F471910
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 642 | 319 | 630 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300050514|nmdc:mga08x19_15081_c1|nmdc:mga08x19_15081_c1_2443_2961 |
| Length | 172 |
| Sequence | MGAGRSGKGRDILFYAVADKEEDRMSDKVILLVEDNPDDEALTLRALKKNNIQNEVVIARDGVEALAYLFGTGAYAGRDVSVLPSVTLLDLKLPKLDGLEVLKKIRADERTKLLPVVILTSSKEEQDLINGYKVGANSYIRKPVDFSQFIEAVRQLGLYWLLLNEAAPVRNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 3 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 4 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 5 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 6 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 7 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 8 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 9 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 10 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 11 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 182 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 202 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 280 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 283 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 310 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 311 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 314 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 315 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 319 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.29 |
| Metatranscriptomes | 0 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.67 |
| Nodule | 0.31 |
| Rhizoplane | 0.78 |
| Rhizosphere | 89.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_679788 | 2162886006 | Bacteria | 945 |
| 2 | rootH1_10134343 | 3300003316 | Bacteria | 1444 |
| 3 | rootH2_10003759 | 3300003320 | Bacteria | 2213 |
| 4 | rootH2_10023036 | 3300003320 | Bacteria | 24889 |
| 5 | rootH2_10031699 | 3300003320 | Bacteria | 12621 |
| 6 | rootL2_10069044 | 3300003322 | Bacteria | 8247 |
| 7 | rootL2_10154203 | 3300003322 | Bacteria | 1755 |
| 8 | Ga0065704_10300019 | 3300005289 | Unclassified | 887 |
| 9 | Ga0065712_10261696 | 3300005290 | Bacteria | 935 |
| 10 | Ga0065707_10011144 | 3300005295 | Bacteria | 2039 |
| 11 | Ga0065707_10083409 | 3300005295 | Bacteria | 9276 |
| 12 | Ga0070658_10095322 | 3300005327 | Bacteria | 2456 |
| 13 | Ga0070676_10905241 | 3300005328 | Bacteria | 657 |
| 14 | Ga0068869_100070567 | 3300005334 | Bacteria | 2585 |
| 15 | Ga0070680_100096823 | 3300005336 | Bacteria | 2447 |
| 16 | Ga0070680_100256130 | 3300005336 | Bacteria | 1480 |
| 17 | Ga0070680_100270259 | 3300005336 | Bacteria | 1439 |
| 18 | Ga0070680_100507777 | 3300005336 | Bacteria | 1032 |
| 19 | Ga0070680_100806192 | 3300005336 | Bacteria | 809 |
| 20 | Ga0070682_100845096 | 3300005337 | Bacteria | 747 |
| 21 | Ga0068868_100087548 | 3300005338 | Bacteria | 2505 |
| 22 | Ga0070691_10185361 | 3300005341 | Bacteria | 1085 |
| 23 | Ga0070687_100775255 | 3300005343 | Bacteria | 677 |
| 24 | Ga0070692_10064723 | 3300005345 | Bacteria | 1934 |
| 25 | Ga0070669_100262039 | 3300005353 | Bacteria | 1380 |
| 26 | Ga0070669_100652807 | 3300005353 | Bacteria | 885 |
| 27 | Ga0070675_100070281 | 3300005354 | Bacteria | 2901 |
| 28 | Ga0070673_100039571 | 3300005364 | Bacteria | 3609 |
| 29 | Ga0070688_101038989 | 3300005365 | Bacteria | 653 |
| 30 | Ga0070659_100287673 | 3300005366 | Bacteria | 1368 |
| 31 | Ga0070667_101038769 | 3300005367 | Bacteria | 765 |
| 32 | Ga0070667_101610485 | 3300005367 | Bacteria | 610 |
| 33 | Ga0070714_100000023 | 3300005435 | Bacteria | 155379 |
| 34 | Ga0070713_100008154 | 3300005436 | Bacteria | 7417 |
| 35 | Ga0070713_100084089 | 3300005436 | Bacteria | 2722 |
| 36 | Ga0070701_10284503 | 3300005438 | Bacteria | 1011 |
| 37 | Ga0070711_100038184 | 3300005439 | Bacteria | 3227 |
| 38 | Ga0070711_100255267 | 3300005439 | Bacteria | 1377 |
| 39 | Ga0070694_100025784 | 3300005444 | Bacteria | 3806 |
| 40 | Ga0070694_100068686 | 3300005444 | Bacteria | 2436 |
| 41 | Ga0070694_100281988 | 3300005444 | Bacteria | 1267 |
| 42 | Ga0070694_100899481 | 3300005444 | Bacteria | 731 |
| 43 | Ga0070708_100109706 | 3300005445 | Bacteria | 2535 |
| 44 | Ga0070708_100513743 | 3300005445 | Bacteria | 1130 |
| 45 | Ga0070708_100577982 | 3300005445 | Unclassified | 1059 |
| 46 | Ga0070708_100650521 | 3300005445 | Bacteria | 993 |
| 47 | Ga0070663_100002871 | 3300005455 | Bacteria | 9802 |
| 48 | Ga0070678_100104448 | 3300005456 | Bacteria | 2203 |
| 49 | Ga0070662_100003114 | 3300005457 | Bacteria | 10298 |
| 50 | Ga0070662_101081656 | 3300005457 | Bacteria | 688 |
| 51 | Ga0070681_10056226 | 3300005458 | Bacteria | 3917 |
| 52 | Ga0070681_10120596 | 3300005458 | Bacteria | 2557 |
| 53 | Ga0070681_10177632 | 3300005458 | Bacteria | 2051 |
| 54 | Ga0070681_10443931 | 3300005458 | Bacteria | 1209 |
| 55 | Ga0068867_100517529 | 3300005459 | Bacteria | 1028 |
| 56 | Ga0070706_100029600 | 3300005467 | Bacteria | 5045 |
| 57 | Ga0070706_100035602 | 3300005467 | Bacteria | 4596 |
| 58 | Ga0070706_100048744 | 3300005467 | Bacteria | 3909 |
| 59 | Ga0070706_100574692 | 3300005467 | Bacteria | 1048 |
| 60 | Ga0070707_100005445 | 3300005468 | Bacteria | 11905 |
| 61 | Ga0070707_100006727 | 3300005468 | Bacteria | 10657 |
| 62 | Ga0070707_100463548 | 3300005468 | Bacteria | 1228 |
| 63 | Ga0070698_100000058 | 3300005471 | Bacteria | 79013 |
| 64 | Ga0070698_100000159 | 3300005471 | Bacteria | 61650 |
| 65 | Ga0070698_100000764 | 3300005471 | Bacteria | 34812 |
| 66 | Ga0070698_100006995 | 3300005471 | Bacteria | 12214 |
| 67 | Ga0070698_100012179 | 3300005471 | Bacteria | 9111 |
| 68 | Ga0070698_101100970 | 3300005471 | Bacteria | 743 |
| 69 | Ga0070699_100010333 | 3300005518 | Bacteria | 8072 |
| 70 | Ga0070699_100042128 | 3300005518 | Unclassified | 3950 |
| 71 | Ga0070699_100584026 | 3300005518 | Bacteria | 1018 |
| 72 | Ga0070699_100672413 | 3300005518 | Bacteria | 945 |
| 73 | Ga0070699_100815176 | 3300005518 | Bacteria | 854 |
| 74 | Ga0070699_100913826 | 3300005518 | Bacteria | 804 |
| 75 | Ga0070699_101661113 | 3300005518 | Bacteria | 585 |
| 76 | Ga0070699_101841445 | 3300005518 | Bacteria | 554 |
| 77 | Ga0070679_100019312 | 3300005530 | Bacteria | 6623 |
| 78 | Ga0070679_100035505 | 3300005530 | Bacteria | 4946 |
| 79 | Ga0070684_100253455 | 3300005535 | Bacteria | 1609 |
| 80 | Ga0070697_100025272 | 3300005536 | Bacteria | 4737 |
| 81 | Ga0070697_100060178 | 3300005536 | Bacteria | 3095 |
| 82 | Ga0070697_100127919 | 3300005536 | Bacteria | 2128 |
| 83 | Ga0070697_100441933 | 3300005536 | Bacteria | 1132 |
| 84 | Ga0070697_100860950 | 3300005536 | Bacteria | 803 |
| 85 | Ga0070686_100186124 | 3300005544 | Bacteria | 1479 |
| 86 | Ga0070695_100004612 | 3300005545 | Bacteria | 8091 |
| 87 | Ga0070695_100780977 | 3300005545 | Bacteria | 764 |
| 88 | Ga0070696_100006626 | 3300005546 | Bacteria | 7737 |
| 89 | Ga0070696_100011402 | 3300005546 | Bacteria | 5953 |
| 90 | Ga0070696_100126289 | 3300005546 | Bacteria | 1856 |
| 91 | Ga0070696_100148401 | 3300005546 | Bacteria | 1719 |
| 92 | Ga0070696_101167491 | 3300005546 | Unclassified | 649 |
| 93 | Ga0070665_100147202 | 3300005548 | Bacteria | 2358 |
| 94 | Ga0070665_100908275 | 3300005548 | Bacteria | 893 |
| 95 | Ga0070704_100484245 | 3300005549 | Bacteria | 1071 |
| 96 | Ga0070704_100527426 | 3300005549 | Bacteria | 1029 |
| 97 | Ga0070704_101089382 | 3300005549 | Bacteria | 725 |
| 98 | Ga0070704_101386636 | 3300005549 | Unclassified | 644 |
| 99 | Ga0070704_101437679 | 3300005549 | Bacteria | 633 |
| 100 | Ga0068855_100787229 | 3300005563 | Bacteria | 1012 |
| 101 | Ga0070664_100467564 | 3300005564 | Bacteria | 1159 |
| 102 | Ga0068857_100233635 | 3300005577 | Bacteria | 1682 |
| 103 | Ga0068857_100565374 | 3300005577 | Bacteria | 1072 |
| 104 | Ga0068857_101318363 | 3300005577 | Bacteria | 701 |
| 105 | Ga0068856_100099132 | 3300005614 | Bacteria | 2904 |
| 106 | Ga0068856_100100973 | 3300005614 | Bacteria | 2878 |
| 107 | Ga0070702_100159068 | 3300005615 | Bacteria | 1458 |
| 108 | Ga0068859_100158455 | 3300005617 | Bacteria | 2342 |
| 109 | Ga0068864_100703804 | 3300005618 | Bacteria | 987 |
| 110 | Ga0068851_10396417 | 3300005834 | Bacteria | 811 |
| 111 | Ga0068863_100159932 | 3300005841 | Bacteria | 2157 |
| 112 | Ga0068863_100976500 | 3300005841 | Bacteria | 849 |
| 113 | Ga0068858_100785077 | 3300005842 | Bacteria | 929 |
| 114 | Ga0068858_101933202 | 3300005842 | Bacteria | 583 |
| 115 | Ga0068860_100353595 | 3300005843 | Bacteria | 1446 |
| 116 | Ga0068862_100050510 | 3300005844 | Bacteria | 3554 |
| 117 | Ga0068862_100262401 | 3300005844 | Bacteria | 1577 |
| 118 | Ga0081455_10786604 | 3300005937 | Bacteria | 598 |
| 119 | Ga0081538_10006389 | 3300005981 | Bacteria | 10384 |
| 120 | Ga0081538_10032285 | 3300005981 | Bacteria | 3512 |
| 121 | Ga0081539_10000292 | 3300005985 | Bacteria | 113454 |
| 122 | Ga0070717_10000687 | 3300006028 | Bacteria | 21805 |
| 123 | Ga0075365_10042235 | 3300006038 | Bacteria | 2980 |
| 124 | Ga0075365_10086233 | 3300006038 | Bacteria | 2134 |
| 125 | Ga0075365_10122381 | 3300006038 | Bacteria | 1795 |
| 126 | Ga0075368_10100029 | 3300006042 | Bacteria | 1190 |
| 127 | Ga0075368_10177511 | 3300006042 | Bacteria | 897 |
| 128 | Ga0075363_100005431 | 3300006048 | Bacteria | 5667 |
| 129 | Ga0075363_100335803 | 3300006048 | Bacteria | 881 |
| 130 | Ga0075364_10223712 | 3300006051 | Bacteria | 1277 |
| 131 | Ga0075364_11016421 | 3300006051 | Bacteria | 563 |
| 132 | Ga0070716_100602149 | 3300006173 | Unclassified | 827 |
| 133 | Ga0075367_10063091 | 3300006178 | Bacteria | 2215 |
| 134 | Ga0075367_10231382 | 3300006178 | Bacteria | 1157 |
| 135 | Ga0075367_10536527 | 3300006178 | Bacteria | 743 |
| 136 | Ga0075369_10095864 | 3300006186 | Bacteria | 1327 |
| 137 | Ga0075366_10337066 | 3300006195 | Bacteria | 925 |
| 138 | Ga0075366_10353012 | 3300006195 | Bacteria | 903 |
| 139 | Ga0097621_100626858 | 3300006237 | Bacteria | 985 |
| 140 | Ga0068871_100166861 | 3300006358 | Bacteria | 1885 |
| 141 | Ga0068871_101578036 | 3300006358 | Bacteria | 621 |
| 142 | Ga0075428_100051489 | 3300006844 | Bacteria | 4515 |
| 143 | Ga0075428_100137213 | 3300006844 | Bacteria | 2659 |
| 144 | Ga0075428_101561540 | 3300006844 | Bacteria | 690 |
| 145 | Ga0075430_100082327 | 3300006846 | Bacteria | 2697 |
| 146 | Ga0075430_100269874 | 3300006846 | Unclassified | 1408 |
| 147 | Ga0075430_100845757 | 3300006846 | Unclassified | 754 |
| 148 | Ga0075431_100021729 | 3300006847 | Bacteria | 6562 |
| 149 | Ga0075431_100058163 | 3300006847 | Bacteria | 3988 |
| 150 | Ga0075431_100443650 | 3300006847 | Unclassified | 1294 |
| 151 | Ga0075431_100687296 | 3300006847 | Bacteria | 1001 |
| 152 | Ga0075431_101290217 | 3300006847 | Unclassified | 691 |
| 153 | Ga0075431_101372186 | 3300006847 | Bacteria | 667 |
| 154 | Ga0075433_10075979 | 3300006852 | Bacteria | 2958 |
| 155 | Ga0075433_10081111 | 3300006852 | Bacteria | 2860 |
| 156 | Ga0075433_10101960 | 3300006852 | Bacteria | 2541 |
| 157 | Ga0075433_10161733 | 3300006852 | Bacteria | 1993 |
| 158 | Ga0075433_10411478 | 3300006852 | Bacteria | 1193 |
| 159 | Ga0075434_100032062 | 3300006871 | Bacteria | 5180 |
| 160 | Ga0075434_100113024 | 3300006871 | Bacteria | 2727 |
| 161 | Ga0075429_100008724 | 3300006880 | Bacteria | 8818 |
| 162 | Ga0075429_100141214 | 3300006880 | Bacteria | 2108 |
| 163 | Ga0075429_100214620 | 3300006880 | Bacteria | 1686 |
| 164 | Ga0068865_102043792 | 3300006881 | Bacteria | 520 |
| 165 | Ga0075436_100007182 | 3300006914 | Bacteria | 7620 |
| 166 | Ga0075436_100070812 | 3300006914 | Bacteria | 2411 |
| 167 | Ga0075436_100100568 | 3300006914 | Bacteria | 2014 |
| 168 | Ga0075436_100320655 | 3300006914 | Bacteria | 1113 |
| 169 | Ga0097620_100158459 | 3300006931 | Bacteria | 2342 |
| 170 | Ga0075435_100061547 | 3300007076 | Bacteria | 3045 |
| 171 | Ga0075435_101570467 | 3300007076 | Unclassified | 577 |
| 172 | Ga0105240_10001610 | 3300009093 | Bacteria | 38284 |
| 173 | Ga0105240_11260220 | 3300009093 | Bacteria | 781 |
| 174 | Ga0105240_11450950 | 3300009093 | Bacteria | 720 |
| 175 | Ga0111539_10004059 | 3300009094 | Bacteria | 19229 |
| 176 | Ga0111539_10009670 | 3300009094 | Bacteria | 12168 |
| 177 | Ga0111539_10340969 | 3300009094 | Bacteria | 1744 |
| 178 | Ga0105245_10000203 | 3300009098 | Bacteria | 56667 |
| 179 | Ga0114129_10004265 | 3300009147 | Bacteria | 20207 |
| 180 | Ga0114129_10021692 | 3300009147 | Bacteria | 9114 |
| 181 | Ga0114129_10057688 | 3300009147 | Bacteria | 5431 |
| 182 | Ga0114129_10119539 | 3300009147 | Bacteria | 3629 |
| 183 | Ga0114129_10138001 | 3300009147 | Unclassified | 3345 |
| 184 | Ga0114129_10148532 | 3300009147 | Bacteria | 3209 |
| 185 | Ga0114129_10165522 | 3300009147 | Bacteria | 3018 |
| 186 | Ga0114129_10187742 | 3300009147 | Unclassified | 2808 |
| 187 | Ga0114129_10258760 | 3300009147 | Bacteria | 2334 |
| 188 | Ga0114129_10281935 | 3300009147 | Bacteria | 2220 |
| 189 | Ga0114129_10405251 | 3300009147 | Unclassified | 1796 |
| 190 | Ga0114129_10467730 | 3300009147 | Bacteria | 1652 |
| 191 | Ga0114129_10715980 | 3300009147 | Unclassified | 1285 |
| 192 | Ga0114129_11636456 | 3300009147 | Bacteria | 787 |
| 193 | Ga0114129_11730058 | 3300009147 | Unclassified | 762 |
| 194 | Ga0114129_11810943 | 3300009147 | Unclassified | 742 |
| 195 | Ga0105243_10362188 | 3300009148 | Bacteria | 1335 |
| 196 | Ga0105242_11043739 | 3300009176 | Bacteria | 828 |
| 197 | Ga0105248_10423508 | 3300009177 | Bacteria | 1499 |
| 198 | Ga0105237_10001240 | 3300009545 | Bacteria | 34022 |
| 199 | Ga0105237_10242316 | 3300009545 | Bacteria | 1804 |
| 200 | Ga0105237_10784921 | 3300009545 | Bacteria | 959 |
| 201 | Ga0105238_12205065 | 3300009551 | Bacteria | 586 |
| 202 | Ga0105249_10126564 | 3300009553 | Bacteria | 2434 |
| 203 | Ga0105249_10254733 | 3300009553 | Bacteria | 1741 |
| 204 | Ga0105239_10028309 | 3300010375 | Bacteria | 6164 |
| 205 | Ga0105239_10129732 | 3300010375 | Bacteria | 2803 |
| 206 | Ga0105239_10193765 | 3300010375 | Bacteria | 2275 |
| 207 | Ga0157369_10266027 | 3300013105 | Bacteria | 1788 |
| 208 | Ga0157374_10000028 | 3300013296 | Bacteria | 213725 |
| 209 | Ga0157374_10343043 | 3300013296 | Bacteria | 1483 |
| 210 | Ga0163162_11614973 | 3300013306 | Bacteria | 740 |
| 211 | Ga0157375_10636180 | 3300013308 | Bacteria | 1224 |
| 212 | Ga0163163_10149914 | 3300014325 | Bacteria | 2376 |
| 213 | Ga0163163_10877720 | 3300014325 | Bacteria | 960 |
| 214 | Ga0157380_10186155 | 3300014326 | Bacteria | 1829 |
| 215 | Ga0157380_11158810 | 3300014326 | Bacteria | 815 |
| 216 | Ga0157380_12391862 | 3300014326 | Bacteria | 593 |
| 217 | Ga0157377_10253643 | 3300014745 | Unclassified | 1141 |
| 218 | Ga0157376_10001656 | 3300014969 | Bacteria | 14794 |
| 219 | Ga0157376_10027362 | 3300014969 | Bacteria | 4518 |
| 220 | Ga0182007_10135009 | 3300015262 | Bacteria | 832 |
| 221 | Ga0213876_10515916 | 3300021384 | Bacteria | 636 |
| 222 | Ga0207680_10187301 | 3300025903 | Bacteria | 1403 |
| 223 | Ga0207647_10437103 | 3300025904 | Unclassified | 734 |
| 224 | Ga0207645_10549811 | 3300025907 | Bacteria | 783 |
| 225 | Ga0207705_10129660 | 3300025909 | Bacteria | 1876 |
| 226 | Ga0207684_10008739 | 3300025910 | Bacteria | 8994 |
| 227 | Ga0207684_10017912 | 3300025910 | Bacteria | 6071 |
| 228 | Ga0207684_10821221 | 3300025910 | Bacteria | 785 |
| 229 | Ga0207707_10015908 | 3300025912 | Bacteria | 6560 |
| 230 | Ga0207707_10126924 | 3300025912 | Bacteria | 2231 |
| 231 | Ga0207671_10476299 | 3300025914 | Bacteria | 995 |
| 232 | Ga0207663_10032508 | 3300025916 | Bacteria | 3098 |
| 233 | Ga0207660_10150166 | 3300025917 | Bacteria | 1789 |
| 234 | Ga0207660_11622644 | 3300025917 | Bacteria | 521 |
| 235 | Ga0207652_10023424 | 3300025921 | Bacteria | 5115 |
| 236 | Ga0207652_10034976 | 3300025921 | Bacteria | 4238 |
| 237 | Ga0207646_10003462 | 3300025922 | Bacteria | 17824 |
| 238 | Ga0207646_10019175 | 3300025922 | Bacteria | 6359 |
| 239 | Ga0207646_10367936 | 3300025922 | Bacteria | 1299 |
| 240 | Ga0207646_11606165 | 3300025922 | Bacteria | 561 |
| 241 | Ga0207694_10080606 | 3300025924 | Bacteria | 2555 |
| 242 | Ga0207687_10001086 | 3300025927 | Bacteria | 18472 |
| 243 | Ga0207700_10011057 | 3300025928 | Bacteria | 5737 |
| 244 | Ga0207664_10000128 | 3300025929 | Bacteria | 66208 |
| 245 | Ga0207690_10247374 | 3300025932 | Bacteria | 1376 |
| 246 | Ga0207706_10000439 | 3300025933 | Bacteria | 44418 |
| 247 | Ga0207706_10287247 | 3300025933 | Bacteria | 1434 |
| 248 | Ga0207709_10182279 | 3300025935 | Unclassified | 1484 |
| 249 | Ga0207709_11466006 | 3300025935 | Unclassified | 566 |
| 250 | Ga0207670_10562434 | 3300025936 | Bacteria | 933 |
| 251 | Ga0207691_10047581 | 3300025940 | Bacteria | 3935 |
| 252 | Ga0207711_10739985 | 3300025941 | Bacteria | 917 |
| 253 | Ga0207689_10192761 | 3300025942 | Bacteria | 1682 |
| 254 | Ga0207689_11023819 | 3300025942 | Unclassified | 696 |
| 255 | Ga0207661_10095658 | 3300025944 | Bacteria | 2484 |
| 256 | Ga0207679_10434390 | 3300025945 | Bacteria | 1161 |
| 257 | Ga0207667_11239583 | 3300025949 | Bacteria | 724 |
| 258 | Ga0207712_10353856 | 3300025961 | Bacteria | 1222 |
| 259 | Ga0207712_10597378 | 3300025961 | Bacteria | 954 |
| 260 | Ga0207712_10743491 | 3300025961 | Unclassified | 859 |
| 261 | Ga0207658_10284534 | 3300025986 | Bacteria | 1419 |
| 262 | Ga0207658_11359070 | 3300025986 | Bacteria | 650 |
| 263 | Ga0207677_10112166 | 3300026023 | Bacteria | 2033 |
| 264 | Ga0207677_11389879 | 3300026023 | Bacteria | 646 |
| 265 | Ga0207678_10007177 | 3300026067 | Bacteria | 9880 |
| 266 | Ga0207678_11358721 | 3300026067 | Bacteria | 628 |
| 267 | Ga0207708_10202845 | 3300026075 | Bacteria | 1583 |
| 268 | Ga0207702_10032344 | 3300026078 | Bacteria | 4365 |
| 269 | Ga0207702_10224987 | 3300026078 | Bacteria | 1750 |
| 270 | Ga0207641_10055607 | 3300026088 | Bacteria | 3361 |
| 271 | Ga0207641_11415775 | 3300026088 | Unclassified | 696 |
| 272 | Ga0207648_10144945 | 3300026089 | Bacteria | 2095 |
| 273 | Ga0207676_10151924 | 3300026095 | Bacteria | 1995 |
| 274 | Ga0207676_10744398 | 3300026095 | Bacteria | 953 |
| 275 | Ga0207674_10276669 | 3300026116 | Bacteria | 1626 |
| 276 | Ga0207674_10620773 | 3300026116 | Bacteria | 1044 |
| 277 | Ga0207674_10730158 | 3300026116 | Bacteria | 956 |
| 278 | Ga0207683_10089802 | 3300026121 | Bacteria | 2735 |
| 279 | Ga0207428_10016855 | 3300027907 | Bacteria | 6278 |
| 280 | Ga0268266_10981650 | 3300028379 | Bacteria | 817 |
| 281 | Ga0268265_10239076 | 3300028380 | Bacteria | 1601 |
| 282 | Ga0268265_10256827 | 3300028380 | Bacteria | 1551 |
| 283 | Ga0268265_11166881 | 3300028380 | Bacteria | 767 |
| 284 | Ga0268264_10102774 | 3300028381 | Bacteria | 2487 |
| 285 | Ga0265337_1010077 | 3300028556 | Unclassified | 3329 |
| 286 | Ga0265337_1052064 | 3300028556 | Bacteria | 1150 |
| 287 | Ga0265326_10008773 | 3300028558 | Bacteria | 3035 |
| 288 | Ga0265319_1000011 | 3300028563 | Bacteria | 184643 |
| 289 | Ga0265318_10000284 | 3300028577 | Bacteria | 41911 |
| 290 | Ga0265318_10086188 | 3300028577 | Bacteria | 1157 |
| 291 | Ga0265323_10000015 | 3300028653 | Bacteria | 105428 |
| 292 | Ga0265323_10086129 | 3300028653 | Bacteria | 1056 |
| 293 | Ga0265322_10000430 | 3300028654 | Bacteria | 17001 |
| 294 | Ga0265322_10031342 | 3300028654 | Unclassified | 1517 |
| 295 | Ga0265336_10008503 | 3300028666 | Bacteria | 3597 |
| 296 | Ga0307515_10097779 | 3300028794 | Bacteria | 3583 |
| 297 | Ga0265338_10028491 | 3300028800 | Bacteria | 5567 |
| 298 | Ga0265338_10032370 | 3300028800 | Bacteria | 5101 |
| 299 | Ga0265338_10159423 | 3300028800 | Bacteria | 1744 |
| 300 | Ga0265338_10567933 | 3300028800 | Bacteria | 793 |
| 301 | Ga0265330_10364410 | 3300031235 | Bacteria | 611 |
| 302 | Ga0265332_10086329 | 3300031238 | Bacteria | 1329 |
| 303 | Ga0265320_10028596 | 3300031240 | Bacteria | 2893 |
| 304 | Ga0265320_10035765 | 3300031240 | Bacteria | 2515 |
| 305 | Ga0265325_10030965 | 3300031241 | Bacteria | 2867 |
| 306 | Ga0265325_10038957 | 3300031241 | Bacteria | 2505 |
| 307 | Ga0265325_10232646 | 3300031241 | Bacteria | 840 |
| 308 | Ga0265340_10019758 | 3300031247 | Bacteria | 3467 |
| 309 | Ga0265340_10062479 | 3300031247 | Unclassified | 1779 |
| 310 | Ga0265340_10148660 | 3300031247 | Bacteria | 1069 |
| 311 | Ga0265331_10033079 | 3300031250 | Bacteria | 2558 |
| 312 | Ga0265331_10272285 | 3300031250 | Bacteria | 759 |
| 313 | Ga0265327_10039369 | 3300031251 | Bacteria | 2568 |
| 314 | Ga0265316_10000549 | 3300031344 | Bacteria | 42208 |
| 315 | Ga0265316_10008443 | 3300031344 | Bacteria | 9560 |
| 316 | Ga0265316_10009062 | 3300031344 | Bacteria | 9171 |
| 317 | Ga0265316_10015617 | 3300031344 | Bacteria | 6629 |
| 318 | Ga0265316_10021000 | 3300031344 | Bacteria | 5541 |
| 319 | Ga0265316_10129728 | 3300031344 | Bacteria | 1900 |
| 320 | Ga0265316_10195582 | 3300031344 | Bacteria | 1501 |
| 321 | Ga0307513_10006699 | 3300031456 | Bacteria | 15030 |
| 322 | Ga0307509_10001290 | 3300031507 | Bacteria | 42541 |
| 323 | Ga0265313_10015352 | 3300031595 | Bacteria | 4466 |
| 324 | Ga0265313_10038587 | 3300031595 | Bacteria | 2377 |
| 325 | Ga0307508_10000513 | 3300031616 | Bacteria | 46447 |
| 326 | Ga0307508_10131554 | 3300031616 | Bacteria | 2106 |
| 327 | Ga0265314_10000001 | 3300031711 | Bacteria | 3792860 |
| 328 | Ga0265314_10004796 | 3300031711 | Bacteria | 12383 |
| 329 | Ga0265314_10006365 | 3300031711 | Bacteria | 10468 |
| 330 | Ga0265314_10012148 | 3300031711 | Bacteria | 7052 |
| 331 | Ga0265314_10045630 | 3300031711 | Bacteria | 3096 |
| 332 | Ga0265314_10175595 | 3300031711 | Bacteria | 1289 |
| 333 | Ga0265342_10032133 | 3300031712 | Bacteria | 3238 |
| 334 | Ga0265342_10470479 | 3300031712 | Bacteria | 643 |
| 335 | Ga0307516_10080566 | 3300031730 | Bacteria | 3100 |
| 336 | Ga0307516_10116148 | 3300031730 | Bacteria | 2472 |
| 337 | Ga0307405_10405214 | 3300031731 | Bacteria | 1069 |
| 338 | Ga0307409_100570590 | 3300031995 | Bacteria | 1114 |
| 339 | Ga0307416_100964139 | 3300032002 | Bacteria | 955 |
| 340 | Ga0307416_102059168 | 3300032002 | Bacteria | 673 |
| 341 | Ga0307416_102254177 | 3300032002 | Bacteria | 645 |
| 342 | Ga0307414_11923782 | 3300032004 | Bacteria | 552 |
| 343 | Ga0316583_10000170 | 3300032133 | Bacteria | 16330 |
| 344 | Ga0373949_0000884 | 3300035090 | Bacteria | 9431 |
| 345 | Ga0373951_0125100 | 3300035091 | Bacteria | 703 |
| 346 | Ga0373923_0030406 | 3300035111 | Bacteria | 2172 |
| 347 | Ga0373953_0257236 | 3300035117 | Bacteria | 759 |
| 348 | Ga0373956_0363820 | 3300035119 | Bacteria | 690 |
| 349 | Ga0373957_0270730 | 3300035120 | Bacteria | 717 |
| 350 | Ga0373960_0002896 | 3300035121 | Bacteria | 3880 |
| 351 | Ga0373955_0071999 | 3300035172 | Bacteria | 1935 |
| 352 | Ga0373942_0098086 | 3300035207 | Bacteria | 892 |
| 353 | Ga0373927_0046495 | 3300035695 | Bacteria | 2808 |
| 354 | Ga0373933_0047960 | 3300035724 | Bacteria | 2542 |
| 355 | Ga0373933_0060641 | 3300035724 | Bacteria | 2281 |
| 356 | Ga0373933_0116647 | 3300035724 | Bacteria | 1669 |
| 357 | Ga0373937_0016096 | 3300036401 | Bacteria | 6634 |
| 358 | Ga0373937_0458987 | 3300036401 | Bacteria | 1210 |
| 359 | Ga0395899_0002535 | 3300037312 | Bacteria | 14799 |
| 360 | Ga0395898_0256697 | 3300037466 | Unclassified | 1667 |
| 361 | Ga0395898_0714121 | 3300037466 | Bacteria | 944 |
| 362 | Ga0395905_0001144 | 3300037471 | Bacteria | 33189 |
| 363 | Ga0395905_0261352 | 3300037471 | Bacteria | 1616 |
| 364 | Ga0395905_0884818 | 3300037471 | Bacteria | 796 |
| 365 | Ga0395905_1099164 | 3300037471 | Unclassified | 698 |
| 366 | Ga0436364_1369666 | 3300037853 | Bacteria | 2750 |
| 367 | Ga0395901_0001208 | 3300038443 | Bacteria | 27462 |
| 368 | Ga0237819_17348 | 3300038705 | Bacteria | 794 |
| 369 | Ga0436365_1438224 | 3300039437 | Bacteria | 1164 |
| 370 | Ga0436365_1922161 | 3300039437 | Bacteria | 615 |
| 371 | Ga0436360_0819779 | 3300039438 | Bacteria | 1057 |
| 372 | Ga0451807_2214409 | 3300041486 | Bacteria | 550 |
| 373 | Ga0451853_1103094 | 3300041512 | Bacteria | 1901 |
| 374 | Ga0451853_1741855 | 3300041512 | Bacteria | 810 |
| 375 | Ga0439441_070899 | 3300042001 | Bacteria | 747 |
| 376 | Ga0451577_0000499 | 3300042876 | Bacteria | 66047 |
| 377 | Ga0451577_0003072 | 3300042876 | Bacteria | 18887 |
| 378 | Ga0451577_0187282 | 3300042876 | Bacteria | 1867 |
| 379 | Ga0451577_0216403 | 3300042876 | Bacteria | 1731 |
| 380 | Ga0451577_0507438 | 3300042876 | Bacteria | 1095 |
| 381 | Ga0466972_0000388 | 3300044658 | Bacteria | 23520 |
| 382 | Ga0466972_0010970 | 3300044658 | Bacteria | 4548 |
| 383 | Ga0466972_0366054 | 3300044658 | Bacteria | 675 |
| 384 | Ga0453683_0000852 | 3300044673 | Bacteria | 29434 |
| 385 | Ga0453683_0001962 | 3300044673 | Bacteria | 16666 |
| 386 | Ga0453683_0211231 | 3300044673 | Bacteria | 1233 |
| 387 | Ga0453683_0925856 | 3300044673 | Bacteria | 577 |
| 388 | Ga0466965_0012718 | 3300044683 | Bacteria | 3964 |
| 389 | Ga0466961_0575191 | 3300044693 | Bacteria | 678 |
| 390 | Ga0466964_0020565 | 3300044706 | Bacteria | 2543 |
| 391 | Ga0453684_0000586 | 3300044712 | Bacteria | 135374 |
| 392 | Ga0453684_0001918 | 3300044712 | Bacteria | 53912 |
| 393 | Ga0453684_0012865 | 3300044712 | Bacteria | 13709 |
| 394 | Ga0453684_0013262 | 3300044712 | Bacteria | 13422 |
| 395 | Ga0453684_0014672 | 3300044712 | Bacteria | 12496 |
| 396 | Ga0453684_0025189 | 3300044712 | Bacteria | 8648 |
| 397 | Ga0453684_0487849 | 3300044712 | Bacteria | 1366 |
| 398 | Ga0453684_0488900 | 3300044712 | Bacteria | 1364 |
| 399 | Ga0453684_0637993 | 3300044712 | Bacteria | 1163 |
| 400 | Ga0453684_0830088 | 3300044712 | Unclassified | 995 |
| 401 | Ga0453684_1033348 | 3300044712 | Unclassified | 872 |
| 402 | Ga0453684_1494637 | 3300044712 | Bacteria | 697 |
| 403 | Ga0466971_0000045 | 3300044719 | Bacteria | 50210 |
| 404 | Ga0466971_0000077 | 3300044719 | Bacteria | 35552 |
| 405 | Ga0466968_0014455 | 3300044735 | Bacteria | 3120 |
| 406 | Ga0466970_0149126 | 3300044765 | Bacteria | 1291 |
| 407 | Ga0466970_0352708 | 3300044765 | Bacteria | 835 |
| 408 | Ga0466957_0009239 | 3300044842 | Bacteria | 5623 |
| 409 | Ga0466957_0062415 | 3300044842 | Bacteria | 2288 |
| 410 | Ga0466960_0008293 | 3300044901 | Bacteria | 4250 |
| 411 | Ga0466960_0152870 | 3300044901 | Bacteria | 1234 |
| 412 | Ga0466960_0307868 | 3300044901 | Bacteria | 894 |
| 413 | Ga0466959_0111800 | 3300045049 | Bacteria | 1949 |
| 414 | Ga0451576_0016323 | 3300045051 | Bacteria | 8200 |
| 415 | Ga0451576_0045719 | 3300045051 | Bacteria | 4609 |
| 416 | Ga0451576_0085907 | 3300045051 | Bacteria | 3273 |
| 417 | Ga0451576_0089349 | 3300045051 | Bacteria | 3204 |
| 418 | Ga0451576_0152340 | 3300045051 | Bacteria | 2411 |
| 419 | Ga0451576_0174098 | 3300045051 | Bacteria | 2247 |
| 420 | Ga0451576_0272924 | 3300045051 | Bacteria | 1768 |
| 421 | Ga0451576_0472624 | 3300045051 | Bacteria | 1317 |
| 422 | Ga0451576_0975983 | 3300045051 | Bacteria | 888 |
| 423 | Ga0466958_0823882 | 3300045836 | Bacteria | 605 |
| 424 | Ga0466967_0054343 | 3300045976 | Bacteria | 3524 |
| 425 | Ga0466967_0077361 | 3300045976 | Bacteria | 2995 |
| 426 | Ga0495592_0113869 | 3300046454 | Unclassified | 1911 |
| 427 | Ga0495651_0005556 | 3300046462 | Bacteria | 9614 |
| 428 | Ga0495651_0048384 | 3300046462 | Bacteria | 3284 |
| 429 | Ga0495653_0003304 | 3300046463 | Bacteria | 12941 |
| 430 | Ga0495650_0020245 | 3300046471 | Bacteria | 3249 |
| 431 | Ga0495608_0001943 | 3300046511 | Bacteria | 14836 |
| 432 | Ga0495608_0123941 | 3300046511 | Unclassified | 1656 |
| 433 | Ga0495628_0222364 | 3300046516 | Bacteria | 1418 |
| 434 | Ga0495630_0031225 | 3300046517 | Bacteria | 3966 |
| 435 | Ga0495652_0003238 | 3300046529 | Bacteria | 16225 |
| 436 | Ga0495652_0036919 | 3300046529 | Bacteria | 4243 |
| 437 | Ga0495586_0427936 | 3300046535 | Bacteria | 763 |
| 438 | Ga0495587_0009943 | 3300046536 | Bacteria | 6072 |
| 439 | Ga0495598_0032659 | 3300046537 | Bacteria | 1472 |
| 440 | Ga0495621_0005591 | 3300046539 | Bacteria | 3624 |
| 441 | Ga0495645_0013858 | 3300046543 | Bacteria | 5715 |
| 442 | Ga0495645_0027140 | 3300046543 | Bacteria | 4159 |
| 443 | Ga0495622_0064198 | 3300046557 | Bacteria | 1698 |
| 444 | Ga0495667_0002735 | 3300046559 | Bacteria | 11784 |
| 445 | Ga0495667_0086718 | 3300046559 | Bacteria | 2030 |
| 446 | Ga0495668_0605885 | 3300046616 | Bacteria | 605 |
| 447 | Ga0495635_0015163 | 3300046663 | Bacteria | 5391 |
| 448 | Ga0495659_0122722 | 3300046664 | Bacteria | 1024 |
| 449 | Ga0495588_0029584 | 3300046674 | Unclassified | 2749 |
| 450 | Ga0495657_0001156 | 3300046675 | Bacteria | 23145 |
| 451 | Ga0495657_0123220 | 3300046675 | Unclassified | 1631 |
| 452 | Ga0495599_0490094 | 3300046678 | Bacteria | 724 |
| 453 | Ga0495599_0589901 | 3300046678 | Bacteria | 648 |
| 454 | Ga0495623_0164994 | 3300046679 | Bacteria | 1298 |
| 455 | Ga0495600_0010984 | 3300046809 | Bacteria | 5634 |
| 456 | Ga0495604_0003904 | 3300047317 | Bacteria | 11873 |
| 457 | Ga0495636_0020776 | 3300047318 | Bacteria | 2647 |
| 458 | Ga0495674_0012283 | 3300047319 | Bacteria | 8072 |
| 459 | Ga0495672_0003726 | 3300047320 | Bacteria | 12852 |
| 460 | Ga0495672_0062108 | 3300047320 | Bacteria | 2150 |
| 461 | Ga0495680_0002785 | 3300047322 | Bacteria | 17617 |
| 462 | Ga0495675_0007432 | 3300047444 | Bacteria | 6746 |
| 463 | Ga0495684_0012913 | 3300047471 | Bacteria | 6447 |
| 464 | Ga0495684_0606521 | 3300047471 | Bacteria | 738 |
| 465 | Ga0495602_0063732 | 3300048088 | Bacteria | 3192 |
| 466 | Ga0496106_1371746 | 3300048909 | Unclassified | 547 |
| 467 | Ga0496108_0711884 | 3300048911 | Bacteria | 870 |
| 468 | Ga0496109_0292655 | 3300048912 | Bacteria | 1535 |
| 469 | Ga0496114_0550779 | 3300048917 | Bacteria | 1019 |
| 470 | Ga0496116_0003081 | 3300048919 | Bacteria | 16808 |
| 471 | Ga0501031_0000053 | 3300049568 | Bacteria | 62966 |
| 472 | Ga0501031_0000383 | 3300049568 | Bacteria | 25957 |
| 473 | Ga0501031_0000514 | 3300049568 | Bacteria | 22669 |
| 474 | Ga0501032_0024208 | 3300049569 | Bacteria | 4194 |
| 475 | Ga0501033_0000049 | 3300049570 | Bacteria | 114610 |
| 476 | Ga0501033_0000057 | 3300049570 | Bacteria | 107439 |
| 477 | Ga0501034_0162941 | 3300049571 | Bacteria | 2200 |
| 478 | Ga0501034_0242107 | 3300049571 | Bacteria | 1750 |
| 479 | Ga0501034_0394729 | 3300049571 | Bacteria | 1307 |
| 480 | Ga0501036_0008961 | 3300049572 | Bacteria | 8228 |
| 481 | Ga0501036_0091278 | 3300049572 | Bacteria | 2573 |
| 482 | Ga0501036_0152311 | 3300049572 | Bacteria | 1950 |
| 483 | Ga0501036_0621439 | 3300049572 | Bacteria | 895 |
| 484 | Ga0501037_0000002 | 3300049573 | Bacteria | 292291 |
| 485 | Ga0501037_0940642 | 3300049573 | Bacteria | 565 |
| 486 | Ga0501038_0001276 | 3300049574 | Bacteria | 22851 |
| 487 | Ga0501038_0008875 | 3300049574 | Bacteria | 9228 |
| 488 | Ga0501038_0128109 | 3300049574 | Bacteria | 2087 |
| 489 | Ga0501038_0154658 | 3300049574 | Bacteria | 1868 |
| 490 | Ga0501038_0227861 | 3300049574 | Bacteria | 1484 |
| 491 | Ga0501039_0000217 | 3300049575 | Bacteria | 42182 |
| 492 | Ga0501039_0000405 | 3300049575 | Bacteria | 30997 |
| 493 | Ga0501039_0002621 | 3300049575 | Bacteria | 13429 |
| 494 | Ga0501039_0008472 | 3300049575 | Bacteria | 7839 |
| 495 | Ga0501039_0651095 | 3300049575 | Bacteria | 825 |
| 496 | Ga0501040_0574258 | 3300049576 | Bacteria | 814 |
| 497 | Ga0501041_0040587 | 3300049577 | Bacteria | 2825 |
| 498 | Ga0501042_0614878 | 3300049578 | Bacteria | 790 |
| 499 | Ga0501043_0002182 | 3300049579 | Bacteria | 16711 |
| 500 | Ga0501043_0002351 | 3300049579 | Bacteria | 16031 |
| 501 | Ga0501043_0003769 | 3300049579 | Bacteria | 12461 |
| 502 | Ga0501043_0028414 | 3300049579 | Bacteria | 4390 |
| 503 | Ga0501047_0004689 | 3300049581 | Bacteria | 12856 |
| 504 | Ga0501047_0009135 | 3300049581 | Bacteria | 9360 |
| 505 | Ga0501047_0079423 | 3300049581 | Bacteria | 3154 |
| 506 | Ga0501047_0163713 | 3300049581 | Bacteria | 2095 |
| 507 | Ga0501047_0266251 | 3300049581 | Bacteria | 1561 |
| 508 | Ga0501047_0574448 | 3300049581 | Bacteria | 950 |
| 509 | Ga0501048_0566636 | 3300049582 | Bacteria | 815 |
| 510 | Ga0501068_0232096 | 3300049584 | Bacteria | 1173 |
| 511 | Ga0501068_0290122 | 3300049584 | Bacteria | 1046 |
| 512 | Ga0501070_0000696 | 3300049586 | Bacteria | 30864 |
| 513 | Ga0501070_0002593 | 3300049586 | Bacteria | 15800 |
| 514 | Ga0501070_0048386 | 3300049586 | Bacteria | 3532 |
| 515 | Ga0501070_0088488 | 3300049586 | Bacteria | 2563 |
| 516 | Ga0501071_0019581 | 3300049587 | Bacteria | 4697 |
| 517 | Ga0501072_0005594 | 3300049588 | Bacteria | 9562 |
| 518 | Ga0501072_0028489 | 3300049588 | Bacteria | 4361 |
| 519 | Ga0501073_0012098 | 3300049589 | Bacteria | 6301 |
| 520 | Ga0501073_0628206 | 3300049589 | Bacteria | 741 |
| 521 | Ga0501073_0822535 | 3300049589 | Bacteria | 640 |
| 522 | Ga0501074_0260459 | 3300049590 | Bacteria | 1233 |
| 523 | Ga0501074_0509032 | 3300049590 | Bacteria | 853 |
| 524 | Ga0501075_0082560 | 3300049591 | Bacteria | 2434 |
| 525 | Ga0501075_0105565 | 3300049591 | Bacteria | 2141 |
| 526 | Ga0501075_1425734 | 3300049591 | Unclassified | 524 |
| 527 | Ga0501076_0098357 | 3300049592 | Bacteria | 2357 |
| 528 | Ga0501076_0119301 | 3300049592 | Bacteria | 2136 |
| 529 | Ga0501076_0124687 | 3300049592 | Bacteria | 2087 |
| 530 | Ga0501207_080398 | 3300049654 | Bacteria | 626 |
| 531 | Ga0501209_198446 | 3300049656 | Bacteria | 617 |
| 532 | Ga0501227_018133 | 3300049665 | Bacteria | 1595 |
| 533 | Ga0501240_023486 | 3300049673 | Bacteria | 946 |
| 534 | Ga0501257_066563 | 3300049686 | Bacteria | 916 |
| 535 | Ga0501079_0177071 | 3300049741 | Bacteria | 1663 |
| 536 | Ga0501079_0972288 | 3300049741 | Bacteria | 669 |
| 537 | Ga0501079_0984639 | 3300049741 | Bacteria | 664 |
| 538 | Ga0501080_0013488 | 3300049742 | Bacteria | 7520 |
| 539 | Ga0501080_0014976 | 3300049742 | Bacteria | 7140 |
| 540 | Ga0501080_0683659 | 3300049742 | Bacteria | 906 |
| 541 | Ga0501080_0958643 | 3300049742 | Bacteria | 743 |
| 542 | Ga0501080_1173224 | 3300049742 | Bacteria | 661 |
| 543 | Ga0501080_1410921 | 3300049742 | Bacteria | 594 |
| 544 | Ga0501081_0214114 | 3300049743 | Bacteria | 1400 |
| 545 | Ga0501081_0456408 | 3300049743 | Bacteria | 950 |
| 546 | Ga0501083_0012288 | 3300049744 | Bacteria | 5993 |
| 547 | Ga0501035_0000001 | 3300049822 | Bacteria | 1037138 |
| 548 | Ga0501035_0000007 | 3300049822 | Bacteria | 359281 |
| 549 | Ga0501044_0000259 | 3300049823 | Bacteria | 67115 |
| 550 | Ga0501044_0002636 | 3300049823 | Bacteria | 20400 |
| 551 | Ga0501044_0022639 | 3300049823 | Bacteria | 6692 |
| 552 | Ga0501044_0069602 | 3300049823 | Bacteria | 3582 |
| 553 | Ga0501045_0005133 | 3300049824 | Bacteria | 9063 |
| 554 | Ga0501045_0108160 | 3300049824 | Bacteria | 2061 |
| 555 | nmdc:mga03n38_15322_c1 | 3300050490 | Bacteria | 2958 |
| 556 | nmdc:mga00v17_530860_c1 | 3300050491 | Bacteria | 762 |
| 557 | nmdc:mga00v17_68236_c1 | 3300050491 | Bacteria | 2198 |
| 558 | nmdc:mga0yw44_121420_c1 | 3300050492 | Bacteria | 1683 |
| 559 | nmdc:mga0yw44_14001_c1 | 3300050492 | Bacteria | 4243 |
| 560 | nmdc:mga0yw44_52914_c1 | 3300050492 | Bacteria | 2463 |
| 561 | nmdc:mga0k408_467382_c1 | 3300050493 | Unclassified | 748 |
| 562 | nmdc:mga06z11_182719_c1 | 3300050494 | Bacteria | 1210 |
| 563 | nmdc:mga06z11_65160_c1 | 3300050494 | Bacteria | 1911 |
| 564 | nmdc:mga06z11_72288_c1 | 3300050494 | Bacteria | 1828 |
| 565 | nmdc:mga04h51_424854_c1 | 3300050495 | Bacteria | 559 |
| 566 | nmdc:mga05p37_1232802_c1 | 3300050507 | Unclassified | 769 |
| 567 | nmdc:mga05p37_141842_c1 | 3300050507 | Bacteria | 2943 |
| 568 | nmdc:mga05p37_1615547_c1 | 3300050507 | Bacteria | 638 |
| 569 | nmdc:mga05p37_172394_c1 | 3300050507 | Bacteria | 2638 |
| 570 | nmdc:mga05p37_1768520_c1 | 3300050507 | Bacteria | 598 |
| 571 | nmdc:mga05p37_20364_c1 | 3300050507 | Bacteria | 8026 |
| 572 | nmdc:mga05p37_251374_c1 | 3300050507 | Bacteria | 2120 |
| 573 | nmdc:mga05p37_293738_c1 | 3300050507 | Bacteria | 1934 |
| 574 | nmdc:mga05p37_3145_c1 | 3300050507 | Bacteria | 19203 |
| 575 | nmdc:mga05p37_32319_c1 | 3300050507 | Bacteria | 6399 |
| 576 | nmdc:mga05p37_388086_c1 | 3300050507 | Bacteria | 1634 |
| 577 | nmdc:mga05p37_474218_c1 | 3300050507 | Bacteria | 1443 |
| 578 | nmdc:mga05p37_780282_c1 | 3300050507 | Bacteria | 1049 |
| 579 | nmdc:mga09592_3139_c1 | 3300050508 | Bacteria | 13416 |
| 580 | nmdc:mga09592_49245_c1 | 3300050508 | Bacteria | 3552 |
| 581 | nmdc:mga09592_89312_c1 | 3300050508 | Bacteria | 2632 |
| 582 | nmdc:mga0qj67_16521_c1 | 3300050509 | Bacteria | 5600 |
| 583 | nmdc:mga0qj67_719512_c1 | 3300050509 | Unclassified | 793 |
| 584 | nmdc:mga0qj67_726952_c1 | 3300050509 | Bacteria | 789 |
| 585 | nmdc:mga06r32_1239529_c1 | 3300050510 | Unclassified | 691 |
| 586 | nmdc:mga06r32_221443_c1 | 3300050510 | Bacteria | 1880 |
| 587 | nmdc:mga06r32_258239_c1 | 3300050510 | Bacteria | 1730 |
| 588 | nmdc:mga06r32_329050_c1 | 3300050510 | Bacteria | 1513 |
| 589 | nmdc:mga06r32_517159_c1 | 3300050510 | Unclassified | 1169 |
| 590 | nmdc:mga06r32_68031_c1 | 3300050510 | Bacteria | 3440 |
| 591 | nmdc:mga08y16_5068_c1 | 3300050511 | Bacteria | 13771 |
| 592 | nmdc:mga08y16_65823_c1 | 3300050511 | Bacteria | 3783 |
| 593 | nmdc:mga08y16_946986_c1 | 3300050511 | Bacteria | 844 |
| 594 | nmdc:mga0n895_308615_c1 | 3300050512 | Bacteria | 1604 |
| 595 | nmdc:mga0n895_46388_c1 | 3300050512 | Bacteria | 4245 |
| 596 | nmdc:mga0n895_55397_c1 | 3300050512 | Bacteria | 3903 |
| 597 | nmdc:mga0rr50_1511446_c1 | 3300050513 | Unclassified | 568 |
| 598 | nmdc:mga0rr50_47972_c1 | 3300050513 | Bacteria | 3155 |
| 599 | nmdc:mga08x19_123326_c1 | 3300050514 | Bacteria | 1738 |
| 600 | nmdc:mga08x19_124016_c1 | 3300050514 | Bacteria | 1733 |
| 601 | nmdc:mga08x19_128423_c1 | 3300050514 | Bacteria | 1703 |
| 602 | nmdc:mga08x19_15081_c1 | 3300050514 | Bacteria | 4695 |
| 603 | nmdc:mga08x19_608504_c1 | 3300050514 | Bacteria | 774 |
| 604 | nmdc:mga0a205_102218_c1 | 3300050515 | Bacteria | 2765 |
| 605 | nmdc:mga0a205_1076045_c1 | 3300050515 | Unclassified | 651 |
| 606 | nmdc:mga0a205_335009_c1 | 3300050515 | Bacteria | 1382 |
| 607 | nmdc:mga0a205_364253_c1 | 3300050515 | Bacteria | 1312 |
| 608 | nmdc:mga0a205_489078_c1 | 3300050515 | Bacteria | 1088 |
| 609 | nmdc:mga0a205_58053_c1 | 3300050515 | Bacteria | 3738 |
| 610 | nmdc:mga0a205_58937_c1 | 3300050515 | Bacteria | 3709 |
| 611 | nmdc:mga0a205_9398_c1 | 3300050515 | Bacteria | 8936 |
| 612 | nmdc:mga0sz30_31431_c1 | 3300050516 | Bacteria | 2197 |
| 613 | Ga0495601_0031035 | 3300053077 | Bacteria | 3321 |
| 614 | Ga0495619_0006543 | 3300053085 | Bacteria | 7371 |
| 615 | Ga0500554_163651 | 3300053102 | Bacteria | 750 |
| 616 | Ga0500569_066961 | 3300053109 | Bacteria | 1122 |
| 617 | Ga0500568_0264008 | 3300053139 | Bacteria | 626 |
| 618 | Ga0501084_0959507 | 3300054114 | Bacteria | 719 |
| 619 | Ga0501084_1641839 | 3300054114 | Bacteria | 537 |
| 620 | Ga0590071_004510 | 3300059421 | Unclassified | 3379 |
| 621 | Ga0590075_142472 | 3300059424 | Unclassified | 630 |
| 622 | Ga0590077_078231 | 3300059426 | Unclassified | 760 |
| 623 | Ga0501082_0031105 | 3300060353 | Bacteria | 4601 |
| 624 | Ga0501082_0100889 | 3300060353 | Bacteria | 2497 |
| 625 | Ga0501082_0142278 | 3300060353 | Bacteria | 2082 |
| 626 | Ga0501082_0646995 | 3300060353 | Bacteria | 925 |
| 627 | Ga0466962_0000006 | 3300061719 | Bacteria | 168917 |
| 628 | Ga0466962_0000052 | 3300061719 | Bacteria | 47302 |
| 629 | Ga0530510_0292007 | 3300061734 | Bacteria | 1219 |
| 630 | Ga0530510_0927639 | 3300061734 | Bacteria | 666 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025935 | Ga0207709_11466006 | Ga0207709_114660061 | 127 |
| 2 | 3300014745 | Ga0157377_10253643 | Ga0157377_102536431 | 131 |
| 3 | 3300005467 | Ga0070706_100574692 | Ga0070706_1005746922 | 135 |
| 4 | 3300009147 | Ga0114129_10119539 | Ga0114129_101195392 | 136 |
| 5 | 3300025910 | Ga0207684_10821221 | Ga0207684_108212212 | 136 |
| 6 | 3300050507 | nmdc:mga05p37_1615547_c1 | nmdc:mga05p37_1615547_c1_169_609 | 136 |
| 7 | 3300005367 | Ga0070667_101610485 | Ga0070667_1016104852 | 137 |
| 8 | 3300005444 | Ga0070694_100025784 | Ga0070694_1000257843 | 137 |
| 9 | 3300005468 | Ga0070707_100006727 | Ga0070707_1000067274 | 137 |
| 10 | 3300005545 | Ga0070695_100004612 | Ga0070695_1000046124 | 137 |
| 11 | 3300005618 | Ga0068864_100703804 | Ga0068864_1007038042 | 137 |
| 12 | 3300005841 | Ga0068863_100159932 | Ga0068863_1001599322 | 137 |
| 13 | 3300005842 | Ga0068858_101933202 | Ga0068858_1019332021 | 137 |
| 14 | 3300005843 | Ga0068860_100353595 | Ga0068860_1003535952 | 137 |
| 15 | 3300005844 | Ga0068862_100262401 | Ga0068862_1002624012 | 137 |
| 16 | 3300009147 | Ga0114129_10004265 | Ga0114129_1000426514 | 137 |
| 17 | 3300009553 | Ga0105249_10126564 | Ga0105249_101265642 | 137 |
| 18 | 3300014325 | Ga0163163_10877720 | Ga0163163_108777202 | 137 |
| 19 | 3300025922 | Ga0207646_10019175 | Ga0207646_100191753 | 137 |
| 20 | 3300025961 | Ga0207712_10743491 | Ga0207712_107434911 | 137 |
| 21 | 3300025986 | Ga0207658_11359070 | Ga0207658_113590702 | 137 |
| 22 | 3300026088 | Ga0207641_10055607 | Ga0207641_100556072 | 137 |
| 23 | 3300026095 | Ga0207676_10744398 | Ga0207676_107443981 | 137 |
| 24 | 3300028380 | Ga0268265_10239076 | Ga0268265_102390762 | 137 |
| 25 | 3300028381 | Ga0268264_10102774 | Ga0268264_101027742 | 137 |
| 26 | 3300050507 | nmdc:mga05p37_3145_c1 | nmdc:mga05p37_3145_c1_4393_4833 | 137 |
| 27 | 3300050515 | nmdc:mga0a205_364253_c1 | nmdc:mga0a205_364253_c1_822_1262 | 137 |
| 28 | 3300006852 | Ga0075433_10101960 | Ga0075433_101019602 | 138 |
| 29 | 3300006914 | Ga0075436_100320655 | Ga0075436_1003206552 | 138 |
| 30 | 3300009147 | Ga0114129_10187742 | Ga0114129_101877422 | 138 |
| 31 | 3300035117 | Ga0373953_0257236 | Ga0373953_0257236_71_529 | 138 |
| 32 | 3300035119 | Ga0373956_0363820 | Ga0373956_0363820_78_506 | 138 |
| 33 | 3300035120 | Ga0373957_0270730 | Ga0373957_0270730_71_529 | 138 |
| 34 | 3300035172 | Ga0373955_0071999 | Ga0373955_0071999_556_1014 | 138 |
| 35 | 3300035724 | Ga0373933_0047960 | Ga0373933_0047960_2081_2509 | 138 |
| 36 | 3300035724 | Ga0373933_0060641 | Ga0373933_0060641_132_590 | 138 |
| 37 | 3300036401 | Ga0373937_0016096 | Ga0373937_0016096_3342_3800 | 138 |
| 38 | 3300046454 | Ga0495592_0113869 | Ga0495592_0113869_1409_1837 | 138 |
| 39 | 3300046462 | Ga0495651_0005556 | Ga0495651_0005556_602_1060 | 138 |
| 40 | 3300046462 | Ga0495651_0048384 | Ga0495651_0048384_1568_1996 | 138 |
| 41 | 3300046463 | Ga0495653_0003304 | Ga0495653_0003304_8764_9222 | 138 |
| 42 | 3300046511 | Ga0495608_0001943 | Ga0495608_0001943_7448_7906 | 138 |
| 43 | 3300046511 | Ga0495608_0123941 | Ga0495608_0123941_103_531 | 138 |
| 44 | 3300046529 | Ga0495652_0003238 | Ga0495652_0003238_4321_4779 | 138 |
| 45 | 3300046529 | Ga0495652_0036919 | Ga0495652_0036919_1878_2306 | 138 |
| 46 | 3300046536 | Ga0495587_0009943 | Ga0495587_0009943_4809_5267 | 138 |
| 47 | 3300046543 | Ga0495645_0027140 | Ga0495645_0027140_2064_2522 | 138 |
| 48 | 3300046559 | Ga0495667_0002735 | Ga0495667_0002735_4307_4765 | 138 |
| 49 | 3300046559 | Ga0495667_0086718 | Ga0495667_0086718_745_1173 | 138 |
| 50 | 3300046663 | Ga0495635_0015163 | Ga0495635_0015163_599_1057 | 138 |
| 51 | 3300046675 | Ga0495657_0001156 | Ga0495657_0001156_15764_16222 | 138 |
| 52 | 3300046675 | Ga0495657_0123220 | Ga0495657_0123220_966_1394 | 138 |
| 53 | 3300046678 | Ga0495599_0490094 | Ga0495599_0490094_57_515 | 138 |
| 54 | 3300046678 | Ga0495599_0589901 | Ga0495599_0589901_162_590 | 138 |
| 55 | 3300046679 | Ga0495623_0164994 | Ga0495623_0164994_175_633 | 138 |
| 56 | 3300046809 | Ga0495600_0010984 | Ga0495600_0010984_875_1333 | 138 |
| 57 | 3300047317 | Ga0495604_0003904 | Ga0495604_0003904_7975_8433 | 138 |
| 58 | 3300047319 | Ga0495674_0012283 | Ga0495674_0012283_3778_4236 | 138 |
| 59 | 3300047322 | Ga0495680_0002785 | Ga0495680_0002785_9852_10310 | 138 |
| 60 | 3300047444 | Ga0495675_0007432 | Ga0495675_0007432_4275_4733 | 138 |
| 61 | 3300047471 | Ga0495684_0012913 | Ga0495684_0012913_1937_2395 | 138 |
| 62 | 3300047471 | Ga0495684_0606521 | Ga0495684_0606521_159_587 | 138 |
| 63 | 3300048088 | Ga0495602_0063732 | Ga0495602_0063732_2156_2614 | 138 |
| 64 | 3300050507 | nmdc:mga05p37_474218_c1 | nmdc:mga05p37_474218_c1_333_788 | 138 |
| 65 | 3300053077 | Ga0495601_0031035 | Ga0495601_0031035_2207_2665 | 138 |
| 66 | 3300053085 | Ga0495619_0006543 | Ga0495619_0006543_6889_7347 | 138 |
| 67 | iso_pu_bacteria | 2617270889 | 2617917190 | 138 |
| 68 | iso_pu_bacteria | 2841911363 | 2841915318 | 138 |
| 69 | iso_pu_bacteria | 2841917233 | 2841922215 | 138 |
| 70 | iso_pu_bacteria | 2913844669 | 2913845009 | 138 |
| 71 | iso_pu_bacteria | 2913939268 | 2913941746 | 138 |
| 72 | iso_pu_bacteria | 642555144 | 642602656 | 138 |
| 73 | 3300006914 | Ga0075436_100100568 | Ga0075436_1001005682 | 139 |
| 74 | 3300007076 | Ga0075435_100061547 | Ga0075435_1000615472 | 139 |
| 75 | 3300009147 | Ga0114129_11636456 | Ga0114129_116364562 | 139 |
| 76 | 3300031730 | Ga0307516_10116148 | Ga0307516_101161482 | 139 |
| 77 | 3300041486 | Ga0451807_2214409 | Ga0451807_2214409_95_514 | 139 |
| 78 | 3300044673 | Ga0453683_0925856 | Ga0453683_0925856_73_498 | 139 |
| 79 | 3300045051 | Ga0451576_0045719 | Ga0451576_0045719_2389_2832 | 139 |
| 80 | 3300045051 | Ga0451576_0085907 | Ga0451576_0085907_312_737 | 139 |
| 81 | 3300050512 | nmdc:mga0n895_308615_c1 | nmdc:mga0n895_308615_c1_271_717 | 139 |
| 82 | 3300050513 | nmdc:mga0rr50_47972_c1 | nmdc:mga0rr50_47972_c1_147_593 | 139 |
| 83 | 3300050514 | nmdc:mga08x19_124016_c1 | nmdc:mga08x19_124016_c1_998_1444 | 139 |
| 84 | 3300050515 | nmdc:mga0a205_58053_c1 | nmdc:mga0a205_58053_c1_3156_3602 | 139 |
| 85 | 3300005536 | Ga0070697_100060178 | Ga0070697_1000601782 | 140 |
| 86 | 3300038443 | Ga0395901_0001208 | Ga0395901_0001208_16250_16678 | 140 |
| 87 | 3300044765 | Ga0466970_0149126 | Ga0466970_0149126_828_1253 | 140 |
| 88 | 3300045049 | Ga0466959_0111800 | Ga0466959_0111800_159_584 | 140 |
| 89 | 3300049588 | Ga0501072_0005594 | Ga0501072_0005594_1850_2290 | 140 |
| 90 | 3300050507 | nmdc:mga05p37_1232802_c1 | nmdc:mga05p37_1232802_c1_222_644 | 140 |
| 91 | 3300005337 | Ga0070682_100845096 | Ga0070682_1008450961 | 141 |
| 92 | 3300005438 | Ga0070701_10284503 | Ga0070701_102845032 | 141 |
| 93 | 3300005445 | Ga0070708_100109706 | Ga0070708_1001097062 | 141 |
| 94 | 3300005455 | Ga0070663_100002871 | Ga0070663_1000028712 | 141 |
| 95 | 3300005467 | Ga0070706_100035602 | Ga0070706_1000356022 | 141 |
| 96 | 3300005471 | Ga0070698_100000159 | Ga0070698_1000001592 | 141 |
| 97 | 3300005548 | Ga0070665_100147202 | Ga0070665_1001472023 | 141 |
| 98 | 3300005615 | Ga0070702_100159068 | Ga0070702_1001590682 | 141 |
| 99 | 3300006844 | Ga0075428_100051489 | Ga0075428_1000514895 | 141 |
| 100 | 3300014325 | Ga0163163_10149914 | Ga0163163_101499143 | 141 |
| 101 | 3300025910 | Ga0207684_10008739 | Ga0207684_100087397 | 141 |
| 102 | 3300026067 | Ga0207678_10007177 | Ga0207678_1000717712 | 141 |
| 103 | 3300035091 | Ga0373951_0125100 | Ga0373951_0125100_117_548 | 141 |
| 104 | 3300044658 | Ga0466972_0010970 | Ga0466972_0010970_422_871 | 141 |
| 105 | 3300044735 | Ga0466968_0014455 | Ga0466968_0014455_1868_2317 | 141 |
| 106 | 3300044901 | Ga0466960_0008293 | Ga0466960_0008293_578_1027 | 141 |
| 107 | 3300049589 | Ga0501073_0822535 | Ga0501073_0822535_92_517 | 141 |
| 108 | 3300049654 | Ga0501207_080398 | Ga0501207_080398_121_546 | 141 |
| 109 | 3300049673 | Ga0501240_023486 | Ga0501240_023486_67_492 | 141 |
| 110 | iso_pu_bacteria | 2848694841 | 2848697416 | 141 |
| 111 | iso_pu_bacteria | 2849660919 | 2849661278 | 141 |
| 112 | iso_pu_bacteria | 2883291878 | 2883292243 | 141 |
| 113 | iso_pu_bacteria | 2883354860 | 2883355243 | 141 |
| 114 | 3300003320 | rootH2_10031699 | rootH2_100316992 | 142 |
| 115 | 3300005546 | Ga0070696_101167491 | Ga0070696_1011674911 | 142 |
| 116 | 3300005577 | Ga0068857_100565374 | Ga0068857_1005653742 | 142 |
| 117 | 3300026116 | Ga0207674_10620773 | Ga0207674_106207732 | 142 |
| 118 | 3300035111 | Ga0373923_0030406 | Ga0373923_0030406_713_1141 | 142 |
| 119 | 3300036401 | Ga0373937_0458987 | Ga0373937_0458987_750_1178 | 142 |
| 120 | 3300046616 | Ga0495668_0605885 | Ga0495668_0605885_13_444 | 142 |
| 121 | 3300031238 | Ga0265332_10086329 | Ga0265332_100863292 | 143 |
| 122 | 3300031241 | Ga0265325_10038957 | Ga0265325_100389572 | 143 |
| 123 | 3300031247 | Ga0265340_10019758 | Ga0265340_100197582 | 143 |
| 124 | 3300031344 | Ga0265316_10195582 | Ga0265316_101955822 | 143 |
| 125 | 3300031595 | Ga0265313_10038587 | Ga0265313_100385872 | 143 |
| 126 | 3300031712 | Ga0265342_10470479 | Ga0265342_104704792 | 143 |
| 127 | 3300048917 | Ga0496114_0550779 | Ga0496114_0550779_351_785 | 143 |
| 128 | 3300049591 | Ga0501075_0082560 | Ga0501075_0082560_377_817 | 143 |
| 129 | 3300049742 | Ga0501080_0683659 | Ga0501080_0683659_384_824 | 143 |
| 130 | 3300049744 | Ga0501083_0012288 | Ga0501083_0012288_1236_1673 | 143 |
| 131 | 3300061734 | Ga0530510_0927639 | Ga0530510_0927639_180_620 | 143 |
| 132 | iso_pu_bacteria | 2831426010 | 2831426739 | 143 |
| 133 | 3300003316 | rootH1_10134343 | rootH1_101343432 | 144 |
| 134 | 3300003320 | rootH2_10003759 | rootH2_100037591 | 144 |
| 135 | 3300003322 | rootL2_10069044 | rootL2_100690444 | 144 |
| 136 | 3300003322 | rootL2_10154203 | rootL2_101542032 | 144 |
| 137 | 3300005327 | Ga0070658_10095322 | Ga0070658_100953222 | 144 |
| 138 | 3300005444 | Ga0070694_100068686 | Ga0070694_1000686862 | 144 |
| 139 | 3300005458 | Ga0070681_10056226 | Ga0070681_100562264 | 144 |
| 140 | 3300005471 | Ga0070698_101100970 | Ga0070698_1011009702 | 144 |
| 141 | 3300005518 | Ga0070699_101841445 | Ga0070699_1018414451 | 144 |
| 142 | 3300006195 | Ga0075366_10337066 | Ga0075366_103370661 | 144 |
| 143 | 3300006195 | Ga0075366_10353012 | Ga0075366_103530122 | 144 |
| 144 | 3300006358 | Ga0068871_100166861 | Ga0068871_1001668612 | 144 |
| 145 | 3300009093 | Ga0105240_10001610 | Ga0105240_1000161018 | 144 |
| 146 | 3300009147 | Ga0114129_10715980 | Ga0114129_107159803 | 144 |
| 147 | 3300009176 | Ga0105242_11043739 | Ga0105242_110437392 | 144 |
| 148 | 3300009545 | Ga0105237_10001240 | Ga0105237_1000124011 | 144 |
| 149 | 3300013296 | Ga0157374_10000028 | Ga0157374_10000028124 | 144 |
| 150 | 3300013306 | Ga0163162_11614973 | Ga0163162_116149732 | 144 |
| 151 | 3300014969 | Ga0157376_10001656 | Ga0157376_100016563 | 144 |
| 152 | 3300025909 | Ga0207705_10129660 | Ga0207705_101296602 | 144 |
| 153 | 3300025912 | Ga0207707_10126924 | Ga0207707_101269242 | 144 |
| 154 | 3300026067 | Ga0207678_11358721 | Ga0207678_113587212 | 144 |
| 155 | 3300031241 | Ga0265325_10232646 | Ga0265325_102326461 | 144 |
| 156 | 3300031730 | Ga0307516_10080566 | Ga0307516_100805662 | 144 |
| 157 | 3300039438 | Ga0436360_0819779 | Ga0436360_0819779_602_1042 | 144 |
| 158 | 3300041512 | Ga0451853_1741855 | Ga0451853_1741855_250_684 | 144 |
| 159 | 3300044673 | Ga0453683_0001962 | Ga0453683_0001962_9923_10360 | 144 |
| 160 | 3300044706 | Ga0466964_0020565 | Ga0466964_0020565_1922_2431 | 144 |
| 161 | 3300044712 | Ga0453684_1494637 | Ga0453684_1494637_116_553 | 144 |
| 162 | 3300044719 | Ga0466971_0000045 | Ga0466971_0000045_29990_30433 | 144 |
| 163 | 3300044842 | Ga0466957_0009239 | Ga0466957_0009239_1977_2486 | 144 |
| 164 | 3300044901 | Ga0466960_0307868 | Ga0466960_0307868_71_514 | 144 |
| 165 | 3300045051 | Ga0451576_0472624 | Ga0451576_0472624_285_722 | 144 |
| 166 | 3300045976 | Ga0466967_0077361 | Ga0466967_0077361_2205_2648 | 144 |
| 167 | 3300046535 | Ga0495586_0427936 | Ga0495586_0427936_108_542 | 144 |
| 168 | 3300046674 | Ga0495588_0029584 | Ga0495588_0029584_1303_1746 | 144 |
| 169 | 3300049570 | Ga0501033_0000049 | Ga0501033_0000049_1957_2400 | 144 |
| 170 | 3300049570 | Ga0501033_0000057 | Ga0501033_0000057_17824_18270 | 144 |
| 171 | 3300049574 | Ga0501038_0001276 | Ga0501038_0001276_1283_1726 | 144 |
| 172 | 3300049574 | Ga0501038_0008875 | Ga0501038_0008875_2753_3199 | 144 |
| 173 | 3300049590 | Ga0501074_0509032 | Ga0501074_0509032_198_641 | 144 |
| 174 | 3300050493 | nmdc:mga0k408_467382_c1 | nmdc:mga0k408_467382_c1_222_665 | 144 |
| 175 | 3300054114 | Ga0501084_0959507 | Ga0501084_0959507_192_626 | 144 |
| 176 | 3300060353 | Ga0501082_0646995 | Ga0501082_0646995_78_542 | 144 |
| 177 | 3300061719 | Ga0466962_0000052 | Ga0466962_0000052_25193_25636 | 144 |
| 178 | 3300003320 | rootH2_10023036 | rootH2_100230365 | 145 |
| 179 | 3300005289 | Ga0065704_10300019 | Ga0065704_103000192 | 145 |
| 180 | 3300005328 | Ga0070676_10905241 | Ga0070676_109052412 | 145 |
| 181 | 3300005334 | Ga0068869_100070567 | Ga0068869_1000705671 | 145 |
| 182 | 3300005336 | Ga0070680_100507777 | Ga0070680_1005077771 | 145 |
| 183 | 3300005336 | Ga0070680_100806192 | Ga0070680_1008061922 | 145 |
| 184 | 3300005338 | Ga0068868_100087548 | Ga0068868_1000875482 | 145 |
| 185 | 3300005343 | Ga0070687_100775255 | Ga0070687_1007752552 | 145 |
| 186 | 3300005345 | Ga0070692_10064723 | Ga0070692_100647232 | 145 |
| 187 | 3300005353 | Ga0070669_100652807 | Ga0070669_1006528072 | 145 |
| 188 | 3300005366 | Ga0070659_100287673 | Ga0070659_1002876732 | 145 |
| 189 | 3300005445 | Ga0070708_100577982 | Ga0070708_1005779822 | 145 |
| 190 | 3300005458 | Ga0070681_10177632 | Ga0070681_101776322 | 145 |
| 191 | 3300005458 | Ga0070681_10443931 | Ga0070681_104439312 | 145 |
| 192 | 3300005467 | Ga0070706_100029600 | Ga0070706_1000296004 | 145 |
| 193 | 3300005468 | Ga0070707_100005445 | Ga0070707_1000054453 | 145 |
| 194 | 3300005471 | Ga0070698_100006995 | Ga0070698_1000069953 | 145 |
| 195 | 3300005471 | Ga0070698_100012179 | Ga0070698_1000121793 | 145 |
| 196 | 3300005518 | Ga0070699_100042128 | Ga0070699_1000421284 | 145 |
| 197 | 3300005518 | Ga0070699_100584026 | Ga0070699_1005840262 | 145 |
| 198 | 3300005530 | Ga0070679_100019312 | Ga0070679_1000193123 | 145 |
| 199 | 3300005535 | Ga0070684_100253455 | Ga0070684_1002534552 | 145 |
| 200 | 3300005536 | Ga0070697_100025272 | Ga0070697_1000252722 | 145 |
| 201 | 3300005536 | Ga0070697_100441933 | Ga0070697_1004419332 | 145 |
| 202 | 3300005549 | Ga0070704_101089382 | Ga0070704_1010893821 | 145 |
| 203 | 3300005563 | Ga0068855_100787229 | Ga0068855_1007872292 | 145 |
| 204 | 3300005577 | Ga0068857_100233635 | Ga0068857_1002336353 | 145 |
| 205 | 3300005577 | Ga0068857_101318363 | Ga0068857_1013183631 | 145 |
| 206 | 3300005614 | Ga0068856_100099132 | Ga0068856_1000991322 | 145 |
| 207 | 3300005614 | Ga0068856_100100973 | Ga0068856_1001009733 | 145 |
| 208 | 3300005617 | Ga0068859_100158455 | Ga0068859_1001584552 | 145 |
| 209 | 3300005842 | Ga0068858_100785077 | Ga0068858_1007850772 | 145 |
| 210 | 3300005937 | Ga0081455_10786604 | Ga0081455_107866042 | 145 |
| 211 | 3300005981 | Ga0081538_10006389 | Ga0081538_1000638912 | 145 |
| 212 | 3300005981 | Ga0081538_10032285 | Ga0081538_100322852 | 145 |
| 213 | 3300006237 | Ga0097621_100626858 | Ga0097621_1006268581 | 145 |
| 214 | 3300006358 | Ga0068871_101578036 | Ga0068871_1015780361 | 145 |
| 215 | 3300006852 | Ga0075433_10411478 | Ga0075433_104114782 | 145 |
| 216 | 3300006871 | Ga0075434_100113024 | Ga0075434_1001130243 | 145 |
| 217 | 3300006931 | Ga0097620_100158459 | Ga0097620_1001584592 | 145 |
| 218 | 3300009093 | Ga0105240_11260220 | Ga0105240_112602202 | 145 |
