F471910

General Info

Members Datasets Scaffolds Average Seq Length
642 319 630 147

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_15081_c1|nmdc:mga08x19_15081_c1_2443_2961
Length 172
Sequence MGAGRSGKGRDILFYAVADKEEDRMSDKVILLVEDNPDDEALTLRALKKNNIQNEVVIARDGVEALAYLFGTGAYAGRDVSVLPSVTLLDLKLPKLDGLEVLKKIRADERTKLLPVVILTSSKEEQDLINGYKVGANSYIRKPVDFSQFIEAVRQLGLYWLLLNEAAPVRNR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
3 2831426010 Nostoc sp. 106C Isolate Unclassified
4 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
5 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
6 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
7 2849660919 Nostoc sp. T09 Isolate Unclassified
8 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
9 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
10 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
11 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
154 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
158 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
280 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
281 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
282 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
283 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
310 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
319 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 0.31
Rhizoplane 0.78
Rhizosphere 89.88
Stem 0
Stem Tuber 0
Unclassified 4.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_679788 2162886006 Bacteria 945
2 rootH1_10134343 3300003316 Bacteria 1444
3 rootH2_10003759 3300003320 Bacteria 2213
4 rootH2_10023036 3300003320 Bacteria 24889
5 rootH2_10031699 3300003320 Bacteria 12621
6 rootL2_10069044 3300003322 Bacteria 8247
7 rootL2_10154203 3300003322 Bacteria 1755
8 Ga0065704_10300019 3300005289 Unclassified 887
9 Ga0065712_10261696 3300005290 Bacteria 935
10 Ga0065707_10011144 3300005295 Bacteria 2039
11 Ga0065707_10083409 3300005295 Bacteria 9276
12 Ga0070658_10095322 3300005327 Bacteria 2456
13 Ga0070676_10905241 3300005328 Bacteria 657
14 Ga0068869_100070567 3300005334 Bacteria 2585
15 Ga0070680_100096823 3300005336 Bacteria 2447
16 Ga0070680_100256130 3300005336 Bacteria 1480
17 Ga0070680_100270259 3300005336 Bacteria 1439
18 Ga0070680_100507777 3300005336 Bacteria 1032
19 Ga0070680_100806192 3300005336 Bacteria 809
20 Ga0070682_100845096 3300005337 Bacteria 747
21 Ga0068868_100087548 3300005338 Bacteria 2505
22 Ga0070691_10185361 3300005341 Bacteria 1085
23 Ga0070687_100775255 3300005343 Bacteria 677
24 Ga0070692_10064723 3300005345 Bacteria 1934
25 Ga0070669_100262039 3300005353 Bacteria 1380
26 Ga0070669_100652807 3300005353 Bacteria 885
27 Ga0070675_100070281 3300005354 Bacteria 2901
28 Ga0070673_100039571 3300005364 Bacteria 3609
29 Ga0070688_101038989 3300005365 Bacteria 653
30 Ga0070659_100287673 3300005366 Bacteria 1368
31 Ga0070667_101038769 3300005367 Bacteria 765
32 Ga0070667_101610485 3300005367 Bacteria 610
33 Ga0070714_100000023 3300005435 Bacteria 155379
34 Ga0070713_100008154 3300005436 Bacteria 7417
35 Ga0070713_100084089 3300005436 Bacteria 2722
36 Ga0070701_10284503 3300005438 Bacteria 1011
37 Ga0070711_100038184 3300005439 Bacteria 3227
38 Ga0070711_100255267 3300005439 Bacteria 1377
39 Ga0070694_100025784 3300005444 Bacteria 3806
40 Ga0070694_100068686 3300005444 Bacteria 2436
41 Ga0070694_100281988 3300005444 Bacteria 1267
42 Ga0070694_100899481 3300005444 Bacteria 731
43 Ga0070708_100109706 3300005445 Bacteria 2535
44 Ga0070708_100513743 3300005445 Bacteria 1130
45 Ga0070708_100577982 3300005445 Unclassified 1059
46 Ga0070708_100650521 3300005445 Bacteria 993
47 Ga0070663_100002871 3300005455 Bacteria 9802
48 Ga0070678_100104448 3300005456 Bacteria 2203
49 Ga0070662_100003114 3300005457 Bacteria 10298
50 Ga0070662_101081656 3300005457 Bacteria 688
51 Ga0070681_10056226 3300005458 Bacteria 3917
52 Ga0070681_10120596 3300005458 Bacteria 2557
53 Ga0070681_10177632 3300005458 Bacteria 2051
54 Ga0070681_10443931 3300005458 Bacteria 1209
55 Ga0068867_100517529 3300005459 Bacteria 1028
56 Ga0070706_100029600 3300005467 Bacteria 5045
57 Ga0070706_100035602 3300005467 Bacteria 4596
58 Ga0070706_100048744 3300005467 Bacteria 3909
59 Ga0070706_100574692 3300005467 Bacteria 1048
60 Ga0070707_100005445 3300005468 Bacteria 11905
61 Ga0070707_100006727 3300005468 Bacteria 10657
62 Ga0070707_100463548 3300005468 Bacteria 1228
63 Ga0070698_100000058 3300005471 Bacteria 79013
64 Ga0070698_100000159 3300005471 Bacteria 61650
65 Ga0070698_100000764 3300005471 Bacteria 34812
66 Ga0070698_100006995 3300005471 Bacteria 12214
67 Ga0070698_100012179 3300005471 Bacteria 9111
68 Ga0070698_101100970 3300005471 Bacteria 743
69 Ga0070699_100010333 3300005518 Bacteria 8072
70 Ga0070699_100042128 3300005518 Unclassified 3950
71 Ga0070699_100584026 3300005518 Bacteria 1018
72 Ga0070699_100672413 3300005518 Bacteria 945
73 Ga0070699_100815176 3300005518 Bacteria 854
74 Ga0070699_100913826 3300005518 Bacteria 804
75 Ga0070699_101661113 3300005518 Bacteria 585
76 Ga0070699_101841445 3300005518 Bacteria 554
77 Ga0070679_100019312 3300005530 Bacteria 6623
78 Ga0070679_100035505 3300005530 Bacteria 4946
79 Ga0070684_100253455 3300005535 Bacteria 1609
80 Ga0070697_100025272 3300005536 Bacteria 4737
81 Ga0070697_100060178 3300005536 Bacteria 3095
82 Ga0070697_100127919 3300005536 Bacteria 2128
83 Ga0070697_100441933 3300005536 Bacteria 1132
84 Ga0070697_100860950 3300005536 Bacteria 803
85 Ga0070686_100186124 3300005544 Bacteria 1479
86 Ga0070695_100004612 3300005545 Bacteria 8091
87 Ga0070695_100780977 3300005545 Bacteria 764
88 Ga0070696_100006626 3300005546 Bacteria 7737
89 Ga0070696_100011402 3300005546 Bacteria 5953
90 Ga0070696_100126289 3300005546 Bacteria 1856
91 Ga0070696_100148401 3300005546 Bacteria 1719
92 Ga0070696_101167491 3300005546 Unclassified 649
93 Ga0070665_100147202 3300005548 Bacteria 2358
94 Ga0070665_100908275 3300005548 Bacteria 893
95 Ga0070704_100484245 3300005549 Bacteria 1071
96 Ga0070704_100527426 3300005549 Bacteria 1029
97 Ga0070704_101089382 3300005549 Bacteria 725
98 Ga0070704_101386636 3300005549 Unclassified 644
99 Ga0070704_101437679 3300005549 Bacteria 633
100 Ga0068855_100787229 3300005563 Bacteria 1012
101 Ga0070664_100467564 3300005564 Bacteria 1159
102 Ga0068857_100233635 3300005577 Bacteria 1682
103 Ga0068857_100565374 3300005577 Bacteria 1072
104 Ga0068857_101318363 3300005577 Bacteria 701
105 Ga0068856_100099132 3300005614 Bacteria 2904
106 Ga0068856_100100973 3300005614 Bacteria 2878
107 Ga0070702_100159068 3300005615 Bacteria 1458
108 Ga0068859_100158455 3300005617 Bacteria 2342
109 Ga0068864_100703804 3300005618 Bacteria 987
110 Ga0068851_10396417 3300005834 Bacteria 811
111 Ga0068863_100159932 3300005841 Bacteria 2157
112 Ga0068863_100976500 3300005841 Bacteria 849
113 Ga0068858_100785077 3300005842 Bacteria 929
114 Ga0068858_101933202 3300005842 Bacteria 583
115 Ga0068860_100353595 3300005843 Bacteria 1446
116 Ga0068862_100050510 3300005844 Bacteria 3554
117 Ga0068862_100262401 3300005844 Bacteria 1577
118 Ga0081455_10786604 3300005937 Bacteria 598
119 Ga0081538_10006389 3300005981 Bacteria 10384
120 Ga0081538_10032285 3300005981 Bacteria 3512
121 Ga0081539_10000292 3300005985 Bacteria 113454
122 Ga0070717_10000687 3300006028 Bacteria 21805
123 Ga0075365_10042235 3300006038 Bacteria 2980
124 Ga0075365_10086233 3300006038 Bacteria 2134
125 Ga0075365_10122381 3300006038 Bacteria 1795
126 Ga0075368_10100029 3300006042 Bacteria 1190
127 Ga0075368_10177511 3300006042 Bacteria 897
128 Ga0075363_100005431 3300006048 Bacteria 5667
129 Ga0075363_100335803 3300006048 Bacteria 881
130 Ga0075364_10223712 3300006051 Bacteria 1277
131 Ga0075364_11016421 3300006051 Bacteria 563
132 Ga0070716_100602149 3300006173 Unclassified 827
133 Ga0075367_10063091 3300006178 Bacteria 2215
134 Ga0075367_10231382 3300006178 Bacteria 1157
135 Ga0075367_10536527 3300006178 Bacteria 743
136 Ga0075369_10095864 3300006186 Bacteria 1327
137 Ga0075366_10337066 3300006195 Bacteria 925
138 Ga0075366_10353012 3300006195 Bacteria 903
139 Ga0097621_100626858 3300006237 Bacteria 985
140 Ga0068871_100166861 3300006358 Bacteria 1885
141 Ga0068871_101578036 3300006358 Bacteria 621
142 Ga0075428_100051489 3300006844 Bacteria 4515
143 Ga0075428_100137213 3300006844 Bacteria 2659
144 Ga0075428_101561540 3300006844 Bacteria 690
145 Ga0075430_100082327 3300006846 Bacteria 2697
146 Ga0075430_100269874 3300006846 Unclassified 1408
147 Ga0075430_100845757 3300006846 Unclassified 754
148 Ga0075431_100021729 3300006847 Bacteria 6562
149 Ga0075431_100058163 3300006847 Bacteria 3988
150 Ga0075431_100443650 3300006847 Unclassified 1294
151 Ga0075431_100687296 3300006847 Bacteria 1001
152 Ga0075431_101290217 3300006847 Unclassified 691
153 Ga0075431_101372186 3300006847 Bacteria 667
154 Ga0075433_10075979 3300006852 Bacteria 2958
155 Ga0075433_10081111 3300006852 Bacteria 2860
156 Ga0075433_10101960 3300006852 Bacteria 2541
157 Ga0075433_10161733 3300006852 Bacteria 1993
158 Ga0075433_10411478 3300006852 Bacteria 1193
159 Ga0075434_100032062 3300006871 Bacteria 5180
160 Ga0075434_100113024 3300006871 Bacteria 2727
161 Ga0075429_100008724 3300006880 Bacteria 8818
162 Ga0075429_100141214 3300006880 Bacteria 2108
163 Ga0075429_100214620 3300006880 Bacteria 1686
164 Ga0068865_102043792 3300006881 Bacteria 520
165 Ga0075436_100007182 3300006914 Bacteria 7620
166 Ga0075436_100070812 3300006914 Bacteria 2411
167 Ga0075436_100100568 3300006914 Bacteria 2014
168 Ga0075436_100320655 3300006914 Bacteria 1113
169 Ga0097620_100158459 3300006931 Bacteria 2342
170 Ga0075435_100061547 3300007076 Bacteria 3045
171 Ga0075435_101570467 3300007076 Unclassified 577
172 Ga0105240_10001610 3300009093 Bacteria 38284
173 Ga0105240_11260220 3300009093 Bacteria 781
174 Ga0105240_11450950 3300009093 Bacteria 720
175 Ga0111539_10004059 3300009094 Bacteria 19229
176 Ga0111539_10009670 3300009094 Bacteria 12168
177 Ga0111539_10340969 3300009094 Bacteria 1744
178 Ga0105245_10000203 3300009098 Bacteria 56667
179 Ga0114129_10004265 3300009147 Bacteria 20207
180 Ga0114129_10021692 3300009147 Bacteria 9114
181 Ga0114129_10057688 3300009147 Bacteria 5431
182 Ga0114129_10119539 3300009147 Bacteria 3629
183 Ga0114129_10138001 3300009147 Unclassified 3345
184 Ga0114129_10148532 3300009147 Bacteria 3209
185 Ga0114129_10165522 3300009147 Bacteria 3018
186 Ga0114129_10187742 3300009147 Unclassified 2808
187 Ga0114129_10258760 3300009147 Bacteria 2334
188 Ga0114129_10281935 3300009147 Bacteria 2220
189 Ga0114129_10405251 3300009147 Unclassified 1796
190 Ga0114129_10467730 3300009147 Bacteria 1652
191 Ga0114129_10715980 3300009147 Unclassified 1285
192 Ga0114129_11636456 3300009147 Bacteria 787
193 Ga0114129_11730058 3300009147 Unclassified 762
194 Ga0114129_11810943 3300009147 Unclassified 742
195 Ga0105243_10362188 3300009148 Bacteria 1335
196 Ga0105242_11043739 3300009176 Bacteria 828
197 Ga0105248_10423508 3300009177 Bacteria 1499
198 Ga0105237_10001240 3300009545 Bacteria 34022
199 Ga0105237_10242316 3300009545 Bacteria 1804
200 Ga0105237_10784921 3300009545 Bacteria 959
201 Ga0105238_12205065 3300009551 Bacteria 586
202 Ga0105249_10126564 3300009553 Bacteria 2434
203 Ga0105249_10254733 3300009553 Bacteria 1741
204 Ga0105239_10028309 3300010375 Bacteria 6164
205 Ga0105239_10129732 3300010375 Bacteria 2803
206 Ga0105239_10193765 3300010375 Bacteria 2275
207 Ga0157369_10266027 3300013105 Bacteria 1788
208 Ga0157374_10000028 3300013296 Bacteria 213725
209 Ga0157374_10343043 3300013296 Bacteria 1483
210 Ga0163162_11614973 3300013306 Bacteria 740
211 Ga0157375_10636180 3300013308 Bacteria 1224
212 Ga0163163_10149914 3300014325 Bacteria 2376
213 Ga0163163_10877720 3300014325 Bacteria 960
214 Ga0157380_10186155 3300014326 Bacteria 1829
215 Ga0157380_11158810 3300014326 Bacteria 815
216 Ga0157380_12391862 3300014326 Bacteria 593
217 Ga0157377_10253643 3300014745 Unclassified 1141
218 Ga0157376_10001656 3300014969 Bacteria 14794
219 Ga0157376_10027362 3300014969 Bacteria 4518
220 Ga0182007_10135009 3300015262 Bacteria 832
221 Ga0213876_10515916 3300021384 Bacteria 636
222 Ga0207680_10187301 3300025903 Bacteria 1403
223 Ga0207647_10437103 3300025904 Unclassified 734
224 Ga0207645_10549811 3300025907 Bacteria 783
225 Ga0207705_10129660 3300025909 Bacteria 1876
226 Ga0207684_10008739 3300025910 Bacteria 8994
227 Ga0207684_10017912 3300025910 Bacteria 6071
228 Ga0207684_10821221 3300025910 Bacteria 785
229 Ga0207707_10015908 3300025912 Bacteria 6560
230 Ga0207707_10126924 3300025912 Bacteria 2231
231 Ga0207671_10476299 3300025914 Bacteria 995
232 Ga0207663_10032508 3300025916 Bacteria 3098
233 Ga0207660_10150166 3300025917 Bacteria 1789
234 Ga0207660_11622644 3300025917 Bacteria 521
235 Ga0207652_10023424 3300025921 Bacteria 5115
236 Ga0207652_10034976 3300025921 Bacteria 4238
237 Ga0207646_10003462 3300025922 Bacteria 17824
238 Ga0207646_10019175 3300025922 Bacteria 6359
239 Ga0207646_10367936 3300025922 Bacteria 1299
240 Ga0207646_11606165 3300025922 Bacteria 561
241 Ga0207694_10080606 3300025924 Bacteria 2555
242 Ga0207687_10001086 3300025927 Bacteria 18472
243 Ga0207700_10011057 3300025928 Bacteria 5737
244 Ga0207664_10000128 3300025929 Bacteria 66208
245 Ga0207690_10247374 3300025932 Bacteria 1376
246 Ga0207706_10000439 3300025933 Bacteria 44418
247 Ga0207706_10287247 3300025933 Bacteria 1434
248 Ga0207709_10182279 3300025935 Unclassified 1484
249 Ga0207709_11466006 3300025935 Unclassified 566
250 Ga0207670_10562434 3300025936 Bacteria 933
251 Ga0207691_10047581 3300025940 Bacteria 3935
252 Ga0207711_10739985 3300025941 Bacteria 917
253 Ga0207689_10192761 3300025942 Bacteria 1682
254 Ga0207689_11023819 3300025942 Unclassified 696
255 Ga0207661_10095658 3300025944 Bacteria 2484
256 Ga0207679_10434390 3300025945 Bacteria 1161
257 Ga0207667_11239583 3300025949 Bacteria 724
258 Ga0207712_10353856 3300025961 Bacteria 1222
259 Ga0207712_10597378 3300025961 Bacteria 954
260 Ga0207712_10743491 3300025961 Unclassified 859
261 Ga0207658_10284534 3300025986 Bacteria 1419
262 Ga0207658_11359070 3300025986 Bacteria 650
263 Ga0207677_10112166 3300026023 Bacteria 2033
264 Ga0207677_11389879 3300026023 Bacteria 646
265 Ga0207678_10007177 3300026067 Bacteria 9880
266 Ga0207678_11358721 3300026067 Bacteria 628
267 Ga0207708_10202845 3300026075 Bacteria 1583
268 Ga0207702_10032344 3300026078 Bacteria 4365
269 Ga0207702_10224987 3300026078 Bacteria 1750
270 Ga0207641_10055607 3300026088 Bacteria 3361
271 Ga0207641_11415775 3300026088 Unclassified 696
272 Ga0207648_10144945 3300026089 Bacteria 2095
273 Ga0207676_10151924 3300026095 Bacteria 1995
274 Ga0207676_10744398 3300026095 Bacteria 953
275 Ga0207674_10276669 3300026116 Bacteria 1626
276 Ga0207674_10620773 3300026116 Bacteria 1044
277 Ga0207674_10730158 3300026116 Bacteria 956
278 Ga0207683_10089802 3300026121 Bacteria 2735
279 Ga0207428_10016855 3300027907 Bacteria 6278
280 Ga0268266_10981650 3300028379 Bacteria 817
281 Ga0268265_10239076 3300028380 Bacteria 1601
282 Ga0268265_10256827 3300028380 Bacteria 1551
283 Ga0268265_11166881 3300028380 Bacteria 767
284 Ga0268264_10102774 3300028381 Bacteria 2487
285 Ga0265337_1010077 3300028556 Unclassified 3329
286 Ga0265337_1052064 3300028556 Bacteria 1150
287 Ga0265326_10008773 3300028558 Bacteria 3035
288 Ga0265319_1000011 3300028563 Bacteria 184643
289 Ga0265318_10000284 3300028577 Bacteria 41911
290 Ga0265318_10086188 3300028577 Bacteria 1157
291 Ga0265323_10000015 3300028653 Bacteria 105428
292 Ga0265323_10086129 3300028653 Bacteria 1056
293 Ga0265322_10000430 3300028654 Bacteria 17001
294 Ga0265322_10031342 3300028654 Unclassified 1517
295 Ga0265336_10008503 3300028666 Bacteria 3597
296 Ga0307515_10097779 3300028794 Bacteria 3583
297 Ga0265338_10028491 3300028800 Bacteria 5567
298 Ga0265338_10032370 3300028800 Bacteria 5101
299 Ga0265338_10159423 3300028800 Bacteria 1744
300 Ga0265338_10567933 3300028800 Bacteria 793
301 Ga0265330_10364410 3300031235 Bacteria 611
302 Ga0265332_10086329 3300031238 Bacteria 1329
303 Ga0265320_10028596 3300031240 Bacteria 2893
304 Ga0265320_10035765 3300031240 Bacteria 2515
305 Ga0265325_10030965 3300031241 Bacteria 2867
306 Ga0265325_10038957 3300031241 Bacteria 2505
307 Ga0265325_10232646 3300031241 Bacteria 840
308 Ga0265340_10019758 3300031247 Bacteria 3467
309 Ga0265340_10062479 3300031247 Unclassified 1779
310 Ga0265340_10148660 3300031247 Bacteria 1069
311 Ga0265331_10033079 3300031250 Bacteria 2558
312 Ga0265331_10272285 3300031250 Bacteria 759
313 Ga0265327_10039369 3300031251 Bacteria 2568
314 Ga0265316_10000549 3300031344 Bacteria 42208
315 Ga0265316_10008443 3300031344 Bacteria 9560
316 Ga0265316_10009062 3300031344 Bacteria 9171
317 Ga0265316_10015617 3300031344 Bacteria 6629
318 Ga0265316_10021000 3300031344 Bacteria 5541
319 Ga0265316_10129728 3300031344 Bacteria 1900
320 Ga0265316_10195582 3300031344 Bacteria 1501
321 Ga0307513_10006699 3300031456 Bacteria 15030
322 Ga0307509_10001290 3300031507 Bacteria 42541
323 Ga0265313_10015352 3300031595 Bacteria 4466
324 Ga0265313_10038587 3300031595 Bacteria 2377
325 Ga0307508_10000513 3300031616 Bacteria 46447
326 Ga0307508_10131554 3300031616 Bacteria 2106
327 Ga0265314_10000001 3300031711 Bacteria 3792860
328 Ga0265314_10004796 3300031711 Bacteria 12383
329 Ga0265314_10006365 3300031711 Bacteria 10468
330 Ga0265314_10012148 3300031711 Bacteria 7052
331 Ga0265314_10045630 3300031711 Bacteria 3096
332 Ga0265314_10175595 3300031711 Bacteria 1289
333 Ga0265342_10032133 3300031712 Bacteria 3238
334 Ga0265342_10470479 3300031712 Bacteria 643
335 Ga0307516_10080566 3300031730 Bacteria 3100
336 Ga0307516_10116148 3300031730 Bacteria 2472
337 Ga0307405_10405214 3300031731 Bacteria 1069
338 Ga0307409_100570590 3300031995 Bacteria 1114
339 Ga0307416_100964139 3300032002 Bacteria 955
340 Ga0307416_102059168 3300032002 Bacteria 673
341 Ga0307416_102254177 3300032002 Bacteria 645
342 Ga0307414_11923782 3300032004 Bacteria 552
343 Ga0316583_10000170 3300032133 Bacteria 16330
344 Ga0373949_0000884 3300035090 Bacteria 9431
345 Ga0373951_0125100 3300035091 Bacteria 703
346 Ga0373923_0030406 3300035111 Bacteria 2172
347 Ga0373953_0257236 3300035117 Bacteria 759
348 Ga0373956_0363820 3300035119 Bacteria 690
349 Ga0373957_0270730 3300035120 Bacteria 717
350 Ga0373960_0002896 3300035121 Bacteria 3880
351 Ga0373955_0071999 3300035172 Bacteria 1935
352 Ga0373942_0098086 3300035207 Bacteria 892
353 Ga0373927_0046495 3300035695 Bacteria 2808
354 Ga0373933_0047960 3300035724 Bacteria 2542
355 Ga0373933_0060641 3300035724 Bacteria 2281
356 Ga0373933_0116647 3300035724 Bacteria 1669
357 Ga0373937_0016096 3300036401 Bacteria 6634
358 Ga0373937_0458987 3300036401 Bacteria 1210
359 Ga0395899_0002535 3300037312 Bacteria 14799
360 Ga0395898_0256697 3300037466 Unclassified 1667
361 Ga0395898_0714121 3300037466 Bacteria 944
362 Ga0395905_0001144 3300037471 Bacteria 33189
363 Ga0395905_0261352 3300037471 Bacteria 1616
364 Ga0395905_0884818 3300037471 Bacteria 796
365 Ga0395905_1099164 3300037471 Unclassified 698
366 Ga0436364_1369666 3300037853 Bacteria 2750
367 Ga0395901_0001208 3300038443 Bacteria 27462
368 Ga0237819_17348 3300038705 Bacteria 794
369 Ga0436365_1438224 3300039437 Bacteria 1164
370 Ga0436365_1922161 3300039437 Bacteria 615
371 Ga0436360_0819779 3300039438 Bacteria 1057
372 Ga0451807_2214409 3300041486 Bacteria 550
373 Ga0451853_1103094 3300041512 Bacteria 1901
374 Ga0451853_1741855 3300041512 Bacteria 810
375 Ga0439441_070899 3300042001 Bacteria 747
376 Ga0451577_0000499 3300042876 Bacteria 66047
377 Ga0451577_0003072 3300042876 Bacteria 18887
378 Ga0451577_0187282 3300042876 Bacteria 1867
379 Ga0451577_0216403 3300042876 Bacteria 1731
380 Ga0451577_0507438 3300042876 Bacteria 1095
381 Ga0466972_0000388 3300044658 Bacteria 23520
382 Ga0466972_0010970 3300044658 Bacteria 4548
383 Ga0466972_0366054 3300044658 Bacteria 675
384 Ga0453683_0000852 3300044673 Bacteria 29434
385 Ga0453683_0001962 3300044673 Bacteria 16666
386 Ga0453683_0211231 3300044673 Bacteria 1233
387 Ga0453683_0925856 3300044673 Bacteria 577
388 Ga0466965_0012718 3300044683 Bacteria 3964
389 Ga0466961_0575191 3300044693 Bacteria 678
390 Ga0466964_0020565 3300044706 Bacteria 2543
391 Ga0453684_0000586 3300044712 Bacteria 135374
392 Ga0453684_0001918 3300044712 Bacteria 53912
393 Ga0453684_0012865 3300044712 Bacteria 13709
394 Ga0453684_0013262 3300044712 Bacteria 13422
395 Ga0453684_0014672 3300044712 Bacteria 12496
396 Ga0453684_0025189 3300044712 Bacteria 8648
397 Ga0453684_0487849 3300044712 Bacteria 1366
398 Ga0453684_0488900 3300044712 Bacteria 1364
399 Ga0453684_0637993 3300044712 Bacteria 1163
400 Ga0453684_0830088 3300044712 Unclassified 995
401 Ga0453684_1033348 3300044712 Unclassified 872
402 Ga0453684_1494637 3300044712 Bacteria 697
403 Ga0466971_0000045 3300044719 Bacteria 50210
404 Ga0466971_0000077 3300044719 Bacteria 35552
405 Ga0466968_0014455 3300044735 Bacteria 3120
406 Ga0466970_0149126 3300044765 Bacteria 1291
407 Ga0466970_0352708 3300044765 Bacteria 835
408 Ga0466957_0009239 3300044842 Bacteria 5623
409 Ga0466957_0062415 3300044842 Bacteria 2288
410 Ga0466960_0008293 3300044901 Bacteria 4250
411 Ga0466960_0152870 3300044901 Bacteria 1234
412 Ga0466960_0307868 3300044901 Bacteria 894
413 Ga0466959_0111800 3300045049 Bacteria 1949
414 Ga0451576_0016323 3300045051 Bacteria 8200
415 Ga0451576_0045719 3300045051 Bacteria 4609
416 Ga0451576_0085907 3300045051 Bacteria 3273
417 Ga0451576_0089349 3300045051 Bacteria 3204
418 Ga0451576_0152340 3300045051 Bacteria 2411
419 Ga0451576_0174098 3300045051 Bacteria 2247
420 Ga0451576_0272924 3300045051 Bacteria 1768
421 Ga0451576_0472624 3300045051 Bacteria 1317
422 Ga0451576_0975983 3300045051 Bacteria 888
423 Ga0466958_0823882 3300045836 Bacteria 605
424 Ga0466967_0054343 3300045976 Bacteria 3524
425 Ga0466967_0077361 3300045976 Bacteria 2995
426 Ga0495592_0113869 3300046454 Unclassified 1911
427 Ga0495651_0005556 3300046462 Bacteria 9614
428 Ga0495651_0048384 3300046462 Bacteria 3284
429 Ga0495653_0003304 3300046463 Bacteria 12941
430 Ga0495650_0020245 3300046471 Bacteria 3249
431 Ga0495608_0001943 3300046511 Bacteria 14836
432 Ga0495608_0123941 3300046511 Unclassified 1656
433 Ga0495628_0222364 3300046516 Bacteria 1418
434 Ga0495630_0031225 3300046517 Bacteria 3966
435 Ga0495652_0003238 3300046529 Bacteria 16225
436 Ga0495652_0036919 3300046529 Bacteria 4243
437 Ga0495586_0427936 3300046535 Bacteria 763
438 Ga0495587_0009943 3300046536 Bacteria 6072
439 Ga0495598_0032659 3300046537 Bacteria 1472
440 Ga0495621_0005591 3300046539 Bacteria 3624
441 Ga0495645_0013858 3300046543 Bacteria 5715
442 Ga0495645_0027140 3300046543 Bacteria 4159
443 Ga0495622_0064198 3300046557 Bacteria 1698
444 Ga0495667_0002735 3300046559 Bacteria 11784
445 Ga0495667_0086718 3300046559 Bacteria 2030
446 Ga0495668_0605885 3300046616 Bacteria 605
447 Ga0495635_0015163 3300046663 Bacteria 5391
448 Ga0495659_0122722 3300046664 Bacteria 1024
449 Ga0495588_0029584 3300046674 Unclassified 2749
450 Ga0495657_0001156 3300046675 Bacteria 23145
451 Ga0495657_0123220 3300046675 Unclassified 1631
452 Ga0495599_0490094 3300046678 Bacteria 724
453 Ga0495599_0589901 3300046678 Bacteria 648
454 Ga0495623_0164994 3300046679 Bacteria 1298
455 Ga0495600_0010984 3300046809 Bacteria 5634
456 Ga0495604_0003904 3300047317 Bacteria 11873
457 Ga0495636_0020776 3300047318 Bacteria 2647
458 Ga0495674_0012283 3300047319 Bacteria 8072
459 Ga0495672_0003726 3300047320 Bacteria 12852
460 Ga0495672_0062108 3300047320 Bacteria 2150
461 Ga0495680_0002785 3300047322 Bacteria 17617
462 Ga0495675_0007432 3300047444 Bacteria 6746
463 Ga0495684_0012913 3300047471 Bacteria 6447
464 Ga0495684_0606521 3300047471 Bacteria 738
465 Ga0495602_0063732 3300048088 Bacteria 3192
466 Ga0496106_1371746 3300048909 Unclassified 547
467 Ga0496108_0711884 3300048911 Bacteria 870
468 Ga0496109_0292655 3300048912 Bacteria 1535
469 Ga0496114_0550779 3300048917 Bacteria 1019
470 Ga0496116_0003081 3300048919 Bacteria 16808
471 Ga0501031_0000053 3300049568 Bacteria 62966
472 Ga0501031_0000383 3300049568 Bacteria 25957
473 Ga0501031_0000514 3300049568 Bacteria 22669
474 Ga0501032_0024208 3300049569 Bacteria 4194
475 Ga0501033_0000049 3300049570 Bacteria 114610
476 Ga0501033_0000057 3300049570 Bacteria 107439
477 Ga0501034_0162941 3300049571 Bacteria 2200
478 Ga0501034_0242107 3300049571 Bacteria 1750
479 Ga0501034_0394729 3300049571 Bacteria 1307
480 Ga0501036_0008961 3300049572 Bacteria 8228
481 Ga0501036_0091278 3300049572 Bacteria 2573
482 Ga0501036_0152311 3300049572 Bacteria 1950
483 Ga0501036_0621439 3300049572 Bacteria 895
484 Ga0501037_0000002 3300049573 Bacteria 292291
485 Ga0501037_0940642 3300049573 Bacteria 565
486 Ga0501038_0001276 3300049574 Bacteria 22851
487 Ga0501038_0008875 3300049574 Bacteria 9228
488 Ga0501038_0128109 3300049574 Bacteria 2087
489 Ga0501038_0154658 3300049574 Bacteria 1868
490 Ga0501038_0227861 3300049574 Bacteria 1484
491 Ga0501039_0000217 3300049575 Bacteria 42182
492 Ga0501039_0000405 3300049575 Bacteria 30997
493 Ga0501039_0002621 3300049575 Bacteria 13429
494 Ga0501039_0008472 3300049575 Bacteria 7839
495 Ga0501039_0651095 3300049575 Bacteria 825
496 Ga0501040_0574258 3300049576 Bacteria 814
497 Ga0501041_0040587 3300049577 Bacteria 2825
498 Ga0501042_0614878 3300049578 Bacteria 790
499 Ga0501043_0002182 3300049579 Bacteria 16711
500 Ga0501043_0002351 3300049579 Bacteria 16031
501 Ga0501043_0003769 3300049579 Bacteria 12461
502 Ga0501043_0028414 3300049579 Bacteria 4390
503 Ga0501047_0004689 3300049581 Bacteria 12856
504 Ga0501047_0009135 3300049581 Bacteria 9360
505 Ga0501047_0079423 3300049581 Bacteria 3154
506 Ga0501047_0163713 3300049581 Bacteria 2095
507 Ga0501047_0266251 3300049581 Bacteria 1561
508 Ga0501047_0574448 3300049581 Bacteria 950
509 Ga0501048_0566636 3300049582 Bacteria 815
510 Ga0501068_0232096 3300049584 Bacteria 1173
511 Ga0501068_0290122 3300049584 Bacteria 1046
512 Ga0501070_0000696 3300049586 Bacteria 30864
513 Ga0501070_0002593 3300049586 Bacteria 15800
514 Ga0501070_0048386 3300049586 Bacteria 3532
515 Ga0501070_0088488 3300049586 Bacteria 2563
516 Ga0501071_0019581 3300049587 Bacteria 4697
517 Ga0501072_0005594 3300049588 Bacteria 9562
518 Ga0501072_0028489 3300049588 Bacteria 4361
519 Ga0501073_0012098 3300049589 Bacteria 6301
520 Ga0501073_0628206 3300049589 Bacteria 741
521 Ga0501073_0822535 3300049589 Bacteria 640
522 Ga0501074_0260459 3300049590 Bacteria 1233
523 Ga0501074_0509032 3300049590 Bacteria 853
524 Ga0501075_0082560 3300049591 Bacteria 2434
525 Ga0501075_0105565 3300049591 Bacteria 2141
526 Ga0501075_1425734 3300049591 Unclassified 524
527 Ga0501076_0098357 3300049592 Bacteria 2357
528 Ga0501076_0119301 3300049592 Bacteria 2136
529 Ga0501076_0124687 3300049592 Bacteria 2087
530 Ga0501207_080398 3300049654 Bacteria 626
531 Ga0501209_198446 3300049656 Bacteria 617
532 Ga0501227_018133 3300049665 Bacteria 1595
533 Ga0501240_023486 3300049673 Bacteria 946
534 Ga0501257_066563 3300049686 Bacteria 916
535 Ga0501079_0177071 3300049741 Bacteria 1663
536 Ga0501079_0972288 3300049741 Bacteria 669
537 Ga0501079_0984639 3300049741 Bacteria 664
538 Ga0501080_0013488 3300049742 Bacteria 7520
539 Ga0501080_0014976 3300049742 Bacteria 7140
540 Ga0501080_0683659 3300049742 Bacteria 906
541 Ga0501080_0958643 3300049742 Bacteria 743
542 Ga0501080_1173224 3300049742 Bacteria 661
543 Ga0501080_1410921 3300049742 Bacteria 594
544 Ga0501081_0214114 3300049743 Bacteria 1400
545 Ga0501081_0456408 3300049743 Bacteria 950
546 Ga0501083_0012288 3300049744 Bacteria 5993
547 Ga0501035_0000001 3300049822 Bacteria 1037138
548 Ga0501035_0000007 3300049822 Bacteria 359281
549 Ga0501044_0000259 3300049823 Bacteria 67115
550 Ga0501044_0002636 3300049823 Bacteria 20400
551 Ga0501044_0022639 3300049823 Bacteria 6692
552 Ga0501044_0069602 3300049823 Bacteria 3582
553 Ga0501045_0005133 3300049824 Bacteria 9063
554 Ga0501045_0108160 3300049824 Bacteria 2061
555 nmdc:mga03n38_15322_c1 3300050490 Bacteria 2958
556 nmdc:mga00v17_530860_c1 3300050491 Bacteria 762
557 nmdc:mga00v17_68236_c1 3300050491 Bacteria 2198
558 nmdc:mga0yw44_121420_c1 3300050492 Bacteria 1683
559 nmdc:mga0yw44_14001_c1 3300050492 Bacteria 4243
560 nmdc:mga0yw44_52914_c1 3300050492 Bacteria 2463
561 nmdc:mga0k408_467382_c1 3300050493 Unclassified 748
562 nmdc:mga06z11_182719_c1 3300050494 Bacteria 1210
563 nmdc:mga06z11_65160_c1 3300050494 Bacteria 1911
564 nmdc:mga06z11_72288_c1 3300050494 Bacteria 1828
565 nmdc:mga04h51_424854_c1 3300050495 Bacteria 559
566 nmdc:mga05p37_1232802_c1 3300050507 Unclassified 769
567 nmdc:mga05p37_141842_c1 3300050507 Bacteria 2943
568 nmdc:mga05p37_1615547_c1 3300050507 Bacteria 638
569 nmdc:mga05p37_172394_c1 3300050507 Bacteria 2638
570 nmdc:mga05p37_1768520_c1 3300050507 Bacteria 598
571 nmdc:mga05p37_20364_c1 3300050507 Bacteria 8026
572 nmdc:mga05p37_251374_c1 3300050507 Bacteria 2120
573 nmdc:mga05p37_293738_c1 3300050507 Bacteria 1934
574 nmdc:mga05p37_3145_c1 3300050507 Bacteria 19203
575 nmdc:mga05p37_32319_c1 3300050507 Bacteria 6399
576 nmdc:mga05p37_388086_c1 3300050507 Bacteria 1634
577 nmdc:mga05p37_474218_c1 3300050507 Bacteria 1443
578 nmdc:mga05p37_780282_c1 3300050507 Bacteria 1049
579 nmdc:mga09592_3139_c1 3300050508 Bacteria 13416
580 nmdc:mga09592_49245_c1 3300050508 Bacteria 3552
581 nmdc:mga09592_89312_c1 3300050508 Bacteria 2632
582 nmdc:mga0qj67_16521_c1 3300050509 Bacteria 5600
583 nmdc:mga0qj67_719512_c1 3300050509 Unclassified 793
584 nmdc:mga0qj67_726952_c1 3300050509 Bacteria 789
585 nmdc:mga06r32_1239529_c1 3300050510 Unclassified 691
586 nmdc:mga06r32_221443_c1 3300050510 Bacteria 1880
587 nmdc:mga06r32_258239_c1 3300050510 Bacteria 1730
588 nmdc:mga06r32_329050_c1 3300050510 Bacteria 1513
589 nmdc:mga06r32_517159_c1 3300050510 Unclassified 1169
590 nmdc:mga06r32_68031_c1 3300050510 Bacteria 3440
591 nmdc:mga08y16_5068_c1 3300050511 Bacteria 13771
592 nmdc:mga08y16_65823_c1 3300050511 Bacteria 3783
593 nmdc:mga08y16_946986_c1 3300050511 Bacteria 844
594 nmdc:mga0n895_308615_c1 3300050512 Bacteria 1604
595 nmdc:mga0n895_46388_c1 3300050512 Bacteria 4245
596 nmdc:mga0n895_55397_c1 3300050512 Bacteria 3903
597 nmdc:mga0rr50_1511446_c1 3300050513 Unclassified 568
598 nmdc:mga0rr50_47972_c1 3300050513 Bacteria 3155
599 nmdc:mga08x19_123326_c1 3300050514 Bacteria 1738
600 nmdc:mga08x19_124016_c1 3300050514 Bacteria 1733
601 nmdc:mga08x19_128423_c1 3300050514 Bacteria 1703
602 nmdc:mga08x19_15081_c1 3300050514 Bacteria 4695
603 nmdc:mga08x19_608504_c1 3300050514 Bacteria 774
604 nmdc:mga0a205_102218_c1 3300050515 Bacteria 2765
605 nmdc:mga0a205_1076045_c1 3300050515 Unclassified 651
606 nmdc:mga0a205_335009_c1 3300050515 Bacteria 1382
607 nmdc:mga0a205_364253_c1 3300050515 Bacteria 1312
608 nmdc:mga0a205_489078_c1 3300050515 Bacteria 1088
609 nmdc:mga0a205_58053_c1 3300050515 Bacteria 3738
610 nmdc:mga0a205_58937_c1 3300050515 Bacteria 3709
611 nmdc:mga0a205_9398_c1 3300050515 Bacteria 8936
612 nmdc:mga0sz30_31431_c1 3300050516 Bacteria 2197
613 Ga0495601_0031035 3300053077 Bacteria 3321
614 Ga0495619_0006543 3300053085 Bacteria 7371
615 Ga0500554_163651 3300053102 Bacteria 750
616 Ga0500569_066961 3300053109 Bacteria 1122
617 Ga0500568_0264008 3300053139 Bacteria 626
618 Ga0501084_0959507 3300054114 Bacteria 719
619 Ga0501084_1641839 3300054114 Bacteria 537
620 Ga0590071_004510 3300059421 Unclassified 3379
621 Ga0590075_142472 3300059424 Unclassified 630
622 Ga0590077_078231 3300059426 Unclassified 760
623 Ga0501082_0031105 3300060353 Bacteria 4601
624 Ga0501082_0100889 3300060353 Bacteria 2497
625 Ga0501082_0142278 3300060353 Bacteria 2082
626 Ga0501082_0646995 3300060353 Bacteria 925
627 Ga0466962_0000006 3300061719 Bacteria 168917
628 Ga0466962_0000052 3300061719 Bacteria 47302
629 Ga0530510_0292007 3300061734 Bacteria 1219
630 Ga0530510_0927639 3300061734 Bacteria 666

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_11466006 Ga0207709_114660061 127
2 3300014745 Ga0157377_10253643 Ga0157377_102536431 131
3 3300005467 Ga0070706_100574692 Ga0070706_1005746922 135
4 3300009147 Ga0114129_10119539 Ga0114129_101195392 136
5 3300025910 Ga0207684_10821221 Ga0207684_108212212 136
6 3300050507 nmdc:mga05p37_1615547_c1 nmdc:mga05p37_1615547_c1_169_609 136
7 3300005367 Ga0070667_101610485 Ga0070667_1016104852 137
8 3300005444 Ga0070694_100025784 Ga0070694_1000257843 137
9 3300005468 Ga0070707_100006727 Ga0070707_1000067274 137
10 3300005545 Ga0070695_100004612 Ga0070695_1000046124 137
11 3300005618 Ga0068864_100703804 Ga0068864_1007038042 137
12 3300005841 Ga0068863_100159932 Ga0068863_1001599322 137
13 3300005842 Ga0068858_101933202 Ga0068858_1019332021 137
14 3300005843 Ga0068860_100353595 Ga0068860_1003535952 137
15 3300005844 Ga0068862_100262401 Ga0068862_1002624012 137
16 3300009147 Ga0114129_10004265 Ga0114129_1000426514 137
17 3300009553 Ga0105249_10126564 Ga0105249_101265642 137
18 3300014325 Ga0163163_10877720 Ga0163163_108777202 137
19 3300025922 Ga0207646_10019175 Ga0207646_100191753 137
20 3300025961 Ga0207712_10743491 Ga0207712_107434911 137
21 3300025986 Ga0207658_11359070 Ga0207658_113590702 137
22 3300026088 Ga0207641_10055607 Ga0207641_100556072 137
23 3300026095 Ga0207676_10744398 Ga0207676_107443981 137
24 3300028380 Ga0268265_10239076 Ga0268265_102390762 137
25 3300028381 Ga0268264_10102774 Ga0268264_101027742 137
26 3300050507 nmdc:mga05p37_3145_c1 nmdc:mga05p37_3145_c1_4393_4833 137
27 3300050515 nmdc:mga0a205_364253_c1 nmdc:mga0a205_364253_c1_822_1262 137
28 3300006852 Ga0075433_10101960 Ga0075433_101019602 138
29 3300006914 Ga0075436_100320655 Ga0075436_1003206552 138
30 3300009147 Ga0114129_10187742 Ga0114129_101877422 138
31 3300035117 Ga0373953_0257236 Ga0373953_0257236_71_529 138
32 3300035119 Ga0373956_0363820 Ga0373956_0363820_78_506 138
33 3300035120 Ga0373957_0270730 Ga0373957_0270730_71_529 138
34 3300035172 Ga0373955_0071999 Ga0373955_0071999_556_1014 138
35 3300035724 Ga0373933_0047960 Ga0373933_0047960_2081_2509 138
36 3300035724 Ga0373933_0060641 Ga0373933_0060641_132_590 138
37 3300036401 Ga0373937_0016096 Ga0373937_0016096_3342_3800 138
38 3300046454 Ga0495592_0113869 Ga0495592_0113869_1409_1837 138
39 3300046462 Ga0495651_0005556 Ga0495651_0005556_602_1060 138
40 3300046462 Ga0495651_0048384 Ga0495651_0048384_1568_1996 138
41 3300046463 Ga0495653_0003304 Ga0495653_0003304_8764_9222 138
42 3300046511 Ga0495608_0001943 Ga0495608_0001943_7448_7906 138
43 3300046511 Ga0495608_0123941 Ga0495608_0123941_103_531 138
44 3300046529 Ga0495652_0003238 Ga0495652_0003238_4321_4779 138
45 3300046529 Ga0495652_0036919 Ga0495652_0036919_1878_2306 138
46 3300046536 Ga0495587_0009943 Ga0495587_0009943_4809_5267 138
47 3300046543 Ga0495645_0027140 Ga0495645_0027140_2064_2522 138
48 3300046559 Ga0495667_0002735 Ga0495667_0002735_4307_4765 138
49 3300046559 Ga0495667_0086718 Ga0495667_0086718_745_1173 138
50 3300046663 Ga0495635_0015163 Ga0495635_0015163_599_1057 138
51 3300046675 Ga0495657_0001156 Ga0495657_0001156_15764_16222 138
52 3300046675 Ga0495657_0123220 Ga0495657_0123220_966_1394 138
53 3300046678 Ga0495599_0490094 Ga0495599_0490094_57_515 138
54 3300046678 Ga0495599_0589901 Ga0495599_0589901_162_590 138
55 3300046679 Ga0495623_0164994 Ga0495623_0164994_175_633 138
56 3300046809 Ga0495600_0010984 Ga0495600_0010984_875_1333 138
57 3300047317 Ga0495604_0003904 Ga0495604_0003904_7975_8433 138
58 3300047319 Ga0495674_0012283 Ga0495674_0012283_3778_4236 138
59 3300047322 Ga0495680_0002785 Ga0495680_0002785_9852_10310 138
60 3300047444 Ga0495675_0007432 Ga0495675_0007432_4275_4733 138
61 3300047471 Ga0495684_0012913 Ga0495684_0012913_1937_2395 138
62 3300047471 Ga0495684_0606521 Ga0495684_0606521_159_587 138
63 3300048088 Ga0495602_0063732 Ga0495602_0063732_2156_2614 138
64 3300050507 nmdc:mga05p37_474218_c1 nmdc:mga05p37_474218_c1_333_788 138
65 3300053077 Ga0495601_0031035 Ga0495601_0031035_2207_2665 138
66 3300053085 Ga0495619_0006543 Ga0495619_0006543_6889_7347 138
67 iso_pu_bacteria 2617270889 2617917190 138
68 iso_pu_bacteria 2841911363 2841915318 138
69 iso_pu_bacteria 2841917233 2841922215 138
70 iso_pu_bacteria 2913844669 2913845009 138
71 iso_pu_bacteria 2913939268 2913941746 138
72 iso_pu_bacteria 642555144 642602656 138
73 3300006914 Ga0075436_100100568 Ga0075436_1001005682 139
74 3300007076 Ga0075435_100061547 Ga0075435_1000615472 139
75 3300009147 Ga0114129_11636456 Ga0114129_116364562 139
76 3300031730 Ga0307516_10116148 Ga0307516_101161482 139
77 3300041486 Ga0451807_2214409 Ga0451807_2214409_95_514 139
78 3300044673 Ga0453683_0925856 Ga0453683_0925856_73_498 139
79 3300045051 Ga0451576_0045719 Ga0451576_0045719_2389_2832 139
80 3300045051 Ga0451576_0085907 Ga0451576_0085907_312_737 139
81 3300050512 nmdc:mga0n895_308615_c1 nmdc:mga0n895_308615_c1_271_717 139
82 3300050513 nmdc:mga0rr50_47972_c1 nmdc:mga0rr50_47972_c1_147_593 139
83 3300050514 nmdc:mga08x19_124016_c1 nmdc:mga08x19_124016_c1_998_1444 139
84 3300050515 nmdc:mga0a205_58053_c1 nmdc:mga0a205_58053_c1_3156_3602 139
85 3300005536 Ga0070697_100060178 Ga0070697_1000601782 140
86 3300038443 Ga0395901_0001208 Ga0395901_0001208_16250_16678 140
87 3300044765 Ga0466970_0149126 Ga0466970_0149126_828_1253 140
88 3300045049 Ga0466959_0111800 Ga0466959_0111800_159_584 140
89 3300049588 Ga0501072_0005594 Ga0501072_0005594_1850_2290 140
90 3300050507 nmdc:mga05p37_1232802_c1 nmdc:mga05p37_1232802_c1_222_644 140
91 3300005337 Ga0070682_100845096 Ga0070682_1008450961 141
92 3300005438 Ga0070701_10284503 Ga0070701_102845032 141
93 3300005445 Ga0070708_100109706 Ga0070708_1001097062 141
94 3300005455 Ga0070663_100002871 Ga0070663_1000028712 141
95 3300005467 Ga0070706_100035602 Ga0070706_1000356022 141
96 3300005471 Ga0070698_100000159 Ga0070698_1000001592 141
97 3300005548 Ga0070665_100147202 Ga0070665_1001472023 141
98 3300005615 Ga0070702_100159068 Ga0070702_1001590682 141
99 3300006844 Ga0075428_100051489 Ga0075428_1000514895 141
100 3300014325 Ga0163163_10149914 Ga0163163_101499143 141
101 3300025910 Ga0207684_10008739 Ga0207684_100087397 141
102 3300026067 Ga0207678_10007177 Ga0207678_1000717712 141
103 3300035091 Ga0373951_0125100 Ga0373951_0125100_117_548 141
104 3300044658 Ga0466972_0010970 Ga0466972_0010970_422_871 141
105 3300044735 Ga0466968_0014455 Ga0466968_0014455_1868_2317 141
106 3300044901 Ga0466960_0008293 Ga0466960_0008293_578_1027 141
107 3300049589 Ga0501073_0822535 Ga0501073_0822535_92_517 141
108 3300049654 Ga0501207_080398 Ga0501207_080398_121_546 141
109 3300049673 Ga0501240_023486 Ga0501240_023486_67_492 141
110 iso_pu_bacteria 2848694841 2848697416 141
111 iso_pu_bacteria 2849660919 2849661278 141
112 iso_pu_bacteria 2883291878 2883292243 141
113 iso_pu_bacteria 2883354860 2883355243 141
114 3300003320 rootH2_10031699 rootH2_100316992 142
115 3300005546 Ga0070696_101167491 Ga0070696_1011674911 142
116 3300005577 Ga0068857_100565374 Ga0068857_1005653742 142
117 3300026116 Ga0207674_10620773 Ga0207674_106207732 142
118 3300035111 Ga0373923_0030406 Ga0373923_0030406_713_1141 142
119 3300036401 Ga0373937_0458987 Ga0373937_0458987_750_1178 142
120 3300046616 Ga0495668_0605885 Ga0495668_0605885_13_444 142
121 3300031238 Ga0265332_10086329 Ga0265332_100863292 143
122 3300031241 Ga0265325_10038957 Ga0265325_100389572 143
123 3300031247 Ga0265340_10019758 Ga0265340_100197582 143
124 3300031344 Ga0265316_10195582 Ga0265316_101955822 143
125 3300031595 Ga0265313_10038587 Ga0265313_100385872 143
126 3300031712 Ga0265342_10470479 Ga0265342_104704792 143
127 3300048917 Ga0496114_0550779 Ga0496114_0550779_351_785 143
128 3300049591 Ga0501075_0082560 Ga0501075_0082560_377_817 143
129 3300049742 Ga0501080_0683659 Ga0501080_0683659_384_824 143
130 3300049744 Ga0501083_0012288 Ga0501083_0012288_1236_1673 143
131 3300061734 Ga0530510_0927639 Ga0530510_0927639_180_620 143
132 iso_pu_bacteria 2831426010 2831426739 143
133 3300003316 rootH1_10134343 rootH1_101343432 144
134 3300003320 rootH2_10003759 rootH2_100037591 144
135 3300003322 rootL2_10069044 rootL2_100690444 144
136 3300003322 rootL2_10154203 rootL2_101542032 144
137 3300005327 Ga0070658_10095322 Ga0070658_100953222 144
138 3300005444 Ga0070694_100068686 Ga0070694_1000686862 144
139 3300005458 Ga0070681_10056226 Ga0070681_100562264 144
140 3300005471 Ga0070698_101100970 Ga0070698_1011009702 144
141 3300005518 Ga0070699_101841445 Ga0070699_1018414451 144
142 3300006195 Ga0075366_10337066 Ga0075366_103370661 144
143 3300006195 Ga0075366_10353012 Ga0075366_103530122 144
144 3300006358 Ga0068871_100166861 Ga0068871_1001668612 144
145 3300009093 Ga0105240_10001610 Ga0105240_1000161018 144
146 3300009147 Ga0114129_10715980 Ga0114129_107159803 144
147 3300009176 Ga0105242_11043739 Ga0105242_110437392 144
148 3300009545 Ga0105237_10001240 Ga0105237_1000124011 144
149 3300013296 Ga0157374_10000028 Ga0157374_10000028124 144
150 3300013306 Ga0163162_11614973 Ga0163162_116149732 144
151 3300014969 Ga0157376_10001656 Ga0157376_100016563 144
152 3300025909 Ga0207705_10129660 Ga0207705_101296602 144
153 3300025912 Ga0207707_10126924 Ga0207707_101269242 144
154 3300026067 Ga0207678_11358721 Ga0207678_113587212 144
155 3300031241 Ga0265325_10232646 Ga0265325_102326461 144
156 3300031730 Ga0307516_10080566 Ga0307516_100805662 144
157 3300039438 Ga0436360_0819779 Ga0436360_0819779_602_1042 144
158 3300041512 Ga0451853_1741855 Ga0451853_1741855_250_684 144
159 3300044673 Ga0453683_0001962 Ga0453683_0001962_9923_10360 144
160 3300044706 Ga0466964_0020565 Ga0466964_0020565_1922_2431 144
161 3300044712 Ga0453684_1494637 Ga0453684_1494637_116_553 144
162 3300044719 Ga0466971_0000045 Ga0466971_0000045_29990_30433 144
163 3300044842 Ga0466957_0009239 Ga0466957_0009239_1977_2486 144
164 3300044901 Ga0466960_0307868 Ga0466960_0307868_71_514 144
165 3300045051 Ga0451576_0472624 Ga0451576_0472624_285_722 144
166 3300045976 Ga0466967_0077361 Ga0466967_0077361_2205_2648 144
167 3300046535 Ga0495586_0427936 Ga0495586_0427936_108_542 144
168 3300046674 Ga0495588_0029584 Ga0495588_0029584_1303_1746 144
169 3300049570 Ga0501033_0000049 Ga0501033_0000049_1957_2400 144
170 3300049570 Ga0501033_0000057 Ga0501033_0000057_17824_18270 144
171 3300049574 Ga0501038_0001276 Ga0501038_0001276_1283_1726 144
172 3300049574 Ga0501038_0008875 Ga0501038_0008875_2753_3199 144
173 3300049590 Ga0501074_0509032 Ga0501074_0509032_198_641 144
174 3300050493 nmdc:mga0k408_467382_c1 nmdc:mga0k408_467382_c1_222_665 144
175 3300054114 Ga0501084_0959507 Ga0501084_0959507_192_626 144
176 3300060353 Ga0501082_0646995 Ga0501082_0646995_78_542 144
177 3300061719 Ga0466962_0000052 Ga0466962_0000052_25193_25636 144
178 3300003320 rootH2_10023036 rootH2_100230365 145
179 3300005289 Ga0065704_10300019 Ga0065704_103000192 145
180 3300005328 Ga0070676_10905241 Ga0070676_109052412 145
181 3300005334 Ga0068869_100070567 Ga0068869_1000705671 145
182 3300005336 Ga0070680_100507777 Ga0070680_1005077771 145
183 3300005336 Ga0070680_100806192 Ga0070680_1008061922 145
184 3300005338 Ga0068868_100087548 Ga0068868_1000875482 145
185 3300005343 Ga0070687_100775255 Ga0070687_1007752552 145
186 3300005345 Ga0070692_10064723 Ga0070692_100647232 145
187 3300005353 Ga0070669_100652807 Ga0070669_1006528072 145
188 3300005366 Ga0070659_100287673 Ga0070659_1002876732 145
189 3300005445 Ga0070708_100577982 Ga0070708_1005779822 145
190 3300005458 Ga0070681_10177632 Ga0070681_101776322 145
191 3300005458 Ga0070681_10443931 Ga0070681_104439312 145
192 3300005467 Ga0070706_100029600 Ga0070706_1000296004 145
193 3300005468 Ga0070707_100005445 Ga0070707_1000054453 145
194 3300005471 Ga0070698_100006995 Ga0070698_1000069953 145
195 3300005471 Ga0070698_100012179 Ga0070698_1000121793 145
196 3300005518 Ga0070699_100042128 Ga0070699_1000421284 145
197 3300005518 Ga0070699_100584026 Ga0070699_1005840262 145
198 3300005530 Ga0070679_100019312 Ga0070679_1000193123 145
199 3300005535 Ga0070684_100253455 Ga0070684_1002534552 145
200 3300005536 Ga0070697_100025272 Ga0070697_1000252722 145
201 3300005536 Ga0070697_100441933 Ga0070697_1004419332 145
202 3300005549 Ga0070704_101089382 Ga0070704_1010893821 145
203 3300005563 Ga0068855_100787229 Ga0068855_1007872292 145
204 3300005577 Ga0068857_100233635 Ga0068857_1002336353 145
205 3300005577 Ga0068857_101318363 Ga0068857_1013183631 145
206 3300005614 Ga0068856_100099132 Ga0068856_1000991322 145
207 3300005614 Ga0068856_100100973 Ga0068856_1001009733 145
208 3300005617 Ga0068859_100158455 Ga0068859_1001584552 145
209 3300005842 Ga0068858_100785077 Ga0068858_1007850772 145
210 3300005937 Ga0081455_10786604 Ga0081455_107866042 145
211 3300005981 Ga0081538_10006389 Ga0081538_1000638912 145
212 3300005981 Ga0081538_10032285 Ga0081538_100322852 145
213 3300006237 Ga0097621_100626858 Ga0097621_1006268581 145
214 3300006358 Ga0068871_101578036 Ga0068871_1015780361 145
215 3300006852 Ga0075433_10411478 Ga0075433_104114782 145
216 3300006871 Ga0075434_100113024 Ga0075434_1001130243 145
217 3300006931 Ga0097620_100158459 Ga0097620_1001584592 145
218 3300009093 Ga0105240_11260220 Ga0105240_112602202 145
219 3300009094 Ga0111539_10340969 Ga0111539_103409692 145
220 3300009098 Ga0105245_10000203 Ga0105245_100002036 145
221 3300009147 Ga0114129_10148532 Ga0114129_101485322 145
222 3300009147 Ga0114129_10165522 Ga0114129_101655222 145
223 3300009147 Ga0114129_10281935 Ga0114129_102819353 145
224 3300009545 Ga0105237_10242316 Ga0105237_102423163 145
225 3300009545 Ga0105237_10784921 Ga0105237_107849212 145
226 3300009551 Ga0105238_12205065 Ga0105238_122050652 145
227 3300010375 Ga0105239_10129732 Ga0105239_101297323 145
228 3300010375 Ga0105239_10193765 Ga0105239_101937652 145
229 3300013296 Ga0157374_10343043 Ga0157374_103430432 145
230 3300014326 Ga0157380_11158810 Ga0157380_111588101 145
231 3300014969 Ga0157376_10027362 Ga0157376_100273623 145
232 3300025907 Ga0207645_10549811 Ga0207645_105498112 145
233 3300025910 Ga0207684_10017912 Ga0207684_100179122 145
234 3300025914 Ga0207671_10476299 Ga0207671_104762991 145
235 3300025917 Ga0207660_11622644 Ga0207660_116226441 145
236 3300025921 Ga0207652_10034976 Ga0207652_100349762 145
237 3300025922 Ga0207646_10003462 Ga0207646_100034625 145
238 3300025924 Ga0207694_10080606 Ga0207694_100806062 145
239 3300025927 Ga0207687_10001086 Ga0207687_1000108612 145
240 3300025932 Ga0207690_10247374 Ga0207690_102473741 145
241 3300025942 Ga0207689_10192761 Ga0207689_101927612 145
242 3300025944 Ga0207661_10095658 Ga0207661_100956583 145
243 3300025949 Ga0207667_11239583 Ga0207667_112395832 145
244 3300026023 Ga0207677_10112166 Ga0207677_101121662 145
245 3300026023 Ga0207677_11389879 Ga0207677_113898791 145
246 3300026078 Ga0207702_10032344 Ga0207702_100323444 145
247 3300026078 Ga0207702_10224987 Ga0207702_102249872 145
248 3300026088 Ga0207641_11415775 Ga0207641_114157751 145
249 3300026116 Ga0207674_10276669 Ga0207674_102766692 145
250 3300026116 Ga0207674_10730158 Ga0207674_107301581 145
251 3300031456 Ga0307513_10006699 Ga0307513_100066999 145
252 3300031507 Ga0307509_10001290 Ga0307509_1000129045 145
253 3300031616 Ga0307508_10131554 Ga0307508_101315542 145
254 3300031711 Ga0265314_10175595 Ga0265314_101755952 145
255 3300031731 Ga0307405_10405214 Ga0307405_104052142 145
256 3300032002 Ga0307416_102059168 Ga0307416_1020591681 145
257 3300035090 Ga0373949_0000884 Ga0373949_0000884_3026_3463 145
258 3300037312 Ga0395899_0002535 Ga0395899_0002535_11429_11866 145
259 3300037466 Ga0395898_0714121 Ga0395898_0714121_306_743 145
260 3300037471 Ga0395905_0261352 Ga0395905_0261352_652_1089 145
261 3300037471 Ga0395905_0884818 Ga0395905_0884818_29_466 145
262 3300038705 Ga0237819_17348 Ga0237819_17348_255_698 145
263 3300044658 Ga0466972_0366054 Ga0466972_0366054_88_525 145
264 3300044673 Ga0453683_0211231 Ga0453683_0211231_715_1155 145
265 3300044693 Ga0466961_0575191 Ga0466961_0575191_58_501 145
266 3300044712 Ga0453684_0012865 Ga0453684_0012865_2228_2665 145
267 3300044712 Ga0453684_0025189 Ga0453684_0025189_2486_2935 145
268 3300044712 Ga0453684_0830088 Ga0453684_0830088_447_884 145
269 3300044712 Ga0453684_1033348 Ga0453684_1033348_349_786 145
270 3300045051 Ga0451576_0016323 Ga0451576_0016323_930_1367 145
271 3300045836 Ga0466958_0823882 Ga0466958_0823882_132_575 145
272 3300046471 Ga0495650_0020245 Ga0495650_0020245_1092_1529 145
273 3300046539 Ga0495621_0005591 Ga0495621_0005591_1907_2344 145
274 3300046664 Ga0495659_0122722 Ga0495659_0122722_247_687 145
275 3300048909 Ga0496106_1371746 Ga0496106_1371746_18_464 145
276 3300048911 Ga0496108_0711884 Ga0496108_0711884_313_759 145
277 3300048912 Ga0496109_0292655 Ga0496109_0292655_973_1419 145
278 3300049571 Ga0501034_0394729 Ga0501034_0394729_94_531 145
279 3300049589 Ga0501073_0012098 Ga0501073_0012098_536_973 145
280 3300049592 Ga0501076_0119301 Ga0501076_0119301_746_1192 145
281 3300049656 Ga0501209_198446 Ga0501209_198446_136_573 145
282 3300049665 Ga0501227_018133 Ga0501227_018133_72_509 145
283 3300049741 Ga0501079_0984639 Ga0501079_0984639_112_600 145
284 3300049742 Ga0501080_0013488 Ga0501080_0013488_4219_4656 145
285 3300049742 Ga0501080_1173224 Ga0501080_1173224_65_502 145
286 3300049742 Ga0501080_1410921 Ga0501080_1410921_96_533 145
287 3300050507 nmdc:mga05p37_32319_c1 nmdc:mga05p37_32319_c1_299_739 145
288 3300050507 nmdc:mga05p37_388086_c1 nmdc:mga05p37_388086_c1_626_1063 145
289 3300050509 nmdc:mga0qj67_16521_c1 nmdc:mga0qj67_16521_c1_3005_3442 145
290 3300050511 nmdc:mga08y16_946986_c1 nmdc:mga08y16_946986_c1_137_574 145
291 3300050512 nmdc:mga0n895_46388_c1 nmdc:mga0n895_46388_c1_3471_3911 145
292 3300050515 nmdc:mga0a205_1076045_c1 nmdc:mga0a205_1076045_c1_194_640 145
293 3300050515 nmdc:mga0a205_335009_c1 nmdc:mga0a205_335009_c1_830_1270 145
294 3300053102 Ga0500554_163651 Ga0500554_163651_216_653 145
295 3300060353 Ga0501082_0031105 Ga0501082_0031105_755_1192 145
296 3300005290 Ga0065712_10261696 Ga0065712_102616962 146
297 3300005295 Ga0065707_10011144 Ga0065707_100111443 146
298 3300005336 Ga0070680_100256130 Ga0070680_1002561301 146
299 3300005341 Ga0070691_10185361 Ga0070691_101853611 146
300 3300005353 Ga0070669_100262039 Ga0070669_1002620392 146
301 3300005354 Ga0070675_100070281 Ga0070675_1000702812 146
302 3300005364 Ga0070673_100039571 Ga0070673_1000395712 146
303 3300005365 Ga0070688_101038989 Ga0070688_1010389891 146
304 3300005367 Ga0070667_101038769 Ga0070667_1010387692 146
305 3300005444 Ga0070694_100281988 Ga0070694_1002819882 146
306 3300005456 Ga0070678_100104448 Ga0070678_1001044483 146
307 3300005457 Ga0070662_101081656 Ga0070662_1010816562 146
308 3300005459 Ga0068867_100517529 Ga0068867_1005175292 146
309 3300005471 Ga0070698_100000058 Ga0070698_10000005864 146
310 3300005518 Ga0070699_101661113 Ga0070699_1016611131 146
311 3300005544 Ga0070686_100186124 Ga0070686_1001861242 146
312 3300005546 Ga0070696_100006626 Ga0070696_1000066262 146
313 3300005546 Ga0070696_100148401 Ga0070696_1001484012 146
314 3300005549 Ga0070704_100527426 Ga0070704_1005274262 146
315 3300005549 Ga0070704_101437679 Ga0070704_1014376791 146
316 3300005841 Ga0068863_100976500 Ga0068863_1009765002 146
317 3300006844 Ga0075428_100137213 Ga0075428_1001372132 146
318 3300006844 Ga0075428_101561540 Ga0075428_1015615403 146
319 3300006846 Ga0075430_100082327 Ga0075430_1000823273 146
320 3300006847 Ga0075431_100021729 Ga0075431_1000217294 146
321 3300006847 Ga0075431_101372186 Ga0075431_1013721862 146
322 3300006852 Ga0075433_10161733 Ga0075433_101617332 146
323 3300006871 Ga0075434_100032062 Ga0075434_1000320625 146
324 3300006880 Ga0075429_100008724 Ga0075429_1000087245 146
325 3300006880 Ga0075429_100141214 Ga0075429_1001412141 146
326 3300009094 Ga0111539_10004059 Ga0111539_100040596 146
327 3300009094 Ga0111539_10009670 Ga0111539_100096703 146
328 3300009147 Ga0114129_10467730 Ga0114129_104677302 146
329 3300009147 Ga0114129_11730058 Ga0114129_117300581 146
330 3300009148 Ga0105243_10362188 Ga0105243_103621882 146
331 3300009177 Ga0105248_10423508 Ga0105248_104235083 146
332 3300009553 Ga0105249_10254733 Ga0105249_102547332 146
333 3300010375 Ga0105239_10028309 Ga0105239_100283095 146
334 3300013308 Ga0157375_10636180 Ga0157375_106361801 146
335 3300014326 Ga0157380_10186155 Ga0157380_101861552 146
336 3300014326 Ga0157380_12391862 Ga0157380_123918621 146
337 3300015262 Ga0182007_10135009 Ga0182007_101350091 146
338 3300021384 Ga0213876_10515916 Ga0213876_105159161 146
339 3300025903 Ga0207680_10187301 Ga0207680_101873012 146
340 3300025904 Ga0207647_10437103 Ga0207647_104371032 146
341 3300025922 Ga0207646_11606165 Ga0207646_116061652 146
342 3300025933 Ga0207706_10287247 Ga0207706_102872472 146
343 3300025935 Ga0207709_10182279 Ga0207709_101822792 146
344 3300025936 Ga0207670_10562434 Ga0207670_105624342 146
345 3300025940 Ga0207691_10047581 Ga0207691_100475813 146
346 3300025941 Ga0207711_10739985 Ga0207711_107399852 146
347 3300025961 Ga0207712_10353856 Ga0207712_103538562 146
348 3300025961 Ga0207712_10597378 Ga0207712_105973781 146
349 3300025986 Ga0207658_10284534 Ga0207658_102845342 146
350 3300026075 Ga0207708_10202845 Ga0207708_102028452 146
351 3300026089 Ga0207648_10144945 Ga0207648_101449452 146
352 3300026121 Ga0207683_10089802 Ga0207683_100898023 146
353 3300027907 Ga0207428_10016855 Ga0207428_100168554 146
354 3300028380 Ga0268265_11166881 Ga0268265_111668812 146
355 3300028800 Ga0265338_10159423 Ga0265338_101594232 146
356 3300028800 Ga0265338_10567933 Ga0265338_105679331 146
357 3300031241 Ga0265325_10030965 Ga0265325_100309651 146
358 3300031247 Ga0265340_10148660 Ga0265340_101486601 146
359 3300031250 Ga0265331_10033079 Ga0265331_100330792 146
360 3300031344 Ga0265316_10008443 Ga0265316_100084435 146
361 3300031711 Ga0265314_10004796 Ga0265314_100047964 146
362 3300032133 Ga0316583_10000170 Ga0316583_1000017011 146
363 3300035724 Ga0373933_0116647 Ga0373933_0116647_420_860 146
364 3300037471 Ga0395905_1099164 Ga0395905_1099164_148_591 146
365 3300037853 Ga0436364_1369666 Ga0436364_1369666_1672_2112 146
366 3300039437 Ga0436365_1922161 Ga0436365_1922161_64_504 146
367 3300042876 Ga0451577_0187282 Ga0451577_0187282_82_522 146
368 3300042876 Ga0451577_0216403 Ga0451577_0216403_242_691 146
369 3300042876 Ga0451577_0507438 Ga0451577_0507438_558_998 146
370 3300044673 Ga0453683_0000852 Ga0453683_0000852_803_1246 146
371 3300044712 Ga0453684_0488900 Ga0453684_0488900_762_1202 146
372 3300044712 Ga0453684_0637993 Ga0453684_0637993_535_975 146
373 3300045051 Ga0451576_0174098 Ga0451576_0174098_1333_1773 146
374 3300046516 Ga0495628_0222364 Ga0495628_0222364_608_1051 146
375 3300046517 Ga0495630_0031225 Ga0495630_0031225_1403_1843 146
376 3300046537 Ga0495598_0032659 Ga0495598_0032659_998_1441 146
377 3300046543 Ga0495645_0013858 Ga0495645_0013858_2613_3056 146
378 3300047318 Ga0495636_0020776 Ga0495636_0020776_216_659 146
379 3300049568 Ga0501031_0000053 Ga0501031_0000053_30168_30617 146
380 3300049568 Ga0501031_0000383 Ga0501031_0000383_7675_8121 146
381 3300049569 Ga0501032_0024208 Ga0501032_0024208_1077_1523 146
382 3300049571 Ga0501034_0162941 Ga0501034_0162941_311_751 146
383 3300049572 Ga0501036_0008961 Ga0501036_0008961_4501_4950 146
384 3300049572 Ga0501036_0091278 Ga0501036_0091278_725_1165 146
385 3300049572 Ga0501036_0152311 Ga0501036_0152311_998_1444 146
386 3300049573 Ga0501037_0940642 Ga0501037_0940642_36_476 146
387 3300049574 Ga0501038_0128109 Ga0501038_0128109_867_1313 146
388 3300049574 Ga0501038_0154658 Ga0501038_0154658_477_917 146
389 3300049574 Ga0501038_0227861 Ga0501038_0227861_240_689 146
390 3300049575 Ga0501039_0000217 Ga0501039_0000217_29540_29986 146
391 3300049575 Ga0501039_0000405 Ga0501039_0000405_20806_21255 146
392 3300049575 Ga0501039_0008472 Ga0501039_0008472_6216_6656 146
393 3300049579 Ga0501043_0002182 Ga0501043_0002182_6407_6856 146
394 3300049579 Ga0501043_0002351 Ga0501043_0002351_15335_15781 146
395 3300049579 Ga0501043_0003769 Ga0501043_0003769_6415_6864 146
396 3300049581 Ga0501047_0004689 Ga0501047_0004689_9605_10051 146
397 3300049581 Ga0501047_0079423 Ga0501047_0079423_113_562 146
398 3300049581 Ga0501047_0574448 Ga0501047_0574448_211_651 146
399 3300049582 Ga0501048_0566636 Ga0501048_0566636_124_564 146
400 3300049584 Ga0501068_0232096 Ga0501068_0232096_396_845 146
401 3300049584 Ga0501068_0290122 Ga0501068_0290122_98_544 146
402 3300049586 Ga0501070_0000696 Ga0501070_0000696_24642_25091 146
403 3300049586 Ga0501070_0048386 Ga0501070_0048386_1745_2191 146
404 3300049588 Ga0501072_0028489 Ga0501072_0028489_2995_3435 146
405 3300049591 Ga0501075_0105565 Ga0501075_0105565_1255_1695 146
406 3300049592 Ga0501076_0098357 Ga0501076_0098357_910_1350 146
407 3300049742 Ga0501080_0014976 Ga0501080_0014976_2153_2593 146
408 3300049742 Ga0501080_0958643 Ga0501080_0958643_163_609 146
409 3300049743 Ga0501081_0456408 Ga0501081_0456408_459_899 146
410 3300049822 Ga0501035_0000001 Ga0501035_0000001_26342_26788 146
411 3300049822 Ga0501035_0000001 Ga0501035_0000001_428324_428773 146
412 3300049823 Ga0501044_0002636 Ga0501044_0002636_18327_18773 146
413 3300049823 Ga0501044_0069602 Ga0501044_0069602_2600_3040 146
414 3300049824 Ga0501045_0005133 Ga0501045_0005133_5312_5752 146
415 3300050507 nmdc:mga05p37_251374_c1 nmdc:mga05p37_251374_c1_809_1252 146
416 3300050507 nmdc:mga05p37_293738_c1 nmdc:mga05p37_293738_c1_487_930 146
417 3300050508 nmdc:mga09592_49245_c1 nmdc:mga09592_49245_c1_128_571 146
418 3300050508 nmdc:mga09592_89312_c1 nmdc:mga09592_89312_c1_243_686 146
419 3300050509 nmdc:mga0qj67_726952_c1 nmdc:mga0qj67_726952_c1_238_681 146
420 3300050510 nmdc:mga06r32_221443_c1 nmdc:mga06r32_221443_c1_322_765 146
421 3300050510 nmdc:mga06r32_258239_c1 nmdc:mga06r32_258239_c1_606_1049 146
422 3300050511 nmdc:mga08y16_5068_c1 nmdc:mga08y16_5068_c1_8909_9352 146
423 3300050511 nmdc:mga08y16_65823_c1 nmdc:mga08y16_65823_c1_3004_3447 146
424 3300050512 nmdc:mga0n895_55397_c1 nmdc:mga0n895_55397_c1_796_1239 146
425 3300050514 nmdc:mga08x19_608504_c1 nmdc:mga08x19_608504_c1_141_590 146
426 3300050515 nmdc:mga0a205_489078_c1 nmdc:mga0a205_489078_c1_576_1019 146
427 3300050515 nmdc:mga0a205_58937_c1 nmdc:mga0a205_58937_c1_2129_2572 146
428 3300060353 Ga0501082_0100889 Ga0501082_0100889_1204_1644 146
429 3300061734 Ga0530510_0292007 Ga0530510_0292007_412_852 146
430 3300005436 Ga0070713_100008154 Ga0070713_1000081543 147
431 3300005445 Ga0070708_100650521 Ga0070708_1006505212 147
432 3300005471 Ga0070698_100000764 Ga0070698_1000007645 147
433 3300005536 Ga0070697_100860950 Ga0070697_1008609502 147
434 3300005564 Ga0070664_100467564 Ga0070664_1004675642 147
435 3300005834 Ga0068851_10396417 Ga0068851_103964172 147
436 3300005844 Ga0068862_100050510 Ga0068862_1000505102 147
437 3300005985 Ga0081539_10000292 Ga0081539_1000029277 147
438 3300006051 Ga0075364_10223712 Ga0075364_102237122 147
439 3300006178 Ga0075367_10536527 Ga0075367_105365271 147
440 3300006847 Ga0075431_100443650 Ga0075431_1004436502 147
441 3300006847 Ga0075431_100687296 Ga0075431_1006872962 147
442 3300006880 Ga0075429_100214620 Ga0075429_1002146202 147
443 3300009147 Ga0114129_10258760 Ga0114129_102587601 147
444 3300025928 Ga0207700_10011057 Ga0207700_100110575 147
445 3300025945 Ga0207679_10434390 Ga0207679_104343902 147
446 3300028380 Ga0268265_10256827 Ga0268265_102568272 147
447 3300028800 Ga0265338_10032370 Ga0265338_100323702 147
448 3300031344 Ga0265316_10015617 Ga0265316_100156172 147
449 3300031344 Ga0265316_10129728 Ga0265316_101297282 147
450 3300031711 Ga0265314_10000001 Ga0265314_10000001864 147
451 3300031995 Ga0307409_100570590 Ga0307409_1005705902 147
452 3300032004 Ga0307414_11923782 Ga0307414_119237821 147
453 3300035121 Ga0373960_0002896 Ga0373960_0002896_207_650 147
454 3300035207 Ga0373942_0098086 Ga0373942_0098086_45_488 147
455 3300035695 Ga0373927_0046495 Ga0373927_0046495_2292_2741 147
456 3300039437 Ga0436365_1438224 Ga0436365_1438224_543_986 147
457 3300041512 Ga0451853_1103094 Ga0451853_1103094_780_1226 147
458 3300042876 Ga0451577_0000499 Ga0451577_0000499_33509_33952 147
459 3300042876 Ga0451577_0003072 Ga0451577_0003072_7923_8366 147
460 3300044683 Ga0466965_0012718 Ga0466965_0012718_493_945 147
461 3300044712 Ga0453684_0000586 Ga0453684_0000586_40847_41290 147
462 3300044712 Ga0453684_0001918 Ga0453684_0001918_33155_33598 147
463 3300044719 Ga0466971_0000077 Ga0466971_0000077_18865_19317 147
464 3300044765 Ga0466970_0352708 Ga0466970_0352708_306_758 147
465 3300044842 Ga0466957_0062415 Ga0466957_0062415_1143_1595 147
466 3300044901 Ga0466960_0152870 Ga0466960_0152870_758_1210 147
467 3300045051 Ga0451576_0089349 Ga0451576_0089349_995_1450 147
468 3300045051 Ga0451576_0272924 Ga0451576_0272924_50_505 147
469 3300045976 Ga0466967_0054343 Ga0466967_0054343_2936_3388 147
470 3300046557 Ga0495622_0064198 Ga0495622_0064198_785_1228 147
471 3300047320 Ga0495672_0003726 Ga0495672_0003726_8055_8507 147
472 3300047320 Ga0495672_0062108 Ga0495672_0062108_1538_1990 147
473 3300049575 Ga0501039_0651095 Ga0501039_0651095_161_604 147
474 3300049576 Ga0501040_0574258 Ga0501040_0574258_274_717 147
475 3300049578 Ga0501042_0614878 Ga0501042_0614878_18_461 147
476 3300049581 Ga0501047_0163713 Ga0501047_0163713_1267_1710 147
477 3300049581 Ga0501047_0266251 Ga0501047_0266251_738_1181 147
478 3300049586 Ga0501070_0088488 Ga0501070_0088488_149_592 147
479 3300049589 Ga0501073_0628206 Ga0501073_0628206_274_717 147
480 3300049592 Ga0501076_0124687 Ga0501076_0124687_719_1162 147
481 3300049686 Ga0501257_066563 Ga0501257_066563_13_456 147
482 3300049741 Ga0501079_0972288 Ga0501079_0972288_89_532 147
483 3300049823 Ga0501044_0022639 Ga0501044_0022639_4268_4711 147
484 3300049824 Ga0501045_0108160 Ga0501045_0108160_323_766 147
485 3300050507 nmdc:mga05p37_1768520_c1 nmdc:mga05p37_1768520_c1_68_514 147
486 3300050507 nmdc:mga05p37_780282_c1 nmdc:mga05p37_780282_c1_64_507 147
487 3300050508 nmdc:mga09592_3139_c1 nmdc:mga09592_3139_c1_6375_6830 147
488 3300050510 nmdc:mga06r32_329050_c1 nmdc:mga06r32_329050_c1_819_1274 147
489 3300050510 nmdc:mga06r32_517159_c1 nmdc:mga06r32_517159_c1_329_772 147
490 3300053139 Ga0500568_0264008 Ga0500568_0264008_168_611 147
491 3300054114 Ga0501084_1641839 Ga0501084_1641839_37_480 147
492 3300061719 Ga0466962_0000006 Ga0466962_0000006_107527_107979 147
493 2162886006 SwRhRL3b_contig_679788 SwRhRL3b_0178.00001350 148
494 3300005295 Ga0065707_10083409 Ga0065707_100834096 148
495 3300005336 Ga0070680_100096823 Ga0070680_1000968232 148
496 3300005336 Ga0070680_100270259 Ga0070680_1002702592 148
497 3300005435 Ga0070714_100000023 Ga0070714_10000002314 148
498 3300005436 Ga0070713_100084089 Ga0070713_1000840892 148
499 3300005439 Ga0070711_100038184 Ga0070711_1000381843 148
500 3300005439 Ga0070711_100255267 Ga0070711_1002552672 148
501 3300005444 Ga0070694_100899481 Ga0070694_1008994811 148
502 3300005445 Ga0070708_100513743 Ga0070708_1005137432 148
503 3300005457 Ga0070662_100003114 Ga0070662_10000311412 148
504 3300005458 Ga0070681_10120596 Ga0070681_101205963 148
505 3300005467 Ga0070706_100048744 Ga0070706_1000487442 148
506 3300005468 Ga0070707_100463548 Ga0070707_1004635481 148
507 3300005518 Ga0070699_100010333 Ga0070699_1000103335 148
508 3300005518 Ga0070699_100672413 Ga0070699_1006724131 148
509 3300005518 Ga0070699_100815176 Ga0070699_1008151761 148
510 3300005518 Ga0070699_100913826 Ga0070699_1009138262 148
511 3300005530 Ga0070679_100035505 Ga0070679_1000355052 148
512 3300005536 Ga0070697_100127919 Ga0070697_1001279193 148
513 3300005545 Ga0070695_100780977 Ga0070695_1007809771 148
514 3300005546 Ga0070696_100011402 Ga0070696_1000114024 148
515 3300005546 Ga0070696_100126289 Ga0070696_1001262892 148
516 3300005548 Ga0070665_100908275 Ga0070665_1009082752 148
517 3300005549 Ga0070704_100484245 Ga0070704_1004842452 148
518 3300005549 Ga0070704_101386636 Ga0070704_1013866362 148
519 3300006028 Ga0070717_10000687 Ga0070717_100006873 148
520 3300006038 Ga0075365_10042235 Ga0075365_100422352 148
521 3300006038 Ga0075365_10086233 Ga0075365_100862331 148
522 3300006038 Ga0075365_10122381 Ga0075365_101223812 148
523 3300006042 Ga0075368_10100029 Ga0075368_101000291 148
524 3300006042 Ga0075368_10177511 Ga0075368_101775112 148
525 3300006048 Ga0075363_100005431 Ga0075363_1000054315 148
526 3300006048 Ga0075363_100335803 Ga0075363_1003358031 148
527 3300006051 Ga0075364_11016421 Ga0075364_110164211 148
528 3300006173 Ga0070716_100602149 Ga0070716_1006021492 148
529 3300006178 Ga0075367_10063091 Ga0075367_100630912 148
530 3300006178 Ga0075367_10231382 Ga0075367_102313821 148
531 3300006186 Ga0075369_10095864 Ga0075369_100958642 148
532 3300006846 Ga0075430_100269874 Ga0075430_1002698742 148
533 3300006846 Ga0075430_100845757 Ga0075430_1008457572 148
534 3300006847 Ga0075431_100058163 Ga0075431_1000581632 148
535 3300006847 Ga0075431_101290217 Ga0075431_1012902172 148
536 3300006852 Ga0075433_10075979 Ga0075433_100759792 148
537 3300006852 Ga0075433_10081111 Ga0075433_100811112 148
538 3300006881 Ga0068865_102043792 Ga0068865_1020437921 148
539 3300006914 Ga0075436_100007182 Ga0075436_1000071822 148
540 3300006914 Ga0075436_100070812 Ga0075436_1000708122 148
541 3300007076 Ga0075435_101570467 Ga0075435_1015704672 148
542 3300009093 Ga0105240_11450950 Ga0105240_114509502 148
543 3300009147 Ga0114129_10021692 Ga0114129_100216926 148
544 3300009147 Ga0114129_10057688 Ga0114129_100576882 148
545 3300009147 Ga0114129_10138001 Ga0114129_101380017 148
546 3300009147 Ga0114129_10405251 Ga0114129_104052512 148
547 3300009147 Ga0114129_11810943 Ga0114129_118109432 148
548 3300013105 Ga0157369_10266027 Ga0157369_102660273 148
549 3300025912 Ga0207707_10015908 Ga0207707_100159085 148
550 3300025916 Ga0207663_10032508 Ga0207663_100325083 148
551 3300025917 Ga0207660_10150166 Ga0207660_101501662 148
552 3300025921 Ga0207652_10023424 Ga0207652_100234245 148
553 3300025922 Ga0207646_10367936 Ga0207646_103679362 148
554 3300025929 Ga0207664_10000128 Ga0207664_1000012831 148
555 3300025933 Ga0207706_10000439 Ga0207706_1000043938 148
556 3300025942 Ga0207689_11023819 Ga0207689_110238192 148
557 3300026095 Ga0207676_10151924 Ga0207676_101519242 148
558 3300028379 Ga0268266_10981650 Ga0268266_109816502 148
559 3300028556 Ga0265337_1010077 Ga0265337_10100772 148
560 3300028556 Ga0265337_1052064 Ga0265337_10520642 148
561 3300028558 Ga0265326_10008773 Ga0265326_100087732 148
562 3300028563 Ga0265319_1000011 Ga0265319_1000011120 148
563 3300028577 Ga0265318_10000284 Ga0265318_1000028431 148
564 3300028577 Ga0265318_10086188 Ga0265318_100861882 148
565 3300028653 Ga0265323_10000015 Ga0265323_100000157 148
566 3300028653 Ga0265323_10086129 Ga0265323_100861291 148
567 3300028654 Ga0265322_10000430 Ga0265322_100004304 148
568 3300028654 Ga0265322_10031342 Ga0265322_100313422 148
569 3300028666 Ga0265336_10008503 Ga0265336_100085032 148
570 3300028794 Ga0307515_10097779 Ga0307515_100977792 148
571 3300028800 Ga0265338_10028491 Ga0265338_100284912 148
572 3300031235 Ga0265330_10364410 Ga0265330_103644101 148
573 3300031240 Ga0265320_10028596 Ga0265320_100285961 148
574 3300031240 Ga0265320_10035765 Ga0265320_100357652 148
575 3300031247 Ga0265340_10062479 Ga0265340_100624792 148
576 3300031250 Ga0265331_10272285 Ga0265331_102722852 148
577 3300031251 Ga0265327_10039369 Ga0265327_100393692 148
578 3300031344 Ga0265316_10000549 Ga0265316_100005497 148
579 3300031344 Ga0265316_10009062 Ga0265316_1000906211 148
580 3300031344 Ga0265316_10021000 Ga0265316_100210004 148
581 3300031595 Ga0265313_10015352 Ga0265313_100153522 148
582 3300031616 Ga0307508_10000513 Ga0307508_100005138 148
583 3300031711 Ga0265314_10006365 Ga0265314_100063656 148
584 3300031711 Ga0265314_10012148 Ga0265314_100121483 148
585 3300031711 Ga0265314_10045630 Ga0265314_100456302 148
586 3300031712 Ga0265342_10032133 Ga0265342_100321332 148
587 3300032002 Ga0307416_100964139 Ga0307416_1009641392 148
588 3300032002 Ga0307416_102254177 Ga0307416_1022541772 148
589 3300037466 Ga0395898_0256697 Ga0395898_0256697_748_1230 148
590 3300037471 Ga0395905_0001144 Ga0395905_0001144_30205_30687 148
591 3300042001 Ga0439441_070899 Ga0439441_070899_238_684 148
592 3300044658 Ga0466972_0000388 Ga0466972_0000388_12228_12683 148
593 3300044712 Ga0453684_0013262 Ga0453684_0013262_3685_4134 148
594 3300044712 Ga0453684_0014672 Ga0453684_0014672_6775_7254 148
595 3300044712 Ga0453684_0487849 Ga0453684_0487849_169_621 148
596 3300045051 Ga0451576_0152340 Ga0451576_0152340_1585_2031 148
597 3300045051 Ga0451576_0975983 Ga0451576_0975983_409_864 148
598 3300048919 Ga0496116_0003081 Ga0496116_0003081_8516_8974 148
599 3300049568 Ga0501031_0000514 Ga0501031_0000514_9364_9822 148
600 3300049571 Ga0501034_0242107 Ga0501034_0242107_1068_1529 148
601 3300049572 Ga0501036_0621439 Ga0501036_0621439_106_564 148
602 3300049573 Ga0501037_0000002 Ga0501037_0000002_222192_222650 148
603 3300049575 Ga0501039_0002621 Ga0501039_0002621_6604_7062 148
604 3300049577 Ga0501041_0040587 Ga0501041_0040587_2265_2717 148
605 3300049579 Ga0501043_0028414 Ga0501043_0028414_697_1155 148
606 3300049581 Ga0501047_0009135 Ga0501047_0009135_1832_2290 148
607 3300049586 Ga0501070_0002593 Ga0501070_0002593_790_1248 148
608 3300049587 Ga0501071_0019581 Ga0501071_0019581_3341_3811 148
609 3300049590 Ga0501074_0260459 Ga0501074_0260459_145_615 148
610 3300049591 Ga0501075_1425734 Ga0501075_1425734_25_474 148
611 3300049741 Ga0501079_0177071 Ga0501079_0177071_1160_1630 148
612 3300049743 Ga0501081_0214114 Ga0501081_0214114_351_821 148
613 3300049822 Ga0501035_0000007 Ga0501035_0000007_159599_160057 148
614 3300049823 Ga0501044_0000259 Ga0501044_0000259_14301_14759 148
615 3300050490 nmdc:mga03n38_15322_c1 nmdc:mga03n38_15322_c1_620_1072 148
616 3300050491 nmdc:mga00v17_530860_c1 nmdc:mga00v17_530860_c1_208_660 148
617 3300050491 nmdc:mga00v17_68236_c1 nmdc:mga00v17_68236_c1_1262_1714 148
618 3300050492 nmdc:mga0yw44_121420_c1 nmdc:mga0yw44_121420_c1_51_503 148
619 3300050492 nmdc:mga0yw44_14001_c1 nmdc:mga0yw44_14001_c1_2027_2479 148
620 3300050492 nmdc:mga0yw44_52914_c1 nmdc:mga0yw44_52914_c1_187_639 148
621 3300050494 nmdc:mga06z11_182719_c1 nmdc:mga06z11_182719_c1_483_935 148
622 3300050494 nmdc:mga06z11_65160_c1 nmdc:mga06z11_65160_c1_321_773 148
623 3300050494 nmdc:mga06z11_72288_c1 nmdc:mga06z11_72288_c1_468_920 148
624 3300050495 nmdc:mga04h51_424854_c1 nmdc:mga04h51_424854_c1_77_529 148
625 3300050507 nmdc:mga05p37_141842_c1 nmdc:mga05p37_141842_c1_1849_2301 148
626 3300050507 nmdc:mga05p37_172394_c1 nmdc:mga05p37_172394_c1_1432_1878 148
627 3300050507 nmdc:mga05p37_20364_c1 nmdc:mga05p37_20364_c1_5373_5825 148
628 3300050509 nmdc:mga0qj67_719512_c1 nmdc:mga0qj67_719512_c1_123_578 148
629 3300050510 nmdc:mga06r32_1239529_c1 nmdc:mga06r32_1239529_c1_193_648 148
630 3300050510 nmdc:mga06r32_68031_c1 nmdc:mga06r32_68031_c1_2755_3201 148
631 3300050513 nmdc:mga0rr50_1511446_c1 nmdc:mga0rr50_1511446_c1_69_524 148
632 3300050514 nmdc:mga08x19_123326_c1 nmdc:mga08x19_123326_c1_1204_1659 148
633 3300050514 nmdc:mga08x19_128423_c1 nmdc:mga08x19_128423_c1_130_576 148
634 3300050514 nmdc:mga08x19_15081_c1 nmdc:mga08x19_15081_c1_2443_2961 148
635 3300050515 nmdc:mga0a205_102218_c1 nmdc:mga0a205_102218_c1_2117_2563 148
636 3300050515 nmdc:mga0a205_9398_c1 nmdc:mga0a205_9398_c1_2430_2882 148
637 3300050516 nmdc:mga0sz30_31431_c1 nmdc:mga0sz30_31431_c1_776_1228 148
638 3300053109 Ga0500569_066961 Ga0500569_066961_252_722 148
639 3300059421 Ga0590071_004510 Ga0590071_004510_2463_2921 148
640 3300059424 Ga0590075_142472 Ga0590075_142472_87_545 148
641 3300059426 Ga0590077_078231 Ga0590077_078231_256_714 148
642 3300060353 Ga0501082_0142278 Ga0501082_0142278_476_946 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

30

154

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ab6-assembly2.cif.gz_B structure of chey mutant f14n, v86t 0.9257 4 134
1ab5-assembly2.cif.gz_B structure of chey mutant f14n, v21t 0.923 4 134
1ymu-assembly1.cif.gz_B signal transduction protein chey mutant with met 17 replaced by gly (m17g) 0.9228 4 134
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9179 4 132
1zes-assembly2.cif.gz_B bef3- activated phob receiver domain 0.912 4 132
ID Description Score Start End Superfamily
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9286 4 133 3.40.50.2300
af_Q1JSA0_6_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9148 5 131 3.40.50.2300
5brjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9109 4 141 3.40.50.2300
af_K7KGZ6_7_112_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9101 29 134 3.40.50.2300
af_K7N076_11_147_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9087 4 133 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537LGN3-F1-model_v4 Response regulator 0.9704 4 97 GO:0000160
AF-A0A2N6A3I8-F1-model_v4 Response regulatory domain-containing protein 0.9669 4 137 GO:0000160
AF-A0A3N5LXH5-F1-model_v4 Response regulator 0.9645 4 132 GO:0000160
GO:0003677
AF-A0A1F3XDR8-F1-model_v4 Two-component system response regulator 0.962 1 114 GO:0000160
AF-A0A2H0H521-F1-model_v4 Two-component system response regulator 0.9586 1 133 GO:0000160

Feature Viewer

pLDDT pTM Quality
86.36 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map