F471437

General Info

Members Datasets Scaffolds Average Seq Length
637 366 635 146

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10003256|Ga0265331_100032567
Length 176
Sequence MIGNDNDLRDLYQDLILDHSKHPHNFRAVPEANRDALGHNPLCGDRLSLQLKVDADDVIQDVGFQGSGCAISVASASMMTDMLRGRTLEEANALFAYMHALCTGRDYSVPAEMAGTTVTAPCTGENPPHVTLADDDRDRLQALAGVRHYPMRVKCATLAWHTMQAALDNKTKVSTE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
4 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
5 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
201 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
202 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
203 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
226 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
293 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
328 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
329 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
330 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
347 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
351 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
356 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
357 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
358 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
361 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.88
Metatranscriptomes 5.65
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0
Rhizoplane 3.61
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1005527 2162886007 Bacteria 6812
2 MBSR1b_contig_1214556 2162886012 Bacteria 959
3 JGI24750J21931_1041354 3300002070 Bacteria 701
4 JGI25151J46595_10010063 3300003187 Bacteria 4428
5 rootH1_10008501 3300003316 Bacteria 16023
6 rootL2_10034951 3300003322 Bacteria 11923
7 rootH1_10112062 3300003316 Bacteria 1399
8 rootH1_10112062 3300003323 Bacteria 2728
9 Ga0006562J51391_1000948 3300003578 Bacteria 18850
10 Ga0055532_1004114 3300003758 Bacteria 2283
11 Ga0058862_11585074 3300004803 Bacteria 1385
12 Ga0065704_10000411 3300005289 Bacteria 28770
13 Ga0065712_10003849 3300005290 Bacteria 4867
14 Ga0065715_10092544 3300005293 Bacteria 5067
15 Ga0065707_10081966 3300005295 Bacteria 26944
16 Ga0070658_10323747 3300005327 Bacteria 1316
17 Ga0070676_10032981 3300005328 Bacteria 2969
18 Ga0070676_10178973 3300005328 Bacteria 1377
19 Ga0070676_10668482 3300005328 Bacteria 756
20 Ga0070670_100022137 3300005331 Bacteria 5471
21 Ga0070670_100173857 3300005331 Bacteria 1869
22 Ga0070670_100466076 3300005331 Bacteria 1121
23 Ga0068869_100017831 3300005334 Bacteria 4822
24 Ga0068869_100065870 3300005334 Bacteria 2668
25 Ga0068869_100757560 3300005334 Bacteria 832
26 Ga0070680_100014471 3300005336 Bacteria 6171
27 Ga0070680_100082155 3300005336 Bacteria 2659
28 Ga0070682_100117396 3300005337 Bacteria 1781
29 Ga0070682_100801400 3300005337 Bacteria 765
30 Ga0068868_100026036 3300005338 Bacteria 4454
31 Ga0070689_100008629 3300005340 Bacteria 7188
32 Ga0070691_10365677 3300005341 Unclassified 805
33 Ga0070687_100139086 3300005343 Bacteria 1412
34 Ga0070661_100007962 3300005344 Bacteria 7321
35 Ga0070661_100393101 3300005344 Bacteria 1095
36 Ga0070661_101086293 3300005344 Bacteria 666
37 Ga0070692_10022839 3300005345 Bacteria 3060
38 Ga0070692_10268656 3300005345 Bacteria 1029
39 Ga0070668_100031631 3300005347 Bacteria 4026
40 Ga0070668_100367843 3300005347 Bacteria 1221
41 Ga0070669_100016708 3300005353 Bacteria 5238
42 Ga0070669_100050901 3300005353 Bacteria 3026
43 Ga0070669_100397597 3300005353 Bacteria 1127
44 Ga0070675_100010875 3300005354 Bacteria 7118
45 Ga0070675_100104699 3300005354 Bacteria 2387
46 Ga0070675_100545840 3300005354 Bacteria 1048
47 Ga0070675_101620232 3300005354 Unclassified 597
48 Ga0070671_100013991 3300005355 Bacteria 6478
49 Ga0070674_100020865 3300005356 Bacteria 4195
50 Ga0070674_100060672 3300005356 Bacteria 2637
51 Ga0070673_100006740 3300005364 Bacteria 7494
52 Ga0070673_101605862 3300005364 Unclassified 614
53 Ga0070688_100024750 3300005365 Bacteria 3547
54 Ga0070688_100614490 3300005365 Bacteria 833
55 Ga0070667_101041581 3300005367 Bacteria 764
56 Ga0070709_10338902 3300005434 Bacteria 1108
57 Ga0070714_100017134 3300005435 Bacteria 5866
58 Ga0070714_100704938 3300005435 Bacteria 974
59 Ga0070713_100371294 3300005436 Bacteria 1331
60 Ga0070710_10170391 3300005437 Bacteria 1356
61 Ga0070701_10006243 3300005438 Bacteria 5000
62 Ga0070700_100042341 3300005441 Bacteria 2796
63 Ga0070700_100076162 3300005441 Bacteria 2154
64 Ga0070700_100426068 3300005441 Bacteria 1004
65 Ga0070694_100458500 3300005444 Unclassified 1008
66 Ga0070694_100582736 3300005444 Bacteria 899
67 Ga0070663_100284866 3300005455 Bacteria 1318
68 Ga0070678_101004675 3300005456 Bacteria 767
69 Ga0070662_100044474 3300005457 Bacteria 3181
70 Ga0070662_100128993 3300005457 Bacteria 1947
71 Ga0070662_100332782 3300005457 Bacteria 1241
72 Ga0068867_100021713 3300005459 Bacteria 4581
73 Ga0068867_100036820 3300005459 Bacteria 3554
74 Ga0070685_10004948 3300005466 Bacteria 6745
75 Ga0070679_100713075 3300005530 Bacteria 946
76 Ga0070679_100988426 3300005530 Bacteria 785
77 Ga0070684_100086852 3300005535 Bacteria 2777
78 Ga0068853_100847867 3300005539 Bacteria 876
79 Ga0070672_100011947 3300005543 Bacteria 6071
80 Ga0070672_100034945 3300005543 Bacteria 3817
81 Ga0070672_100052226 3300005543 Bacteria 3191
82 Ga0070686_100063807 3300005544 Bacteria 2387
83 Ga0070686_100207209 3300005544 Bacteria 1409
84 Ga0070695_100396481 3300005545 Bacteria 1045
85 Ga0070695_100961389 3300005545 Bacteria 693
86 Ga0070696_100413326 3300005546 Bacteria 1058
87 Ga0070696_100434558 3300005546 Bacteria 1033
88 Ga0070693_100351430 3300005547 Bacteria 1009
89 Ga0070665_100333268 3300005548 Bacteria 1522
90 Ga0070665_100636462 3300005548 Bacteria 1080
91 Ga0070665_100983682 3300005548 Bacteria 856
92 Ga0070704_100036982 3300005549 Bacteria 3331
93 Ga0070704_100236588 3300005549 Bacteria 1493
94 Ga0068855_100000592 3300005563 Bacteria 44394
95 Ga0068855_100848707 3300005563 Bacteria 968
96 Ga0070664_100033747 3300005564 Bacteria 4289
97 Ga0070664_100423364 3300005564 Bacteria 1220
98 Ga0068857_100018195 3300005577 Bacteria 6162
99 Ga0068857_100021815 3300005577 Bacteria 5637
100 Ga0068854_100438015 3300005578 Bacteria 1089
101 Ga0068856_100086602 3300005614 Bacteria 3113
102 Ga0068856_100098495 3300005614 Bacteria 2914
103 Ga0070702_100014488 3300005615 Bacteria 4000
104 Ga0070702_100862519 3300005615 Bacteria 706
105 Ga0068859_100007132 3300005617 Bacteria 11343
106 Ga0068864_100018191 3300005618 Bacteria 5866
107 Ga0068864_100349797 3300005618 Bacteria 1394
108 Ga0068861_100000256 3300005719 Bacteria 29591
109 Ga0068861_100010076 3300005719 Bacteria 6554
110 Ga0068861_100011863 3300005719 Bacteria 6067
111 Ga0068861_100017222 3300005719 Bacteria 5124
112 Ga0068861_100296518 3300005719 Bacteria 1398
113 Ga0068861_101529215 3300005719 Bacteria 656
114 Ga0068870_10021396 3300005840 Bacteria 3163
115 Ga0068870_10040720 3300005840 Bacteria 2411
116 Ga0068870_10230120 3300005840 Bacteria 1139
117 Ga0068863_100036792 3300005841 Bacteria 4661
118 Ga0068863_101852005 3300005841 Bacteria 613
119 Ga0068860_100057858 3300005843 Bacteria 3685
120 Ga0068860_101185633 3300005843 Bacteria 784
121 Ga0068862_100000878 3300005844 Bacteria 29297
122 Ga0068862_100009915 3300005844 Bacteria 7868
123 Ga0068862_100017462 3300005844 Bacteria 5977
124 Ga0068862_100019648 3300005844 Bacteria 5641
125 Ga0075364_10107807 3300006051 Bacteria 1857
126 Ga0070715_10212121 3300006163 Bacteria 990
127 Ga0070712_101215316 3300006175 Bacteria 656
128 Ga0097621_100129456 3300006237 Bacteria 2147
129 Ga0097621_100331324 3300006237 Bacteria 1350
130 Ga0075370_10786249 3300006353 Unclassified 580
131 Ga0068871_100029018 3300006358 Bacteria 4343
132 Ga0068871_100329134 3300006358 Bacteria 1347
133 Ga0075428_100001451 3300006844 Bacteria 25355
134 Ga0075428_100168484 3300006844 Bacteria 2375
135 Ga0075428_100246049 3300006844 Bacteria 1928
136 Ga0075428_100478570 3300006844 Bacteria 1333
137 Ga0075430_100001349 3300006846 Bacteria 19852
138 Ga0075430_100005330 3300006846 Bacteria 10855
139 Ga0075430_100010186 3300006846 Bacteria 7960
140 Ga0075430_100029879 3300006846 Bacteria 4627
141 Ga0075431_100004956 3300006847 Bacteria 13103
142 Ga0075431_100033316 3300006847 Bacteria 5309
143 Ga0075431_100074247 3300006847 Bacteria 3509
144 Ga0075431_100445914 3300006847 Bacteria 1290
145 Ga0075434_100144861 3300006871 Bacteria 2396
146 Ga0075429_100001381 3300006880 Bacteria 19862
147 Ga0075429_100029953 3300006880 Bacteria 4727
148 Ga0075429_100042664 3300006880 Bacteria 3947
149 Ga0075429_100109148 3300006880 Bacteria 2419
150 Ga0075429_100213419 3300006880 Bacteria 1691
151 Ga0075429_100389771 3300006880 Bacteria 1220
152 Ga0068865_100057258 3300006881 Bacteria 2719
153 Ga0068865_100911108 3300006881 Bacteria 765
154 Ga0097620_100007132 3300006931 Bacteria 11343
155 Ga0105244_10265795 3300009036 Bacteria 798
156 Ga0105250_10073926 3300009092 Bacteria 1378
157 Ga0105240_10053016 3300009093 Bacteria 5095
158 Ga0105240_10095439 3300009093 Bacteria 3626
159 Ga0105240_10133832 3300009093 Bacteria 2970
160 Ga0105240_10135872 3300009093 Bacteria 2945
161 Ga0105240_10453866 3300009093 Bacteria 1434
162 Ga0111539_10004344 3300009094 Bacteria 18562
163 Ga0111539_10012659 3300009094 Bacteria 10568
164 Ga0111539_10046924 3300009094 Bacteria 5165
165 Ga0111539_10053274 3300009094 Bacteria 4816
166 Ga0111539_10065773 3300009094 Bacteria 4283
167 Ga0111539_10066066 3300009094 Bacteria 4272
168 Ga0105245_10037225 3300009098 Bacteria 4326
169 Ga0105245_10881618 3300009098 Unclassified 936
170 Ga0105247_10064863 3300009101 Bacteria 2270
171 Ga0105247_10147661 3300009101 Bacteria 1547
172 Ga0114129_10003124 3300009147 Bacteria 23226
173 Ga0114129_10066065 3300009147 Bacteria 5045
174 Ga0114129_12003377 3300009147 Bacteria 700
175 Ga0105243_10021747 3300009148 Bacteria 4870
176 Ga0105243_10037553 3300009148 Bacteria 3766
177 Ga0105243_10155869 3300009148 Bacteria 1964
178 Ga0105243_11248651 3300009148 Bacteria 758
179 Ga0105241_10959760 3300009174 Bacteria 797
180 Ga0105241_10969160 3300009174 Unclassified 794
181 Ga0105242_10017403 3300009176 Bacteria 5602
182 Ga0105242_11605763 3300009176 Bacteria 684
183 Ga0105248_10001950 3300009177 Bacteria 22929
184 Ga0105237_10210806 3300009545 Bacteria 1943
185 Ga0105237_10235889 3300009545 Bacteria 1830
186 Ga0105237_10271447 3300009545 Bacteria 1699
187 Ga0105238_10240191 3300009551 Bacteria 1789
188 Ga0105238_11645396 3300009551 Bacteria 672
189 Ga0105249_10007767 3300009553 Bacteria 9348
190 Ga0105249_10143321 3300009553 Bacteria 2293
191 Ga0105249_12442636 3300009553 Bacteria 595
192 Ga0105239_10319122 3300010375 Bacteria 1752
193 Ga0105239_10617436 3300010375 Bacteria 1237
194 Ga0105239_10976283 3300010375 Bacteria 974
195 Ga0105239_11159321 3300010375 Unclassified 890
196 Ga0105246_10006304 3300011119 Bacteria 7239
197 Ga0157374_10201778 3300013296 Bacteria 1947
198 Ga0157378_10065072 3300013297 Bacteria 3263
199 Ga0157378_11092578 3300013297 Bacteria 834
200 Ga0163162_10024984 3300013306 Bacteria 5902
201 Ga0163162_11294765 3300013306 Bacteria 828
202 Ga0157372_10180157 3300013307 Bacteria 2446
203 Ga0157375_10038243 3300013308 Bacteria 4606
204 Ga0157375_10344941 3300013308 Bacteria 1655
205 Ga0163163_10026463 3300014325 Bacteria 5545
206 Ga0157380_10006068 3300014326 Bacteria 8470
207 Ga0157380_10290419 3300014326 Bacteria 1501
208 Ga0157380_10562052 3300014326 Bacteria 1121
209 Ga0157380_10892309 3300014326 Bacteria 914
210 Ga0157380_10959941 3300014326 Bacteria 885
211 Ga0157377_10001056 3300014745 Bacteria 11660
212 Ga0157379_10692785 3300014968 Bacteria 956
213 Ga0157379_10709054 3300014968 Bacteria 945
214 Ga0163161_10099335 3300017792 Bacteria 2164
215 Ga0163161_10500164 3300017792 Bacteria 990
216 Ga0163161_11036524 3300017792 Bacteria 702
217 Ga0206350_10161612 3300020080 Bacteria 1134
218 Ga0213872_10000514 3300021361 Bacteria 30580
219 Ga0213872_10074827 3300021361 Bacteria 1524
220 Ga0209147_101571 3300025229 Bacteria 7779
221 Ga0209673_1001821 3300025273 Bacteria 17473
222 Ga0209025_1128520 3300025294 Bacteria 741
223 Ga0207696_1019848 3300025711 Bacteria 2178
224 Ga0207655_1001341 3300025728 Bacteria 23130
225 Ga0207713_1000472 3300025735 Bacteria 41917
226 Ga0207692_10395306 3300025898 Bacteria 861
227 Ga0207642_10012826 3300025899 Bacteria 3038
228 Ga0207710_10008538 3300025900 Bacteria 4319
229 Ga0207710_10100405 3300025900 Bacteria 1364
230 Ga0207688_10071683 3300025901 Bacteria 1967
231 Ga0207680_10315621 3300025903 Bacteria 1092
232 Ga0207685_10207650 3300025905 Bacteria 924
233 Ga0207699_10176362 3300025906 Bacteria 1434
234 Ga0207645_10005569 3300025907 Bacteria 9113
235 Ga0207645_10083156 3300025907 Bacteria 2053
236 Ga0207643_10015341 3300025908 Bacteria 4170
237 Ga0207643_10028973 3300025908 Bacteria 3078
238 Ga0207705_10349922 3300025909 Bacteria 1138
239 Ga0207705_10980272 3300025909 Unclassified 653
240 Ga0207695_10130671 3300025913 Bacteria 2469
241 Ga0207695_10224533 3300025913 Bacteria 1785
242 Ga0207695_10406886 3300025913 Bacteria 1245
243 Ga0207695_10738339 3300025913 Bacteria 865
244 Ga0207695_10749189 3300025913 Bacteria 857
245 Ga0207671_10114232 3300025914 Bacteria 2058
246 Ga0207671_10195680 3300025914 Bacteria 1577
247 Ga0207671_10404758 3300025914 Bacteria 1085
248 Ga0207660_10101854 3300025917 Bacteria 2146
249 Ga0207660_10374835 3300025917 Bacteria 1143
250 Ga0207662_10037651 3300025918 Bacteria 2832
251 Ga0207662_10788673 3300025918 Bacteria 669
252 Ga0207649_10168541 3300025920 Bacteria 1523
253 Ga0207652_10383099 3300025921 Bacteria 1269
254 Ga0207652_10413418 3300025921 Bacteria 1217
255 Ga0207681_10021598 3300025923 Bacteria 4095
256 Ga0207681_10094648 3300025923 Bacteria 2141
257 Ga0207681_10265027 3300025923 Bacteria 1346
258 Ga0207681_10310313 3300025923 Bacteria 1251
259 Ga0207694_10001823 3300025924 Bacteria 17744
260 Ga0207694_10016981 3300025924 Bacteria 5497
261 Ga0207650_10053397 3300025925 Bacteria 2995
262 Ga0207650_10496509 3300025925 Bacteria 1019
263 Ga0207659_10010463 3300025926 Bacteria 5831
264 Ga0207659_10211389 3300025926 Bacteria 1555
265 Ga0207659_10668837 3300025926 Bacteria 888
266 Ga0207687_10194604 3300025927 Bacteria 1581
267 Ga0207687_10603955 3300025927 Unclassified 925
268 Ga0207664_10010789 3300025929 Bacteria 6464
269 Ga0207664_10711767 3300025929 Bacteria 903
270 Ga0207644_10019360 3300025931 Bacteria 4617
271 Ga0207644_10645115 3300025931 Bacteria 881
272 Ga0207690_10173195 3300025932 Bacteria 1618
273 Ga0207706_10005852 3300025933 Bacteria 11436
274 Ga0207706_10022412 3300025933 Bacteria 5670
275 Ga0207706_10084440 3300025933 Bacteria 2792
276 Ga0207686_10266591 3300025934 Bacteria 1258
277 Ga0207709_10011396 3300025935 Bacteria 4905
278 Ga0207709_10385063 3300025935 Unclassified 1068
279 Ga0207709_10506634 3300025935 Bacteria 943
280 Ga0207670_10004031 3300025936 Bacteria 7853
281 Ga0207670_10135651 3300025936 Bacteria 1809
282 Ga0207669_10021850 3300025937 Bacteria 3387
283 Ga0207704_10155243 3300025938 Bacteria 1621
284 Ga0207704_10409003 3300025938 Bacteria 1073
285 Ga0207704_10792149 3300025938 Bacteria 791
286 Ga0207704_10961832 3300025938 Bacteria 721
287 Ga0207691_10023246 3300025940 Bacteria 5836
288 Ga0207691_10057873 3300025940 Bacteria 3527
289 Ga0207711_10006071 3300025941 Bacteria 10206
290 Ga0207689_10009129 3300025942 Bacteria 8580
291 Ga0207689_10074642 3300025942 Bacteria 2786
292 Ga0207689_10252163 3300025942 Unclassified 1459
293 Ga0207689_10686150 3300025942 Bacteria 863
294 Ga0207689_11306422 3300025942 Bacteria 609
295 Ga0207679_10006042 3300025945 Bacteria 7629
296 Ga0207679_10078858 3300025945 Bacteria 2510
297 Ga0207667_10042294 3300025949 Bacteria 4844
298 Ga0207667_10687442 3300025949 Bacteria 1026
299 Ga0207651_10004828 3300025960 Bacteria 6863
300 Ga0207712_10014997 3300025961 Bacteria 4993
301 Ga0207668_10013314 3300025972 Bacteria 5060
302 Ga0207668_10548382 3300025972 Bacteria 1001
303 Ga0207640_10111925 3300025981 Bacteria 1937
304 Ga0207678_10141799 3300026067 Bacteria 2051
305 Ga0207678_10288954 3300026067 Bacteria 1408
306 Ga0207708_10013991 3300026075 Bacteria 5994
307 Ga0207708_10028460 3300026075 Bacteria 4231
308 Ga0207708_10038857 3300026075 Bacteria 3626
309 Ga0207702_10050849 3300026078 Bacteria 3500
310 Ga0207702_10111968 3300026078 Bacteria 2428
311 Ga0207641_10004245 3300026088 Bacteria 12488
312 Ga0207641_10123034 3300026088 Bacteria 2318
313 Ga0207648_10016032 3300026089 Bacteria 6865
314 Ga0207648_10029655 3300026089 Bacteria 4851
315 Ga0207676_10101344 3300026095 Bacteria 2387
316 Ga0207676_10860230 3300026095 Bacteria 887
317 Ga0207674_10023013 3300026116 Bacteria 6682
318 Ga0207674_10026270 3300026116 Bacteria 6190
319 Ga0207675_100001062 3300026118 Bacteria 27254
320 Ga0207675_100001108 3300026118 Bacteria 26655
321 Ga0207675_100007848 3300026118 Bacteria 10070
322 Ga0207675_100017987 3300026118 Bacteria 6592
323 Ga0207675_100028971 3300026118 Bacteria 5159
324 Ga0207675_100273562 3300026118 Bacteria 1639
325 Ga0207683_10030144 3300026121 Bacteria 4699
326 Ga0207683_10290573 3300026121 Bacteria 1495
327 Ga0209995_1050258 3300027471 Unclassified 707
328 Ga0209970_1013824 3300027614 Bacteria 1340
329 Ga0209983_1003117 3300027665 Bacteria 3562
330 Ga0209971_1033429 3300027682 Bacteria 1235
331 Ga0209998_10000777 3300027717 Bacteria 8268
332 Ga0209974_10010067 3300027876 Bacteria 3196
333 Ga0209974_10120213 3300027876 Unclassified 930
334 Ga0207428_10014691 3300027907 Bacteria 6787
335 Ga0207428_10019641 3300027907 Bacteria 5759
336 Ga0207428_10047592 3300027907 Bacteria 3443
337 Ga0207428_10119049 3300027907 Bacteria 2026
338 Ga0207428_10198600 3300027907 Bacteria 1510
339 Ga0268266_10005477 3300028379 Bacteria 11822
340 Ga0268266_10243375 3300028379 Bacteria 1661
341 Ga0268266_10265486 3300028379 Bacteria 1592
342 Ga0268266_11117378 3300028379 Bacteria 762
343 Ga0268265_10000559 3300028380 Bacteria 37946
344 Ga0268265_10007663 3300028380 Bacteria 7287
345 Ga0268265_10042522 3300028380 Bacteria 3372
346 Ga0268265_10149190 3300028380 Bacteria 1970
347 Ga0268264_10174279 3300028381 Bacteria 1948
348 Ga0265336_10019739 3300028666 Bacteria 2171
349 Ga0265338_10015048 3300028800 Bacteria 8538
350 Ga0265328_10110850 3300031239 Bacteria 1020
351 Ga0265331_10003256 3300031250 Bacteria 10585
352 Ga0307513_10408641 3300031456 Bacteria 1090
353 Ga0307408_100010613 3300031548 Bacteria 6077
354 Ga0307408_100076616 3300031548 Bacteria 2488
355 Ga0307408_100159822 3300031548 Bacteria 1789
356 Ga0307408_100275942 3300031548 Bacteria 1398
357 Ga0316575_10005923 3300031665 Bacteria 4375
358 Ga0316579_10004986 3300031691 Bacteria 5323
359 Ga0316579_10030530 3300031691 Unclassified 2464
360 Ga0316579_10181842 3300031691 Bacteria 1016
361 Ga0265314_10003713 3300031711 Bacteria 14618
362 Ga0316576_10012929 3300031727 Bacteria 5526
363 Ga0316576_10092883 3300031727 Bacteria 2248
364 Ga0316578_10002481 3300031728 Bacteria 8124
365 Ga0316578_10067143 3300031728 Bacteria 2119
366 Ga0307405_10479437 3300031731 Bacteria 993
367 Ga0316577_10236261 3300031733 Bacteria 1033
368 Ga0307413_10146505 3300031824 Bacteria 1640
369 Ga0307413_10357891 3300031824 Bacteria 1129
370 Ga0307410_10063148 3300031852 Bacteria 2540
371 Ga0307410_10492103 3300031852 Bacteria 1008
372 Ga0307410_11091041 3300031852 Bacteria 692
373 Ga0307410_11450691 3300031852 Bacteria 603
374 Ga0307406_10192152 3300031901 Bacteria 1495
375 Ga0307406_10269336 3300031901 Bacteria 1293
376 Ga0307406_10428153 3300031901 Bacteria 1056
377 Ga0307406_10755414 3300031901 Bacteria 817
378 Ga0307406_11393677 3300031901 Bacteria 614
379 Ga0307407_10467083 3300031903 Bacteria 919
380 Ga0307407_10858452 3300031903 Bacteria 694
381 Ga0307412_10117700 3300031911 Bacteria 1908
382 Ga0307409_101477730 3300031995 Bacteria 707
383 Ga0307416_100071953 3300032002 Bacteria 2875
384 Ga0307416_100176825 3300032002 Bacteria 1995
385 Ga0307416_100262339 3300032002 Bacteria 1689
386 Ga0307416_100923954 3300032002 Bacteria 973
387 Ga0307416_101502055 3300032002 Bacteria 779
388 Ga0307416_102261761 3300032002 Bacteria 644
389 Ga0307416_102264127 3300032002 Bacteria 644
390 Ga0307411_10050935 3300032005 Bacteria 2699
391 Ga0307411_10288486 3300032005 Unclassified 1310
392 Ga0307411_10740214 3300032005 Bacteria 860
393 Ga0307411_12048295 3300032005 Bacteria 535
394 Ga0307415_101435002 3300032126 Bacteria 658
395 Ga0316583_10039308 3300032133 Unclassified 1675
396 Ga0316585_10004868 3300032137 Bacteria 3769
397 Ga0316580_10004653 3300032139 Bacteria 3984
398 Ga0316580_10182750 3300032139 Bacteria 645
399 Ga0316593_10007229 3300032168 Bacteria 3042
400 Ga0316593_10030927 3300032168 Bacteria 1741
401 Ga0316592_1004098 3300033524 Bacteria 2685
402 Ga0316588_1000288 3300033528 Bacteria 6270
403 Ga0373940_0039046 3300035088 Bacteria 1298
404 Ga0373940_0125956 3300035088 Bacteria 799
405 Ga0373936_0138593 3300035113 Bacteria 1049
406 Ga0373939_0026335 3300035114 Bacteria 1638
407 Ga0373960_0065591 3300035121 Bacteria 1111
408 Ga0373942_0020873 3300035207 Bacteria 1648
409 Ga0373961_0204020 3300035241 Bacteria 699
410 Ga0373962_0033158 3300035242 Bacteria 1424
411 Ga0316574_0388611 3300035398 Unclassified 879
412 Ga0373931_0253530 3300035691 Bacteria 1071
413 Ga0373931_0290693 3300035691 Bacteria 1006
414 Ga0373927_0763152 3300035695 Bacteria 639
415 Ga0316582_0012410 3300036647 Bacteria 4754
416 Ga0316582_0408366 3300036647 Bacteria 936
417 Ga0316582_0630330 3300036647 Unclassified 737
418 Ga0316584_0030605 3300036712 Bacteria 3975
419 Ga0316584_0064963 3300036712 Bacteria 2733
420 Ga0395899_0037139 3300037312 Bacteria 3652
421 Ga0395899_0248203 3300037312 Bacteria 1222
422 Ga0395900_0257425 3300037418 Bacteria 1744
423 Ga0395898_0850017 3300037466 Bacteria 852
424 Ga0395901_0156565 3300038443 Bacteria 2393
425 Ga0436361_0206950 3300039447 Bacteria 229672
426 Ga0436361_0278271 3300039447 Bacteria 1598
427 Ga0451807_0905457 3300041486 Bacteria 634
428 Ga0451839_0832343 3300041496 Bacteria 1059
429 Ga0451849_0735254 3300041505 Bacteria 1541
430 Ga0451843_0091166 3300041509 Bacteria 735
431 Ga0439431_0066527 3300041997 Bacteria 955
432 Ga0439442_086621 3300042002 Unclassified 672
433 Ga0439435_0023736 3300042436 Bacteria 1613
434 Ga0451577_0016709 3300042876 Bacteria 6786
435 Ga0451577_0093219 3300042876 Bacteria 2689
436 Ga0451577_0225991 3300042876 Bacteria 1692
437 Ga0451577_0300670 3300042876 Bacteria 1454
438 Ga0451577_1386959 3300042876 Bacteria 623
439 Ga0439440_0046911 3300042993 Bacteria 1069
440 Ga0453684_0026226 3300044712 Bacteria 8429
441 Ga0453684_0059554 3300044712 Bacteria 4921
442 Ga0453684_0152886 3300044712 Bacteria 2740
443 Ga0453684_1093282 3300044712 Bacteria 843
444 Ga0466957_0231919 3300044842 Bacteria 1222
445 Ga0451576_0095049 3300045051 Bacteria 3100
446 Ga0451576_0340881 3300045051 Bacteria 1569
447 Ga0451576_0848943 3300045051 Bacteria 958
448 Ga0451576_1329397 3300045051 Bacteria 749
449 Ga0495603_0060561 3300046455 Bacteria 2237
450 Ga0495650_0011192 3300046471 Bacteria 4938
451 Ga0495584_0026762 3300046491 Bacteria 2923
452 Ga0495585_0082098 3300046492 Bacteria 1745
453 Ga0495594_0550188 3300046499 Bacteria 655
454 Ga0495583_0174842 3300046506 Bacteria 881
455 Ga0495666_0408072 3300046526 Bacteria 610
456 Ga0495642_0074576 3300046528 Bacteria 1423
457 Ga0495654_0149289 3300046530 Bacteria 1035
458 Ga0495640_0247995 3300046533 Bacteria 1116
459 Ga0495586_0237775 3300046535 Bacteria 1038
460 Ga0495597_0288313 3300046542 Bacteria 638
461 Ga0495597_0361530 3300046542 Bacteria 556
462 Ga0495622_0001863 3300046557 Bacteria 10384
463 Ga0495622_0013116 3300046557 Bacteria 3845
464 Ga0495622_0121340 3300046557 Bacteria 1193
465 Ga0495622_0135269 3300046557 Bacteria 1121
466 Ga0495625_0003302 3300046660 Bacteria 16275
467 Ga0495661_0251527 3300046665 Bacteria 902
468 Ga0495588_0678296 3300046674 Bacteria 539
469 Ga0495646_0268391 3300046680 Bacteria 910
470 Ga0495658_0827217 3300046683 Bacteria 593
471 Ga0495670_0496648 3300046691 Bacteria 662
472 Ga0495670_0832801 3300046691 Bacteria 504
473 Ga0495671_0355432 3300046692 Bacteria 702
474 Ga0495649_0093864 3300046694 Bacteria 1597
475 Ga0495649_0097282 3300046694 Bacteria 1566
476 Ga0495589_0237558 3300046794 Bacteria 853
477 Ga0495604_0262157 3300047317 Bacteria 1174
478 Ga0495672_0096260 3300047320 Bacteria 1614
479 Ga0495672_0192512 3300047320 Bacteria 1024
480 Ga0495672_0355582 3300047320 Bacteria 679
481 Ga0495683_0033315 3300047323 Bacteria 2622
482 Ga0495675_0591902 3300047444 Bacteria 629
483 Ga0495686_0135295 3300047472 Bacteria 1458
484 Ga0495626_0061472 3300048091 Bacteria 1708
485 Ga0496100_0017786 3300048903 Bacteria 4204
486 Ga0496101_0090865 3300048904 Bacteria 2271
487 Ga0496102_0013609 3300048905 Bacteria 7050
488 Ga0496103_0008254 3300048906 Bacteria 6183
489 Ga0496104_0004105 3300048907 Bacteria 12640
490 Ga0496105_0006945 3300048908 Bacteria 8720
491 Ga0496106_0003137 3300048909 Bacteria 12334
492 Ga0496107_0121258 3300048910 Bacteria 1926
493 Ga0496108_0000439 3300048911 Bacteria 33419
494 Ga0496109_0012084 3300048912 Bacteria 7441
495 Ga0496109_0050637 3300048912 Bacteria 3782
496 Ga0496110_0038398 3300048913 Bacteria 4166
497 Ga0496110_0097051 3300048913 Bacteria 2641
498 Ga0496110_0157362 3300048913 Bacteria 2059
499 Ga0496110_0743893 3300048913 Bacteria 883
500 Ga0496111_0002013 3300048914 Bacteria 12084
501 Ga0496112_0151100 3300048915 Bacteria 2289
502 Ga0496112_0806207 3300048915 Bacteria 863
503 Ga0496113_0003053 3300048916 Bacteria 9923
504 Ga0496113_0010563 3300048916 Bacteria 6110
505 Ga0496114_0051384 3300048917 Bacteria 3432
506 Ga0496114_0308746 3300048917 Bacteria 1397
507 Ga0496116_0007463 3300048919 Bacteria 9690
508 Ga0496117_0030682 3300048920 Bacteria 4119
509 Ga0496118_0061027 3300048921 Bacteria 2795
510 Ga0496119_0001639 3300048922 Bacteria 26359
511 Ga0496121_0133348 3300048924 Bacteria 1855
512 Ga0496122_0010776 3300048925 Bacteria 9375
513 Ga0496123_0047529 3300048926 Bacteria 2898
514 Ga0496124_0231815 3300048927 Bacteria 1380
515 Ga0496124_0340649 3300048927 Bacteria 1065
516 Ga0496125_0011191 3300048928 Bacteria 8993
517 Ga0496126_0005200 3300048929 Bacteria 15027
518 Ga0496126_0416475 3300048929 Bacteria 1087
519 Ga0501306_006040 3300049127 Bacteria 1408
520 Ga0501309_007194 3300049129 Bacteria 1375
521 Ga0501341_00934 3300049131 Bacteria 1363
522 Ga0501305_007242 3300049161 Bacteria 1402
523 Ga0501299_012310 3300049522 Bacteria 1457
524 Ga0501311_003353 3300049527 Bacteria 1625
525 Ga0501312_005299 3300049528 Bacteria 1560
526 Ga0501312_079865 3300049528 Bacteria 591
527 Ga0501313_001030 3300049529 Bacteria 2246
528 Ga0501315_001241 3300049531 Bacteria 2121
529 Ga0501316_000041 3300049532 Bacteria 5313
530 Ga0501316_037266 3300049532 Bacteria 668
531 Ga0501317_000055 3300049533 Bacteria 5224
532 Ga0501318_000041 3300049534 Bacteria 5269
533 Ga0501319_001286 3300049535 Bacteria 1422
534 Ga0501320_002486 3300049536 Bacteria 1477
535 Ga0501322_000303 3300049538 Bacteria 2186
536 Ga0501323_001339 3300049539 Bacteria 2155
537 Ga0501324_000661 3300049540 Bacteria 1984
538 Ga0501326_00773 3300049542 Bacteria 1352
539 Ga0501327_00858 3300049543 Bacteria 1350
540 Ga0501328_00414 3300049544 Bacteria 1412
541 Ga0501330_000576 3300049546 Bacteria 1621
542 Ga0501330_000702 3300049546 Bacteria 1530
543 Ga0501332_00916 3300049548 Bacteria 1434
544 Ga0501334_00126 3300049550 Bacteria 2732
545 Ga0501335_001289 3300049551 Bacteria 1899
546 Ga0501338_00929 3300049554 Bacteria 1469
547 Ga0501032_0204347 3300049569 Bacteria 1289
548 Ga0501033_0113017 3300049570 Bacteria 1975
549 Ga0501033_0686164 3300049570 Bacteria 698
550 Ga0501034_0142026 3300049571 Bacteria 2380
551 Ga0501037_0165220 3300049573 Bacteria 1576
552 Ga0501039_1253613 3300049575 Bacteria 573
553 Ga0501041_0859781 3300049577 Bacteria 582
554 Ga0501042_0278558 3300049578 Bacteria 1208
555 Ga0501043_0049648 3300049579 Bacteria 3299
556 Ga0501046_0046018 3300049580 Bacteria 3464
557 Ga0501046_0177478 3300049580 Bacteria 1595
558 Ga0501046_0177669 3300049580 Bacteria 1594
559 Ga0501047_0103849 3300049581 Bacteria 2722
560 Ga0501047_0138814 3300049581 Bacteria 2310
561 Ga0501070_0043737 3300049586 Bacteria 3727
562 Ga0501070_0538095 3300049586 Bacteria 936
563 Ga0501072_0397019 3300049588 Bacteria 1094
564 Ga0501073_0441407 3300049589 Bacteria 900
565 Ga0501075_0120353 3300049591 Bacteria 1998
566 Ga0501206_099439 3300049653 Bacteria 526
567 Ga0501217_126908 3300049661 Bacteria 745
568 Ga0501253_061421 3300049683 Bacteria 811
569 Ga0501245_047812 3300049708 Bacteria 751
570 Ga0501079_0649130 3300049741 Bacteria 831
571 Ga0501079_1622603 3300049741 Bacteria 509
572 Ga0501080_0348399 3300049742 Bacteria 1338
573 Ga0501080_0845063 3300049742 Bacteria 801
574 Ga0501081_0400441 3300049743 Bacteria 1016
575 Ga0501232_074106 3300049757 Bacteria 567
576 Ga0501035_0034484 3300049822 Bacteria 4598
577 Ga0501044_0030186 3300049823 Bacteria 5714
578 Ga0501044_0137498 3300049823 Bacteria 2434
579 Ga0501044_0230890 3300049823 Bacteria 1798
580 nmdc:mga00v17_52782_c1 3300050491 Bacteria 2475
581 nmdc:mga0yw44_52322_c1 3300050492 Bacteria 2475
582 nmdc:mga06z11_977402_c1 3300050494 Bacteria 516
583 nmdc:mga05p37_12690_c1 3300050507 Bacteria 10069
584 nmdc:mga05p37_2097308_c1 3300050507 Bacteria 530
585 nmdc:mga05p37_942147_c1 3300050507 Bacteria 925
586 nmdc:mga09592_180578_c1 3300050508 Bacteria 1826
587 nmdc:mga09592_3569_c1 3300050508 Bacteria 12561
588 nmdc:mga09592_558458_c1 3300050508 Bacteria 983
589 nmdc:mga09592_57438_c1 3300050508 Bacteria 3289
590 nmdc:mga0qj67_18582_c1 3300050509 Bacteria 5298
591 nmdc:mga0qj67_24831_c1 3300050509 Bacteria 4624
592 nmdc:mga0qj67_58667_c1 3300050509 Bacteria 3052
593 nmdc:mga0qj67_761181_c1 3300050509 Bacteria 768
594 nmdc:mga0qj67_9189_c1 3300050509 Bacteria 7341
595 nmdc:mga06r32_109833_c1 3300050510 Bacteria 2712
596 nmdc:mga06r32_20977_c1 3300050510 Bacteria 6025
597 nmdc:mga06r32_29_c1 3300050510 Bacteria 85620
598 nmdc:mga06r32_69838_c1 3300050510 Bacteria 3396
599 nmdc:mga06r32_745_c1 3300050510 Bacteria 28580
600 nmdc:mga08y16_101800_c1 3300050511 Bacteria 2990
601 nmdc:mga08y16_1085_c1 3300050511 Bacteria 26787
602 nmdc:mga08y16_12457_c1 3300050511 Bacteria 8946
603 nmdc:mga08y16_126615_c1 3300050511 Bacteria 2657
604 nmdc:mga08y16_21601_c1 3300050511 Bacteria 6797
605 nmdc:mga08y16_385305_c1 3300050511 Bacteria 1436
606 nmdc:mga08y16_40025_c1 3300050511 Bacteria 4915
607 nmdc:mga08y16_94823_c1 3300050511 Bacteria 3109
608 nmdc:mga0n895_271212_c1 3300050512 Bacteria 1721
609 Ga0500635_0389313 3300053080 Bacteria 552
610 Ga0500578_0273891 3300053086 Bacteria 1009
611 Ga0500583_0071895 3300053092 Bacteria 1656
612 Ga0500583_0173687 3300053092 Bacteria 1073
613 Ga0500651_0334610 3300053093 Bacteria 862
614 Ga0500650_0183134 3300053098 Bacteria 959
615 Ga0500556_0435124 3300053104 Bacteria 500
616 Ga0500594_0237034 3300053118 Bacteria 605
617 Ga0500595_005260 3300053119 Bacteria 5672
618 Ga0500652_000461 3300053131 Bacteria 14425
619 Ga0500655_030809 3300053133 Bacteria 1033
620 Ga0500658_0195587 3300053134 Bacteria 924
621 Ga0500588_0001145 3300053146 Bacteria 4874
622 Ga0500588_0010637 3300053146 Bacteria 2229
623 Ga0500604_0054172 3300053151 Bacteria 1245
624 Ga0500622_0003682 3300053156 Bacteria 10060
625 Ga0500622_0010223 3300053156 Bacteria 5158
626 Ga0500637_0000274 3300053178 Bacteria 19244
627 Ga0500637_0227349 3300053178 Bacteria 1052
628 Ga0500637_0310866 3300053178 Bacteria 855
629 Ga0500601_001029 3300053737 Bacteria 3201
630 Ga0501084_0493529 3300054114 Bacteria 1035
631 Ga0501084_1271753 3300054114 Bacteria 617
632 Ga0590075_147239 3300059424 Unclassified 620
633 Ga0587128_123185 3300059630 Unclassified 566
634 Ga0587114_012855 3300059655 Bacteria 1068
635 Ga0530510_0269732 3300061734 Bacteria 1270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0361530 Ga0495597_0361530_55_495 119
2 3300046557 Ga0495622_0013116 Ga0495622_0013116_1665_2105 119
3 3300046691 Ga0495670_0832801 Ga0495670_0832801_23_463 119
4 3300046694 Ga0495649_0097282 Ga0495649_0097282_44_484 119
5 3300026067 Ga0207678_10288954 Ga0207678_102889542 121
6 3300037466 Ga0395898_0850017 Ga0395898_0850017_281_679 121
7 3300003187 JGI25151J46595_10010063 JGI25151J46595_100100635 122
8 3300003316 rootH1_10008501 rootH1_100085017 122
9 3300003322 rootL2_10034951 rootL2_100349518 122
10 3300003323 rootH1_10112062 rootH1_101120622 122
11 3300003578 Ga0006562J51391_1000948 Ga0006562J51391_100094817 122
12 3300003758 Ga0055532_1004114 Ga0055532_10041143 122
13 3300005331 Ga0070670_100466076 Ga0070670_1004660762 122
14 3300005354 Ga0070675_100104699 Ga0070675_1001046992 122
15 3300005355 Ga0070671_100013991 Ga0070671_1000139913 122
16 3300005543 Ga0070672_100011947 Ga0070672_1000119475 122
17 3300005548 Ga0070665_100333268 Ga0070665_1003332682 122
18 3300006163 Ga0070715_10212121 Ga0070715_102121212 122
19 3300009036 Ga0105244_10265795 Ga0105244_102657951 122
20 3300009092 Ga0105250_10073926 Ga0105250_100739262 122
21 3300009098 Ga0105245_10037225 Ga0105245_100372255 122
22 3300009101 Ga0105247_10064863 Ga0105247_100648632 122
23 3300009148 Ga0105243_10021747 Ga0105243_100217475 122
24 3300009176 Ga0105242_10017403 Ga0105242_100174033 122
25 3300010375 Ga0105239_10976283 Ga0105239_109762832 122
26 3300011119 Ga0105246_10006304 Ga0105246_100063042 122
27 3300013296 Ga0157374_10201778 Ga0157374_102017782 122
28 3300013297 Ga0157378_10065072 Ga0157378_100650723 122
29 3300013307 Ga0157372_10180157 Ga0157372_101801572 122
30 3300025229 Ga0209147_101571 Ga0209147_1015713 122
31 3300025273 Ga0209673_1001821 Ga0209673_100182116 122
32 3300025294 Ga0209025_1128520 Ga0209025_11285201 122
33 3300025711 Ga0207696_1019848 Ga0207696_10198482 122
34 3300025728 Ga0207655_1001341 Ga0207655_100134116 122
35 3300025735 Ga0207713_1000472 Ga0207713_100047231 122
36 3300025900 Ga0207710_10008538 Ga0207710_100085382 122
37 3300025903 Ga0207680_10315621 Ga0207680_103156212 122
38 3300025905 Ga0207685_10207650 Ga0207685_102076502 122
39 3300025926 Ga0207659_10668837 Ga0207659_106688372 122
40 3300025927 Ga0207687_10194604 Ga0207687_101946042 122
41 3300025931 Ga0207644_10019360 Ga0207644_100193603 122
42 3300025934 Ga0207686_10266591 Ga0207686_102665912 122
43 3300025935 Ga0207709_10011396 Ga0207709_100113962 122
44 3300028379 Ga0268266_10265486 Ga0268266_102654862 122
45 3300031548 Ga0307408_100076616 Ga0307408_1000766163 122
46 3300031995 Ga0307409_101477730 Ga0307409_1014777302 122
47 3300032002 Ga0307416_100071953 Ga0307416_1000719533 122
48 3300046491 Ga0495584_0026762 Ga0495584_0026762_2186_2620 122
49 3300046492 Ga0495585_0082098 Ga0495585_0082098_574_1008 122
50 3300046557 Ga0495622_0121340 Ga0495622_0121340_395_829 122
51 3300046665 Ga0495661_0251527 Ga0495661_0251527_262_696 122
52 3300046674 Ga0495588_0678296 Ga0495588_0678296_49_483 122
53 3300046691 Ga0495670_0496648 Ga0495670_0496648_165_599 122
54 3300047323 Ga0495683_0033315 Ga0495683_0033315_302_736 122
55 3300048903 Ga0496100_0017786 Ga0496100_0017786_3702_4136 122
56 3300048904 Ga0496101_0090865 Ga0496101_0090865_769_1203 122
57 3300048905 Ga0496102_0013609 Ga0496102_0013609_2721_3155 122
58 3300048906 Ga0496103_0008254 Ga0496103_0008254_1837_2271 122
59 3300048907 Ga0496104_0004105 Ga0496104_0004105_3908_4342 122
60 3300048908 Ga0496105_0006945 Ga0496105_0006945_3774_4208 122
61 3300048909 Ga0496106_0003137 Ga0496106_0003137_1015_1449 122
62 3300048910 Ga0496107_0121258 Ga0496107_0121258_1179_1613 122
63 3300048911 Ga0496108_0000439 Ga0496108_0000439_24142_24576 122
64 3300048912 Ga0496109_0012084 Ga0496109_0012084_2721_3155 122
65 3300048913 Ga0496110_0038398 Ga0496110_0038398_1849_2283 122
66 3300048914 Ga0496111_0002013 Ga0496111_0002013_765_1199 122
67 3300048915 Ga0496112_0806207 Ga0496112_0806207_302_736 122
68 3300048916 Ga0496113_0003053 Ga0496113_0003053_4036_4470 122
69 3300048917 Ga0496114_0051384 Ga0496114_0051384_2619_3053 122
70 3300048919 Ga0496116_0007463 Ga0496116_0007463_4036_4470 122
71 3300048920 Ga0496117_0030682 Ga0496117_0030682_568_1002 122
72 3300048921 Ga0496118_0061027 Ga0496118_0061027_1586_2020 122
73 3300048922 Ga0496119_0001639 Ga0496119_0001639_25858_26292 122
74 3300048924 Ga0496121_0133348 Ga0496121_0133348_1394_1828 122
75 3300048925 Ga0496122_0010776 Ga0496122_0010776_2212_2646 122
76 3300048926 Ga0496123_0047529 Ga0496123_0047529_540_974 122
77 3300048927 Ga0496124_0231815 Ga0496124_0231815_363_797 122
78 3300048928 Ga0496125_0011191 Ga0496125_0011191_51_485 122
79 3300048929 Ga0496126_0005200 Ga0496126_0005200_3912_4346 122
80 3300049127 Ga0501306_006040 Ga0501306_006040_897_1331 122
81 3300049129 Ga0501309_007194 Ga0501309_007194_898_1332 122
82 3300049131 Ga0501341_00934 Ga0501341_00934_41_475 122
83 3300049161 Ga0501305_007242 Ga0501305_007242_61_495 122
84 3300049527 Ga0501311_003353 Ga0501311_003353_889_1323 122
85 3300049528 Ga0501312_005299 Ga0501312_005299_888_1322 122
86 3300049529 Ga0501313_001030 Ga0501313_001030_404_838 122
87 3300049531 Ga0501315_001241 Ga0501315_001241_1616_2050 122
88 3300049532 Ga0501316_000041 Ga0501316_000041_3388_3822 122
89 3300049533 Ga0501317_000055 Ga0501317_000055_3386_3820 122
90 3300049534 Ga0501318_000041 Ga0501318_000041_3386_3820 122
91 3300049535 Ga0501319_001286 Ga0501319_001286_44_478 122
92 3300049536 Ga0501320_002486 Ga0501320_002486_997_1431 122
93 3300049538 Ga0501322_000303 Ga0501322_000303_378_812 122
94 3300049539 Ga0501323_001339 Ga0501323_001339_1380_1814 122
95 3300049540 Ga0501324_000661 Ga0501324_000661_103_537 122
96 3300049542 Ga0501326_00773 Ga0501326_00773_25_459 122
97 3300049543 Ga0501327_00858 Ga0501327_00858_25_459 122
98 3300049544 Ga0501328_00414 Ga0501328_00414_47_481 122
99 3300049546 Ga0501330_000576 Ga0501330_000576_267_701 122
100 3300049548 Ga0501332_00916 Ga0501332_00916_78_512 122
101 3300049551 Ga0501335_001289 Ga0501335_001289_25_459 122
102 3300049554 Ga0501338_00929 Ga0501338_00929_22_456 122
103 3300049653 Ga0501206_099439 Ga0501206_099439_50_484 122
104 3300049661 Ga0501217_126908 Ga0501217_126908_262_696 122
105 3300049683 Ga0501253_061421 Ga0501253_061421_215_649 122
106 3300049708 Ga0501245_047812 Ga0501245_047812_103_537 122
107 3300049757 Ga0501232_074106 Ga0501232_074106_40_474 122
108 3300061734 Ga0530510_0269732 Ga0530510_0269732_571_1005 122
109 3300050511 nmdc:mga08y16_126615_c1 nmdc:mga08y16_126615_c1_2238_2636 124
110 3300049578 Ga0501042_0278558 Ga0501042_0278558_291_713 136
111 3300049591 Ga0501075_0120353 Ga0501075_0120353_1387_1809 136
112 3300049741 Ga0501079_1622603 Ga0501079_1622603_71_493 136
113 3300054114 Ga0501084_1271753 Ga0501084_1271753_129_551 136
114 iso_pu_bacteria 2977254563 2977256002 137
115 iso_pu_bacteria 3001892409 3001895290 137
116 iso_pu_bacteria 2990275345 2990276848 138
117 3300010375 Ga0105239_11159321 Ga0105239_111593212 139
118 3300049743 Ga0501081_0400441 Ga0501081_0400441_109_549 139
119 3300046557 Ga0495622_0135269 Ga0495622_0135269_263_706 140
120 3300048913 Ga0496110_0743893 Ga0496110_0743893_349_792 140
121 3300049546 Ga0501330_000702 Ga0501330_000702_200_643 140
122 3300049586 Ga0501070_0538095 Ga0501070_0538095_233_679 140
123 3300049741 Ga0501079_0649130 Ga0501079_0649130_58_498 140
124 3300049823 Ga0501044_0230890 Ga0501044_0230890_639_1085 140
125 3300054114 Ga0501084_0493529 Ga0501084_0493529_137_577 140
126 3300006175 Ga0070712_101215316 Ga0070712_1012153162 141
127 3300049528 Ga0501312_079865 Ga0501312_079865_132_575 141
128 3300049532 Ga0501316_037266 Ga0501316_037266_44_487 141
129 3300049550 Ga0501334_00126 Ga0501334_00126_54_500 141
130 3300005434 Ga0070709_10338902 Ga0070709_103389022 142
131 3300005435 Ga0070714_100704938 Ga0070714_1007049381 142
132 3300005437 Ga0070710_10170391 Ga0070710_101703911 142
133 3300006846 Ga0075430_100029879 Ga0075430_1000298795 142
134 3300025898 Ga0207692_10395306 Ga0207692_103953061 142
135 3300025906 Ga0207699_10176362 Ga0207699_101763622 142
136 3300025929 Ga0207664_10711767 Ga0207664_107117671 142
137 3300050509 nmdc:mga0qj67_24831_c1 nmdc:mga0qj67_24831_c1_2345_2821 142
138 3300025942 Ga0207689_10074642 Ga0207689_100746423 143
139 3300026088 Ga0207641_10123034 Ga0207641_101230342 144
140 3300031727 Ga0316576_10012929 Ga0316576_100129293 144
141 3300031728 Ga0316578_10002481 Ga0316578_100024817 144
142 3300032139 Ga0316580_10182750 Ga0316580_101827501 144
143 3300035088 Ga0373940_0039046 Ga0373940_0039046_148_612 144
144 3300035114 Ga0373939_0026335 Ga0373939_0026335_232_696 144
145 3300035207 Ga0373942_0020873 Ga0373942_0020873_1126_1590 144
146 3300035695 Ga0373927_0763152 Ga0373927_0763152_140_604 144
147 3300036647 Ga0316582_0630330 Ga0316582_0630330_150_605 144
148 3300036712 Ga0316584_0064963 Ga0316584_0064963_486_941 144
149 3300046455 Ga0495603_0060561 Ga0495603_0060561_625_1089 144
150 3300046499 Ga0495594_0550188 Ga0495594_0550188_136_600 144
151 3300046506 Ga0495583_0174842 Ga0495583_0174842_80_544 144
152 3300046528 Ga0495642_0074576 Ga0495642_0074576_851_1315 144
153 3300046530 Ga0495654_0149289 Ga0495654_0149289_279_743 144
154 3300046542 Ga0495597_0288313 Ga0495597_0288313_97_564 144
155 3300046557 Ga0495622_0001863 Ga0495622_0001863_41_508 144
156 3300046692 Ga0495671_0355432 Ga0495671_0355432_180_644 144
157 3300046694 Ga0495649_0093864 Ga0495649_0093864_231_695 144
158 3300046794 Ga0495589_0237558 Ga0495589_0237558_273_737 144
159 3300047320 Ga0495672_0192512 Ga0495672_0192512_387_851 144
160 3300048091 Ga0495626_0061472 Ga0495626_0061472_943_1407 144
161 3300053080 Ga0500635_0389313 Ga0500635_0389313_27_494 144
162 3300053086 Ga0500578_0273891 Ga0500578_0273891_420_884 144
163 3300053133 Ga0500655_030809 Ga0500655_030809_37_504 144
164 3300053178 Ga0500637_0000274 Ga0500637_0000274_14263_14736 144
165 3300053178 Ga0500637_0310866 Ga0500637_0310866_211_675 144
166 3300004803 Ga0058862_11585074 Ga0058862_115850743 145
167 3300005334 Ga0068869_100065870 Ga0068869_1000658703 145
168 3300005341 Ga0070691_10365677 Ga0070691_103656772 145
169 3300005344 Ga0070661_100393101 Ga0070661_1003931012 145
170 3300005345 Ga0070692_10022839 Ga0070692_100228395 145
171 3300005354 Ga0070675_101620232 Ga0070675_1016202322 145
172 3300005364 Ga0070673_101605862 Ga0070673_1016058622 145
173 3300005365 Ga0070688_100614490 Ga0070688_1006144902 145
174 3300005438 Ga0070701_10006243 Ga0070701_100062432 145
175 3300005441 Ga0070700_100042341 Ga0070700_1000423412 145
176 3300005444 Ga0070694_100458500 Ga0070694_1004585002 145
177 3300005459 Ga0068867_100036820 Ga0068867_1000368205 145
178 3300005545 Ga0070695_100396481 Ga0070695_1003964811 145
179 3300005549 Ga0070704_100036982 Ga0070704_1000369822 145
180 3300005719 Ga0068861_100017222 Ga0068861_1000172222 145
181 3300005719 Ga0068861_101529215 Ga0068861_1015292151 145
182 3300005840 Ga0068870_10230120 Ga0068870_102301202 145
183 3300005844 Ga0068862_100009915 Ga0068862_1000099157 145
184 3300006846 Ga0075430_100010186 Ga0075430_10001018610 145
185 3300006880 Ga0075429_100029953 Ga0075429_1000299535 145
186 3300009093 Ga0105240_10053016 Ga0105240_100530163 145
187 3300009094 Ga0111539_10012659 Ga0111539_100126595 145
188 3300009098 Ga0105245_10881618 Ga0105245_108816182 145
189 3300009148 Ga0105243_10155869 Ga0105243_101558692 145
190 3300010375 Ga0105239_10319122 Ga0105239_103191222 145
191 3300014326 Ga0157380_10562052 Ga0157380_105620522 145
192 3300020080 Ga0206350_10161612 Ga0206350_101616123 145
193 3300021361 Ga0213872_10000514 Ga0213872_100005143 145
194 3300021361 Ga0213872_10074827 Ga0213872_100748272 145
195 3300025913 Ga0207695_10130671 Ga0207695_101306713 145
196 3300025917 Ga0207660_10101854 Ga0207660_101018543 145
197 3300025918 Ga0207662_10788673 Ga0207662_107886731 145
198 3300025926 Ga0207659_10211389 Ga0207659_102113892 145
199 3300025927 Ga0207687_10603955 Ga0207687_106039552 145
200 3300025935 Ga0207709_10385063 Ga0207709_103850632 145
201 3300025936 Ga0207670_10135651 Ga0207670_101356512 145
202 3300025938 Ga0207704_10409003 Ga0207704_104090032 145
203 3300025942 Ga0207689_10252163 Ga0207689_102521632 145
204 3300026075 Ga0207708_10013991 Ga0207708_100139913 145
205 3300026089 Ga0207648_10029655 Ga0207648_100296555 145
206 3300026118 Ga0207675_100028971 Ga0207675_1000289712 145
207 3300026118 Ga0207675_100273562 Ga0207675_1002735621 145
208 3300027471 Ga0209995_1050258 Ga0209995_10502582 145
209 3300027876 Ga0209974_10120213 Ga0209974_101202132 145
210 3300027907 Ga0207428_10119049 Ga0207428_101190492 145
211 3300028380 Ga0268265_10007663 Ga0268265_100076636 145
212 3300028666 Ga0265336_10019739 Ga0265336_100197392 145
213 3300028800 Ga0265338_10015048 Ga0265338_100150487 145
214 3300031239 Ga0265328_10110850 Ga0265328_101108502 145
215 3300031250 Ga0265331_10003256 Ga0265331_100032567 145
216 3300031711 Ga0265314_10003713 Ga0265314_100037138 145
217 3300032002 Ga0307416_101502055 Ga0307416_1015020552 145
218 3300035691 Ga0373931_0290693 Ga0373931_0290693_138_590 145
219 3300039447 Ga0436361_0206950 Ga0436361_0206950_120043_120504 145
220 3300039447 Ga0436361_0278271 Ga0436361_0278271_565_1029 145
221 3300047472 Ga0495686_0135295 Ga0495686_0135295_69_533 145
222 3300049569 Ga0501032_0204347 Ga0501032_0204347_85_546 145
223 3300049570 Ga0501033_0113017 Ga0501033_0113017_699_1148 145
224 3300049571 Ga0501034_0142026 Ga0501034_0142026_1171_1632 145
225 3300049573 Ga0501037_0165220 Ga0501037_0165220_675_1124 145
226 3300049579 Ga0501043_0049648 Ga0501043_0049648_980_1429 145
227 3300049580 Ga0501046_0177478 Ga0501046_0177478_946_1407 145
228 3300049580 Ga0501046_0177669 Ga0501046_0177669_825_1274 145
229 3300049581 Ga0501047_0103849 Ga0501047_0103849_661_1110 145
230 3300049581 Ga0501047_0138814 Ga0501047_0138814_1309_1770 145
231 3300049586 Ga0501070_0043737 Ga0501070_0043737_864_1313 145
232 3300049588 Ga0501072_0397019 Ga0501072_0397019_626_1078 145
233 3300049589 Ga0501073_0441407 Ga0501073_0441407_184_633 145
234 3300049742 Ga0501080_0348399 Ga0501080_0348399_471_920 145
235 3300049742 Ga0501080_0845063 Ga0501080_0845063_148_600 145
236 3300049822 Ga0501035_0034484 Ga0501035_0034484_992_1441 145
237 3300049823 Ga0501044_0030186 Ga0501044_0030186_2815_3264 145
238 3300049823 Ga0501044_0137498 Ga0501044_0137498_812_1273 145
239 3300050492 nmdc:mga0yw44_52322_c1 nmdc:mga0yw44_52322_c1_2004_2444 145
240 3300050508 nmdc:mga09592_57438_c1 nmdc:mga09592_57438_c1_1091_1543 145
241 3300050509 nmdc:mga0qj67_18582_c1 nmdc:mga0qj67_18582_c1_3698_4150 145
242 3300050511 nmdc:mga08y16_101800_c1 nmdc:mga08y16_101800_c1_2338_2790 145
243 3300050511 nmdc:mga08y16_21601_c1 nmdc:mga08y16_21601_c1_3095_3547 145
244 3300050511 nmdc:mga08y16_385305_c1 nmdc:mga08y16_385305_c1_390_842 145
245 3300053131 Ga0500652_000461 Ga0500652_000461_11691_12167 145
246 3300053737 Ga0500601_001029 Ga0500601_001029_1368_1841 145
247 3300059630 Ga0587128_123185 Ga0587128_123185_54_500 145
248 3300059655 Ga0587114_012855 Ga0587114_012855_290_736 145
249 3300005367 Ga0070667_101041581 Ga0070667_1010415811 146
250 3300005530 Ga0070679_100988426 Ga0070679_1009884262 146
251 3300005563 Ga0068855_100848707 Ga0068855_1008487072 146
252 3300005614 Ga0068856_100098495 Ga0068856_1000984952 146
253 3300009093 Ga0105240_10095439 Ga0105240_100954392 146
254 3300009093 Ga0105240_10133832 Ga0105240_101338322 146
255 3300009093 Ga0105240_10453866 Ga0105240_104538662 146
256 3300009174 Ga0105241_10959760 Ga0105241_109597602 146
257 3300009174 Ga0105241_10969160 Ga0105241_109691602 146
258 3300009545 Ga0105237_10210806 Ga0105237_102108064 146
259 3300009545 Ga0105237_10235889 Ga0105237_102358892 146
260 3300009551 Ga0105238_10240191 Ga0105238_102401913 146
261 3300009551 Ga0105238_11645396 Ga0105238_116453962 146
262 3300025913 Ga0207695_10224533 Ga0207695_102245332 146
263 3300025913 Ga0207695_10738339 Ga0207695_107383392 146
264 3300025913 Ga0207695_10749189 Ga0207695_107491892 146
265 3300025914 Ga0207671_10114232 Ga0207671_101142322 146
266 3300025914 Ga0207671_10404758 Ga0207671_104047583 146
267 3300025924 Ga0207694_10001823 Ga0207694_1000182313 146
268 3300025949 Ga0207667_10687442 Ga0207667_106874422 146
269 3300026078 Ga0207702_10111968 Ga0207702_101119685 146
270 3300031665 Ga0316575_10005923 Ga0316575_100059232 146
271 3300031691 Ga0316579_10004986 Ga0316579_100049862 146
272 3300031691 Ga0316579_10030530 Ga0316579_100305303 146
273 3300031691 Ga0316579_10181842 Ga0316579_101818422 146
274 3300031727 Ga0316576_10092883 Ga0316576_100928832 146
275 3300031728 Ga0316578_10067143 Ga0316578_100671432 146
276 3300031733 Ga0316577_10236261 Ga0316577_102362612 146
277 3300032133 Ga0316583_10039308 Ga0316583_100393082 146
278 3300032137 Ga0316585_10004868 Ga0316585_100048682 146
279 3300032139 Ga0316580_10004653 Ga0316580_100046532 146
280 3300032168 Ga0316593_10007229 Ga0316593_100072293 146
281 3300032168 Ga0316593_10030927 Ga0316593_100309273 146
282 3300033524 Ga0316592_1004098 Ga0316592_10040982 146
283 3300033528 Ga0316588_1000288 Ga0316588_10002883 146
284 3300035398 Ga0316574_0388611 Ga0316574_0388611_114_569 146
285 3300036647 Ga0316582_0012410 Ga0316582_0012410_3920_4375 146
286 3300036647 Ga0316582_0408366 Ga0316582_0408366_174_638 146
287 3300036712 Ga0316584_0030605 Ga0316584_0030605_3279_3734 146
288 3300037312 Ga0395899_0037139 Ga0395899_0037139_2816_3283 146
289 3300037312 Ga0395899_0248203 Ga0395899_0248203_48_515 146
290 3300037418 Ga0395900_0257425 Ga0395900_0257425_516_983 146
291 3300038443 Ga0395901_0156565 Ga0395901_0156565_1153_1620 146
292 3300053098 Ga0500650_0183134 Ga0500650_0183134_357_824 146
293 3300053146 Ga0500588_0010637 Ga0500588_0010637_595_1062 146
294 2162886007 SwRhRL2b_contig_1005527 SwRhRL2b_0962.00003360 147
295 2162886012 MBSR1b_contig_1214556 MBSR1b_0359.00000110 147
296 3300002070 JGI24750J21931_1041354 JGI24750J21931_10413542 147
297 3300005289 Ga0065704_10000411 Ga0065704_1000041128 147
298 3300005290 Ga0065712_10003849 Ga0065712_100038493 147
299 3300005293 Ga0065715_10092544 Ga0065715_100925445 147
300 3300005295 Ga0065707_10081966 Ga0065707_1008196625 147
301 3300005327 Ga0070658_10323747 Ga0070658_103237471 147
302 3300005328 Ga0070676_10032981 Ga0070676_100329816 147
303 3300005328 Ga0070676_10178973 Ga0070676_101789733 147
304 3300005328 Ga0070676_10668482 Ga0070676_106684821 147
305 3300005331 Ga0070670_100022137 Ga0070670_1000221374 147
306 3300005331 Ga0070670_100173857 Ga0070670_1001738572 147
307 3300005334 Ga0068869_100017831 Ga0068869_1000178314 147
308 3300005334 Ga0068869_100757560 Ga0068869_1007575602 147
309 3300005336 Ga0070680_100014471 Ga0070680_1000144717 147
310 3300005336 Ga0070680_100082155 Ga0070680_1000821553 147
311 3300005337 Ga0070682_100117396 Ga0070682_1001173962 147
312 3300005337 Ga0070682_100801400 Ga0070682_1008014001 147
313 3300005338 Ga0068868_100026036 Ga0068868_1000260365 147
314 3300005340 Ga0070689_100008629 Ga0070689_1000086295 147
315 3300005343 Ga0070687_100139086 Ga0070687_1001390861 147
316 3300005344 Ga0070661_100007962 Ga0070661_1000079622 147
317 3300005344 Ga0070661_101086293 Ga0070661_1010862932 147
318 3300005345 Ga0070692_10268656 Ga0070692_102686562 147
319 3300005347 Ga0070668_100031631 Ga0070668_1000316313 147
320 3300005347 Ga0070668_100367843 Ga0070668_1003678432 147
321 3300005353 Ga0070669_100016708 Ga0070669_1000167082 147
322 3300005353 Ga0070669_100050901 Ga0070669_1000509016 147
323 3300005353 Ga0070669_100397597 Ga0070669_1003975972 147
324 3300005354 Ga0070675_100010875 Ga0070675_1000108754 147
325 3300005354 Ga0070675_100545840 Ga0070675_1005458402 147
326 3300005356 Ga0070674_100020865 Ga0070674_1000208652 147
327 3300005356 Ga0070674_100060672 Ga0070674_1000606724 147
328 3300005364 Ga0070673_100006740 Ga0070673_1000067405 147
329 3300005365 Ga0070688_100024750 Ga0070688_1000247504 147
330 3300005435 Ga0070714_100017134 Ga0070714_1000171342 147
331 3300005436 Ga0070713_100371294 Ga0070713_1003712942 147
332 3300005441 Ga0070700_100076162 Ga0070700_1000761624 147
333 3300005441 Ga0070700_100426068 Ga0070700_1004260682 147
334 3300005444 Ga0070694_100582736 Ga0070694_1005827361 147
335 3300005455 Ga0070663_100284866 Ga0070663_1002848662 147
336 3300005456 Ga0070678_101004675 Ga0070678_1010046752 147
337 3300005457 Ga0070662_100044474 Ga0070662_1000444743 147
338 3300005457 Ga0070662_100128993 Ga0070662_1001289934 147
339 3300005457 Ga0070662_100332782 Ga0070662_1003327822 147
340 3300005459 Ga0068867_100021713 Ga0068867_1000217133 147
341 3300005466 Ga0070685_10004948 Ga0070685_100049487 147
342 3300005530 Ga0070679_100713075 Ga0070679_1007130752 147
343 3300005535 Ga0070684_100086852 Ga0070684_1000868522 147
344 3300005539 Ga0068853_100847867 Ga0068853_1008478671 147
345 3300005543 Ga0070672_100034945 Ga0070672_1000349454 147
346 3300005543 Ga0070672_100052226 Ga0070672_1000522263 147
347 3300005544 Ga0070686_100063807 Ga0070686_1000638072 147
348 3300005544 Ga0070686_100207209 Ga0070686_1002072093 147
349 3300005545 Ga0070695_100961389 Ga0070695_1009613892 147
350 3300005546 Ga0070696_100413326 Ga0070696_1004133262 147
351 3300005546 Ga0070696_100434558 Ga0070696_1004345581 147
352 3300005547 Ga0070693_100351430 Ga0070693_1003514302 147
353 3300005548 Ga0070665_100636462 Ga0070665_1006364621 147
354 3300005548 Ga0070665_100983682 Ga0070665_1009836822 147
355 3300005549 Ga0070704_100236588 Ga0070704_1002365881 147
356 3300005563 Ga0068855_100000592 Ga0068855_1000005925 147
357 3300005564 Ga0070664_100033747 Ga0070664_1000337475 147
358 3300005564 Ga0070664_100423364 Ga0070664_1004233642 147
359 3300005577 Ga0068857_100018195 Ga0068857_1000181956 147
360 3300005577 Ga0068857_100021815 Ga0068857_1000218156 147
361 3300005578 Ga0068854_100438015 Ga0068854_1004380152 147
362 3300005614 Ga0068856_100086602 Ga0068856_1000866022 147
363 3300005615 Ga0070702_100014488 Ga0070702_1000144882 147
364 3300005615 Ga0070702_100862519 Ga0070702_1008625191 147
365 3300005617 Ga0068859_100007132 Ga0068859_1000071328 147
366 3300005618 Ga0068864_100018191 Ga0068864_1000181913 147
367 3300005618 Ga0068864_100349797 Ga0068864_1003497972 147
368 3300005719 Ga0068861_100000256 Ga0068861_10000025617 147
369 3300005719 Ga0068861_100010076 Ga0068861_1000100765 147
370 3300005719 Ga0068861_100011863 Ga0068861_1000118633 147
371 3300005719 Ga0068861_100296518 Ga0068861_1002965182 147
372 3300005840 Ga0068870_10021396 Ga0068870_100213962 147
373 3300005840 Ga0068870_10040720 Ga0068870_100407203 147
374 3300005841 Ga0068863_100036792 Ga0068863_1000367924 147
375 3300005841 Ga0068863_101852005 Ga0068863_1018520052 147
376 3300005843 Ga0068860_100057858 Ga0068860_1000578584 147
377 3300005843 Ga0068860_101185633 Ga0068860_1011856332 147
378 3300005844 Ga0068862_100000878 Ga0068862_10000087823 147
379 3300005844 Ga0068862_100017462 Ga0068862_1000174623 147
380 3300005844 Ga0068862_100019648 Ga0068862_1000196483 147
381 3300006051 Ga0075364_10107807 Ga0075364_101078072 147
382 3300006237 Ga0097621_100129456 Ga0097621_1001294562 147
383 3300006237 Ga0097621_100331324 Ga0097621_1003313242 147
384 3300006353 Ga0075370_10786249 Ga0075370_107862492 147
385 3300006358 Ga0068871_100029018 Ga0068871_1000290183 147
386 3300006358 Ga0068871_100329134 Ga0068871_1003291342 147
387 3300006844 Ga0075428_100001451 Ga0075428_10000145112 147
388 3300006844 Ga0075428_100168484 Ga0075428_1001684845 147
389 3300006844 Ga0075428_100246049 Ga0075428_1002460492 147
390 3300006844 Ga0075428_100478570 Ga0075428_1004785702 147
391 3300006846 Ga0075430_100001349 Ga0075430_10000134921 147
392 3300006846 Ga0075430_100005330 Ga0075430_1000053308 147
393 3300006847 Ga0075431_100004956 Ga0075431_10000495612 147
394 3300006847 Ga0075431_100033316 Ga0075431_1000333165 147
395 3300006847 Ga0075431_100074247 Ga0075431_1000742474 147
396 3300006847 Ga0075431_100445914 Ga0075431_1004459142 147
397 3300006871 Ga0075434_100144861 Ga0075434_1001448612 147
398 3300006880 Ga0075429_100001381 Ga0075429_10000138112 147
399 3300006880 Ga0075429_100042664 Ga0075429_1000426642 147
400 3300006880 Ga0075429_100109148 Ga0075429_1001091485 147
401 3300006880 Ga0075429_100213419 Ga0075429_1002134192 147
402 3300006880 Ga0075429_100389771 Ga0075429_1003897712 147
403 3300006881 Ga0068865_100057258 Ga0068865_1000572583 147
404 3300006881 Ga0068865_100911108 Ga0068865_1009111081 147
405 3300006931 Ga0097620_100007132 Ga0097620_1000071328 147
406 3300009093 Ga0105240_10135872 Ga0105240_101358722 147
407 3300009094 Ga0111539_10004344 Ga0111539_1000434410 147
408 3300009094 Ga0111539_10046924 Ga0111539_100469245 147
409 3300009094 Ga0111539_10053274 Ga0111539_100532743 147
410 3300009094 Ga0111539_10065773 Ga0111539_100657735 147
411 3300009094 Ga0111539_10066066 Ga0111539_100660662 147
412 3300009101 Ga0105247_10147661 Ga0105247_101476612 147
413 3300009147 Ga0114129_10003124 Ga0114129_1000312419 147
414 3300009147 Ga0114129_10066065 Ga0114129_100660655 147
415 3300009147 Ga0114129_12003377 Ga0114129_120033772 147
416 3300009148 Ga0105243_10037553 Ga0105243_100375533 147
417 3300009148 Ga0105243_11248651 Ga0105243_112486512 147
418 3300009176 Ga0105242_11605763 Ga0105242_116057631 147
419 3300009177 Ga0105248_10001950 Ga0105248_1000195020 147
420 3300009545 Ga0105237_10271447 Ga0105237_102714473 147
421 3300009553 Ga0105249_10007767 Ga0105249_100077675 147
422 3300009553 Ga0105249_10143321 Ga0105249_101433213 147
423 3300009553 Ga0105249_12442636 Ga0105249_124426362 147
424 3300010375 Ga0105239_10617436 Ga0105239_106174363 147
425 3300013297 Ga0157378_11092578 Ga0157378_110925782 147
426 3300013306 Ga0163162_10024984 Ga0163162_100249843 147
427 3300013306 Ga0163162_11294765 Ga0163162_112947652 147
428 3300013308 Ga0157375_10038243 Ga0157375_100382435 147
429 3300013308 Ga0157375_10344941 Ga0157375_103449412 147
430 3300014325 Ga0163163_10026463 Ga0163163_100264634 147
431 3300014326 Ga0157380_10006068 Ga0157380_100060683 147
432 3300014326 Ga0157380_10290419 Ga0157380_102904192 147
433 3300014326 Ga0157380_10892309 Ga0157380_108923092 147
434 3300014326 Ga0157380_10959941 Ga0157380_109599412 147
435 3300014745 Ga0157377_10001056 Ga0157377_100010567 147
436 3300014968 Ga0157379_10692785 Ga0157379_106927852 147
437 3300014968 Ga0157379_10709054 Ga0157379_107090542 147
438 3300017792 Ga0163161_10099335 Ga0163161_100993352 147
439 3300017792 Ga0163161_10500164 Ga0163161_105001642 147
440 3300017792 Ga0163161_11036524 Ga0163161_110365242 147
441 3300025899 Ga0207642_10012826 Ga0207642_100128262 147
442 3300025900 Ga0207710_10100405 Ga0207710_101004052 147
443 3300025901 Ga0207688_10071683 Ga0207688_100716832 147
444 3300025907 Ga0207645_10005569 Ga0207645_100055697 147
445 3300025907 Ga0207645_10083156 Ga0207645_100831562 147
446 3300025908 Ga0207643_10015341 Ga0207643_100153414 147
447 3300025908 Ga0207643_10028973 Ga0207643_100289732 147
448 3300025909 Ga0207705_10349922 Ga0207705_103499222 147
449 3300025909 Ga0207705_10980272 Ga0207705_109802721 147
450 3300025913 Ga0207695_10406886 Ga0207695_104068862 147
451 3300025914 Ga0207671_10195680 Ga0207671_101956802 147
452 3300025917 Ga0207660_10374835 Ga0207660_103748352 147
453 3300025918 Ga0207662_10037651 Ga0207662_100376514 147
454 3300025920 Ga0207649_10168541 Ga0207649_101685413 147
455 3300025921 Ga0207652_10383099 Ga0207652_103830992 147
456 3300025921 Ga0207652_10413418 Ga0207652_104134182 147
457 3300025923 Ga0207681_10021598 Ga0207681_100215985 147
458 3300025923 Ga0207681_10094648 Ga0207681_100946482 147
459 3300025923 Ga0207681_10265027 Ga0207681_102650272 147
460 3300025923 Ga0207681_10310313 Ga0207681_103103132 147
461 3300025924 Ga0207694_10016981 Ga0207694_100169817 147
462 3300025925 Ga0207650_10053397 Ga0207650_100533974 147
463 3300025925 Ga0207650_10496509 Ga0207650_104965091 147
464 3300025926 Ga0207659_10010463 Ga0207659_100104635 147
465 3300025929 Ga0207664_10010789 Ga0207664_100107892 147
466 3300025931 Ga0207644_10645115 Ga0207644_106451152 147
467 3300025932 Ga0207690_10173195 Ga0207690_101731952 147
468 3300025933 Ga0207706_10005852 Ga0207706_100058526 147
469 3300025933 Ga0207706_10022412 Ga0207706_100224125 147
470 3300025933 Ga0207706_10084440 Ga0207706_100844403 147
471 3300025935 Ga0207709_10506634 Ga0207709_105066342 147
472 3300025936 Ga0207670_10004031 Ga0207670_100040314 147
473 3300025937 Ga0207669_10021850 Ga0207669_100218505 147
474 3300025938 Ga0207704_10155243 Ga0207704_101552432 147
475 3300025938 Ga0207704_10792149 Ga0207704_107921492 147
476 3300025938 Ga0207704_10961832 Ga0207704_109618321 147
477 3300025940 Ga0207691_10023246 Ga0207691_100232463 147
478 3300025940 Ga0207691_10057873 Ga0207691_100578734 147
479 3300025941 Ga0207711_10006071 Ga0207711_100060718 147
480 3300025942 Ga0207689_10009129 Ga0207689_100091296 147
481 3300025942 Ga0207689_10686150 Ga0207689_106861502 147
482 3300025942 Ga0207689_11306422 Ga0207689_113064221 147
483 3300025945 Ga0207679_10006042 Ga0207679_100060424 147
484 3300025945 Ga0207679_10078858 Ga0207679_100788582 147
485 3300025949 Ga0207667_10042294 Ga0207667_100422944 147
486 3300025960 Ga0207651_10004828 Ga0207651_100048282 147
487 3300025961 Ga0207712_10014997 Ga0207712_100149975 147
488 3300025972 Ga0207668_10013314 Ga0207668_100133143 147
489 3300025972 Ga0207668_10548382 Ga0207668_105483822 147
490 3300025981 Ga0207640_10111925 Ga0207640_101119254 147
491 3300026067 Ga0207678_10141799 Ga0207678_101417992 147
492 3300026075 Ga0207708_10028460 Ga0207708_100284605 147
493 3300026075 Ga0207708_10038857 Ga0207708_100388574 147
494 3300026078 Ga0207702_10050849 Ga0207702_100508494 147
495 3300026088 Ga0207641_10004245 Ga0207641_100042455 147
496 3300026089 Ga0207648_10016032 Ga0207648_100160324 147
497 3300026095 Ga0207676_10101344 Ga0207676_101013442 147
498 3300026095 Ga0207676_10860230 Ga0207676_108602302 147
499 3300026116 Ga0207674_10023013 Ga0207674_100230137 147
500 3300026116 Ga0207674_10026270 Ga0207674_100262702 147
501 3300026118 Ga0207675_100001062 Ga0207675_1000010625 147
502 3300026118 Ga0207675_100001108 Ga0207675_10000110816 147
503 3300026118 Ga0207675_100007848 Ga0207675_1000078485 147
504 3300026118 Ga0207675_100017987 Ga0207675_1000179873 147
505 3300026121 Ga0207683_10030144 Ga0207683_100301445 147
506 3300026121 Ga0207683_10290573 Ga0207683_102905732 147
507 3300027614 Ga0209970_1013824 Ga0209970_10138242 147
508 3300027665 Ga0209983_1003117 Ga0209983_10031174 147
509 3300027682 Ga0209971_1033429 Ga0209971_10334292 147
510 3300027717 Ga0209998_10000777 Ga0209998_100007776 147
511 3300027876 Ga0209974_10010067 Ga0209974_100100676 147
512 3300027907 Ga0207428_10014691 Ga0207428_100146917 147
513 3300027907 Ga0207428_10019641 Ga0207428_100196413 147
514 3300027907 Ga0207428_10047592 Ga0207428_100475923 147
515 3300027907 Ga0207428_10198600 Ga0207428_101986001 147
516 3300028379 Ga0268266_10005477 Ga0268266_1000547714 147
517 3300028379 Ga0268266_10243375 Ga0268266_102433752 147
518 3300028379 Ga0268266_11117378 Ga0268266_111173782 147
519 3300028380 Ga0268265_10000559 Ga0268265_1000055934 147
520 3300028380 Ga0268265_10042522 Ga0268265_100425225 147
521 3300028380 Ga0268265_10149190 Ga0268265_101491902 147
522 3300028381 Ga0268264_10174279 Ga0268264_101742793 147
523 3300031456 Ga0307513_10408641 Ga0307513_104086412 147
524 3300031548 Ga0307408_100010613 Ga0307408_1000106133 147
525 3300031548 Ga0307408_100159822 Ga0307408_1001598222 147
526 3300031548 Ga0307408_100275942 Ga0307408_1002759422 147
527 3300031731 Ga0307405_10479437 Ga0307405_104794371 147
528 3300031824 Ga0307413_10146505 Ga0307413_101465054 147
529 3300031824 Ga0307413_10357891 Ga0307413_103578912 147
530 3300031852 Ga0307410_10063148 Ga0307410_100631485 147
531 3300031852 Ga0307410_10492103 Ga0307410_104921032 147
532 3300031852 Ga0307410_11091041 Ga0307410_110910411 147
533 3300031852 Ga0307410_11450691 Ga0307410_114506912 147
534 3300031901 Ga0307406_10192152 Ga0307406_101921522 147
535 3300031901 Ga0307406_10269336 Ga0307406_102693362 147
536 3300031901 Ga0307406_10428153 Ga0307406_104281532 147
537 3300031901 Ga0307406_10755414 Ga0307406_107554142 147
538 3300031901 Ga0307406_11393677 Ga0307406_113936771 147
539 3300031903 Ga0307407_10467083 Ga0307407_104670832 147
540 3300031903 Ga0307407_10858452 Ga0307407_108584522 147
541 3300031911 Ga0307412_10117700 Ga0307412_101177001 147
542 3300032002 Ga0307416_100176825 Ga0307416_1001768252 147
543 3300032002 Ga0307416_100262339 Ga0307416_1002623392 147
544 3300032002 Ga0307416_100923954 Ga0307416_1009239542 147
545 3300032002 Ga0307416_102261761 Ga0307416_1022617611 147
546 3300032002 Ga0307416_102264127 Ga0307416_1022641271 147
547 3300032005 Ga0307411_10050935 Ga0307411_100509355 147
548 3300032005 Ga0307411_10288486 Ga0307411_102884862 147
549 3300032005 Ga0307411_10740214 Ga0307411_107402142 147
550 3300032005 Ga0307411_12048295 Ga0307411_120482951 147
551 3300032126 Ga0307415_101435002 Ga0307415_1014350021 147
552 3300035088 Ga0373940_0125956 Ga0373940_0125956_328_783 147
553 3300035113 Ga0373936_0138593 Ga0373936_0138593_568_1014 147
554 3300035121 Ga0373960_0065591 Ga0373960_0065591_99_545 147
555 3300035241 Ga0373961_0204020 Ga0373961_0204020_149_595 147
556 3300035242 Ga0373962_0033158 Ga0373962_0033158_209_664 147
557 3300035691 Ga0373931_0253530 Ga0373931_0253530_415_861 147
558 3300041486 Ga0451807_0905457 Ga0451807_0905457_155_601 147
559 3300041496 Ga0451839_0832343 Ga0451839_0832343_457_903 147
560 3300041505 Ga0451849_0735254 Ga0451849_0735254_847_1293 147
561 3300041509 Ga0451843_0091166 Ga0451843_0091166_149_595 147
562 3300041997 Ga0439431_0066527 Ga0439431_0066527_381_827 147
563 3300042002 Ga0439442_086621 Ga0439442_086621_129_575 147
564 3300042436 Ga0439435_0023736 Ga0439435_0023736_412_858 147
565 3300042876 Ga0451577_0016709 Ga0451577_0016709_3381_3824 147
566 3300042876 Ga0451577_0093219 Ga0451577_0093219_2023_2466 147
567 3300042876 Ga0451577_0225991 Ga0451577_0225991_1103_1546 147
568 3300042876 Ga0451577_0300670 Ga0451577_0300670_969_1412 147
569 3300042876 Ga0451577_1386959 Ga0451577_1386959_83_526 147
570 3300042993 Ga0439440_0046911 Ga0439440_0046911_471_917 147
571 3300044712 Ga0453684_0026226 Ga0453684_0026226_4422_4865 147
572 3300044712 Ga0453684_0059554 Ga0453684_0059554_2353_2796 147
573 3300044712 Ga0453684_0152886 Ga0453684_0152886_1115_1558 147
574 3300044712 Ga0453684_1093282 Ga0453684_1093282_319_762 147
575 3300044842 Ga0466957_0231919 Ga0466957_0231919_267_713 147
576 3300045051 Ga0451576_0095049 Ga0451576_0095049_1995_2438 147
577 3300045051 Ga0451576_0340881 Ga0451576_0340881_1054_1500 147
578 3300045051 Ga0451576_0848943 Ga0451576_0848943_471_917 147
579 3300045051 Ga0451576_1329397 Ga0451576_1329397_125_568 147
580 3300046471 Ga0495650_0011192 Ga0495650_0011192_1600_2046 147
581 3300046526 Ga0495666_0408072 Ga0495666_0408072_109_573 147
582 3300046533 Ga0495640_0247995 Ga0495640_0247995_619_1083 147
583 3300046535 Ga0495586_0237775 Ga0495586_0237775_114_605 147
584 3300046660 Ga0495625_0003302 Ga0495625_0003302_4927_5379 147
585 3300046680 Ga0495646_0268391 Ga0495646_0268391_373_864 147
586 3300046683 Ga0495658_0827217 Ga0495658_0827217_10_465 147
587 3300047317 Ga0495604_0262157 Ga0495604_0262157_494_985 147
588 3300047320 Ga0495672_0096260 Ga0495672_0096260_119_565 147
589 3300047320 Ga0495672_0355582 Ga0495672_0355582_14_460 147
590 3300047444 Ga0495675_0591902 Ga0495675_0591902_15_506 147
591 3300048912 Ga0496109_0050637 Ga0496109_0050637_2656_3102 147
592 3300048913 Ga0496110_0097051 Ga0496110_0097051_1497_1943 147
593 3300048913 Ga0496110_0157362 Ga0496110_0157362_1291_1737 147
594 3300048915 Ga0496112_0151100 Ga0496112_0151100_1025_1471 147
595 3300048916 Ga0496113_0010563 Ga0496113_0010563_2996_3442 147
596 3300048917 Ga0496114_0308746 Ga0496114_0308746_19_465 147
597 3300048927 Ga0496124_0340649 Ga0496124_0340649_343_789 147
598 3300048929 Ga0496126_0416475 Ga0496126_0416475_280_762 147
599 3300049522 Ga0501299_012310 Ga0501299_012310_599_1054 147
600 3300049570 Ga0501033_0686164 Ga0501033_0686164_114_560 147
601 3300049575 Ga0501039_1253613 Ga0501039_1253613_77_523 147
602 3300049577 Ga0501041_0859781 Ga0501041_0859781_14_460 147
603 3300049580 Ga0501046_0046018 Ga0501046_0046018_1448_1894 147
604 3300050491 nmdc:mga00v17_52782_c1 nmdc:mga00v17_52782_c1_1578_2042 147
605 3300050494 nmdc:mga06z11_977402_c1 nmdc:mga06z11_977402_c1_16_480 147
606 3300050507 nmdc:mga05p37_12690_c1 nmdc:mga05p37_12690_c1_5992_6438 147
607 3300050507 nmdc:mga05p37_2097308_c1 nmdc:mga05p37_2097308_c1_12_458 147
608 3300050507 nmdc:mga05p37_942147_c1 nmdc:mga05p37_942147_c1_251_694 147
609 3300050508 nmdc:mga09592_180578_c1 nmdc:mga09592_180578_c1_1028_1474 147
610 3300050508 nmdc:mga09592_3569_c1 nmdc:mga09592_3569_c1_7412_7858 147
611 3300050508 nmdc:mga09592_558458_c1 nmdc:mga09592_558458_c1_325_771 147
612 3300050509 nmdc:mga0qj67_58667_c1 nmdc:mga0qj67_58667_c1_247_693 147
613 3300050509 nmdc:mga0qj67_761181_c1 nmdc:mga0qj67_761181_c1_298_744 147
614 3300050509 nmdc:mga0qj67_9189_c1 nmdc:mga0qj67_9189_c1_3253_3699 147
615 3300050510 nmdc:mga06r32_109833_c1 nmdc:mga06r32_109833_c1_525_971 147
616 3300050510 nmdc:mga06r32_20977_c1 nmdc:mga06r32_20977_c1_3743_4210 147
617 3300050510 nmdc:mga06r32_29_c1 nmdc:mga06r32_29_c1_9869_10315 147
618 3300050510 nmdc:mga06r32_69838_c1 nmdc:mga06r32_69838_c1_2171_2617 147
619 3300050510 nmdc:mga06r32_745_c1 nmdc:mga06r32_745_c1_9558_10004 147
620 3300050511 nmdc:mga08y16_1085_c1 nmdc:mga08y16_1085_c1_11195_11641 147
621 3300050511 nmdc:mga08y16_12457_c1 nmdc:mga08y16_12457_c1_265_711 147
622 3300050511 nmdc:mga08y16_40025_c1 nmdc:mga08y16_40025_c1_1020_1466 147
623 3300050511 nmdc:mga08y16_94823_c1 nmdc:mga08y16_94823_c1_544_990 147
624 3300050512 nmdc:mga0n895_271212_c1 nmdc:mga0n895_271212_c1_842_1288 147
625 3300053092 Ga0500583_0071895 Ga0500583_0071895_653_1099 147
626 3300053092 Ga0500583_0173687 Ga0500583_0173687_105_551 147
627 3300053093 Ga0500651_0334610 Ga0500651_0334610_61_507 147
628 3300053104 Ga0500556_0435124 Ga0500556_0435124_27_473 147
629 3300053118 Ga0500594_0237034 Ga0500594_0237034_29_475 147
630 3300053119 Ga0500595_005260 Ga0500595_005260_3333_3815 147
631 3300053134 Ga0500658_0195587 Ga0500658_0195587_235_681 147
632 3300053146 Ga0500588_0001145 Ga0500588_0001145_2283_2729 147
633 3300053151 Ga0500604_0054172 Ga0500604_0054172_643_1089 147
634 3300053156 Ga0500622_0003682 Ga0500622_0003682_6776_7222 147
635 3300053156 Ga0500622_0010223 Ga0500622_0010223_2658_3104 147
636 3300053178 Ga0500637_0227349 Ga0500637_0227349_68_514 147
637 3300059424 Ga0590075_147239 Ga0590075_147239_34_480 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

11

121

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9579 2 138
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9416 2 138
6a6f-assembly1.cif.gz_B crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 0.94 5 138
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9353 1 138
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9315 2 139
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9462 1 138 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.933 1 138 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9326 3 140 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9024 2 137 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8898 2 137 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A3D3D5D7-F1-model_v4 deleted 0.9855 5 95
AF-A0A7W1K4Z9-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9793 1 88 GO:0005506
GO:0016226
GO:0051536
AF-A0A6N6Z0K4-F1-model_v4 Nitrogen fixation protein NifU 0.9754 2 146 GO:0005506
GO:0016226
GO:0051536
AF-A0A550H1A1-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9712 10 86 GO:0005506
GO:0016226
GO:0051536
AF-A0A1Q7PZQ5-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9703 7 140 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
93.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map