| 219 | 3300009094 | Ga0111539_10340969 | Ga0111539_103409692 | 145 |
| 220 | 3300009098 | Ga0105245_10000203 | Ga0105245_100002036 | 145 |
| 221 | 3300009147 | Ga0114129_10148532 | Ga0114129_101485322 | 145 |
| 222 | 3300009147 | Ga0114129_10165522 | Ga0114129_101655222 | 145 |
| 223 | 3300009147 | Ga0114129_10281935 | Ga0114129_102819353 | 145 |
| 224 | 3300009545 | Ga0105237_10242316 | Ga0105237_102423163 | 145 |
| 225 | 3300009545 | Ga0105237_10784921 | Ga0105237_107849212 | 145 |
| 226 | 3300009551 | Ga0105238_12205065 | Ga0105238_122050652 | 145 |
| 227 | 3300010375 | Ga0105239_10129732 | Ga0105239_101297323 | 145 |
| 228 | 3300010375 | Ga0105239_10193765 | Ga0105239_101937652 | 145 |
| 229 | 3300013296 | Ga0157374_10343043 | Ga0157374_103430432 | 145 |
| 230 | 3300014326 | Ga0157380_11158810 | Ga0157380_111588101 | 145 |
| 231 | 3300014969 | Ga0157376_10027362 | Ga0157376_100273623 | 145 |
| 232 | 3300025907 | Ga0207645_10549811 | Ga0207645_105498112 | 145 |
| 233 | 3300025910 | Ga0207684_10017912 | Ga0207684_100179122 | 145 |
| 234 | 3300025914 | Ga0207671_10476299 | Ga0207671_104762991 | 145 |
| 235 | 3300025917 | Ga0207660_11622644 | Ga0207660_116226441 | 145 |
| 236 | 3300025921 | Ga0207652_10034976 | Ga0207652_100349762 | 145 |
| 237 | 3300025922 | Ga0207646_10003462 | Ga0207646_100034625 | 145 |
| 238 | 3300025924 | Ga0207694_10080606 | Ga0207694_100806062 | 145 |
| 239 | 3300025927 | Ga0207687_10001086 | Ga0207687_1000108612 | 145 |
| 240 | 3300025932 | Ga0207690_10247374 | Ga0207690_102473741 | 145 |
| 241 | 3300025942 | Ga0207689_10192761 | Ga0207689_101927612 | 145 |
| 242 | 3300025944 | Ga0207661_10095658 | Ga0207661_100956583 | 145 |
| 243 | 3300025949 | Ga0207667_11239583 | Ga0207667_112395832 | 145 |
| 244 | 3300026023 | Ga0207677_10112166 | Ga0207677_101121662 | 145 |
| 245 | 3300026023 | Ga0207677_11389879 | Ga0207677_113898791 | 145 |
| 246 | 3300026078 | Ga0207702_10032344 | Ga0207702_100323444 | 145 |
| 247 | 3300026078 | Ga0207702_10224987 | Ga0207702_102249872 | 145 |
| 248 | 3300026088 | Ga0207641_11415775 | Ga0207641_114157751 | 145 |
| 249 | 3300026116 | Ga0207674_10276669 | Ga0207674_102766692 | 145 |
| 250 | 3300026116 | Ga0207674_10730158 | Ga0207674_107301581 | 145 |
| 251 | 3300031456 | Ga0307513_10006699 | Ga0307513_100066999 | 145 |
| 252 | 3300031507 | Ga0307509_10001290 | Ga0307509_1000129045 | 145 |
| 253 | 3300031616 | Ga0307508_10131554 | Ga0307508_101315542 | 145 |
| 254 | 3300031711 | Ga0265314_10175595 | Ga0265314_101755952 | 145 |
| 255 | 3300031731 | Ga0307405_10405214 | Ga0307405_104052142 | 145 |
| 256 | 3300032002 | Ga0307416_102059168 | Ga0307416_1020591681 | 145 |
| 257 | 3300035090 | Ga0373949_0000884 | Ga0373949_0000884_3026_3463 | 145 |
| 258 | 3300037312 | Ga0395899_0002535 | Ga0395899_0002535_11429_11866 | 145 |
| 259 | 3300037466 | Ga0395898_0714121 | Ga0395898_0714121_306_743 | 145 |
| 260 | 3300037471 | Ga0395905_0261352 | Ga0395905_0261352_652_1089 | 145 |
| 261 | 3300037471 | Ga0395905_0884818 | Ga0395905_0884818_29_466 | 145 |
| 262 | 3300038705 | Ga0237819_17348 | Ga0237819_17348_255_698 | 145 |
| 263 | 3300044658 | Ga0466972_0366054 | Ga0466972_0366054_88_525 | 145 |
| 264 | 3300044673 | Ga0453683_0211231 | Ga0453683_0211231_715_1155 | 145 |
| 265 | 3300044693 | Ga0466961_0575191 | Ga0466961_0575191_58_501 | 145 |
| 266 | 3300044712 | Ga0453684_0012865 | Ga0453684_0012865_2228_2665 | 145 |
| 267 | 3300044712 | Ga0453684_0025189 | Ga0453684_0025189_2486_2935 | 145 |
| 268 | 3300044712 | Ga0453684_0830088 | Ga0453684_0830088_447_884 | 145 |
| 269 | 3300044712 | Ga0453684_1033348 | Ga0453684_1033348_349_786 | 145 |
| 270 | 3300045051 | Ga0451576_0016323 | Ga0451576_0016323_930_1367 | 145 |
| 271 | 3300045836 | Ga0466958_0823882 | Ga0466958_0823882_132_575 | 145 |
| 272 | 3300046471 | Ga0495650_0020245 | Ga0495650_0020245_1092_1529 | 145 |
| 273 | 3300046539 | Ga0495621_0005591 | Ga0495621_0005591_1907_2344 | 145 |
| 274 | 3300046664 | Ga0495659_0122722 | Ga0495659_0122722_247_687 | 145 |
| 275 | 3300048909 | Ga0496106_1371746 | Ga0496106_1371746_18_464 | 145 |
| 276 | 3300048911 | Ga0496108_0711884 | Ga0496108_0711884_313_759 | 145 |
| 277 | 3300048912 | Ga0496109_0292655 | Ga0496109_0292655_973_1419 | 145 |
| 278 | 3300049571 | Ga0501034_0394729 | Ga0501034_0394729_94_531 | 145 |
| 279 | 3300049589 | Ga0501073_0012098 | Ga0501073_0012098_536_973 | 145 |
| 280 | 3300049592 | Ga0501076_0119301 | Ga0501076_0119301_746_1192 | 145 |
| 281 | 3300049656 | Ga0501209_198446 | Ga0501209_198446_136_573 | 145 |
| 282 | 3300049665 | Ga0501227_018133 | Ga0501227_018133_72_509 | 145 |
| 283 | 3300049741 | Ga0501079_0984639 | Ga0501079_0984639_112_600 | 145 |
| 284 | 3300049742 | Ga0501080_0013488 | Ga0501080_0013488_4219_4656 | 145 |
| 285 | 3300049742 | Ga0501080_1173224 | Ga0501080_1173224_65_502 | 145 |
| 286 | 3300049742 | Ga0501080_1410921 | Ga0501080_1410921_96_533 | 145 |
| 287 | 3300050507 | nmdc:mga05p37_32319_c1 | nmdc:mga05p37_32319_c1_299_739 | 145 |
| 288 | 3300050507 | nmdc:mga05p37_388086_c1 | nmdc:mga05p37_388086_c1_626_1063 | 145 |
| 289 | 3300050509 | nmdc:mga0qj67_16521_c1 | nmdc:mga0qj67_16521_c1_3005_3442 | 145 |
| 290 | 3300050511 | nmdc:mga08y16_946986_c1 | nmdc:mga08y16_946986_c1_137_574 | 145 |
| 291 | 3300050512 | nmdc:mga0n895_46388_c1 | nmdc:mga0n895_46388_c1_3471_3911 | 145 |
| 292 | 3300050515 | nmdc:mga0a205_1076045_c1 | nmdc:mga0a205_1076045_c1_194_640 | 145 |
| 293 | 3300050515 | nmdc:mga0a205_335009_c1 | nmdc:mga0a205_335009_c1_830_1270 | 145 |
| 294 | 3300053102 | Ga0500554_163651 | Ga0500554_163651_216_653 | 145 |
| 295 | 3300060353 | Ga0501082_0031105 | Ga0501082_0031105_755_1192 | 145 |
| 296 | 3300005290 | Ga0065712_10261696 | Ga0065712_102616962 | 146 |
| 297 | 3300005295 | Ga0065707_10011144 | Ga0065707_100111443 | 146 |
| 298 | 3300005336 | Ga0070680_100256130 | Ga0070680_1002561301 | 146 |
| 299 | 3300005341 | Ga0070691_10185361 | Ga0070691_101853611 | 146 |
| 300 | 3300005353 | Ga0070669_100262039 | Ga0070669_1002620392 | 146 |
| 301 | 3300005354 | Ga0070675_100070281 | Ga0070675_1000702812 | 146 |
| 302 | 3300005364 | Ga0070673_100039571 | Ga0070673_1000395712 | 146 |
| 303 | 3300005365 | Ga0070688_101038989 | Ga0070688_1010389891 | 146 |
| 304 | 3300005367 | Ga0070667_101038769 | Ga0070667_1010387692 | 146 |
| 305 | 3300005444 | Ga0070694_100281988 | Ga0070694_1002819882 | 146 |
| 306 | 3300005456 | Ga0070678_100104448 | Ga0070678_1001044483 | 146 |
| 307 | 3300005457 | Ga0070662_101081656 | Ga0070662_1010816562 | 146 |
| 308 | 3300005459 | Ga0068867_100517529 | Ga0068867_1005175292 | 146 |
| 309 | 3300005471 | Ga0070698_100000058 | Ga0070698_10000005864 | 146 |
| 310 | 3300005518 | Ga0070699_101661113 | Ga0070699_1016611131 | 146 |
| 311 | 3300005544 | Ga0070686_100186124 | Ga0070686_1001861242 | 146 |
| 312 | 3300005546 | Ga0070696_100006626 | Ga0070696_1000066262 | 146 |
| 313 | 3300005546 | Ga0070696_100148401 | Ga0070696_1001484012 | 146 |
| 314 | 3300005549 | Ga0070704_100527426 | Ga0070704_1005274262 | 146 |
| 315 | 3300005549 | Ga0070704_101437679 | Ga0070704_1014376791 | 146 |
| 316 | 3300005841 | Ga0068863_100976500 | Ga0068863_1009765002 | 146 |
| 317 | 3300006844 | Ga0075428_100137213 | Ga0075428_1001372132 | 146 |
| 318 | 3300006844 | Ga0075428_101561540 | Ga0075428_1015615403 | 146 |
| 319 | 3300006846 | Ga0075430_100082327 | Ga0075430_1000823273 | 146 |
| 320 | 3300006847 | Ga0075431_100021729 | Ga0075431_1000217294 | 146 |
| 321 | 3300006847 | Ga0075431_101372186 | Ga0075431_1013721862 | 146 |
| 322 | 3300006852 | Ga0075433_10161733 | Ga0075433_101617332 | 146 |
| 323 | 3300006871 | Ga0075434_100032062 | Ga0075434_1000320625 | 146 |
| 324 | 3300006880 | Ga0075429_100008724 | Ga0075429_1000087245 | 146 |
| 325 | 3300006880 | Ga0075429_100141214 | Ga0075429_1001412141 | 146 |
| 326 | 3300009094 | Ga0111539_10004059 | Ga0111539_100040596 | 146 |
| 327 | 3300009094 | Ga0111539_10009670 | Ga0111539_100096703 | 146 |
| 328 | 3300009147 | Ga0114129_10467730 | Ga0114129_104677302 | 146 |
| 329 | 3300009147 | Ga0114129_11730058 | Ga0114129_117300581 | 146 |
| 330 | 3300009148 | Ga0105243_10362188 | Ga0105243_103621882 | 146 |
| 331 | 3300009177 | Ga0105248_10423508 | Ga0105248_104235083 | 146 |
| 332 | 3300009553 | Ga0105249_10254733 | Ga0105249_102547332 | 146 |
| 333 | 3300010375 | Ga0105239_10028309 | Ga0105239_100283095 | 146 |
| 334 | 3300013308 | Ga0157375_10636180 | Ga0157375_106361801 | 146 |
| 335 | 3300014326 | Ga0157380_10186155 | Ga0157380_101861552 | 146 |
| 336 | 3300014326 | Ga0157380_12391862 | Ga0157380_123918621 | 146 |
| 337 | 3300015262 | Ga0182007_10135009 | Ga0182007_101350091 | 146 |
| 338 | 3300021384 | Ga0213876_10515916 | Ga0213876_105159161 | 146 |
| 339 | 3300025903 | Ga0207680_10187301 | Ga0207680_101873012 | 146 |
| 340 | 3300025904 | Ga0207647_10437103 | Ga0207647_104371032 | 146 |
| 341 | 3300025922 | Ga0207646_11606165 | Ga0207646_116061652 | 146 |
| 342 | 3300025933 | Ga0207706_10287247 | Ga0207706_102872472 | 146 |
| 343 | 3300025935 | Ga0207709_10182279 | Ga0207709_101822792 | 146 |
| 344 | 3300025936 | Ga0207670_10562434 | Ga0207670_105624342 | 146 |
| 345 | 3300025940 | Ga0207691_10047581 | Ga0207691_100475813 | 146 |
| 346 | 3300025941 | Ga0207711_10739985 | Ga0207711_107399852 | 146 |
| 347 | 3300025961 | Ga0207712_10353856 | Ga0207712_103538562 | 146 |
| 348 | 3300025961 | Ga0207712_10597378 | Ga0207712_105973781 | 146 |
| 349 | 3300025986 | Ga0207658_10284534 | Ga0207658_102845342 | 146 |
| 350 | 3300026075 | Ga0207708_10202845 | Ga0207708_102028452 | 146 |
| 351 | 3300026089 | Ga0207648_10144945 | Ga0207648_101449452 | 146 |
| 352 | 3300026121 | Ga0207683_10089802 | Ga0207683_100898023 | 146 |
| 353 | 3300027907 | Ga0207428_10016855 | Ga0207428_100168554 | 146 |
| 354 | 3300028380 | Ga0268265_11166881 | Ga0268265_111668812 | 146 |
| 355 | 3300028800 | Ga0265338_10159423 | Ga0265338_101594232 | 146 |
| 356 | 3300028800 | Ga0265338_10567933 | Ga0265338_105679331 | 146 |
| 357 | 3300031241 | Ga0265325_10030965 | Ga0265325_100309651 | 146 |
| 358 | 3300031247 | Ga0265340_10148660 | Ga0265340_101486601 | 146 |
| 359 | 3300031250 | Ga0265331_10033079 | Ga0265331_100330792 | 146 |
| 360 | 3300031344 | Ga0265316_10008443 | Ga0265316_100084435 | 146 |
| 361 | 3300031711 | Ga0265314_10004796 | Ga0265314_100047964 | 146 |
| 362 | 3300032133 | Ga0316583_10000170 | Ga0316583_1000017011 | 146 |
| 363 | 3300035724 | Ga0373933_0116647 | Ga0373933_0116647_420_860 | 146 |
| 364 | 3300037471 | Ga0395905_1099164 | Ga0395905_1099164_148_591 | 146 |
| 365 | 3300037853 | Ga0436364_1369666 | Ga0436364_1369666_1672_2112 | 146 |
| 366 | 3300039437 | Ga0436365_1922161 | Ga0436365_1922161_64_504 | 146 |
| 367 | 3300042876 | Ga0451577_0187282 | Ga0451577_0187282_82_522 | 146 |
| 368 | 3300042876 | Ga0451577_0216403 | Ga0451577_0216403_242_691 | 146 |
| 369 | 3300042876 | Ga0451577_0507438 | Ga0451577_0507438_558_998 | 146 |
| 370 | 3300044673 | Ga0453683_0000852 | Ga0453683_0000852_803_1246 | 146 |
| 371 | 3300044712 | Ga0453684_0488900 | Ga0453684_0488900_762_1202 | 146 |
| 372 | 3300044712 | Ga0453684_0637993 | Ga0453684_0637993_535_975 | 146 |
| 373 | 3300045051 | Ga0451576_0174098 | Ga0451576_0174098_1333_1773 | 146 |
| 374 | 3300046516 | Ga0495628_0222364 | Ga0495628_0222364_608_1051 | 146 |
| 375 | 3300046517 | Ga0495630_0031225 | Ga0495630_0031225_1403_1843 | 146 |
| 376 | 3300046537 | Ga0495598_0032659 | Ga0495598_0032659_998_1441 | 146 |
| 377 | 3300046543 | Ga0495645_0013858 | Ga0495645_0013858_2613_3056 | 146 |
| 378 | 3300047318 | Ga0495636_0020776 | Ga0495636_0020776_216_659 | 146 |
| 379 | 3300049568 | Ga0501031_0000053 | Ga0501031_0000053_30168_30617 | 146 |
| 380 | 3300049568 | Ga0501031_0000383 | Ga0501031_0000383_7675_8121 | 146 |
| 381 | 3300049569 | Ga0501032_0024208 | Ga0501032_0024208_1077_1523 | 146 |
| 382 | 3300049571 | Ga0501034_0162941 | Ga0501034_0162941_311_751 | 146 |
| 383 | 3300049572 | Ga0501036_0008961 | Ga0501036_0008961_4501_4950 | 146 |
| 384 | 3300049572 | Ga0501036_0091278 | Ga0501036_0091278_725_1165 | 146 |
| 385 | 3300049572 | Ga0501036_0152311 | Ga0501036_0152311_998_1444 | 146 |
| 386 | 3300049573 | Ga0501037_0940642 | Ga0501037_0940642_36_476 | 146 |
| 387 | 3300049574 | Ga0501038_0128109 | Ga0501038_0128109_867_1313 | 146 |
| 388 | 3300049574 | Ga0501038_0154658 | Ga0501038_0154658_477_917 | 146 |
| 389 | 3300049574 | Ga0501038_0227861 | Ga0501038_0227861_240_689 | 146 |
| 390 | 3300049575 | Ga0501039_0000217 | Ga0501039_0000217_29540_29986 | 146 |
| 391 | 3300049575 | Ga0501039_0000405 | Ga0501039_0000405_20806_21255 | 146 |
| 392 | 3300049575 | Ga0501039_0008472 | Ga0501039_0008472_6216_6656 | 146 |
| 393 | 3300049579 | Ga0501043_0002182 | Ga0501043_0002182_6407_6856 | 146 |
| 394 | 3300049579 | Ga0501043_0002351 | Ga0501043_0002351_15335_15781 | 146 |
| 395 | 3300049579 | Ga0501043_0003769 | Ga0501043_0003769_6415_6864 | 146 |
| 396 | 3300049581 | Ga0501047_0004689 | Ga0501047_0004689_9605_10051 | 146 |
| 397 | 3300049581 | Ga0501047_0079423 | Ga0501047_0079423_113_562 | 146 |
| 398 | 3300049581 | Ga0501047_0574448 | Ga0501047_0574448_211_651 | 146 |
| 399 | 3300049582 | Ga0501048_0566636 | Ga0501048_0566636_124_564 | 146 |
| 400 | 3300049584 | Ga0501068_0232096 | Ga0501068_0232096_396_845 | 146 |
| 401 | 3300049584 | Ga0501068_0290122 | Ga0501068_0290122_98_544 | 146 |
| 402 | 3300049586 | Ga0501070_0000696 | Ga0501070_0000696_24642_25091 | 146 |
| 403 | 3300049586 | Ga0501070_0048386 | Ga0501070_0048386_1745_2191 | 146 |
| 404 | 3300049588 | Ga0501072_0028489 | Ga0501072_0028489_2995_3435 | 146 |
| 405 | 3300049591 | Ga0501075_0105565 | Ga0501075_0105565_1255_1695 | 146 |
| 406 | 3300049592 | Ga0501076_0098357 | Ga0501076_0098357_910_1350 | 146 |
| 407 | 3300049742 | Ga0501080_0014976 | Ga0501080_0014976_2153_2593 | 146 |
| 408 | 3300049742 | Ga0501080_0958643 | Ga0501080_0958643_163_609 | 146 |
| 409 | 3300049743 | Ga0501081_0456408 | Ga0501081_0456408_459_899 | 146 |
| 410 | 3300049822 | Ga0501035_0000001 | Ga0501035_0000001_26342_26788 | 146 |
| 411 | 3300049822 | Ga0501035_0000001 | Ga0501035_0000001_428324_428773 | 146 |
| 412 | 3300049823 | Ga0501044_0002636 | Ga0501044_0002636_18327_18773 | 146 |
| 413 | 3300049823 | Ga0501044_0069602 | Ga0501044_0069602_2600_3040 | 146 |
| 414 | 3300049824 | Ga0501045_0005133 | Ga0501045_0005133_5312_5752 | 146 |
| 415 | 3300050507 | nmdc:mga05p37_251374_c1 | nmdc:mga05p37_251374_c1_809_1252 | 146 |
| 416 | 3300050507 | nmdc:mga05p37_293738_c1 | nmdc:mga05p37_293738_c1_487_930 | 146 |
| 417 | 3300050508 | nmdc:mga09592_49245_c1 | nmdc:mga09592_49245_c1_128_571 | 146 |
| 418 | 3300050508 | nmdc:mga09592_89312_c1 | nmdc:mga09592_89312_c1_243_686 | 146 |
| 419 | 3300050509 | nmdc:mga0qj67_726952_c1 | nmdc:mga0qj67_726952_c1_238_681 | 146 |
| 420 | 3300050510 | nmdc:mga06r32_221443_c1 | nmdc:mga06r32_221443_c1_322_765 | 146 |
| 421 | 3300050510 | nmdc:mga06r32_258239_c1 | nmdc:mga06r32_258239_c1_606_1049 | 146 |
| 422 | 3300050511 | nmdc:mga08y16_5068_c1 | nmdc:mga08y16_5068_c1_8909_9352 | 146 |
| 423 | 3300050511 | nmdc:mga08y16_65823_c1 | nmdc:mga08y16_65823_c1_3004_3447 | 146 |
| 424 | 3300050512 | nmdc:mga0n895_55397_c1 | nmdc:mga0n895_55397_c1_796_1239 | 146 |
| 425 | 3300050514 | nmdc:mga08x19_608504_c1 | nmdc:mga08x19_608504_c1_141_590 | 146 |
| 426 | 3300050515 | nmdc:mga0a205_489078_c1 | nmdc:mga0a205_489078_c1_576_1019 | 146 |
| 427 | 3300050515 | nmdc:mga0a205_58937_c1 | nmdc:mga0a205_58937_c1_2129_2572 | 146 |
| 428 | 3300060353 | Ga0501082_0100889 | Ga0501082_0100889_1204_1644 | 146 |
| 429 | 3300061734 | Ga0530510_0292007 | Ga0530510_0292007_412_852 | 146 |
| 430 | 3300005436 | Ga0070713_100008154 | Ga0070713_1000081543 | 147 |
| 431 | 3300005445 | Ga0070708_100650521 | Ga0070708_1006505212 | 147 |
| 432 | 3300005471 | Ga0070698_100000764 | Ga0070698_1000007645 | 147 |
| 433 | 3300005536 | Ga0070697_100860950 | Ga0070697_1008609502 | 147 |
| 434 | 3300005564 | Ga0070664_100467564 | Ga0070664_1004675642 | 147 |
| 435 | 3300005834 | Ga0068851_10396417 | Ga0068851_103964172 | 147 |
| 436 | 3300005844 | Ga0068862_100050510 | Ga0068862_1000505102 | 147 |
| 437 | 3300005985 | Ga0081539_10000292 | Ga0081539_1000029277 | 147 |
| 438 | 3300006051 | Ga0075364_10223712 | Ga0075364_102237122 | 147 |
| 439 | 3300006178 | Ga0075367_10536527 | Ga0075367_105365271 | 147 |
| 440 | 3300006847 | Ga0075431_100443650 | Ga0075431_1004436502 | 147 |
| 441 | 3300006847 | Ga0075431_100687296 | Ga0075431_1006872962 | 147 |
| 442 | 3300006880 | Ga0075429_100214620 | Ga0075429_1002146202 | 147 |
| 443 | 3300009147 | Ga0114129_10258760 | Ga0114129_102587601 | 147 |
| 444 | 3300025928 | Ga0207700_10011057 | Ga0207700_100110575 | 147 |
| 445 | 3300025945 | Ga0207679_10434390 | Ga0207679_104343902 | 147 |
| 446 | 3300028380 | Ga0268265_10256827 | Ga0268265_102568272 | 147 |
| 447 | 3300028800 | Ga0265338_10032370 | Ga0265338_100323702 | 147 |
| 448 | 3300031344 | Ga0265316_10015617 | Ga0265316_100156172 | 147 |
| 449 | 3300031344 | Ga0265316_10129728 | Ga0265316_101297282 | 147 |
| 450 | 3300031711 | Ga0265314_10000001 | Ga0265314_10000001864 | 147 |
| 451 | 3300031995 | Ga0307409_100570590 | Ga0307409_1005705902 | 147 |
| 452 | 3300032004 | Ga0307414_11923782 | Ga0307414_119237821 | 147 |
| 453 | 3300035121 | Ga0373960_0002896 | Ga0373960_0002896_207_650 | 147 |
| 454 | 3300035207 | Ga0373942_0098086 | Ga0373942_0098086_45_488 | 147 |
| 455 | 3300035695 | Ga0373927_0046495 | Ga0373927_0046495_2292_2741 | 147 |
| 456 | 3300039437 | Ga0436365_1438224 | Ga0436365_1438224_543_986 | 147 |
| 457 | 3300041512 | Ga0451853_1103094 | Ga0451853_1103094_780_1226 | 147 |
| 458 | 3300042876 | Ga0451577_0000499 | Ga0451577_0000499_33509_33952 | 147 |
| 459 | 3300042876 | Ga0451577_0003072 | Ga0451577_0003072_7923_8366 | 147 |
| 460 | 3300044683 | Ga0466965_0012718 | Ga0466965_0012718_493_945 | 147 |
| 461 | 3300044712 | Ga0453684_0000586 | Ga0453684_0000586_40847_41290 | 147 |
| 462 | 3300044712 | Ga0453684_0001918 | Ga0453684_0001918_33155_33598 | 147 |
| 463 | 3300044719 | Ga0466971_0000077 | Ga0466971_0000077_18865_19317 | 147 |
| 464 | 3300044765 | Ga0466970_0352708 | Ga0466970_0352708_306_758 | 147 |
| 465 | 3300044842 | Ga0466957_0062415 | Ga0466957_0062415_1143_1595 | 147 |
| 466 | 3300044901 | Ga0466960_0152870 | Ga0466960_0152870_758_1210 | 147 |
| 467 | 3300045051 | Ga0451576_0089349 | Ga0451576_0089349_995_1450 | 147 |
| 468 | 3300045051 | Ga0451576_0272924 | Ga0451576_0272924_50_505 | 147 |
| 469 | 3300045976 | Ga0466967_0054343 | Ga0466967_0054343_2936_3388 | 147 |
| 470 | 3300046557 | Ga0495622_0064198 | Ga0495622_0064198_785_1228 | 147 |
| 471 | 3300047320 | Ga0495672_0003726 | Ga0495672_0003726_8055_8507 | 147 |
| 472 | 3300047320 | Ga0495672_0062108 | Ga0495672_0062108_1538_1990 | 147 |
| 473 | 3300049575 | Ga0501039_0651095 | Ga0501039_0651095_161_604 | 147 |
| 474 | 3300049576 | Ga0501040_0574258 | Ga0501040_0574258_274_717 | 147 |
| 475 | 3300049578 | Ga0501042_0614878 | Ga0501042_0614878_18_461 | 147 |
| 476 | 3300049581 | Ga0501047_0163713 | Ga0501047_0163713_1267_1710 | 147 |
| 477 | 3300049581 | Ga0501047_0266251 | Ga0501047_0266251_738_1181 | 147 |
| 478 | 3300049586 | Ga0501070_0088488 | Ga0501070_0088488_149_592 | 147 |
| 479 | 3300049589 | Ga0501073_0628206 | Ga0501073_0628206_274_717 | 147 |
| 480 | 3300049592 | Ga0501076_0124687 | Ga0501076_0124687_719_1162 | 147 |
| 481 | 3300049686 | Ga0501257_066563 | Ga0501257_066563_13_456 | 147 |
| 482 | 3300049741 | Ga0501079_0972288 | Ga0501079_0972288_89_532 | 147 |
| 483 | 3300049823 | Ga0501044_0022639 | Ga0501044_0022639_4268_4711 | 147 |
| 484 | 3300049824 | Ga0501045_0108160 | Ga0501045_0108160_323_766 | 147 |
| 485 | 3300050507 | nmdc:mga05p37_1768520_c1 | nmdc:mga05p37_1768520_c1_68_514 | 147 |
| 486 | 3300050507 | nmdc:mga05p37_780282_c1 | nmdc:mga05p37_780282_c1_64_507 | 147 |
| 487 | 3300050508 | nmdc:mga09592_3139_c1 | nmdc:mga09592_3139_c1_6375_6830 | 147 |
| 488 | 3300050510 | nmdc:mga06r32_329050_c1 | nmdc:mga06r32_329050_c1_819_1274 | 147 |
| 489 | 3300050510 | nmdc:mga06r32_517159_c1 | nmdc:mga06r32_517159_c1_329_772 | 147 |
| 490 | 3300053139 | Ga0500568_0264008 | Ga0500568_0264008_168_611 | 147 |
| 491 | 3300054114 | Ga0501084_1641839 | Ga0501084_1641839_37_480 | 147 |
| 492 | 3300061719 | Ga0466962_0000006 | Ga0466962_0000006_107527_107979 | 147 |
| 493 | 2162886006 | SwRhRL3b_contig_679788 | SwRhRL3b_0178.00001350 | 148 |
| 494 | 3300005295 | Ga0065707_10083409 | Ga0065707_100834096 | 148 |
| 495 | 3300005336 | Ga0070680_100096823 | Ga0070680_1000968232 | 148 |
| 496 | 3300005336 | Ga0070680_100270259 | Ga0070680_1002702592 | 148 |
| 497 | 3300005435 | Ga0070714_100000023 | Ga0070714_10000002314 | 148 |
| 498 | 3300005436 | Ga0070713_100084089 | Ga0070713_1000840892 | 148 |
| 499 | 3300005439 | Ga0070711_100038184 | Ga0070711_1000381843 | 148 |
| 500 | 3300005439 | Ga0070711_100255267 | Ga0070711_1002552672 | 148 |
| 501 | 3300005444 | Ga0070694_100899481 | Ga0070694_1008994811 | 148 |
| 502 | 3300005445 | Ga0070708_100513743 | Ga0070708_1005137432 | 148 |
| 503 | 3300005457 | Ga0070662_100003114 | Ga0070662_10000311412 | 148 |
| 504 | 3300005458 | Ga0070681_10120596 | Ga0070681_101205963 | 148 |
| 505 | 3300005467 | Ga0070706_100048744 | Ga0070706_1000487442 | 148 |
| 506 | 3300005468 | Ga0070707_100463548 | Ga0070707_1004635481 | 148 |
| 507 | 3300005518 | Ga0070699_100010333 | Ga0070699_1000103335 | 148 |
| 508 | 3300005518 | Ga0070699_100672413 | Ga0070699_1006724131 | 148 |
| 509 | 3300005518 | Ga0070699_100815176 | Ga0070699_1008151761 | 148 |
| 510 | 3300005518 | Ga0070699_100913826 | Ga0070699_1009138262 | 148 |
| 511 | 3300005530 | Ga0070679_100035505 | Ga0070679_1000355052 | 148 |
| 512 | 3300005536 | Ga0070697_100127919 | Ga0070697_1001279193 | 148 |
| 513 | 3300005545 | Ga0070695_100780977 | Ga0070695_1007809771 | 148 |
| 514 | 3300005546 | Ga0070696_100011402 | Ga0070696_1000114024 | 148 |
| 515 | 3300005546 | Ga0070696_100126289 | Ga0070696_1001262892 | 148 |
| 516 | 3300005548 | Ga0070665_100908275 | Ga0070665_1009082752 | 148 |
| 517 | 3300005549 | Ga0070704_100484245 | Ga0070704_1004842452 | 148 |
| 518 | 3300005549 | Ga0070704_101386636 | Ga0070704_1013866362 | 148 |
| 519 | 3300006028 | Ga0070717_10000687 | Ga0070717_100006873 | 148 |
| 520 | 3300006038 | Ga0075365_10042235 | Ga0075365_100422352 | 148 |
| 521 | 3300006038 | Ga0075365_10086233 | Ga0075365_100862331 | 148 |
| 522 | 3300006038 | Ga0075365_10122381 | Ga0075365_101223812 | 148 |
| 523 | 3300006042 | Ga0075368_10100029 | Ga0075368_101000291 | 148 |
| 524 | 3300006042 | Ga0075368_10177511 | Ga0075368_101775112 | 148 |
| 525 | 3300006048 | Ga0075363_100005431 | Ga0075363_1000054315 | 148 |
| 526 | 3300006048 | Ga0075363_100335803 | Ga0075363_1003358031 | 148 |
| 527 | 3300006051 | Ga0075364_11016421 | Ga0075364_110164211 | 148 |
| 528 | 3300006173 | Ga0070716_100602149 | Ga0070716_1006021492 | 148 |
| 529 | 3300006178 | Ga0075367_10063091 | Ga0075367_100630912 | 148 |
| 530 | 3300006178 | Ga0075367_10231382 | Ga0075367_102313821 | 148 |
| 531 | 3300006186 | Ga0075369_10095864 | Ga0075369_100958642 | 148 |
| 532 | 3300006846 | Ga0075430_100269874 | Ga0075430_1002698742 | 148 |
| 533 | 3300006846 | Ga0075430_100845757 | Ga0075430_1008457572 | 148 |
| 534 | 3300006847 | Ga0075431_100058163 | Ga0075431_1000581632 | 148 |
| 535 | 3300006847 | Ga0075431_101290217 | Ga0075431_1012902172 | 148 |
| 536 | 3300006852 | Ga0075433_10075979 | Ga0075433_100759792 | 148 |
| 537 | 3300006852 | Ga0075433_10081111 | Ga0075433_100811112 | 148 |
| 538 | 3300006881 | Ga0068865_102043792 | Ga0068865_1020437921 | 148 |
| 539 | 3300006914 | Ga0075436_100007182 | Ga0075436_1000071822 | 148 |
| 540 | 3300006914 | Ga0075436_100070812 | Ga0075436_1000708122 | 148 |
| 541 | 3300007076 | Ga0075435_101570467 | Ga0075435_1015704672 | 148 |
| 542 | 3300009093 | Ga0105240_11450950 | Ga0105240_114509502 | 148 |
| 543 | 3300009147 | Ga0114129_10021692 | Ga0114129_100216926 | 148 |
| 544 | 3300009147 | Ga0114129_10057688 | Ga0114129_100576882 | 148 |
| 545 | 3300009147 | Ga0114129_10138001 | Ga0114129_101380017 | 148 |
| 546 | 3300009147 | Ga0114129_10405251 | Ga0114129_104052512 | 148 |
| 547 | 3300009147 | Ga0114129_11810943 | Ga0114129_118109432 | 148 |
| 548 | 3300013105 | Ga0157369_10266027 | Ga0157369_102660273 | 148 |
| 549 | 3300025912 | Ga0207707_10015908 | Ga0207707_100159085 | 148 |
| 550 | 3300025916 | Ga0207663_10032508 | Ga0207663_100325083 | 148 |
| 551 | 3300025917 | Ga0207660_10150166 | Ga0207660_101501662 | 148 |
| 552 | 3300025921 | Ga0207652_10023424 | Ga0207652_100234245 | 148 |
| 553 | 3300025922 | Ga0207646_10367936 | Ga0207646_103679362 | 148 |
| 554 | 3300025929 | Ga0207664_10000128 | Ga0207664_1000012831 | 148 |
| 555 | 3300025933 | Ga0207706_10000439 | Ga0207706_1000043938 | 148 |
| 556 | 3300025942 | Ga0207689_11023819 | Ga0207689_110238192 | 148 |
| 557 | 3300026095 | Ga0207676_10151924 | Ga0207676_101519242 | 148 |
| 558 | 3300028379 | Ga0268266_10981650 | Ga0268266_109816502 | 148 |
| 559 | 3300028556 | Ga0265337_1010077 | Ga0265337_10100772 | 148 |
| 560 | 3300028556 | Ga0265337_1052064 | Ga0265337_10520642 | 148 |
| 561 | 3300028558 | Ga0265326_10008773 | Ga0265326_100087732 | 148 |
| 562 | 3300028563 | Ga0265319_1000011 | Ga0265319_1000011120 | 148 |
| 563 | 3300028577 | Ga0265318_10000284 | Ga0265318_1000028431 | 148 |
| 564 | 3300028577 | Ga0265318_10086188 | Ga0265318_100861882 | 148 |
| 565 | 3300028653 | Ga0265323_10000015 | Ga0265323_100000157 | 148 |
| 566 | 3300028653 | Ga0265323_10086129 | Ga0265323_100861291 | 148 |
| 567 | 3300028654 | Ga0265322_10000430 | Ga0265322_100004304 | 148 |
| 568 | 3300028654 | Ga0265322_10031342 | Ga0265322_100313422 | 148 |
| 569 | 3300028666 | Ga0265336_10008503 | Ga0265336_100085032 | 148 |
| 570 | 3300028794 | Ga0307515_10097779 | Ga0307515_100977792 | 148 |
| 571 | 3300028800 | Ga0265338_10028491 | Ga0265338_100284912 | 148 |
| 572 | 3300031235 | Ga0265330_10364410 | Ga0265330_103644101 | 148 |
| 573 | 3300031240 | Ga0265320_10028596 | Ga0265320_100285961 | 148 |
| 574 | 3300031240 | Ga0265320_10035765 | Ga0265320_100357652 | 148 |
| 575 | 3300031247 | Ga0265340_10062479 | Ga0265340_100624792 | 148 |
| 576 | 3300031250 | Ga0265331_10272285 | Ga0265331_102722852 | 148 |
| 577 | 3300031251 | Ga0265327_10039369 | Ga0265327_100393692 | 148 |
| 578 | 3300031344 | Ga0265316_10000549 | Ga0265316_100005497 | 148 |
| 579 | 3300031344 | Ga0265316_10009062 | Ga0265316_1000906211 | 148 |
| 580 | 3300031344 | Ga0265316_10021000 | Ga0265316_100210004 | 148 |
| 581 | 3300031595 | Ga0265313_10015352 | Ga0265313_100153522 | 148 |
| 582 | 3300031616 | Ga0307508_10000513 | Ga0307508_100005138 | 148 |
| 583 | 3300031711 | Ga0265314_10006365 | Ga0265314_100063656 | 148 |
| 584 | 3300031711 | Ga0265314_10012148 | Ga0265314_100121483 | 148 |
| 585 | 3300031711 | Ga0265314_10045630 | Ga0265314_100456302 | 148 |
| 586 | 3300031712 | Ga0265342_10032133 | Ga0265342_100321332 | 148 |
| 587 | 3300032002 | Ga0307416_100964139 | Ga0307416_1009641392 | 148 |
| 588 | 3300032002 | Ga0307416_102254177 | Ga0307416_1022541772 | 148 |
| 589 | 3300037466 | Ga0395898_0256697 | Ga0395898_0256697_748_1230 | 148 |
| 590 | 3300037471 | Ga0395905_0001144 | Ga0395905_0001144_30205_30687 | 148 |
| 591 | 3300042001 | Ga0439441_070899 | Ga0439441_070899_238_684 | 148 |
| 592 | 3300044658 | Ga0466972_0000388 | Ga0466972_0000388_12228_12683 | 148 |
| 593 | 3300044712 | Ga0453684_0013262 | Ga0453684_0013262_3685_4134 | 148 |
| 594 | 3300044712 | Ga0453684_0014672 | Ga0453684_0014672_6775_7254 | 148 |
| 595 | 3300044712 | Ga0453684_0487849 | Ga0453684_0487849_169_621 | 148 |
| 596 | 3300045051 | Ga0451576_0152340 | Ga0451576_0152340_1585_2031 | 148 |
| 597 | 3300045051 | Ga0451576_0975983 | Ga0451576_0975983_409_864 | 148 |
| 598 | 3300048919 | Ga0496116_0003081 | Ga0496116_0003081_8516_8974 | 148 |
| 599 | 3300049568 | Ga0501031_0000514 | Ga0501031_0000514_9364_9822 | 148 |
| 600 | 3300049571 | Ga0501034_0242107 | Ga0501034_0242107_1068_1529 | 148 |
| 601 | 3300049572 | Ga0501036_0621439 | Ga0501036_0621439_106_564 | 148 |
| 602 | 3300049573 | Ga0501037_0000002 | Ga0501037_0000002_222192_222650 | 148 |
| 603 | 3300049575 | Ga0501039_0002621 | Ga0501039_0002621_6604_7062 | 148 |
| 604 | 3300049577 | Ga0501041_0040587 | Ga0501041_0040587_2265_2717 | 148 |
| 605 | 3300049579 | Ga0501043_0028414 | Ga0501043_0028414_697_1155 | 148 |
| 606 | 3300049581 | Ga0501047_0009135 | Ga0501047_0009135_1832_2290 | 148 |
| 607 | 3300049586 | Ga0501070_0002593 | Ga0501070_0002593_790_1248 | 148 |
| 608 | 3300049587 | Ga0501071_0019581 | Ga0501071_0019581_3341_3811 | 148 |
| 609 | 3300049590 | Ga0501074_0260459 | Ga0501074_0260459_145_615 | 148 |
| 610 | 3300049591 | Ga0501075_1425734 | Ga0501075_1425734_25_474 | 148 |
| 611 | 3300049741 | Ga0501079_0177071 | Ga0501079_0177071_1160_1630 | 148 |
| 612 | 3300049743 | Ga0501081_0214114 | Ga0501081_0214114_351_821 | 148 |
| 613 | 3300049822 | Ga0501035_0000007 | Ga0501035_0000007_159599_160057 | 148 |
| 614 | 3300049823 | Ga0501044_0000259 | Ga0501044_0000259_14301_14759 | 148 |
| 615 | 3300050490 | nmdc:mga03n38_15322_c1 | nmdc:mga03n38_15322_c1_620_1072 | 148 |
| 616 | 3300050491 | nmdc:mga00v17_530860_c1 | nmdc:mga00v17_530860_c1_208_660 | 148 |
| 617 | 3300050491 | nmdc:mga00v17_68236_c1 | nmdc:mga00v17_68236_c1_1262_1714 | 148 |
| 618 | 3300050492 | nmdc:mga0yw44_121420_c1 | nmdc:mga0yw44_121420_c1_51_503 | 148 |
| 619 | 3300050492 | nmdc:mga0yw44_14001_c1 | nmdc:mga0yw44_14001_c1_2027_2479 | 148 |
| 620 | 3300050492 | nmdc:mga0yw44_52914_c1 | nmdc:mga0yw44_52914_c1_187_639 | 148 |
| 621 | 3300050494 | nmdc:mga06z11_182719_c1 | nmdc:mga06z11_182719_c1_483_935 | 148 |
| 622 | 3300050494 | nmdc:mga06z11_65160_c1 | nmdc:mga06z11_65160_c1_321_773 | 148 |
| 623 | 3300050494 | nmdc:mga06z11_72288_c1 | nmdc:mga06z11_72288_c1_468_920 | 148 |
| 624 | 3300050495 | nmdc:mga04h51_424854_c1 | nmdc:mga04h51_424854_c1_77_529 | 148 |
| 625 | 3300050507 | nmdc:mga05p37_141842_c1 | nmdc:mga05p37_141842_c1_1849_2301 | 148 |
| 626 | 3300050507 | nmdc:mga05p37_172394_c1 | nmdc:mga05p37_172394_c1_1432_1878 | 148 |
| 627 | 3300050507 | nmdc:mga05p37_20364_c1 | nmdc:mga05p37_20364_c1_5373_5825 | 148 |
| 628 | 3300050509 | nmdc:mga0qj67_719512_c1 | nmdc:mga0qj67_719512_c1_123_578 | 148 |
| 629 | 3300050510 | nmdc:mga06r32_1239529_c1 | nmdc:mga06r32_1239529_c1_193_648 | 148 |
| 630 | 3300050510 | nmdc:mga06r32_68031_c1 | nmdc:mga06r32_68031_c1_2755_3201 | 148 |
| 631 | 3300050513 | nmdc:mga0rr50_1511446_c1 | nmdc:mga0rr50_1511446_c1_69_524 | 148 |
| 632 | 3300050514 | nmdc:mga08x19_123326_c1 | nmdc:mga08x19_123326_c1_1204_1659 | 148 |
| 633 | 3300050514 | nmdc:mga08x19_128423_c1 | nmdc:mga08x19_128423_c1_130_576 | 148 |
| 634 | 3300050514 | nmdc:mga08x19_15081_c1 | nmdc:mga08x19_15081_c1_2443_2961 | 148 |
| 635 | 3300050515 | nmdc:mga0a205_102218_c1 | nmdc:mga0a205_102218_c1_2117_2563 | 148 |
| 636 | 3300050515 | nmdc:mga0a205_9398_c1 | nmdc:mga0a205_9398_c1_2430_2882 | 148 |
| 637 | 3300050516 | nmdc:mga0sz30_31431_c1 | nmdc:mga0sz30_31431_c1_776_1228 | 148 |
| 638 | 3300053109 | Ga0500569_066961 | Ga0500569_066961_252_722 | 148 |
| 639 | 3300059421 | Ga0590071_004510 | Ga0590071_004510_2463_2921 | 148 |
| 640 | 3300059424 | Ga0590075_142472 | Ga0590075_142472_87_545 | 148 |
| 641 | 3300059426 | Ga0590077_078231 | Ga0590077_078231_256_714 | 148 |
| 642 | 3300060353 | Ga0501082_0142278 | Ga0501082_0142278_476_946 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ab6-assembly2.cif.gz_B | structure of chey mutant f14n, v86t | 0.9257 | 4 | 134 |
| 1ab5-assembly2.cif.gz_B | structure of chey mutant f14n, v21t | 0.923 | 4 | 134 |
| 1ymu-assembly1.cif.gz_B | signal transduction protein chey mutant with met 17 replaced by gly (m17g) | 0.9228 | 4 | 134 |
| 4jav-assembly1.cif.gz_D | structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) | 0.9179 | 4 | 132 |
| 1zes-assembly2.cif.gz_B | bef3- activated phob receiver domain | 0.912 | 4 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jp1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9286 | 4 | 133 | 3.40.50.2300 |
| af_Q1JSA0_6_124_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9148 | 5 | 131 | 3.40.50.2300 |
| 5brjA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9109 | 4 | 141 | 3.40.50.2300 |
| af_K7KGZ6_7_112_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9101 | 29 | 134 | 3.40.50.2300 |
| af_K7N076_11_147_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9087 | 4 | 133 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537LGN3-F1-model_v4 | Response regulator | 0.9704 | 4 | 97 |
GO:0000160
|
| AF-A0A2N6A3I8-F1-model_v4 | Response regulatory domain-containing protein | 0.9669 | 4 | 137 |
GO:0000160
|
| AF-A0A3N5LXH5-F1-model_v4 | Response regulator | 0.9645 | 4 | 132 |
GO:0000160
GO:0003677 |
| AF-A0A1F3XDR8-F1-model_v4 | Two-component system response regulator | 0.962 | 1 | 114 |
GO:0000160
|
| AF-A0A2H0H521-F1-model_v4 | Two-component system response regulator | 0.9586 | 1 | 133 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar