_100856962 | 3300005841 | Bacteria | 908 |
| 134 | Ga0068858_100000126 | 3300005842 | Bacteria | 79740 |
| 135 | Ga0068858_100945023 | 3300005842 | Bacteria | 844 |
| 136 | Ga0068860_100237940 | 3300005843 | Bacteria | 1771 |
| 137 | Ga0068860_100773714 | 3300005843 | Bacteria | 972 |
| 138 | Ga0068860_100800955 | 3300005843 | Bacteria | 955 |
| 139 | Ga0068862_100771770 | 3300005844 | Bacteria | 937 |
| 140 | Ga0081538_10001550 | 3300005981 | Bacteria | 23554 |
| 141 | Ga0081538_10002952 | 3300005981 | Bacteria | 16234 |
| 142 | Ga0081538_10005210 | 3300005981 | Bacteria | 11747 |
| 143 | Ga0081538_10012332 | 3300005981 | Bacteria | 6856 |
| 144 | Ga0081538_10018001 | 3300005981 | Bacteria | 5332 |
| 145 | Ga0081538_10019455 | 3300005981 | Bacteria | 5046 |
| 146 | Ga0081538_10271366 | 3300005981 | Bacteria | 635 |
| 147 | Ga0070717_10000358 | 3300006028 | Bacteria | 29359 |
| 148 | Ga0075364_10020198 | 3300006051 | Bacteria | 4189 |
| 149 | Ga0075432_10039752 | 3300006058 | Bacteria | 1641 |
| 150 | Ga0070715_10182770 | 3300006163 | Bacteria | 1053 |
| 151 | Ga0070716_100562939 | 3300006173 | Bacteria | 852 |
| 152 | Ga0070716_101489893 | 3300006173 | Bacteria | 553 |
| 153 | Ga0075362_10012980 | 3300006177 | Bacteria | 3323 |
| 154 | Ga0068871_100883353 | 3300006358 | Bacteria | 828 |
| 155 | Ga0075428_100031483 | 3300006844 | Bacteria | 5862 |
| 156 | Ga0075428_100205418 | 3300006844 | Bacteria | 2129 |
| 157 | Ga0075428_100275866 | 3300006844 | Bacteria | 1809 |
| 158 | Ga0075428_100438204 | 3300006844 | Bacteria | 1400 |
| 159 | Ga0075428_100450526 | 3300006844 | Unclassified | 1379 |
| 160 | Ga0075428_100839747 | 3300006844 | Bacteria | 975 |
| 161 | Ga0075430_100093180 | 3300006846 | Bacteria | 2518 |
| 162 | Ga0075430_100787156 | 3300006846 | Bacteria | 784 |
| 163 | Ga0075430_100972839 | 3300006846 | Bacteria | 699 |
| 164 | Ga0075433_10033580 | 3300006852 | Bacteria | 4400 |
| 165 | Ga0075433_10311866 | 3300006852 | Bacteria | 1392 |
| 166 | Ga0075433_10375920 | 3300006852 | Bacteria | 1255 |
| 167 | Ga0075433_11042784 | 3300006852 | Bacteria | 712 |
| 168 | Ga0075433_11233138 | 3300006852 | Bacteria | 649 |
| 169 | Ga0075434_100044962 | 3300006871 | Bacteria | 4380 |
| 170 | Ga0075434_100172980 | 3300006871 | Bacteria | 2179 |
| 171 | Ga0075434_100218166 | 3300006871 | Bacteria | 1927 |
| 172 | Ga0075434_100426703 | 3300006871 | Bacteria | 1347 |
| 173 | Ga0075434_100557290 | 3300006871 | Bacteria | 1166 |
| 174 | Ga0075434_101240785 | 3300006871 | Bacteria | 757 |
| 175 | Ga0075434_101465951 | 3300006871 | Bacteria | 692 |
| 176 | Ga0075429_100074346 | 3300006880 | Bacteria | 2960 |
| 177 | Ga0075429_100236303 | 3300006880 | Bacteria | 1601 |
| 178 | Ga0075429_100387597 | 3300006880 | Bacteria | 1223 |
| 179 | Ga0068865_100792684 | 3300006881 | Bacteria | 817 |
| 180 | Ga0075436_100015219 | 3300006914 | Bacteria | 5268 |
| 181 | Ga0075436_100595619 | 3300006914 | Bacteria | 814 |
| 182 | Ga0097620_100096764 | 3300006931 | Bacteria | 3004 |
| 183 | Ga0097620_100945002 | 3300006931 | Bacteria | 946 |
| 184 | Ga0097620_101334672 | 3300006931 | Bacteria | 791 |
| 185 | Ga0075435_100019811 | 3300007076 | Bacteria | 5145 |
| 186 | Ga0075435_100024698 | 3300007076 | Bacteria | 4667 |
| 187 | Ga0075435_100129015 | 3300007076 | Bacteria | 2115 |
| 188 | Ga0099795_10127105 | 3300007788 | Bacteria | 1025 |
| 189 | Ga0099795_10216423 | 3300007788 | Bacteria | 814 |
| 190 | Ga0111539_10000254 | 3300009094 | Bacteria | 64117 |
| 191 | Ga0111539_10051057 | 3300009094 | Bacteria | 4926 |
| 192 | Ga0111539_10066486 | 3300009094 | Bacteria | 4258 |
| 193 | Ga0111539_10166012 | 3300009094 | Bacteria | 2581 |
| 194 | Ga0111539_11000809 | 3300009094 | Bacteria | 972 |
| 195 | Ga0111539_11295652 | 3300009094 | Bacteria | 846 |
| 196 | Ga0111539_13044178 | 3300009094 | Bacteria | 541 |
| 197 | Ga0105245_10002811 | 3300009098 | Bacteria | 15656 |
| 198 | Ga0105245_10003274 | 3300009098 | Bacteria | 14536 |
| 199 | Ga0105245_10687991 | 3300009098 | Bacteria | 1055 |
| 200 | Ga0105247_10027881 | 3300009101 | Bacteria | 3415 |
| 201 | Ga0114129_10001925 | 3300009147 | Bacteria | 28355 |
| 202 | Ga0114129_10037064 | 3300009147 | Bacteria | 6885 |
| 203 | Ga0114129_10063727 | 3300009147 | Bacteria | 5145 |
| 204 | Ga0114129_10242045 | 3300009147 | Bacteria | 2425 |
| 205 | Ga0114129_10307432 | 3300009147 | Bacteria | 2111 |
| 206 | Ga0114129_10441641 | 3300009147 | Bacteria | 1708 |
| 207 | Ga0114129_10924990 | 3300009147 | Bacteria | 1103 |
| 208 | Ga0105243_10187817 | 3300009148 | Bacteria | 1802 |
| 209 | Ga0105243_11019192 | 3300009148 | Bacteria | 832 |
| 210 | Ga0105242_10907429 | 3300009176 | Unclassified | 882 |
| 211 | Ga0105248_10306898 | 3300009177 | Bacteria | 1787 |
| 212 | Ga0105248_11656144 | 3300009177 | Bacteria | 725 |
| 213 | Ga0105237_10512613 | 3300009545 | Bacteria | 1206 |
| 214 | Ga0105237_10969923 | 3300009545 | Unclassified | 857 |
| 215 | Ga0105238_10000002 | 3300009551 | Bacteria | 772711 |
| 216 | Ga0105249_10101204 | 3300009553 | Bacteria | 2710 |
| 217 | Ga0105246_10340070 | 3300011119 | Bacteria | 1226 |
| 218 | Ga0157369_10000363 | 3300013105 | Bacteria | 60464 |
| 219 | Ga0157374_10000016 | 3300013296 | Bacteria | 293656 |
| 220 | Ga0157378_10094801 | 3300013297 | Bacteria | 2717 |
| 221 | Ga0157378_10190755 | 3300013297 | Bacteria | 1933 |
| 222 | Ga0157378_10214534 | 3300013297 | Bacteria | 1826 |
| 223 | Ga0157378_10528396 | 3300013297 | Bacteria | 1182 |
| 224 | Ga0157378_11308407 | 3300013297 | Bacteria | 766 |
| 225 | Ga0163162_10086032 | 3300013306 | Bacteria | 3221 |
| 226 | Ga0157372_12109992 | 3300013307 | Bacteria | 647 |
| 227 | Ga0157375_10001186 | 3300013308 | Bacteria | 22482 |
| 228 | Ga0157375_10004506 | 3300013308 | Bacteria | 12112 |
| 229 | Ga0157375_10061602 | 3300013308 | Bacteria | 3726 |
| 230 | Ga0157375_10062738 | 3300013308 | Bacteria | 3694 |
| 231 | Ga0163163_10274144 | 3300014325 | Bacteria | 1738 |
| 232 | Ga0163163_10284597 | 3300014325 | Bacteria | 1705 |
| 233 | Ga0157380_10023433 | 3300014326 | Bacteria | 4657 |
| 234 | Ga0157380_10944054 | 3300014326 | Bacteria | 892 |
| 235 | Ga0157377_10000026 | 3300014745 | Bacteria | 138648 |
| 236 | Ga0157377_10000370 | 3300014745 | Bacteria | 20086 |
| 237 | Ga0157377_10311529 | 3300014745 | Bacteria | 1043 |
| 238 | Ga0157379_10267528 | 3300014968 | Bacteria | 1554 |
| 239 | Ga0157376_10000018 | 3300014969 | Bacteria | 259397 |
| 240 | Ga0213876_10000009 | 3300021384 | Bacteria | 496136 |
| 241 | Ga0207666_1056695 | 3300025271 | Bacteria | 625 |
| 242 | Ga0207653_10134987 | 3300025885 | Bacteria | 898 |
| 243 | Ga0207653_10250572 | 3300025885 | Bacteria | 679 |
| 244 | Ga0207642_10216726 | 3300025899 | Bacteria | 1067 |
| 245 | Ga0207685_10025056 | 3300025905 | Bacteria | 2054 |
| 246 | Ga0207643_10063001 | 3300025908 | Bacteria | 2119 |
| 247 | Ga0207705_10037305 | 3300025909 | Bacteria | 3478 |
| 248 | Ga0207684_10028407 | 3300025910 | Bacteria | 4766 |
| 249 | Ga0207684_10569815 | 3300025910 | Bacteria | 968 |
| 250 | Ga0207684_10853056 | 3300025910 | Bacteria | 768 |
| 251 | Ga0207707_10936340 | 3300025912 | Bacteria | 714 |
| 252 | Ga0207695_10157699 | 3300025913 | Bacteria | 2203 |
| 253 | Ga0207662_10001242 | 3300025918 | Bacteria | 12237 |
| 254 | Ga0207662_10170677 | 3300025918 | Bacteria | 1395 |
| 255 | Ga0207649_11305117 | 3300025920 | Bacteria | 574 |
| 256 | Ga0207646_10051275 | 3300025922 | Bacteria | 3693 |
| 257 | Ga0207646_10185373 | 3300025922 | Bacteria | 1879 |
| 258 | Ga0207681_11511968 | 3300025923 | Bacteria | 563 |
| 259 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 260 | Ga0207650_10001851 | 3300025925 | Bacteria | 14917 |
| 261 | Ga0207650_10040019 | 3300025925 | Bacteria | 3428 |
| 262 | Ga0207687_10000009 | 3300025927 | Bacteria | 443946 |
| 263 | Ga0207687_10002004 | 3300025927 | Bacteria | 14005 |
| 264 | Ga0207687_10306291 | 3300025927 | Bacteria | 1281 |
| 265 | Ga0207700_10014828 | 3300025928 | Bacteria | 5119 |
| 266 | Ga0207664_10348206 | 3300025929 | Bacteria | 1311 |
| 267 | Ga0207706_11219705 | 3300025933 | Bacteria | 624 |
| 268 | Ga0207670_10001935 | 3300025936 | Bacteria | 10844 |
| 269 | Ga0207670_10003762 | 3300025936 | Bacteria | 8063 |
| 270 | Ga0207670_10032517 | 3300025936 | Bacteria | 3355 |
| 271 | Ga0207670_10058309 | 3300025936 | Bacteria | 2622 |
| 272 | Ga0207704_10745347 | 3300025938 | Bacteria | 814 |
| 273 | Ga0207665_10473843 | 3300025939 | Bacteria | 964 |
| 274 | Ga0207691_10002381 | 3300025940 | Bacteria | 18401 |
| 275 | Ga0207711_10097299 | 3300025941 | Bacteria | 2599 |
| 276 | Ga0207711_10113179 | 3300025941 | Bacteria | 2416 |
| 277 | Ga0207689_10067295 | 3300025942 | Bacteria | 2944 |
| 278 | Ga0207661_10000015 | 3300025944 | Bacteria | 318960 |
| 279 | Ga0207651_10110630 | 3300025960 | Bacteria | 2061 |
| 280 | Ga0207640_10182284 | 3300025981 | Bacteria | 1575 |
| 281 | Ga0207677_10000017 | 3300026023 | Bacteria | 140155 |
| 282 | Ga0207703_10000653 | 3300026035 | Bacteria | 34790 |
| 283 | Ga0207703_11086094 | 3300026035 | Bacteria | 768 |
| 284 | Ga0207703_11384905 | 3300026035 | Bacteria | 676 |
| 285 | Ga0207639_10354827 | 3300026041 | Bacteria | 1311 |
| 286 | Ga0207639_10618394 | 3300026041 | Bacteria | 1000 |
| 287 | Ga0207708_10117850 | 3300026075 | Bacteria | 2067 |
| 288 | Ga0207708_10274129 | 3300026075 | Bacteria | 1365 |
| 289 | Ga0207708_10621444 | 3300026075 | Bacteria | 917 |
| 290 | Ga0207708_11373612 | 3300026075 | Bacteria | 620 |
| 291 | Ga0207641_10046806 | 3300026088 | Bacteria | 3646 |
| 292 | Ga0207641_10248171 | 3300026088 | Bacteria | 1661 |
| 293 | Ga0207641_10360078 | 3300026088 | Bacteria | 1389 |
| 294 | Ga0207648_10166559 | 3300026089 | Bacteria | 1948 |
| 295 | Ga0207676_10000002 | 3300026095 | Bacteria | 1198607 |
| 296 | Ga0207676_10076472 | 3300026095 | Bacteria | 2705 |
| 297 | Ga0207676_10134261 | 3300026095 | Bacteria | 2109 |
| 298 | Ga0207674_10029202 | 3300026116 | Bacteria | 5808 |
| 299 | Ga0207674_10146828 | 3300026116 | Bacteria | 2317 |
| 300 | Ga0207675_100014908 | 3300026118 | Bacteria | 7255 |
| 301 | Ga0207675_100046541 | 3300026118 | Bacteria | 4053 |
| 302 | Ga0207675_100267296 | 3300026118 | Bacteria | 1659 |
| 303 | Ga0207675_100861274 | 3300026118 | Bacteria | 921 |
| 304 | Ga0209973_1006677 | 3300027252 | Bacteria | 1267 |
| 305 | Ga0209984_1018238 | 3300027424 | Bacteria | 947 |
| 306 | Ga0209970_1005151 | 3300027614 | Bacteria | 2161 |
| 307 | Ga0209983_1001726 | 3300027665 | Bacteria | 4834 |
| 308 | Ga0209983_1051038 | 3300027665 | Bacteria | 905 |
| 309 | Ga0209971_1065664 | 3300027682 | Bacteria | 879 |
| 310 | Ga0209974_10007726 | 3300027876 | Bacteria | 3697 |
| 311 | Ga0209974_10015791 | 3300027876 | Bacteria | 2507 |
| 312 | Ga0207428_10032114 | 3300027907 | Bacteria | 4322 |
| 313 | Ga0207428_10039117 | 3300027907 | Bacteria | 3850 |
| 314 | Ga0207428_10162506 | 3300027907 | Bacteria | 1695 |
| 315 | Ga0268265_10661570 | 3300028380 | Bacteria | 1005 |
| 316 | Ga0268265_12207380 | 3300028380 | Bacteria | 557 |
| 317 | Ga0268264_10345792 | 3300028381 | Bacteria | 1414 |
| 318 | Ga0268264_11288247 | 3300028381 | Bacteria | 741 |
| 319 | Ga0265337_1001292 | 3300028556 | Bacteria | 12533 |
| 320 | Ga0265337_1019126 | 3300028556 | Bacteria | 2165 |
| 321 | Ga0265337_1084813 | 3300028556 | Bacteria | 865 |
| 322 | Ga0265326_10001534 | 3300028558 | Bacteria | 8079 |
| 323 | Ga0265326_10020830 | 3300028558 | Bacteria | 1879 |
| 324 | Ga0265319_1000077 | 3300028563 | Bacteria | 75962 |
| 325 | Ga0265319_1000371 | 3300028563 | Bacteria | 32428 |
| 326 | Ga0265319_1044267 | 3300028563 | Bacteria | 1492 |
| 327 | Ga0265334_10000696 | 3300028573 | Bacteria | 16863 |
| 328 | Ga0265334_10004850 | 3300028573 | Bacteria | 5914 |
| 329 | Ga0265334_10124182 | 3300028573 | Bacteria | 921 |
| 330 | Ga0265334_10237244 | 3300028573 | Bacteria | 629 |
| 331 | Ga0265318_10002615 | 3300028577 | Bacteria | 9508 |
| 332 | Ga0265323_10000672 | 3300028653 | Bacteria | 18620 |
| 333 | Ga0265322_10000375 | 3300028654 | Bacteria | 18550 |
| 334 | Ga0265322_10007514 | 3300028654 | Bacteria | 3178 |
| 335 | Ga0265336_10000066 | 3300028666 | Bacteria | 95677 |
| 336 | Ga0265338_10013819 | 3300028800 | Bacteria | 9072 |
| 337 | Ga0265338_10024383 | 3300028800 | Bacteria | 6180 |
| 338 | Ga0265338_10026142 | 3300028800 | Bacteria | 5897 |
| 339 | Ga0265338_10029761 | 3300028800 | Bacteria | 5404 |
| 340 | Ga0265338_10062691 | 3300028800 | Bacteria | 3247 |
| 341 | Ga0265338_10071531 | 3300028800 | Bacteria | 2966 |
| 342 | Ga0265324_10000243 | 3300029957 | Bacteria | 41268 |
| 343 | Ga0265324_10002496 | 3300029957 | Bacteria | 9339 |
| 344 | Ga0265324_10020439 | 3300029957 | Bacteria | 2379 |
| 345 | Ga0265324_10143898 | 3300029957 | Bacteria | 809 |
| 346 | Ga0307511_10009343 | 3300030521 | Bacteria | 9771 |
| 347 | Ga0265330_10000067 | 3300031235 | Bacteria | 91033 |
| 348 | Ga0265330_10022116 | 3300031235 | Bacteria | 2897 |
| 349 | Ga0265332_10000513 | 3300031238 | Bacteria | 26432 |
| 350 | Ga0265332_10014669 | 3300031238 | Bacteria | 3462 |
| 351 | Ga0265332_10074846 | 3300031238 | Bacteria | 1440 |
| 352 | Ga0265328_10002334 | 3300031239 | Bacteria | 8555 |
| 353 | Ga0265320_10000644 | 3300031240 | Bacteria | 26646 |
| 354 | Ga0265320_10000896 | 3300031240 | Bacteria | 22415 |
| 355 | Ga0265320_10057827 | 3300031240 | Bacteria | 1859 |
| 356 | Ga0265325_10034126 | 3300031241 | Bacteria | 2710 |
| 357 | Ga0265329_10000849 | 3300031242 | Bacteria | 15450 |
| 358 | Ga0265340_10002520 | 3300031247 | Bacteria | 10399 |
| 359 | Ga0265340_10009287 | 3300031247 | Bacteria | 5281 |
| 360 | Ga0265339_10001501 | 3300031249 | Bacteria | 17252 |
| 361 | Ga0265339_10103030 | 3300031249 | Bacteria | 1483 |
| 362 | Ga0265339_10224012 | 3300031249 | Bacteria | 918 |
| 363 | Ga0265331_10000271 | 3300031250 | Bacteria | 57462 |
| 364 | Ga0265316_10001501 | 3300031344 | Bacteria | 25011 |
| 365 | Ga0265316_10002576 | 3300031344 | Bacteria | 18724 |
| 366 | Ga0265316_10077876 | 3300031344 | Bacteria | 2546 |
| 367 | Ga0307513_10918868 | 3300031456 | Bacteria | 583 |
| 368 | Ga0265313_10052053 | 3300031595 | Bacteria | 1956 |
| 369 | Ga0265313_10084728 | 3300031595 | Bacteria | 1433 |
| 370 | Ga0316575_10011870 | 3300031665 | Bacteria | 3231 |
| 371 | Ga0316579_10002337 | 3300031691 | Bacteria | 7164 |
| 372 | Ga0265314_10001618 | 3300031711 | Bacteria | 24701 |
| 373 | Ga0265314_10068153 | 3300031711 | Bacteria | 2393 |
| 374 | Ga0265314_10451807 | 3300031711 | Bacteria | 684 |
| 375 | Ga0265342_10001108 | 3300031712 | Bacteria | 25815 |
| 376 | Ga0265342_10003238 | 3300031712 | Bacteria | 13514 |
| 377 | Ga0316576_10044407 | 3300031727 | Bacteria | 3210 |
| 378 | Ga0316576_10052632 | 3300031727 | Bacteria | 2965 |
| 379 | Ga0316576_10077995 | 3300031727 | Bacteria | 2454 |
| 380 | Ga0316576_10203206 | 3300031727 | Bacteria | 1492 |
| 381 | Ga0316576_10967833 | 3300031727 | Bacteria | 607 |
| 382 | Ga0316578_10070350 | 3300031728 | Bacteria | 2071 |
| 383 | Ga0316578_10312920 | 3300031728 | Bacteria | 938 |
| 384 | Ga0316578_10350764 | 3300031728 | Bacteria | 878 |
| 385 | Ga0307405_11192659 | 3300031731 | Bacteria | 658 |
| 386 | Ga0316577_10040071 | 3300031733 | Bacteria | 2620 |
| 387 | Ga0316577_10311058 | 3300031733 | Bacteria | 893 |
| 388 | Ga0316577_10851103 | 3300031733 | Bacteria | 517 |
| 389 | Ga0307413_10770933 | 3300031824 | Bacteria | 806 |
| 390 | Ga0307407_10296565 | 3300031903 | Bacteria | 1126 |
| 391 | Ga0307412_10106226 | 3300031911 | Bacteria | 1996 |
| 392 | Ga0307409_101317614 | 3300031995 | Bacteria | 747 |
| 393 | Ga0307416_100016235 | 3300032002 | Bacteria | 5168 |
| 394 | Ga0307416_100053927 | 3300032002 | Bacteria | 3229 |
| 395 | Ga0307416_100201671 | 3300032002 | Bacteria | 1888 |
| 396 | Ga0307411_10428838 | 3300032005 | Bacteria | 1100 |
| 397 | Ga0316583_10156928 | 3300032133 | Bacteria | 792 |
| 398 | Ga0316585_10053256 | 3300032137 | Bacteria | 1301 |
| 399 | Ga0316580_10039922 | 3300032139 | Bacteria | 1450 |
| 400 | Ga0316593_10002170 | 3300032168 | Bacteria | 4579 |
| 401 | Ga0316593_10003594 | 3300032168 | Bacteria | 3873 |
| 402 | Ga0316593_10004215 | 3300032168 | Bacteria | 3668 |
| 403 | Ga0316593_10010852 | 3300032168 | Bacteria | 2629 |
| 404 | Ga0316593_10020465 | 3300032168 | Bacteria | 2057 |
| 405 | Ga0316593_10023609 | 3300032168 | Bacteria | 1943 |
| 406 | Ga0316593_10026649 | 3300032168 | Bacteria | 1849 |
| 407 | Ga0316593_10027077 | 3300032168 | Bacteria | 1837 |
| 408 | Ga0316593_10033657 | 3300032168 | Bacteria | 1679 |
| 409 | Ga0316593_10255291 | 3300032168 | Bacteria | 657 |
| 410 | Ga0316593_10309901 | 3300032168 | Unclassified | 599 |
| 411 | Ga0316593_10336039 | 3300032168 | Bacteria | 576 |
| 412 | Ga0316592_1034995 | 3300033524 | Bacteria | 1101 |
| 413 | Ga0316587_1097974 | 3300033529 | Bacteria | 563 |
| 414 | Ga0316596_1002322 | 3300033541 | Bacteria | 4044 |
| 415 | Ga0316596_1002914 | 3300033541 | Bacteria | 3707 |
| 416 | Ga0316596_1005115 | 3300033541 | Bacteria | 2982 |
| 417 | Ga0316596_1018195 | 3300033541 | Bacteria | 1774 |
| 418 | Ga0316596_1156428 | 3300033541 | Bacteria | 627 |
| 419 | Ga0373926_0147578 | 3300035083 | Bacteria | 895 |
| 420 | Ga0373934_0000155 | 3300035086 | Bacteria | 24945 |
| 421 | Ga0373923_0044713 | 3300035111 | Bacteria | 1837 |
| 422 | Ga0373932_0000892 | 3300035112 | Bacteria | 8739 |
| 423 | Ga0373936_0019872 | 3300035113 | Bacteria | 2606 |
| 424 | Ga0373941_0145218 | 3300035115 | Bacteria | 866 |
| 425 | Ga0373953_0022062 | 3300035117 | Bacteria | 2396 |
| 426 | Ga0373953_0203965 | 3300035117 | Bacteria | 855 |
| 427 | Ga0373953_0247432 | 3300035117 | Bacteria | 774 |
| 428 | Ga0373953_0249874 | 3300035117 | Bacteria | 771 |
| 429 | Ga0373954_0041553 | 3300035118 | Bacteria | 2144 |
| 430 | Ga0373956_0002379 | 3300035119 | Bacteria | 7684 |
| 431 | Ga0373956_0020785 | 3300035119 | Bacteria | 2797 |
| 432 | Ga0373956_0078131 | 3300035119 | Bacteria | 1516 |
| 433 | Ga0373957_0048347 | 3300035120 | Bacteria | 1620 |
| 434 | Ga0373943_0038288 | 3300035170 | Bacteria | 2305 |
| 435 | Ga0373955_0019792 | 3300035172 | Bacteria | 3370 |
| 436 | Ga0373955_0195991 | 3300035172 | Bacteria | 1202 |
| 437 | Ga0373955_0246256 | 3300035172 | Bacteria | 1071 |
| 438 | Ga0373955_0278103 | 3300035172 | Bacteria | 1007 |
| 439 | Ga0373955_0279704 | 3300035172 | Bacteria | 1004 |
| 440 | Ga0316574_0307400 | 3300035398 | Bacteria | 1008 |
| 441 | Ga0316574_0930433 | 3300035398 | Bacteria | 525 |
| 442 | Ga0373924_0046997 | 3300035410 | Bacteria | 1780 |
| 443 | Ga0373935_0044888 | 3300035692 | Bacteria | 2787 |
| 444 | Ga0373933_0037442 | 3300035724 | Bacteria | 2845 |
| 445 | Ga0373933_0072052 | 3300035724 | Bacteria | 2104 |
| 446 | Ga0373933_0898410 | 3300035724 | Bacteria | 583 |
| 447 | Ga0373947_0310249 | 3300035725 | Bacteria | 1053 |
| 448 | Ga0373937_0011530 | 3300036401 | Bacteria | 7759 |
| 449 | Ga0373937_0018806 | 3300036401 | Bacteria | 6175 |
| 450 | Ga0373937_0116858 | 3300036401 | Bacteria | 2484 |
| 451 | Ga0373937_0132405 | 3300036401 | Bacteria | 2329 |
| 452 | Ga0373937_0368737 | 3300036401 | Bacteria | 1361 |
| 453 | Ga0373937_0483504 | 3300036401 | Bacteria | 1176 |
| 454 | Ga0316582_0009633 | 3300036647 | Bacteria | 5250 |
| 455 | Ga0316582_0093009 | 3300036647 | Bacteria | 1988 |
| 456 | Ga0316584_0044037 | 3300036712 | Bacteria | 3328 |
| 457 | Ga0316584_0114634 | 3300036712 | Bacteria | 2016 |
| 458 | Ga0316584_0280418 | 3300036712 | Unclassified | 1211 |
| 459 | Ga0316584_0317936 | 3300036712 | Bacteria | 1124 |
| 460 | Ga0316584_0343974 | 3300036712 | Bacteria | 1072 |
| 461 | Ga0395899_0153009 | 3300037312 | Bacteria | 1634 |
| 462 | Ga0395905_1043845 | 3300037471 | Bacteria | 720 |
| 463 | Ga0316581_0195927 | 3300037588 | Bacteria | 622 |
| 464 | Ga0400490_24938 | 3300038726 | Bacteria | 1738 |
| 465 | Ga0400483_229260 | 3300039062 | Bacteria | 1781 |
| 466 | Ga0400489_87136 | 3300039093 | Bacteria | 2558 |
| 467 | Ga0400487_12922 | 3300039110 | Bacteria | 1326 |
| 468 | Ga0436365_0605606 | 3300039437 | Bacteria | 64934 |
| 469 | Ga0436365_0745504 | 3300039437 | Bacteria | 1100 |
| 470 | Ga0436362_0309166 | 3300039453 | Bacteria | 15196 |
| 471 | Ga0451787_518704 | 3300041441 | Bacteria | 671 |
| 472 | Ga0451795_0162296 | 3300041456 | Bacteria | 2237 |
| 473 | Ga0451804_1046854 | 3300041463 | Bacteria | 951 |
| 474 | Ga0451852_31128 | 3300041508 | Unclassified | 684 |
| 475 | Ga0451855_0111700 | 3300041511 | Bacteria | 1241 |
| 476 | Ga0451855_0685541 | 3300041511 | Bacteria | 1013 |
| 477 | Ga0451853_2311330 | 3300041512 | Bacteria | 608 |
| 478 | Ga0439434_0081741 | 3300042435 | Bacteria | 1026 |
| 479 | Ga0439434_0138557 | 3300042435 | Bacteria | 801 |
| 480 | Ga0439434_0218463 | 3300042435 | Bacteria | 646 |
| 481 | Ga0451577_0020815 | 3300042876 | Bacteria | 6013 |
| 482 | Ga0451577_0021214 | 3300042876 | Bacteria | 5948 |
| 483 | Ga0451577_0024271 | 3300042876 | Bacteria | 5517 |
| 484 | Ga0451577_0103544 | 3300042876 | Bacteria | 2544 |
| 485 | Ga0466969_0142709 | 3300044656 | Bacteria | 1106 |
| 486 | Ga0466972_0048700 | 3300044658 | Bacteria | 2047 |
| 487 | Ga0453683_0184982 | 3300044673 | Bacteria | 1322 |
| 488 | Ga0453683_0382406 | 3300044673 | Bacteria | 906 |
| 489 | Ga0453684_0010849 | 3300044712 | Bacteria | 15438 |
| 490 | Ga0453684_0116274 | 3300044712 | Bacteria | 3239 |
| 491 | Ga0453684_0165439 | 3300044712 | Bacteria | 2611 |
| 492 | Ga0451576_0005783 | 3300045051 | Bacteria | 15385 |
| 493 | Ga0451576_0021519 | 3300045051 | Bacteria | 7010 |
| 494 | Ga0451576_0382538 | 3300045051 | Bacteria | 1475 |
| 495 | Ga0451576_0595133 | 3300045051 | Bacteria | 1162 |
| 496 | Ga0451576_0706757 | 3300045051 | Bacteria | 1059 |
| 497 | Ga0451576_0900274 | 3300045051 | Bacteria | 928 |
| 498 | Ga0451576_1318978 | 3300045051 | Bacteria | 752 |
| 499 | Ga0451576_2232852 | 3300045051 | Bacteria | 561 |
| 500 | Ga0495627_141526 | 3300046453 | Bacteria | 674 |
| 501 | Ga0495592_0048815 | 3300046454 | Bacteria | 3147 |
| 502 | Ga0495592_0275824 | 3300046454 | Bacteria | 1101 |
| 503 | Ga0495629_0530198 | 3300046459 | Bacteria | 792 |
| 504 | Ga0495629_0746192 | 3300046459 | Bacteria | 648 |
| 505 | Ga0495651_0124692 | 3300046462 | Bacteria | 1887 |
| 506 | Ga0495653_0132982 | 3300046463 | Bacteria | 1758 |
| 507 | Ga0495582_0291481 | 3300046473 | Bacteria | 938 |
| 508 | Ga0495662_0109503 | 3300046476 | Bacteria | 1353 |
| 509 | Ga0495608_0010081 | 3300046511 | Bacteria | 6592 |
| 510 | Ga0495618_0000743 | 3300046514 | Bacteria | 22768 |
| 511 | Ga0495618_0065314 | 3300046514 | Bacteria | 2313 |
| 512 | Ga0495618_0635888 | 3300046514 | Bacteria | 632 |
| 513 | Ga0495628_0038502 | 3300046516 | Bacteria | 3827 |
| 514 | Ga0495628_0101738 | 3300046516 | Bacteria | 2217 |
| 515 | Ga0495630_0775938 | 3300046517 | Bacteria | 732 |
| 516 | Ga0495630_1364538 | 3300046517 | Bacteria | 533 |
| 517 | Ga0495666_0140166 | 3300046526 | Bacteria | 1128 |
| 518 | Ga0495665_0705069 | 3300046531 | Bacteria | 500 |
| 519 | Ga0495640_0071361 | 3300046533 | Bacteria | 2331 |
| 520 | Ga0495587_0015907 | 3300046536 | Bacteria | 4686 |
| 521 | Ga0495667_0006622 | 3300046559 | Bacteria | 7865 |
| 522 | Ga0495634_0334981 | 3300046642 | Bacteria | 909 |
| 523 | Ga0495634_0441993 | 3300046642 | Bacteria | 768 |
| 524 | Ga0495635_0033708 | 3300046663 | Bacteria | 3552 |
| 525 | Ga0495635_0124070 | 3300046663 | Bacteria | 1761 |
| 526 | Ga0495657_0062591 | 3300046675 | Bacteria | 2457 |
| 527 | Ga0495599_0082939 | 3300046678 | Bacteria | 2002 |
| 528 | Ga0495658_0011409 | 3300046683 | Bacteria | 4469 |
| 529 | Ga0495658_0167078 | 3300046683 | Bacteria | 1360 |
| 530 | Ga0495669_0421559 | 3300046684 | Bacteria | 647 |
| 531 | Ga0495669_0617450 | 3300046684 | Bacteria | 527 |
| 532 | Ga0495670_0015230 | 3300046691 | Bacteria | 3781 |
| 533 | Ga0495600_0027945 | 3300046809 | Bacteria | 3648 |
| 534 | Ga0495581_0096460 | 3300047315 | Bacteria | 1717 |
| 535 | Ga0495604_0677604 | 3300047317 | Bacteria | 656 |
| 536 | Ga0495674_0369381 | 3300047319 | Bacteria | 1162 |
| 537 | Ga0495680_0434824 | 3300047322 | Bacteria | 900 |
| 538 | Ga0495680_0834128 | 3300047322 | Bacteria | 600 |
| 539 | Ga0495675_0058692 | 3300047444 | Bacteria | 2439 |
| 540 | Ga0495684_0292235 | 3300047471 | Bacteria | 1173 |
| 541 | Ga0495684_0737051 | 3300047471 | Bacteria | 650 |
| 542 | Ga0495615_0012508 | 3300048090 | Bacteria | 1751 |
| 543 | Ga0496105_0835958 | 3300048908 | Bacteria | 698 |
| 544 | Ga0496109_1018480 | 3300048912 | Bacteria | 766 |
| 545 | Ga0496113_0141000 | 3300048916 | Bacteria | 1897 |
| 546 | Ga0496113_0408800 | 3300048916 | Bacteria | 1090 |
| 547 | Ga0496115_1028825 | 3300048918 | Bacteria | 628 |
| 548 | Ga0501308_027163 | 3300049128 | Bacteria | 751 |
| 549 | Ga0501307_007917 | 3300049162 | Bacteria | 1183 |
| 550 | Ga0501312_043040 | 3300049528 | Bacteria | 743 |
| 551 | Ga0501317_046332 | 3300049533 | Bacteria | 679 |
| 552 | Ga0501031_0210635 | 3300049568 | Bacteria | 1266 |
| 553 | Ga0501032_0525370 | 3300049569 | Bacteria | 755 |
| 554 | Ga0501033_0280476 | 3300049570 | Bacteria | 1176 |
| 555 | Ga0501033_0892794 | 3300049570 | Bacteria | 598 |
| 556 | Ga0501034_0599636 | 3300049571 | Bacteria | 1007 |
| 557 | Ga0501036_0044160 | 3300049572 | Bacteria | 3775 |
| 558 | Ga0501036_0235815 | 3300049572 | Bacteria | 1535 |
| 559 | Ga0501036_1133746 | 3300049572 | Bacteria | 638 |
| 560 | Ga0501037_0201791 | 3300049573 | Bacteria | 1405 |
| 561 | Ga0501039_0186094 | 3300049575 | Bacteria | 1633 |
| 562 | Ga0501039_1024618 | 3300049575 | Bacteria | 641 |
| 563 | Ga0501040_0531260 | 3300049576 | Bacteria | 848 |
| 564 | Ga0501041_0007558 | 3300049577 | Bacteria | 6382 |
| 565 | Ga0501043_0432547 | 3300049579 | Bacteria | 991 |
| 566 | Ga0501046_0176815 | 3300049580 | Bacteria | 1598 |
| 567 | Ga0501048_0334924 | 3300049582 | Bacteria | 1078 |
| 568 | Ga0501069_0622504 | 3300049585 | Bacteria | 649 |
| 569 | Ga0501070_1033437 | 3300049586 | Bacteria | 636 |
| 570 | Ga0501071_0085167 | 3300049587 | Bacteria | 2317 |
| 571 | Ga0501071_0820900 | 3300049587 | Bacteria | 717 |
| 572 | Ga0501073_0228778 | 3300049589 | Bacteria | 1285 |
| 573 | Ga0501075_0016329 | 3300049591 | Bacteria | 5345 |
| 574 | Ga0501075_0292130 | 3300049591 | Bacteria | 1242 |
| 575 | Ga0501076_0220653 | 3300049592 | Bacteria | 1549 |
| 576 | Ga0501076_1164313 | 3300049592 | Bacteria | 635 |
| 577 | Ga0501077_0091102 | 3300049593 | Bacteria | 1932 |
| 578 | Ga0501238_054121 | 3300049671 | Bacteria | 605 |
| 579 | Ga0501079_0073172 | 3300049741 | Bacteria | 2649 |
| 580 | Ga0501079_0954480 | 3300049741 | Bacteria | 675 |
| 581 | Ga0501080_0151123 | 3300049742 | Bacteria | 2146 |
| 582 | Ga0501081_0080260 | 3300049743 | Bacteria | 2283 |
| 583 | Ga0501045_0103757 | 3300049824 | Bacteria | 2106 |
| 584 | nmdc:mga05p37_122849_c2 | 3300050507 | Bacteria | 1685 |
| 585 | nmdc:mga05p37_122920_c1 | 3300050507 | Bacteria | 3188 |
| 586 | nmdc:mga05p37_145535_c1 | 3300050507 | Bacteria | 2902 |
| 587 | nmdc:mga05p37_681234_c1 | 3300050507 | Bacteria | 1146 |
| 588 | nmdc:mga05p37_69189_c1 | 3300050507 | Bacteria | 4342 |
| 589 | nmdc:mga05p37_929992_c1 | 3300050507 | Bacteria | 933 |
| 590 | nmdc:mga09592_20930_c1 | 3300050508 | Bacteria | 5386 |
| 591 | nmdc:mga09592_2536_c1 | 3300050508 | Bacteria | 14783 |
| 592 | nmdc:mga0qj67_249961_c1 | 3300050509 | Bacteria | 1439 |
| 593 | nmdc:mga0qj67_398697_c1 | 3300050509 | Bacteria | 1110 |
| 594 | nmdc:mga06r32_257390_c1 | 3300050510 | Bacteria | 1733 |
| 595 | nmdc:mga06r32_269558_c1 | 3300050510 | Bacteria | 1690 |
| 596 | nmdc:mga06r32_428015_c1 | 3300050510 | Bacteria | 1304 |
| 597 | nmdc:mga08y16_1109369_c1 | 3300050511 | Bacteria | 766 |
| 598 | nmdc:mga08y16_148621_c1 | 3300050511 | Bacteria | 2436 |
| 599 | nmdc:mga08y16_1871379_c1 | 3300050511 | Bacteria | 552 |
| 600 | nmdc:mga08y16_192941_c1 | 3300050511 | Bacteria | 2112 |
| 601 | nmdc:mga08y16_2039663_c1 | 3300050511 | Bacteria | 522 |
| 602 | nmdc:mga08y16_296_c1 | 3300050511 | Bacteria | 44778 |
| 603 | nmdc:mga08y16_52626_c1 | 3300050511 | Bacteria | 4259 |
| 604 | nmdc:mga08y16_560141_c1 | 3300050511 | Bacteria | 1156 |
| 605 | nmdc:mga0n895_1167423_c1 | 3300050512 | Bacteria | 745 |
| 606 | nmdc:mga0n895_547849_c1 | 3300050512 | Bacteria | 1163 |
| 607 | nmdc:mga0n895_6816_c1 | 3300050512 | Bacteria | 9752 |
| 608 | nmdc:mga0n895_94929_c1 | 3300050512 | Bacteria | 2987 |
| 609 | nmdc:mga0n895_952059_c1 | 3300050512 | Bacteria | 842 |
| 610 | nmdc:mga0n895_978469_c1 | 3300050512 | Bacteria | 828 |
| 611 | nmdc:mga0rr50_155917_c1 | 3300050513 | Bacteria | 1849 |
| 612 | nmdc:mga0rr50_161_c1 | 3300050513 | Bacteria | 36290 |
| 613 | nmdc:mga0rr50_293289_c1 | 3300050513 | Bacteria | 1359 |
| 614 | nmdc:mga0rr50_302456_c1 | 3300050513 | Bacteria | 1338 |
| 615 | nmdc:mga0rr50_8536_c1 | 3300050513 | Bacteria | 6382 |
| 616 | nmdc:mga08x19_12478_c1 | 3300050514 | Bacteria | 5121 |
| 617 | nmdc:mga08x19_164879_c1 | 3300050514 | Bacteria | 1506 |
| 618 | nmdc:mga08x19_458603_c1 | 3300050514 | Bacteria | 897 |
| 619 | nmdc:mga08x19_70185_c1 | 3300050514 | Bacteria | 2282 |
| 620 | nmdc:mga0a205_48594_c1 | 3300050515 | Bacteria | 4095 |
| 621 | nmdc:mga0a205_799934_c1 | 3300050515 | Bacteria | 791 |
| 622 | Ga0495595_0002299 | 3300053084 | Bacteria | 7449 |
| 623 | Ga0495619_0156748 | 3300053085 | Bacteria | 1571 |
| 624 | Ga0495619_0300763 | 3300053085 | Bacteria | 1111 |
| 625 | Ga0501084_0182708 | 3300054114 | Bacteria | 1770 |
| 626 | Ga0501084_1290496 | 3300054114 | Bacteria | 612 |
| 627 | Ga0590071_000996 | 3300059421 | Bacteria | 7735 |
| 628 | Ga0590074_089481 | 3300059423 | Bacteria | 594 |
| 629 | Ga0590075_014748 | 3300059424 | Bacteria | 1912 |
| 630 | Ga0590077_006869 | 3300059426 | Bacteria | 2331 |
| 631 | Ga0587070_136153 | 3300059491 | Bacteria | 602 |
| 632 | Ga0587077_056032 | 3300059493 | Bacteria | 840 |
| 633 | Ga0587062_030255 | 3300059639 | Bacteria | 825 |
| 634 | Ga0587072_137844 | 3300059643 | Bacteria | 580 |
| 635 | Ga0587110_039101 | 3300059654 | Bacteria | 604 |
| 636 | Ga0501082_0022686 | 3300060353 | Bacteria | 5405 |
| 637 | Ga0501082_0777342 | 3300060353 | Bacteria | 838 |
| 638 | Ga0530510_0103782 | 3300061734 | Bacteria | 2079 |
| 639 | Ga0530510_1112046 | 3300061734 | Bacteria | 605 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300004803 | Ga0058862_10098853 | Ga0058862_100988531 | 110 |
| 2 | 3300009094 | Ga0111539_10000254 | Ga0111539_1000025438 | 112 |
| 3 | 3300046459 | Ga0495629_0530198 | Ga0495629_0530198_401_757 | 112 |
| 4 | 3300047317 | Ga0495604_0677604 | Ga0495604_0677604_12_368 | 112 |
| 5 | 3300011119 | Ga0105246_10340070 | Ga0105246_103400702 | 113 |
| 6 | 3300032168 | Ga0316593_10002170 | Ga0316593_100021706 | 113 |
| 7 | 3300005539 | Ga0068853_102207801 | Ga0068853_1022078011 | 114 |
| 8 | 3300005549 | Ga0070704_100358563 | Ga0070704_1003585632 | 115 |
| 9 | 3300046684 | Ga0495669_0617450 | Ga0495669_0617450_68_493 | 116 |
| 10 | 3300048912 | Ga0496109_1018480 | Ga0496109_1018480_232_678 | 118 |
| 11 | 3300032168 | Ga0316593_10003594 | Ga0316593_100035945 | 120 |
| 12 | 3300044658 | Ga0466972_0048700 | Ga0466972_0048700_152_595 | 120 |
| 13 | 3300049671 | Ga0501238_054121 | Ga0501238_054121_120_563 | 120 |
| 14 | 3300009177 | Ga0105248_11656144 | Ga0105248_116561441 | 122 |
| 15 | 3300035117 | Ga0373953_0249874 | Ga0373953_0249874_304_729 | 123 |
| 16 | 3300046476 | Ga0495662_0109503 | Ga0495662_0109503_275_700 | 124 |
| 17 | 3300005459 | Ga0068867_100760756 | Ga0068867_1007607561 | 125 |
| 18 | 3300031235 | Ga0265330_10022116 | Ga0265330_100221167 | 125 |
| 19 | 3300033541 | Ga0316596_1156428 | Ga0316596_11564281 | 125 |
| 20 | 3300035117 | Ga0373953_0247432 | Ga0373953_0247432_358_759 | 125 |
| 21 | 3300035119 | Ga0373956_0078131 | Ga0373956_0078131_19_420 | 125 |
| 22 | 3300046531 | Ga0495665_0705069 | Ga0495665_0705069_26_427 | 125 |
| 23 | 3300005471 | Ga0070698_100289130 | Ga0070698_1002891303 | 127 |
| 24 | 3300005545 | Ga0070695_100031080 | Ga0070695_1000310805 | 127 |
| 25 | 3300046516 | Ga0495628_0101738 | Ga0495628_0101738_11_412 | 127 |
| 26 | 3300049592 | Ga0501076_1164313 | Ga0501076_1164313_217_621 | 127 |
| 27 | 3300050513 | nmdc:mga0rr50_155917_c1 | nmdc:mga0rr50_155917_c1_1047_1448 | 127 |
| 28 | 3300004800 | Ga0058861_11795149 | Ga0058861_117951491 | 128 |
| 29 | 3300005333 | Ga0070677_10204613 | Ga0070677_102046132 | 128 |
| 30 | 3300005367 | Ga0070667_101483196 | Ga0070667_1014831961 | 128 |
| 31 | 3300005438 | Ga0070701_11107334 | Ga0070701_111073341 | 128 |
| 32 | 3300005444 | Ga0070694_100086832 | Ga0070694_1000868321 | 128 |
| 33 | 3300005444 | Ga0070694_100944466 | Ga0070694_1009444661 | 128 |
| 34 | 3300005456 | Ga0070678_100603764 | Ga0070678_1006037642 | 128 |
| 35 | 3300005719 | Ga0068861_100260811 | Ga0068861_1002608112 | 128 |
| 36 | 3300006051 | Ga0075364_10020198 | Ga0075364_100201985 | 128 |
| 37 | 3300006177 | Ga0075362_10012980 | Ga0075362_100129805 | 128 |
| 38 | 3300006844 | Ga0075428_100839747 | Ga0075428_1008397472 | 128 |
| 39 | 3300006852 | Ga0075433_11042784 | Ga0075433_110427841 | 128 |
| 40 | 3300009094 | Ga0111539_10066486 | Ga0111539_100664866 | 128 |
| 41 | 3300009147 | Ga0114129_10001925 | Ga0114129_100019255 | 128 |
| 42 | 3300009147 | Ga0114129_10037064 | Ga0114129_1003706411 | 128 |
| 43 | 3300009148 | Ga0105243_11019192 | Ga0105243_110191922 | 128 |
| 44 | 3300025913 | Ga0207695_10157699 | Ga0207695_101576992 | 128 |
| 45 | 3300025933 | Ga0207706_11219705 | Ga0207706_112197051 | 128 |
| 46 | 3300026118 | Ga0207675_100861274 | Ga0207675_1008612742 | 128 |
| 47 | 3300031911 | Ga0307412_10106226 | Ga0307412_101062261 | 128 |
| 48 | 3300032002 | Ga0307416_100016235 | Ga0307416_1000162355 | 128 |
| 49 | 3300035172 | Ga0373955_0279704 | Ga0373955_0279704_12_416 | 128 |
| 50 | 3300042876 | Ga0451577_0020815 | Ga0451577_0020815_5362_5766 | 128 |
| 51 | 3300045051 | Ga0451576_0021519 | Ga0451576_0021519_5343_5747 | 128 |
| 52 | 3300045051 | Ga0451576_2232852 | Ga0451576_2232852_18_422 | 128 |
| 53 | 3300046473 | Ga0495582_0291481 | Ga0495582_0291481_281_685 | 128 |
| 54 | 3300046514 | Ga0495618_0000743 | Ga0495618_0000743_21038_21442 | 128 |
| 55 | 3300046663 | Ga0495635_0033708 | Ga0495635_0033708_90_494 | 128 |
| 56 | 3300047322 | Ga0495680_0834128 | Ga0495680_0834128_10_414 | 128 |
| 57 | 3300050507 | nmdc:mga05p37_69189_c1 | nmdc:mga05p37_69189_c1_2726_3130 | 128 |
| 58 | 3300050511 | nmdc:mga08y16_1871379_c1 | nmdc:mga08y16_1871379_c1_14_418 | 128 |
| 59 | 3300050511 | nmdc:mga08y16_52626_c1 | nmdc:mga08y16_52626_c1_808_1212 | 128 |
| 60 | 3300050512 | nmdc:mga0n895_6816_c1 | nmdc:mga0n895_6816_c1_1405_1809 | 128 |
| 61 | 3300050513 | nmdc:mga0rr50_302456_c1 | nmdc:mga0rr50_302456_c1_193_597 | 128 |
| 62 | 3300050515 | nmdc:mga0a205_48594_c1 | nmdc:mga0a205_48594_c1_2395_2799 | 128 |
| 63 | 3300053085 | Ga0495619_0300763 | Ga0495619_0300763_189_593 | 128 |
| 64 | 3300059421 | Ga0590071_000996 | Ga0590071_000996_125_529 | 128 |
| 65 | 3300059423 | Ga0590074_089481 | Ga0590074_089481_104_508 | 128 |
| 66 | 3300059424 | Ga0590075_014748 | Ga0590075_014748_1381_1785 | 128 |
| 67 | 3300059426 | Ga0590077_006869 | Ga0590077_006869_1865_2269 | 128 |
| 68 | 3300060353 | Ga0501082_0777342 | Ga0501082_0777342_23_427 | 128 |
| 69 | 3300061734 | Ga0530510_1112046 | Ga0530510_1112046_189_593 | 128 |
| 70 | 3300003371 | JGI26145J50221_1033850 | JGI26145J50221_10338501 | 129 |
| 71 | 3300005406 | Ga0070703_10586165 | Ga0070703_105861651 | 129 |
| 72 | 3300005530 | Ga0070679_101472261 | Ga0070679_1014722611 | 129 |
| 73 | 3300005548 | Ga0070665_101768127 | Ga0070665_1017681272 | 129 |
| 74 | 3300005564 | Ga0070664_100151761 | Ga0070664_1001517613 | 129 |
| 75 | 3300026041 | Ga0207639_10618394 | Ga0207639_106183941 | 129 |
| 76 | 3300026075 | Ga0207708_10274129 | Ga0207708_102741292 | 129 |
| 77 | 3300026088 | Ga0207641_10360078 | Ga0207641_103600782 | 129 |
| 78 | 3300026116 | Ga0207674_10146828 | Ga0207674_101468282 | 129 |
| 79 | 3300027665 | Ga0209983_1051038 | Ga0209983_10510382 | 129 |
| 80 | 3300027876 | Ga0209974_10007726 | Ga0209974_100077265 | 129 |
| 81 | 3300032002 | Ga0307416_100201671 | Ga0307416_1002016713 | 129 |
| 82 | 3300033524 | Ga0316592_1034995 | Ga0316592_10349952 | 129 |
| 83 | 3300033541 | Ga0316596_1018195 | Ga0316596_10181952 | 129 |
| 84 | 3300037471 | Ga0395905_1043845 | Ga0395905_1043845_95_520 | 129 |
| 85 | 3300048908 | Ga0496105_0835958 | Ga0496105_0835958_129_554 | 129 |
| 86 | 3300048916 | Ga0496113_0141000 | Ga0496113_0141000_701_1126 | 129 |
| 87 | iso_pu_bacteria | 2523533628 | 2524003000 | 131 |
| 88 | iso_pu_bacteria | 2554235469 | 2556065811 | 131 |
| 89 | iso_pu_bacteria | 2711768088 | 2712198851 | 131 |
| 90 | iso_pu_bacteria | 8007371054 | 8007374829 | 131 |
| 91 | 3300031456 | Ga0307513_10918868 | Ga0307513_109188681 | 132 |
| 92 | 3300048090 | Ga0495615_0012508 | Ga0495615_0012508_1252_1695 | 132 |
| 93 | 3300049162 | Ga0501307_007917 | Ga0501307_007917_401_823 | 132 |
| 94 | 3300005435 | Ga0070714_100205774 | Ga0070714_1002057742 | 133 |
| 95 | 3300025929 | Ga0207664_10348206 | Ga0207664_103482062 | 133 |
| 96 | 3300041441 | Ga0451787_518704 | Ga0451787_518704_186_626 | 133 |
| 97 | 3300041463 | Ga0451804_1046854 | Ga0451804_1046854_364_804 | 133 |
| 98 | 3300041512 | Ga0451853_2311330 | Ga0451853_2311330_84_524 | 133 |
| 99 | 3300049128 | Ga0501308_027163 | Ga0501308_027163_178_618 | 133 |
| 100 | 3300049533 | Ga0501317_046332 | Ga0501317_046332_176_616 | 133 |
| 101 | 3300059639 | Ga0587062_030255 | Ga0587062_030255_134_574 | 133 |
| 102 | 3300003373 | JGI25407J50210_10004185 | JGI25407J50210_100041855 | 134 |
| 103 | 3300005340 | Ga0070689_100004116 | Ga0070689_1000041162 | 134 |
| 104 | 3300005367 | Ga0070667_100787605 | Ga0070667_1007876052 | 134 |
| 105 | 3300005367 | Ga0070667_101564654 | Ga0070667_1015646541 | 134 |
| 106 | 3300005437 | Ga0070710_11097853 | Ga0070710_110978531 | 134 |
| 107 | 3300005444 | Ga0070694_100136870 | Ga0070694_1001368702 | 134 |
| 108 | 3300005445 | Ga0070708_100520867 | Ga0070708_1005208672 | 134 |
| 109 | 3300005445 | Ga0070708_101140576 | Ga0070708_1011405761 | 134 |
| 110 | 3300005456 | Ga0070678_100364847 | Ga0070678_1003648472 | 134 |
| 111 | 3300005467 | Ga0070706_100024463 | Ga0070706_1000244634 | 134 |
| 112 | 3300005467 | Ga0070706_100042452 | Ga0070706_1000424525 | 134 |
| 113 | 3300005468 | Ga0070707_100057767 | Ga0070707_1000577672 | 134 |
| 114 | 3300005471 | Ga0070698_100981819 | Ga0070698_1009818192 | 134 |
| 115 | 3300005518 | Ga0070699_100042737 | Ga0070699_1000427372 | 134 |
| 116 | 3300005518 | Ga0070699_101311615 | Ga0070699_1013116151 | 134 |
| 117 | 3300005536 | Ga0070697_100141520 | Ga0070697_1001415201 | 134 |
| 118 | 3300005536 | Ga0070697_100159513 | Ga0070697_1001595133 | 134 |
| 119 | 3300005536 | Ga0070697_100242721 | Ga0070697_1002427212 | 134 |
| 120 | 3300005539 | Ga0068853_100854765 | Ga0068853_1008547652 | 134 |
| 121 | 3300005543 | Ga0070672_100000645 | Ga0070672_1000006455 | 134 |
| 122 | 3300005545 | Ga0070695_100006106 | Ga0070695_1000061066 | 134 |
| 123 | 3300005618 | Ga0068864_100000025 | Ga0068864_100000025241 | 134 |
| 124 | 3300005841 | Ga0068863_100856962 | Ga0068863_1008569622 | 134 |
| 125 | 3300005842 | Ga0068858_100000126 | Ga0068858_10000012679 | 134 |
| 126 | 3300005981 | Ga0081538_10001550 | Ga0081538_1000155013 | 134 |
| 127 | 3300005981 | Ga0081538_10002952 | Ga0081538_1000295212 | 134 |
| 128 | 3300005981 | Ga0081538_10005210 | Ga0081538_100052109 | 134 |
| 129 | 3300005981 | Ga0081538_10012332 | Ga0081538_1001233212 | 134 |
| 130 | 3300005981 | Ga0081538_10018001 | Ga0081538_100180014 | 134 |
| 131 | 3300005981 | Ga0081538_10019455 | Ga0081538_100194553 | 134 |
| 132 | 3300006173 | Ga0070716_101489893 | Ga0070716_1014898932 | 134 |
| 133 | 3300006871 | Ga0075434_100172980 | Ga0075434_1001729804 | 134 |
| 134 | 3300006881 | Ga0068865_100792684 | Ga0068865_1007926842 | 134 |
| 135 | 3300006914 | Ga0075436_100015219 | Ga0075436_1000152193 | 134 |
| 136 | 3300007076 | Ga0075435_100019811 | Ga0075435_1000198115 | 134 |
| 137 | 3300009094 | Ga0111539_10051057 | Ga0111539_100510575 | 134 |
| 138 | 3300009094 | Ga0111539_11000809 | Ga0111539_110008092 | 134 |
| 139 | 3300009098 | Ga0105245_10003274 | Ga0105245_1000327413 | 134 |
| 140 | 3300009147 | Ga0114129_10441641 | Ga0114129_104416413 | 134 |
| 141 | 3300009177 | Ga0105248_10306898 | Ga0105248_103068981 | 134 |
| 142 | 3300013297 | Ga0157378_10190755 | Ga0157378_101907556 | 134 |
| 143 | 3300013297 | Ga0157378_11308407 | Ga0157378_113084071 | 134 |
| 144 | 3300013308 | Ga0157375_10001186 | Ga0157375_100011867 | 134 |
| 145 | 3300014326 | Ga0157380_10023433 | Ga0157380_100234335 | 134 |
| 146 | 3300014745 | Ga0157377_10311529 | Ga0157377_103115292 | 134 |
| 147 | 3300025899 | Ga0207642_10216726 | Ga0207642_102167261 | 134 |
| 148 | 3300025910 | Ga0207684_10028407 | Ga0207684_1002840710 | 134 |
| 149 | 3300025920 | Ga0207649_11305117 | Ga0207649_113051171 | 134 |
| 150 | 3300025922 | Ga0207646_10051275 | Ga0207646_100512755 | 134 |
| 151 | 3300025927 | Ga0207687_10002004 | Ga0207687_100020044 | 134 |
| 152 | 3300025936 | Ga0207670_10001935 | Ga0207670_100019355 | 134 |
| 153 | 3300025938 | Ga0207704_10745347 | Ga0207704_107453472 | 134 |
| 154 | 3300025940 | Ga0207691_10002381 | Ga0207691_1000238114 | 134 |
| 155 | 3300025941 | Ga0207711_10113179 | Ga0207711_101131792 | 134 |
| 156 | 3300026035 | Ga0207703_10000653 | Ga0207703_100006537 | 134 |
| 157 | 3300026035 | Ga0207703_11086094 | Ga0207703_110860941 | 134 |
| 158 | 3300026089 | Ga0207648_10166559 | Ga0207648_101665591 | 134 |
| 159 | 3300026095 | Ga0207676_10000002 | Ga0207676_100000021073 | 134 |
| 160 | 3300031665 | Ga0316575_10011870 | Ga0316575_100118703 | 134 |
| 161 | 3300031691 | Ga0316579_10002337 | Ga0316579_100023373 | 134 |
| 162 | 3300031727 | Ga0316576_10077995 | Ga0316576_100779955 | 134 |
| 163 | 3300031727 | Ga0316576_10203206 | Ga0316576_102032062 | 134 |
| 164 | 3300031727 | Ga0316576_10967833 | Ga0316576_109678331 | 134 |
| 165 | 3300031728 | Ga0316578_10070350 | Ga0316578_100703502 | 134 |
| 166 | 3300031728 | Ga0316578_10350764 | Ga0316578_103507642 | 134 |
| 167 | 3300031733 | Ga0316577_10040071 | Ga0316577_100400715 | 134 |
| 168 | 3300031733 | Ga0316577_10311058 | Ga0316577_103110582 | 134 |
| 169 | 3300031824 | Ga0307413_10770933 | Ga0307413_107709332 | 134 |
| 170 | 3300031903 | Ga0307407_10296565 | Ga0307407_102965652 | 134 |
| 171 | 3300031995 | Ga0307409_101317614 | Ga0307409_1013176142 | 134 |
| 172 | 3300032002 | Ga0307416_100053927 | Ga0307416_1000539273 | 134 |
| 173 | 3300032005 | Ga0307411_10428838 | Ga0307411_104288382 | 134 |
| 174 | 3300032133 | Ga0316583_10156928 | Ga0316583_101569282 | 134 |
| 175 | 3300032137 | Ga0316585_10053256 | Ga0316585_100532563 | 134 |
| 176 | 3300032139 | Ga0316580_10039922 | Ga0316580_100399222 | 134 |
| 177 | 3300032168 | Ga0316593_10004215 | Ga0316593_100042156 | 134 |
| 178 | 3300032168 | Ga0316593_10010852 | Ga0316593_100108521 | 134 |
| 179 | 3300032168 | Ga0316593_10020465 | Ga0316593_100204653 | 134 |
| 180 | 3300032168 | Ga0316593_10023609 | Ga0316593_100236093 | 134 |
| 181 | 3300032168 | Ga0316593_10027077 | Ga0316593_100270772 | 134 |
| 182 | 3300033529 | Ga0316587_1097974 | Ga0316587_10979741 | 134 |
| 183 | 3300033541 | Ga0316596_1002322 | Ga0316596_10023224 | 134 |
| 184 | 3300033541 | Ga0316596_1002914 | Ga0316596_10029144 | 134 |
| 185 | 3300033541 | Ga0316596_1005115 | Ga0316596_10051155 | 134 |
| 186 | 3300035398 | Ga0316574_0930433 | Ga0316574_0930433_24_446 | 134 |
| 187 | 3300036647 | Ga0316582_0009633 | Ga0316582_0009633_4290_4712 | 134 |
| 188 | 3300036712 | Ga0316584_0044037 | Ga0316584_0044037_2359_2781 | 134 |
| 189 | 3300036712 | Ga0316584_0114634 | Ga0316584_0114634_643_1065 | 134 |
| 190 | 3300036712 | Ga0316584_0280418 | Ga0316584_0280418_349_771 | 134 |
| 191 | 3300036712 | Ga0316584_0317936 | Ga0316584_0317936_397_819 | 134 |
| 192 | 3300039093 | Ga0400489_87136 | Ga0400489_87136_965_1387 | 134 |
| 193 | 3300039110 | Ga0400487_12922 | Ga0400487_12922_732_1154 | 134 |
| 194 | 3300039437 | Ga0436365_0745504 | Ga0436365_0745504_643_1065 | 134 |
| 195 | 3300048918 | Ga0496115_1028825 | Ga0496115_1028825_34_456 | 134 |
| 196 | 3300049528 | Ga0501312_043040 | Ga0501312_043040_278_706 | 134 |
| 197 | 3300049589 | Ga0501073_0228778 | Ga0501073_0228778_223_645 | 134 |
| 198 | 3300050507 | nmdc:mga05p37_145535_c1 | nmdc:mga05p37_145535_c1_2408_2830 | 134 |
| 199 | 3300050511 | nmdc:mga08y16_1109369_c1 | nmdc:mga08y16_1109369_c1_198_620 | 134 |
| 200 | 3300050511 | nmdc:mga08y16_192941_c1 | nmdc:mga08y16_192941_c1_644_1066 | 134 |
| 201 | 3300050513 | nmdc:mga0rr50_161_c1 | nmdc:mga0rr50_161_c1_6125_6547 | 134 |
| 202 | 3300050514 | nmdc:mga08x19_12478_c1 | nmdc:mga08x19_12478_c1_3947_4369 | 134 |
| 203 | 3300001991 | JGI24743J22301_10028884 | JGI24743J22301_100288841 | 135 |
| 204 | 3300002459 | JGI24751J29686_10121017 | JGI24751J29686_101210171 | 135 |
| 205 | 3300004785 | Ga0058858_1299979 | Ga0058858_12999791 | 135 |
| 206 | 3300004798 | Ga0058859_10054700 | Ga0058859_100547003 | 135 |
| 207 | 3300004798 | Ga0058859_10108115 | Ga0058859_101081152 | 135 |
| 208 | 3300004798 | Ga0058859_10131413 | Ga0058859_101314132 | 135 |
| 209 | 3300004798 | Ga0058859_11564291 | Ga0058859_115642911 | 135 |
| 210 | 3300004801 | Ga0058860_10195543 | Ga0058860_101955431 | 135 |
| 211 | 3300004803 | Ga0058862_12700650 | Ga0058862_127006501 | 135 |
| 212 | 3300005293 | Ga0065715_10179465 | Ga0065715_101794653 | 135 |
| 213 | 3300005295 | Ga0065707_10598467 | Ga0065707_105984671 | 135 |
| 214 | 3300005327 | Ga0070658_10020602 | Ga0070658_1002060210 | 135 |
| 215 | 3300005329 | Ga0070683_100000118 | Ga0070683_10000011833 | 135 |
| 216 | 3300005330 | Ga0070690_100028743 | Ga0070690_1000287435 | 135 |
| 217 | 3300005330 | Ga0070690_100619142 | Ga0070690_1006191421 | 135 |
| 218 | 3300005330 | Ga0070690_100917987 | Ga0070690_1009179871 | 135 |
| 219 | 3300005331 | Ga0070670_100005117 | Ga0070670_10000511717 | 135 |
| 220 | 3300005331 | Ga0070670_100136162 | Ga0070670_1001361624 | 135 |
| 221 | 3300005331 | Ga0070670_100212412 | Ga0070670_1002124122 | 135 |
| 222 | 3300005334 | Ga0068869_100144565 | Ga0068869_1001445655 | 135 |
| 223 | 3300005334 | Ga0068869_101541980 | Ga0068869_1015419801 | 135 |
| 224 | 3300005336 | Ga0070680_101076595 | Ga0070680_1010765951 | 135 |
| 225 | 3300005336 | Ga0070680_101211617 | Ga0070680_1012116172 | 135 |
| 226 | 3300005337 | Ga0070682_100000004 | Ga0070682_1000000049 | 135 |
| 227 | 3300005337 | Ga0070682_100287714 | Ga0070682_1002877141 | 135 |
| 228 | 3300005338 | Ga0068868_100000927 | Ga0068868_10000092724 | 135 |
| 229 | 3300005340 | Ga0070689_100002507 | Ga0070689_1000025078 | 135 |
| 230 | 3300005340 | Ga0070689_100074023 | Ga0070689_1000740232 | 135 |
| 231 | 3300005340 | Ga0070689_100162060 | Ga0070689_1001620603 | 135 |
| 232 | 3300005340 | Ga0070689_100166284 | Ga0070689_1001662843 | 135 |
| 233 | 3300005343 | Ga0070687_100039402 | Ga0070687_1000394026 | 135 |
| 234 | 3300005343 | Ga0070687_100124434 | Ga0070687_1001244342 | 135 |
| 235 | 3300005344 | Ga0070661_101280450 | Ga0070661_1012804501 | 135 |
| 236 | 3300005345 | Ga0070692_10159911 | Ga0070692_101599112 | 135 |
| 237 | 3300005353 | Ga0070669_100440231 | Ga0070669_1004402312 | 135 |
| 238 | 3300005354 | Ga0070675_100003283 | Ga0070675_10000328315 | 135 |
| 239 | 3300005355 | Ga0070671_100497651 | Ga0070671_1004976512 | 135 |
| 240 | 3300005355 | Ga0070671_100768595 | Ga0070671_1007685951 | 135 |
| 241 | 3300005365 | Ga0070688_100069163 | Ga0070688_1000691634 | 135 |
| 242 | 3300005365 | Ga0070688_100084260 | Ga0070688_1000842605 | 135 |
| 243 | 3300005365 | Ga0070688_100146702 | Ga0070688_1001467022 | 135 |
| 244 | 3300005365 | Ga0070688_101334019 | Ga0070688_1013340191 | 135 |
| 245 | 3300005367 | Ga0070667_101365343 | Ga0070667_1013653432 | 135 |
| 246 | 3300005406 | Ga0070703_10165314 | Ga0070703_101653142 | 135 |
| 247 | 3300005436 | Ga0070713_100020740 | Ga0070713_10002074010 | 135 |
| 248 | 3300005439 | Ga0070711_100016016 | Ga0070711_1000160165 | 135 |
| 249 | 3300005440 | Ga0070705_101054307 | Ga0070705_1010543071 | 135 |
| 250 | 3300005441 | Ga0070700_100125572 | Ga0070700_1001255721 | 135 |
| 251 | 3300005441 | Ga0070700_100312930 | Ga0070700_1003129301 | 135 |
| 252 | 3300005441 | Ga0070700_101938246 | Ga0070700_1019382461 | 135 |
| 253 | 3300005444 | Ga0070694_101354336 | Ga0070694_1013543361 | 135 |
| 254 | 3300005445 | Ga0070708_100043823 | Ga0070708_1000438235 | 135 |
| 255 | 3300005466 | Ga0070685_10006013 | Ga0070685_100060133 | 135 |
| 256 | 3300005467 | Ga0070706_100174116 | Ga0070706_1001741162 | 135 |
| 257 | 3300005467 | Ga0070706_100980556 | Ga0070706_1009805561 | 135 |
| 258 | 3300005468 | Ga0070707_100298445 | Ga0070707_1002984452 | 135 |
| 259 | 3300005468 | Ga0070707_100500589 | Ga0070707_1005005891 | 135 |
| 260 | 3300005468 | Ga0070707_101366960 | Ga0070707_1013669601 | 135 |
| 261 | 3300005518 | Ga0070699_100245148 | Ga0070699_1002451482 | 135 |
| 262 | 3300005535 | Ga0070684_100004380 | Ga0070684_1000043805 | 135 |
| 263 | 3300005536 | Ga0070697_100430910 | Ga0070697_1004309101 | 135 |
| 264 | 3300005544 | Ga0070686_100015810 | Ga0070686_1000158104 | 135 |
| 265 | 3300005544 | Ga0070686_100123070 | Ga0070686_1001230705 | 135 |
| 266 | 3300005544 | Ga0070686_100618046 | Ga0070686_1006180462 | 135 |
| 267 | 3300005544 | Ga0070686_101441635 | Ga0070686_1014416351 | 135 |
| 268 | 3300005545 | Ga0070695_100151664 | Ga0070695_1001516643 | 135 |
| 269 | 3300005547 | Ga0070693_100079597 | Ga0070693_1000795972 | 135 |
| 270 | 3300005549 | Ga0070704_100045604 | Ga0070704_1000456046 | 135 |
| 271 | 3300005549 | Ga0070704_100175096 | Ga0070704_1001750962 | 135 |
| 272 | 3300005549 | Ga0070704_100210687 | Ga0070704_1002106872 | 135 |
| 273 | 3300005549 | Ga0070704_100214293 | Ga0070704_1002142933 | 135 |
| 274 | 3300005549 | Ga0070704_100319935 | Ga0070704_1003199351 | 135 |
| 275 | 3300005577 | Ga0068857_100085364 | Ga0068857_1000853642 | 135 |
| 276 | 3300005577 | Ga0068857_100415904 | Ga0068857_1004159042 | 135 |
| 277 | 3300005577 | Ga0068857_101363645 | Ga0068857_1013636452 | 135 |
| 278 | 3300005615 | Ga0070702_100087415 | Ga0070702_1000874152 | 135 |
| 279 | 3300005615 | Ga0070702_100159474 | Ga0070702_1001594744 | 135 |
| 280 | 3300005615 | Ga0070702_100271565 | Ga0070702_1002715652 | 135 |
| 281 | 3300005615 | Ga0070702_101355050 | Ga0070702_1013550501 | 135 |
| 282 | 3300005617 | Ga0068859_100096765 | Ga0068859_1000967652 | 135 |
| 283 | 3300005617 | Ga0068859_100944974 | Ga0068859_1009449742 | 135 |
| 284 | 3300005617 | Ga0068859_101334740 | Ga0068859_1013347402 | 135 |
| 285 | 3300005618 | Ga0068864_100118935 | Ga0068864_1001189354 | 135 |
| 286 | 3300005618 | Ga0068864_100178104 | Ga0068864_1001781042 | 135 |
| 287 | 3300005618 | Ga0068864_100683246 | Ga0068864_1006832461 | 135 |
| 288 | 3300005719 | Ga0068861_100085703 | Ga0068861_1000857035 | 135 |
| 289 | 3300005840 | Ga0068870_10069881 | Ga0068870_100698815 | 135 |
| 290 | 3300005840 | Ga0068870_10134631 | Ga0068870_101346313 | 135 |
| 291 | 3300005841 | Ga0068863_100059485 | Ga0068863_1000594856 | 135 |
| 292 | 3300005841 | Ga0068863_100422201 | Ga0068863_1004222013 | 135 |
| 293 | 3300005842 | Ga0068858_100945023 | Ga0068858_1009450232 | 135 |
| 294 | 3300005843 | Ga0068860_100237940 | Ga0068860_1002379403 | 135 |
| 295 | 3300005843 | Ga0068860_100773714 | Ga0068860_1007737142 | 135 |
| 296 | 3300005843 | Ga0068860_100800955 | Ga0068860_1008009552 | 135 |
| 297 | 3300005844 | Ga0068862_100771770 | Ga0068862_1007717701 | 135 |
| 298 | 3300005981 | Ga0081538_10271366 | Ga0081538_102713662 | 135 |
| 299 | 3300006028 | Ga0070717_10000358 | Ga0070717_1000035827 | 135 |
| 300 | 3300006058 | Ga0075432_10039752 | Ga0075432_100397521 | 135 |
| 301 | 3300006163 | Ga0070715_10182770 | Ga0070715_101827702 | 135 |
| 302 | 3300006173 | Ga0070716_100562939 | Ga0070716_1005629392 | 135 |
| 303 | 3300006358 | Ga0068871_100883353 | Ga0068871_1008833532 | 135 |
| 304 | 3300006844 | Ga0075428_100031483 | Ga0075428_1000314836 | 135 |
| 305 | 3300006844 | Ga0075428_100205418 | Ga0075428_1002054182 | 135 |
| 306 | 3300006844 | Ga0075428_100275866 | Ga0075428_1002758662 | 135 |
| 307 | 3300006844 | Ga0075428_100438204 | Ga0075428_1004382042 | 135 |
| 308 | 3300006844 | Ga0075428_100450526 | Ga0075428_1004505262 | 135 |
| 309 | 3300006846 | Ga0075430_100093180 | Ga0075430_1000931803 | 135 |
| 310 | 3300006846 | Ga0075430_100787156 | Ga0075430_1007871562 | 135 |
| 311 | 3300006846 | Ga0075430_100972839 | Ga0075430_1009728391 | 135 |
| 312 | 3300006852 | Ga0075433_10033580 | Ga0075433_100335806 | 135 |
| 313 | 3300006852 | Ga0075433_10311866 | Ga0075433_103118662 | 135 |
| 314 | 3300006852 | Ga0075433_10375920 | Ga0075433_103759202 | 135 |
| 315 | 3300006852 | Ga0075433_11233138 | Ga0075433_112331381 | 135 |
| 316 | 3300006871 | Ga0075434_100044962 | Ga0075434_1000449626 | 135 |
| 317 | 3300006871 | Ga0075434_100218166 | Ga0075434_1002181662 | 135 |
| 318 | 3300006871 | Ga0075434_100426703 | Ga0075434_1004267032 | 135 |
| 319 | 3300006871 | Ga0075434_100557290 | Ga0075434_1005572902 | 135 |
| 320 | 3300006871 | Ga0075434_101240785 | Ga0075434_1012407852 | 135 |
| 321 | 3300006871 | Ga0075434_101465951 | Ga0075434_1014659512 | 135 |
| 322 | 3300006880 | Ga0075429_100074346 | Ga0075429_1000743465 | 135 |
| 323 | 3300006880 | Ga0075429_100236303 | Ga0075429_1002363033 | 135 |
| 324 | 3300006880 | Ga0075429_100387597 | Ga0075429_1003875973 | 135 |
| 325 | 3300006914 | Ga0075436_100595619 | Ga0075436_1005956192 | 135 |
| 326 | 3300006931 | Ga0097620_100096764 | Ga0097620_1000967642 | 135 |
| 327 | 3300006931 | Ga0097620_100945002 | Ga0097620_1009450022 | 135 |
| 328 | 3300006931 | Ga0097620_101334672 | Ga0097620_1013346722 | 135 |
| 329 | 3300007076 | Ga0075435_100024698 | Ga0075435_1000246986 | 135 |
| 330 | 3300007076 | Ga0075435_100129015 | Ga0075435_1001290152 | 135 |
| 331 | 3300007788 | Ga0099795_10127105 | Ga0099795_101271052 | 135 |
| 332 | 3300007788 | Ga0099795_10216423 | Ga0099795_102164231 | 135 |
| 333 | 3300009094 | Ga0111539_10166012 | Ga0111539_101660123 | 135 |
| 334 | 3300009094 | Ga0111539_11295652 | Ga0111539_112956521 | 135 |
| 335 | 3300009094 | Ga0111539_13044178 | Ga0111539_130441781 | 135 |
| 336 | 3300009098 | Ga0105245_10002811 | Ga0105245_100028115 | 135 |
| 337 | 3300009098 | Ga0105245_10687991 | Ga0105245_106879912 | 135 |
| 338 | 3300009101 | Ga0105247_10027881 | Ga0105247_100278815 | 135 |
| 339 | 3300009147 | Ga0114129_10063727 | Ga0114129_100637275 | 135 |
| 340 | 3300009147 | Ga0114129_10242045 | Ga0114129_102420455 | 135 |
| 341 | 3300009147 | Ga0114129_10307432 | Ga0114129_103074323 | 135 |
| 342 | 3300009147 | Ga0114129_10924990 | Ga0114129_109249902 | 135 |
| 343 | 3300009148 | Ga0105243_10187817 | Ga0105243_101878174 | 135 |
| 344 | 3300009176 | Ga0105242_10907429 | Ga0105242_109074292 | 135 |
| 345 | 3300009545 | Ga0105237_10512613 | Ga0105237_105126132 | 135 |
| 346 | 3300009545 | Ga0105237_10969923 | Ga0105237_109699232 | 135 |
| 347 | 3300009551 | Ga0105238_10000002 | Ga0105238_10000002368 | 135 |
| 348 | 3300009553 | Ga0105249_10101204 | Ga0105249_101012042 | 135 |
| 349 | 3300013105 | Ga0157369_10000363 | Ga0157369_100003637 | 135 |
| 350 | 3300013296 | Ga0157374_10000016 | Ga0157374_1000001643 | 135 |
| 351 | 3300013297 | Ga0157378_10094801 | Ga0157378_100948012 | 135 |
| 352 | 3300013297 | Ga0157378_10214534 | Ga0157378_102145344 | 135 |
| 353 | 3300013297 | Ga0157378_10528396 | Ga0157378_105283963 | 135 |
| 354 | 3300013306 | Ga0163162_10086032 | Ga0163162_100860323 | 135 |
| 355 | 3300013307 | Ga0157372_12109992 | Ga0157372_121099922 | 135 |
| 356 | 3300013308 | Ga0157375_10004506 | Ga0157375_1000450618 | 135 |
| 357 | 3300013308 | Ga0157375_10061602 | Ga0157375_100616024 | 135 |
| 358 | 3300013308 | Ga0157375_10062738 | Ga0157375_100627385 | 135 |
| 359 | 3300014325 | Ga0163163_10274144 | Ga0163163_102741442 | 135 |
| 360 | 3300014325 | Ga0163163_10284597 | Ga0163163_102845971 | 135 |
| 361 | 3300014326 | Ga0157380_10944054 | Ga0157380_109440541 | 135 |
| 362 | 3300014745 | Ga0157377_10000026 | Ga0157377_100000262 | 135 |
| 363 | 3300014745 | Ga0157377_10000370 | Ga0157377_100003706 | 135 |
| 364 | 3300014968 | Ga0157379_10267528 | Ga0157379_102675281 | 135 |
| 365 | 3300014969 | Ga0157376_10000018 | Ga0157376_1000001823 | 135 |
| 366 | 3300021384 | Ga0213876_10000009 | Ga0213876_1000000981 | 135 |
| 367 | 3300025271 | Ga0207666_1056695 | Ga0207666_10566951 | 135 |
| 368 | 3300025885 | Ga0207653_10134987 | Ga0207653_101349872 | 135 |
| 369 | 3300025885 | Ga0207653_10250572 | Ga0207653_102505722 | 135 |
| 370 | 3300025905 | Ga0207685_10025056 | Ga0207685_100250566 | 135 |
| 371 | 3300025908 | Ga0207643_10063001 | Ga0207643_100630014 | 135 |
| 372 | 3300025909 | Ga0207705_10037305 | Ga0207705_100373052 | 135 |
| 373 | 3300025910 | Ga0207684_10569815 | Ga0207684_105698152 | 135 |
| 374 | 3300025910 | Ga0207684_10853056 | Ga0207684_108530561 | 135 |
| 375 | 3300025912 | Ga0207707_10936340 | Ga0207707_109363402 | 135 |
| 376 | 3300025918 | Ga0207662_10001242 | Ga0207662_100012426 | 135 |
| 377 | 3300025918 | Ga0207662_10170677 | Ga0207662_101706772 | 135 |
| 378 | 3300025922 | Ga0207646_10185373 | Ga0207646_101853732 | 135 |
| 379 | 3300025923 | Ga0207681_11511968 | Ga0207681_115119681 | 135 |
| 380 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001369 | 135 |
| 381 | 3300025925 | Ga0207650_10001851 | Ga0207650_1000185113 | 135 |
| 382 | 3300025925 | Ga0207650_10040019 | Ga0207650_100400192 | 135 |
| 383 | 3300025927 | Ga0207687_10000009 | Ga0207687_10000009181 | 135 |
| 384 | 3300025927 | Ga0207687_10306291 | Ga0207687_103062912 | 135 |
| 385 | 3300025928 | Ga0207700_10014828 | Ga0207700_100148285 | 135 |
| 386 | 3300025936 | Ga0207670_10003762 | Ga0207670_100037621 | 135 |
| 387 | 3300025936 | Ga0207670_10032517 | Ga0207670_100325173 | 135 |
| 388 | 3300025936 | Ga0207670_10058309 | Ga0207670_100583091 | 135 |
| 389 | 3300025939 | Ga0207665_10473843 | Ga0207665_104738432 | 135 |
| 390 | 3300025941 | Ga0207711_10097299 | Ga0207711_100972994 | 135 |
| 391 | 3300025942 | Ga0207689_10067295 | Ga0207689_100672951 | 135 |
| 392 | 3300025944 | Ga0207661_10000015 | Ga0207661_10000015217 | 135 |
| 393 | 3300025960 | Ga0207651_10110630 | Ga0207651_101106302 | 135 |
| 394 | 3300025981 | Ga0207640_10182284 | Ga0207640_101822842 | 135 |
| 395 | 3300026023 | Ga0207677_10000017 | Ga0207677_10000017128 | 135 |
| 396 | 3300026035 | Ga0207703_11384905 | Ga0207703_113849051 | 135 |
| 397 | 3300026041 | Ga0207639_10354827 | Ga0207639_103548273 | 135 |
| 398 | 3300026075 | Ga0207708_10117850 | Ga0207708_101178504 | 135 |
| 399 | 3300026075 | Ga0207708_10621444 | Ga0207708_106214441 | 135 |
| 400 | 3300026075 | Ga0207708_11373612 | Ga0207708_113736121 | 135 |
| 401 | 3300026088 | Ga0207641_10046806 | Ga0207641_100468066 | 135 |
| 402 | 3300026088 | Ga0207641_10248171 | Ga0207641_102481712 | 135 |
| 403 | 3300026095 | Ga0207676_10076472 | Ga0207676_100764726 | 135 |
| 404 | 3300026095 | Ga0207676_10134261 | Ga0207676_101342614 | 135 |
| 405 | 3300026116 | Ga0207674_10029202 | Ga0207674_100292025 | 135 |
| 406 | 3300026118 | Ga0207675_100014908 | Ga0207675_1000149085 | 135 |
| 407 | 3300026118 | Ga0207675_100046541 | Ga0207675_1000465412 | 135 |
| 408 | 3300026118 | Ga0207675_100267296 | Ga0207675_1002672962 | 135 |
| 409 | 3300027252 | Ga0209973_1006677 | Ga0209973_10066772 | 135 |
| 410 | 3300027424 | Ga0209984_1018238 | Ga0209984_10182382 | 135 |
| 411 | 3300027614 | Ga0209970_1005151 | Ga0209970_10051512 | 135 |
| 412 | 3300027665 | Ga0209983_1001726 | Ga0209983_10017262 | 135 |
| 413 | 3300027682 | Ga0209971_1065664 | Ga0209971_10656642 | 135 |
| 414 | 3300027876 | Ga0209974_10015791 | Ga0209974_100157916 | 135 |
| 415 | 3300027907 | Ga0207428_10032114 | Ga0207428_100321146 | 135 |
| 416 | 3300027907 | Ga0207428_10039117 | Ga0207428_100391175 | 135 |
| 417 | 3300027907 | Ga0207428_10162506 | Ga0207428_101625063 | 135 |
| 418 | 3300028380 | Ga0268265_10661570 | Ga0268265_106615702 | 135 |
| 419 | 3300028380 | Ga0268265_12207380 | Ga0268265_122073801 | 135 |
| 420 | 3300028381 | Ga0268264_10345792 | Ga0268264_103457922 | 135 |
| 421 | 3300028381 | Ga0268264_11288247 | Ga0268264_112882472 | 135 |
| 422 | 3300028556 | Ga0265337_1001292 | Ga0265337_10012926 | 135 |
| 423 | 3300028556 | Ga0265337_1019126 | Ga0265337_10191263 | 135 |
| 424 | 3300028556 | Ga0265337_1084813 | Ga0265337_10848132 | 135 |
| 425 | 3300028558 | Ga0265326_10001534 | Ga0265326_100015347 | 135 |
| 426 | 3300028558 | Ga0265326_10020830 | Ga0265326_100208301 | 135 |
| 427 | 3300028563 | Ga0265319_1000077 | Ga0265319_100007728 | 135 |
| 428 | 3300028563 | Ga0265319_1000371 | Ga0265319_100037140 | 135 |
| 429 | 3300028563 | Ga0265319_1044267 | Ga0265319_10442672 | 135 |
| 430 | 3300028573 | Ga0265334_10000696 | Ga0265334_1000069610 | 135 |
| 431 | 3300028573 | Ga0265334_10004850 | Ga0265334_100048505 | 135 |
| 432 | 3300028573 | Ga0265334_10124182 | Ga0265334_101241822 | 135 |
| 433 | 3300028573 | Ga0265334_10237244 | Ga0265334_102372441 | 135 |
| 434 | 3300028577 | Ga0265318_10002615 | Ga0265318_1000261512 | 135 |
| 435 | 3300028653 | Ga0265323_10000672 | Ga0265323_1000067214 | 135 |
| 436 | 3300028654 | Ga0265322_10000375 | Ga0265322_100003755 | 135 |
| 437 | 3300028654 | Ga0265322_10007514 | Ga0265322_100075142 | 135 |
| 438 | 3300028666 | Ga0265336_10000066 | Ga0265336_1000006655 | 135 |
| 439 | 3300028800 | Ga0265338_10013819 | Ga0265338_100138198 | 135 |
| 440 | 3300028800 | Ga0265338_10024383 | Ga0265338_100243836 | 135 |
| 441 | 3300028800 | Ga0265338_10026142 | Ga0265338_100261425 | 135 |
| 442 | 3300028800 | Ga0265338_10029761 | Ga0265338_100297616 | 135 |
| 443 | 3300028800 | Ga0265338_10062691 | Ga0265338_100626913 | 135 |
| 444 | 3300028800 | Ga0265338_10071531 | Ga0265338_100715312 | 135 |
| 445 | 3300029957 | Ga0265324_10000243 | Ga0265324_1000024324 | 135 |
| 446 | 3300029957 | Ga0265324_10002496 | Ga0265324_100024966 | 135 |
| 447 | 3300029957 | Ga0265324_10020439 | Ga0265324_100204392 | 135 |
| 448 | 3300029957 | Ga0265324_10143898 | Ga0265324_101438982 | 135 |
| 449 | 3300030521 | Ga0307511_10009343 | Ga0307511_100093437 | 135 |
| 450 | 3300031235 | Ga0265330_10000067 | Ga0265330_1000006760 | 135 |
| 451 | 3300031238 | Ga0265332_10000513 | Ga0265332_100005139 | 135 |
| 452 | 3300031238 | Ga0265332_10014669 | Ga0265332_100146692 | 135 |
| 453 | 3300031238 | Ga0265332_10074846 | Ga0265332_100748462 | 135 |
| 454 | 3300031239 | Ga0265328_10002334 | Ga0265328_100023345 | 135 |
| 455 | 3300031240 | Ga0265320_10000644 | Ga0265320_100006445 | 135 |
| 456 | 3300031240 | Ga0265320_10000896 | Ga0265320_100008964 | 135 |
| 457 | 3300031240 | Ga0265320_10057827 | Ga0265320_100578272 | 135 |
| 458 | 3300031241 | Ga0265325_10034126 | Ga0265325_100341263 | 135 |
| 459 | 3300031242 | Ga0265329_10000849 | Ga0265329_100008497 | 135 |
| 460 | 3300031247 | Ga0265340_10002520 | Ga0265340_100025205 | 135 |
| 461 | 3300031247 | Ga0265340_10009287 | Ga0265340_100092876 | 135 |
| 462 | 3300031249 | Ga0265339_10001501 | Ga0265339_1000150118 | 135 |
| 463 | 3300031249 | Ga0265339_10103030 | Ga0265339_101030301 | 135 |
| 464 | 3300031249 | Ga0265339_10224012 | Ga0265339_102240122 | 135 |
| 465 | 3300031250 | Ga0265331_10000271 | Ga0265331_100002712 | 135 |
| 466 | 3300031344 | Ga0265316_10001501 | Ga0265316_100015015 | 135 |
| 467 | 3300031344 | Ga0265316_10002576 | Ga0265316_100025767 | 135 |
| 468 | 3300031344 | Ga0265316_10077876 | Ga0265316_100778762 | 135 |
| 469 | 3300031595 | Ga0265313_10052053 | Ga0265313_100520533 | 135 |
| 470 | 3300031595 | Ga0265313_10084728 | Ga0265313_100847282 | 135 |
| 471 | 3300031711 | Ga0265314_10001618 | Ga0265314_100016185 | 135 |
| 472 | 3300031711 | Ga0265314_10068153 | Ga0265314_100681532 | 135 |
| 473 | 3300031711 | Ga0265314_10451807 | Ga0265314_104518072 | 135 |
| 474 | 3300031712 | Ga0265342_10001108 | Ga0265342_100011088 | 135 |
| 475 | 3300031712 | Ga0265342_10003238 | Ga0265342_100032388 | 135 |
| 476 | 3300031727 | Ga0316576_10044407 | Ga0316576_100444076 | 135 |
| 477 | 3300031727 | Ga0316576_10052632 | Ga0316576_100526324 | 135 |
| 478 | 3300031728 | Ga0316578_10312920 | Ga0316578_103129201 | 135 |
| 479 | 3300031731 | Ga0307405_11192659 | Ga0307405_111926592 | 135 |
| 480 | 3300031733 | Ga0316577_10851103 | Ga0316577_108511031 | 135 |
| 481 | 3300032168 | Ga0316593_10026649 | Ga0316593_100266493 | 135 |
| 482 | 3300032168 | Ga0316593_10033657 | Ga0316593_100336571 | 135 |
| 483 | 3300032168 | Ga0316593_10255291 | Ga0316593_102552912 | 135 |
| 484 | 3300032168 | Ga0316593_10309901 | Ga0316593_103099011 | 135 |
| 485 | 3300032168 | Ga0316593_10336039 | Ga0316593_103360391 | 135 |
| 486 | 3300035083 | Ga0373926_0147578 | Ga0373926_0147578_151_582 | 135 |
| 487 | 3300035086 | Ga0373934_0000155 | Ga0373934_0000155_14133_14558 | 135 |
| 488 | 3300035111 | Ga0373923_0044713 | Ga0373923_0044713_340_765 | 135 |
| 489 | 3300035112 | Ga0373932_0000892 | Ga0373932_0000892_1724_2149 | 135 |
| 490 | 3300035113 | Ga0373936_0019872 | Ga0373936_0019872_1480_1905 | 135 |
| 491 | 3300035115 | Ga0373941_0145218 | Ga0373941_0145218_119_544 | 135 |
| 492 | 3300035117 | Ga0373953_0022062 | Ga0373953_0022062_1397_1822 | 135 |
| 493 | 3300035117 | Ga0373953_0203965 | Ga0373953_0203965_330_755 | 135 |
| 494 | 3300035118 | Ga0373954_0041553 | Ga0373954_0041553_310_735 | 135 |
| 495 | 3300035119 | Ga0373956_0002379 | Ga0373956_0002379_1366_1791 | 135 |
| 496 | 3300035119 | Ga0373956_0020785 | Ga0373956_0020785_2262_2687 | 135 |
| 497 | 3300035120 | Ga0373957_0048347 | Ga0373957_0048347_986_1411 | 135 |
| 498 | 3300035170 | Ga0373943_0038288 | Ga0373943_0038288_859_1284 | 135 |
| 499 | 3300035172 | Ga0373955_0019792 | Ga0373955_0019792_1543_1968 | 135 |
| 500 | 3300035172 | Ga0373955_0195991 | Ga0373955_0195991_762_1190 | 135 |
| 501 | 3300035172 | Ga0373955_0246256 | Ga0373955_0246256_588_1013 | 135 |
| 502 | 3300035172 | Ga0373955_0278103 | Ga0373955_0278103_126_551 | 135 |
| 503 | 3300035398 | Ga0316574_0307400 | Ga0316574_0307400_354_779 | 135 |
| 504 | 3300035410 | Ga0373924_0046997 | Ga0373924_0046997_875_1300 | 135 |
| 505 | 3300035692 | Ga0373935_0044888 | Ga0373935_0044888_157_582 | 135 |
| 506 | 3300035724 | Ga0373933_0037442 | Ga0373933_0037442_770_1195 | 135 |
| 507 | 3300035724 | Ga0373933_0072052 | Ga0373933_0072052_742_1167 | 135 |
| 508 | 3300035724 | Ga0373933_0898410 | Ga0373933_0898410_93_518 | 135 |
| 509 | 3300035725 | Ga0373947_0310249 | Ga0373947_0310249_333_758 | 135 |
| 510 | 3300036401 | Ga0373937_0011530 | Ga0373937_0011530_6490_6915 | 135 |
| 511 | 3300036401 | Ga0373937_0018806 | Ga0373937_0018806_4329_4754 | 135 |
| 512 | 3300036401 | Ga0373937_0116858 | Ga0373937_0116858_162_587 | 135 |
| 513 | 3300036401 | Ga0373937_0132405 | Ga0373937_0132405_1173_1598 | 135 |
| 514 | 3300036401 | Ga0373937_0368737 | Ga0373937_0368737_350_775 | 135 |
| 515 | 3300036401 | Ga0373937_0483504 | Ga0373937_0483504_492_917 | 135 |
| 516 | 3300036647 | Ga0316582_0093009 | Ga0316582_0093009_1348_1773 | 135 |
| 517 | 3300036712 | Ga0316584_0343974 | Ga0316584_0343974_462_887 | 135 |
| 518 | 3300037312 | Ga0395899_0153009 | Ga0395899_0153009_804_1229 | 135 |
| 519 | 3300037588 | Ga0316581_0195927 | Ga0316581_0195927_53_478 | 135 |
| 520 | 3300038726 | Ga0400490_24938 | Ga0400490_24938_605_1033 | 135 |
| 521 | 3300039062 | Ga0400483_229260 | Ga0400483_229260_1164_1589 | 135 |
| 522 | 3300039437 | Ga0436365_0605606 | Ga0436365_0605606_55420_55845 | 135 |
| 523 | 3300039453 | Ga0436362_0309166 | Ga0436362_0309166_10902_11327 | 135 |
| 524 | 3300041456 | Ga0451795_0162296 | Ga0451795_0162296_1258_1683 | 135 |
| 525 | 3300041508 | Ga0451852_31128 | Ga0451852_31128_136_564 | 135 |
| 526 | 3300041511 | Ga0451855_0111700 | Ga0451855_0111700_753_1178 | 135 |
| 527 | 3300041511 | Ga0451855_0685541 | Ga0451855_0685541_212_637 | 135 |
| 528 | 3300042435 | Ga0439434_0081741 | Ga0439434_0081741_455_883 | 135 |
| 529 | 3300042435 | Ga0439434_0138557 | Ga0439434_0138557_43_471 | 135 |
| 530 | 3300042435 | Ga0439434_0218463 | Ga0439434_0218463_79_507 | 135 |
| 531 | 3300042876 | Ga0451577_0021214 | Ga0451577_0021214_3031_3456 | 135 |
| 532 | 3300042876 | Ga0451577_0024271 | Ga0451577_0024271_621_1046 | 135 |
| 533 | 3300042876 | Ga0451577_0103544 | Ga0451577_0103544_1226_1651 | 135 |
| 534 | 3300044656 | Ga0466969_0142709 | Ga0466969_0142709_249_686 | 135 |
| 535 | 3300044673 | Ga0453683_0184982 | Ga0453683_0184982_700_1125 | 135 |
| 536 | 3300044673 | Ga0453683_0382406 | Ga0453683_0382406_335_760 | 135 |
| 537 | 3300044712 | Ga0453684_0010849 | Ga0453684_0010849_11331_11756 | 135 |
| 538 | 3300044712 | Ga0453684_0116274 | Ga0453684_0116274_511_951 | 135 |
| 539 | 3300044712 | Ga0453684_0165439 | Ga0453684_0165439_2171_2596 | 135 |
| 540 | 3300045051 | Ga0451576_0005783 | Ga0451576_0005783_13712_14137 | 135 |
| 541 | 3300045051 | Ga0451576_0382538 | Ga0451576_0382538_565_990 | 135 |
| 542 | 3300045051 | Ga0451576_0595133 | Ga0451576_0595133_251_676 | 135 |
| 543 | 3300045051 | Ga0451576_0706757 | Ga0451576_0706757_40_471 | 135 |
| 544 | 3300045051 | Ga0451576_0900274 | Ga0451576_0900274_201_626 | 135 |
| 545 | 3300045051 | Ga0451576_1318978 | Ga0451576_1318978_192_617 | 135 |
| 546 | 3300046453 | Ga0495627_141526 | Ga0495627_141526_62_487 | 135 |
| 547 | 3300046454 | Ga0495592_0048815 | Ga0495592_0048815_1336_1761 | 135 |
| 548 | 3300046454 | Ga0495592_0275824 | Ga0495592_0275824_569_994 | 135 |
| 549 | 3300046459 | Ga0495629_0746192 | Ga0495629_0746192_204_638 | 135 |
| 550 | 3300046462 | Ga0495651_0124692 | Ga0495651_0124692_1237_1662 | 135 |
| 551 | 3300046463 | Ga0495653_0132982 | Ga0495653_0132982_798_1223 | 135 |
| 552 | 3300046511 | Ga0495608_0010081 | Ga0495608_0010081_1394_1819 | 135 |
| 553 | 3300046514 | Ga0495618_0065314 | Ga0495618_0065314_1140_1565 | 135 |
| 554 | 3300046514 | Ga0495618_0635888 | Ga0495618_0635888_183_608 | 135 |
| 555 | 3300046516 | Ga0495628_0038502 | Ga0495628_0038502_2904_3329 | 135 |
| 556 | 3300046517 | Ga0495630_0775938 | Ga0495630_0775938_234_659 | 135 |
| 557 | 3300046517 | Ga0495630_1364538 | Ga0495630_1364538_75_500 | 135 |
| 558 | 3300046526 | Ga0495666_0140166 | Ga0495666_0140166_342_767 | 135 |
| 559 | 3300046533 | Ga0495640_0071361 | Ga0495640_0071361_1095_1520 | 135 |
| 560 | 3300046536 | Ga0495587_0015907 | Ga0495587_0015907_1412_1837 | 135 |
| 561 | 3300046559 | Ga0495667_0006622 | Ga0495667_0006622_2143_2568 | 135 |
| 562 | 3300046642 | Ga0495634_0334981 | Ga0495634_0334981_226_651 | 135 |
| 563 | 3300046642 | Ga0495634_0441993 | Ga0495634_0441993_140_565 | 135 |
| 564 | 3300046663 | Ga0495635_0124070 | Ga0495635_0124070_375_800 | 135 |
| 565 | 3300046675 | Ga0495657_0062591 | Ga0495657_0062591_1422_1847 | 135 |
| 566 | 3300046678 | Ga0495599_0082939 | Ga0495599_0082939_1347_1772 | 135 |
| 567 | 3300046683 | Ga0495658_0011409 | Ga0495658_0011409_2591_3112 | 135 |
| 568 | 3300046683 | Ga0495658_0167078 | Ga0495658_0167078_171_596 | 135 |
| 569 | 3300046684 | Ga0495669_0421559 | Ga0495669_0421559_114_596 | 135 |
| 570 | 3300046691 | Ga0495670_0015230 | Ga0495670_0015230_2697_3122 | 135 |
| 571 | 3300046809 | Ga0495600_0027945 | Ga0495600_0027945_1024_1449 | 135 |
| 572 | 3300047315 | Ga0495581_0096460 | Ga0495581_0096460_1040_1465 | 135 |
| 573 | 3300047319 | Ga0495674_0369381 | Ga0495674_0369381_140_565 | 135 |
| 574 | 3300047322 | Ga0495680_0434824 | Ga0495680_0434824_194_619 | 135 |
| 575 | 3300047444 | Ga0495675_0058692 | Ga0495675_0058692_610_1035 | 135 |
| 576 | 3300047471 | Ga0495684_0292235 | Ga0495684_0292235_293_718 | 135 |
| 577 | 3300047471 | Ga0495684_0737051 | Ga0495684_0737051_133_558 | 135 |
| 578 | 3300048916 | Ga0496113_0408800 | Ga0496113_0408800_520_945 | 135 |
| 579 | 3300049568 | Ga0501031_0210635 | Ga0501031_0210635_98_523 | 135 |
| 580 | 3300049569 | Ga0501032_0525370 | Ga0501032_0525370_286_711 | 135 |
| 581 | 3300049570 | Ga0501033_0280476 | Ga0501033_0280476_700_1125 | 135 |
| 582 | 3300049570 | Ga0501033_0892794 | Ga0501033_0892794_59_484 | 135 |
| 583 | 3300049571 | Ga0501034_0599636 | Ga0501034_0599636_310_735 | 135 |
| 584 | 3300049572 | Ga0501036_0044160 | Ga0501036_0044160_2312_2737 | 135 |
| 585 | 3300049572 | Ga0501036_0235815 | Ga0501036_0235815_975_1403 | 135 |
| 586 | 3300049572 | Ga0501036_1133746 | Ga0501036_1133746_43_471 | 135 |
| 587 | 3300049573 | Ga0501037_0201791 | Ga0501037_0201791_502_927 | 135 |
| 588 | 3300049575 | Ga0501039_0186094 | Ga0501039_0186094_957_1382 | 135 |
| 589 | 3300049575 | Ga0501039_1024618 | Ga0501039_1024618_75_503 | 135 |
| 590 | 3300049576 | Ga0501040_0531260 | Ga0501040_0531260_174_599 | 135 |
| 591 | 3300049577 | Ga0501041_0007558 | Ga0501041_0007558_4921_5346 | 135 |
| 592 | 3300049579 | Ga0501043_0432547 | Ga0501043_0432547_44_469 | 135 |
| 593 | 3300049580 | Ga0501046_0176815 | Ga0501046_0176815_826_1251 | 135 |
| 594 | 3300049582 | Ga0501048_0334924 | Ga0501048_0334924_54_479 | 135 |
| 595 | 3300049585 | Ga0501069_0622504 | Ga0501069_0622504_157_585 | 135 |
| 596 | 3300049586 | Ga0501070_1033437 | Ga0501070_1033437_188_613 | 135 |
| 597 | 3300049587 | Ga0501071_0085167 | Ga0501071_0085167_855_1280 | 135 |
| 598 | 3300049587 | Ga0501071_0820900 | Ga0501071_0820900_104_532 | 135 |
| 599 | 3300049591 | Ga0501075_0016329 | Ga0501075_0016329_3986_4411 | 135 |
| 600 | 3300049591 | Ga0501075_0292130 | Ga0501075_0292130_648_1076 | 135 |
| 601 | 3300049592 | Ga0501076_0220653 | Ga0501076_0220653_975_1400 | 135 |
| 602 | 3300049593 | Ga0501077_0091102 | Ga0501077_0091102_942_1367 | 135 |
| 603 | 3300049741 | Ga0501079_0073172 | Ga0501079_0073172_1586_2011 | 135 |
| 604 | 3300049741 | Ga0501079_0954480 | Ga0501079_0954480_195_620 | 135 |
| 605 | 3300049742 | Ga0501080_0151123 | Ga0501080_0151123_1371_1796 | 135 |
| 606 | 3300049743 | Ga0501081_0080260 | Ga0501081_0080260_689_1114 | 135 |
| 607 | 3300049824 | Ga0501045_0103757 | Ga0501045_0103757_1279_1704 | 135 |
| 608 | 3300050507 | nmdc:mga05p37_122849_c2 | nmdc:mga05p37_122849_c2_776_1201 | 135 |
| 609 | 3300050507 | nmdc:mga05p37_122920_c1 | nmdc:mga05p37_122920_c1_908_1333 | 135 |
| 610 | 3300050507 | nmdc:mga05p37_681234_c1 | nmdc:mga05p37_681234_c1_66_491 | 135 |
| 611 | 3300050507 | nmdc:mga05p37_929992_c1 | nmdc:mga05p37_929992_c1_371_796 | 135 |
| 612 | 3300050508 | nmdc:mga09592_20930_c1 | nmdc:mga09592_20930_c1_3139_3564 | 135 |
| 613 | 3300050508 | nmdc:mga09592_2536_c1 | nmdc:mga09592_2536_c1_14101_14526 | 135 |
| 614 | 3300050509 | nmdc:mga0qj67_249961_c1 | nmdc:mga0qj67_249961_c1_58_483 | 135 |
| 615 | 3300050509 | nmdc:mga0qj67_398697_c1 | nmdc:mga0qj67_398697_c1_494_919 | 135 |
| 616 | 3300050510 | nmdc:mga06r32_257390_c1 | nmdc:mga06r32_257390_c1_864_1289 | 135 |
| 617 | 3300050510 | nmdc:mga06r32_269558_c1 | nmdc:mga06r32_269558_c1_335_763 | 135 |
| 618 | 3300050510 | nmdc:mga06r32_428015_c1 | nmdc:mga06r32_428015_c1_222_647 | 135 |
| 619 | 3300050511 | nmdc:mga08y16_148621_c1 | nmdc:mga08y16_148621_c1_355_780 | 135 |
| 620 | 3300050511 | nmdc:mga08y16_2039663_c1 | nmdc:mga08y16_2039663_c1_85_510 | 135 |
| 621 | 3300050511 | nmdc:mga08y16_296_c1 | nmdc:mga08y16_296_c1_28492_28917 | 135 |
| 622 | 3300050511 | nmdc:mga08y16_560141_c1 | nmdc:mga08y16_560141_c1_375_800 | 135 |
| 623 | 3300050512 | nmdc:mga0n895_1167423_c1 | nmdc:mga0n895_1167423_c1_74_499 | 135 |
| 624 | 3300050512 | nmdc:mga0n895_547849_c1 | nmdc:mga0n895_547849_c1_277_702 | 135 |
| 625 | 3300050512 | nmdc:mga0n895_94929_c1 | nmdc:mga0n895_94929_c1_369_794 | 135 |
| 626 | 3300050512 | nmdc:mga0n895_952059_c1 | nmdc:mga0n895_952059_c1_108_533 | 135 |
| 627 | 3300050512 | nmdc:mga0n895_978469_c1 | nmdc:mga0n895_978469_c1_143_568 | 135 |
| 628 | 3300050513 | nmdc:mga0rr50_293289_c1 | nmdc:mga0rr50_293289_c1_552_977 | 135 |
| 629 | 3300050513 | nmdc:mga0rr50_8536_c1 | nmdc:mga0rr50_8536_c1_4591_5016 | 135 |
| 630 | 3300050514 | nmdc:mga08x19_164879_c1 | nmdc:mga08x19_164879_c1_65_490 | 135 |
| 631 | 3300050514 | nmdc:mga08x19_458603_c1 | nmdc:mga08x19_458603_c1_308_733 | 135 |
| 632 | 3300050514 | nmdc:mga08x19_70185_c1 | nmdc:mga08x19_70185_c1_295_720 | 135 |
| 633 | 3300050515 | nmdc:mga0a205_799934_c1 | nmdc:mga0a205_799934_c1_176_601 | 135 |
| 634 | 3300053084 | Ga0495595_0002299 | Ga0495595_0002299_6015_6440 | 135 |
| 635 | 3300053085 | Ga0495619_0156748 | Ga0495619_0156748_929_1354 | 135 |
| 636 | 3300054114 | Ga0501084_0182708 | Ga0501084_0182708_1139_1564 | 135 |
| 637 | 3300054114 | Ga0501084_1290496 | Ga0501084_1290496_139_567 | 135 |
| 638 | 3300059491 | Ga0587070_136153 | Ga0587070_136153_105_530 | 135 |
| 639 | 3300059493 | Ga0587077_056032 | Ga0587077_056032_328_759 | 135 |
| 640 | 3300059643 | Ga0587072_137844 | Ga0587072_137844_31_456 | 135 |
| 641 | 3300059654 | Ga0587110_039101 | Ga0587110_039101_74_523 | 135 |
| 642 | 3300060353 | Ga0501082_0022686 | Ga0501082_0022686_4063_4488 | 135 |
| 643 | 3300061734 | Ga0530510_0103782 | Ga0530510_0103782_319_744 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cjt-assembly4.cif.gz_H | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.9877 | 3 | 72 |
| 3egv-assembly1.cif.gz_B | ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 | 0.9762 | 3 | 78 |
| 3cjt-assembly4.cif.gz_H | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.9606 | 3 | 72 |
| 3egv-assembly1.cif.gz_B | ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 | 0.9517 | 3 | 78 |
| 2bcw-assembly1.cif.gz_A | coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex | 0.944 | 9 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9828 | 3 | 67 | 3.30.1550.10 |
| 3egvB00 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9762 | 3 | 78 | 3.30.1550.10 |
| 4v19K01 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9588 | 6 | 70 | 3.30.1550.10 |
| af_I1J9L7_135_215_1.10.10.250 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9519 | 72 | 133 | 1.10.10.250 |
| 3egvB00 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9517 | 3 | 78 | 3.30.1550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J4E0X6-F1-model_v4 | deleted | 1.006 | 1 | 70 |
|
| AF-A0A2N2LDD6-F1-model_v4 | 50S ribosomal protein L11 | 1.004 | 1 | 72 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A2D7JF69-F1-model_v4 | 50S ribosomal protein L11 | 1.004 | 1 | 71 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A5K0WVA7-F1-model_v4 | Large ribosomal subunit protein uL11 N-terminal domain-containing protein | 1.001 | 6 | 62 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7W1H7B9-F1-model_v4 | Large ribosomal subunit protein uL11 N-terminal domain-containing protein | 0.9951 | 7 | 60 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar