F471437
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 637 | 366 | 635 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300031250|Ga0265331_10003256|Ga0265331_100032567 |
| Length | 176 |
| Sequence | MIGNDNDLRDLYQDLILDHSKHPHNFRAVPEANRDALGHNPLCGDRLSLQLKVDADDVIQDVGFQGSGCAISVASASMMTDMLRGRTLEEANALFAYMHALCTGRDYSVPAEMAGTTVTAPCTGENPPHVTLADDDRDRLQALAGVRHYPMRVKCATLAWHTMQAALDNKTKVSTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 4 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 5 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 185 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 188 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 201 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 202 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 203 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 225 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 226 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 229 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 279 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 284 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 285 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 286 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 287 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 288 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 293 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 328 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 329 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 330 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 347 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 348 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 352 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 355 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 356 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 361 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 362 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 364 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.88 |
| Metatranscriptomes | 5.65 |
| Isolates | 0.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.87 |
| Nodule | 0 |
| Rhizoplane | 3.61 |
| Rhizosphere | 88.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1005527 | 2162886007 | Bacteria | 6812 |
| 2 | MBSR1b_contig_1214556 | 2162886012 | Bacteria | 959 |
| 3 | JGI24750J21931_1041354 | 3300002070 | Bacteria | 701 |
| 4 | JGI25151J46595_10010063 | 3300003187 | Bacteria | 4428 |
| 5 | rootH1_10008501 | 3300003316 | Bacteria | 16023 |
| 6 | rootL2_10034951 | 3300003322 | Bacteria | 11923 |
| 7 | rootH1_10112062 | 3300003316 | Bacteria | 1399 |
| 8 | rootH1_10112062 | 3300003323 | Bacteria | 2728 |
| 9 | Ga0006562J51391_1000948 | 3300003578 | Bacteria | 18850 |
| 10 | Ga0055532_1004114 | 3300003758 | Bacteria | 2283 |
| 11 | Ga0058862_11585074 | 3300004803 | Bacteria | 1385 |
| 12 | Ga0065704_10000411 | 3300005289 | Bacteria | 28770 |
| 13 | Ga0065712_10003849 | 3300005290 | Bacteria | 4867 |
| 14 | Ga0065715_10092544 | 3300005293 | Bacteria | 5067 |
| 15 | Ga0065707_10081966 | 3300005295 | Bacteria | 26944 |
| 16 | Ga0070658_10323747 | 3300005327 | Bacteria | 1316 |
| 17 | Ga0070676_10032981 | 3300005328 | Bacteria | 2969 |
| 18 | Ga0070676_10178973 | 3300005328 | Bacteria | 1377 |
| 19 | Ga0070676_10668482 | 3300005328 | Bacteria | 756 |
| 20 | Ga0070670_100022137 | 3300005331 | Bacteria | 5471 |
| 21 | Ga0070670_100173857 | 3300005331 | Bacteria | 1869 |
| 22 | Ga0070670_100466076 | 3300005331 | Bacteria | 1121 |
| 23 | Ga0068869_100017831 | 3300005334 | Bacteria | 4822 |
| 24 | Ga0068869_100065870 | 3300005334 | Bacteria | 2668 |
| 25 | Ga0068869_100757560 | 3300005334 | Bacteria | 832 |
| 26 | Ga0070680_100014471 | 3300005336 | Bacteria | 6171 |
| 27 | Ga0070680_100082155 | 3300005336 | Bacteria | 2659 |
| 28 | Ga0070682_100117396 | 3300005337 | Bacteria | 1781 |
| 29 | Ga0070682_100801400 | 3300005337 | Bacteria | 765 |
| 30 | Ga0068868_100026036 | 3300005338 | Bacteria | 4454 |
| 31 | Ga0070689_100008629 | 3300005340 | Bacteria | 7188 |
| 32 | Ga0070691_10365677 | 3300005341 | Unclassified | 805 |
| 33 | Ga0070687_100139086 | 3300005343 | Bacteria | 1412 |
| 34 | Ga0070661_100007962 | 3300005344 | Bacteria | 7321 |
| 35 | Ga0070661_100393101 | 3300005344 | Bacteria | 1095 |
| 36 | Ga0070661_101086293 | 3300005344 | Bacteria | 666 |
| 37 | Ga0070692_10022839 | 3300005345 | Bacteria | 3060 |
| 38 | Ga0070692_10268656 | 3300005345 | Bacteria | 1029 |
| 39 | Ga0070668_100031631 | 3300005347 | Bacteria | 4026 |
| 40 | Ga0070668_100367843 | 3300005347 | Bacteria | 1221 |
| 41 | Ga0070669_100016708 | 3300005353 | Bacteria | 5238 |
| 42 | Ga0070669_100050901 | 3300005353 | Bacteria | 3026 |
| 43 | Ga0070669_100397597 | 3300005353 | Bacteria | 1127 |
| 44 | Ga0070675_100010875 | 3300005354 | Bacteria | 7118 |
| 45 | Ga0070675_100104699 | 3300005354 | Bacteria | 2387 |
| 46 | Ga0070675_100545840 | 3300005354 | Bacteria | 1048 |
| 47 | Ga0070675_101620232 | 3300005354 | Unclassified | 597 |
| 48 | Ga0070671_100013991 | 3300005355 | Bacteria | 6478 |
| 49 | Ga0070674_100020865 | 3300005356 | Bacteria | 4195 |
| 50 | Ga0070674_100060672 | 3300005356 | Bacteria | 2637 |
| 51 | Ga0070673_100006740 | 3300005364 | Bacteria | 7494 |
| 52 | Ga0070673_101605862 | 3300005364 | Unclassified | 614 |
| 53 | Ga0070688_100024750 | 3300005365 | Bacteria | 3547 |
| 54 | Ga0070688_100614490 | 3300005365 | Bacteria | 833 |
| 55 | Ga0070667_101041581 | 3300005367 | Bacteria | 764 |
| 56 | Ga0070709_10338902 | 3300005434 | Bacteria | 1108 |
| 57 | Ga0070714_100017134 | 3300005435 | Bacteria | 5866 |
| 58 | Ga0070714_100704938 | 3300005435 | Bacteria | 974 |
| 59 | Ga0070713_100371294 | 3300005436 | Bacteria | 1331 |
| 60 | Ga0070710_10170391 | 3300005437 | Bacteria | 1356 |
| 61 | Ga0070701_10006243 | 3300005438 | Bacteria | 5000 |
| 62 | Ga0070700_100042341 | 3300005441 | Bacteria | 2796 |
| 63 | Ga0070700_100076162 | 3300005441 | Bacteria | 2154 |
| 64 | Ga0070700_100426068 | 3300005441 | Bacteria | 1004 |
| 65 | Ga0070694_100458500 | 3300005444 | Unclassified | 1008 |
| 66 | Ga0070694_100582736 | 3300005444 | Bacteria | 899 |
| 67 | Ga0070663_100284866 | 3300005455 | Bacteria | 1318 |
| 68 | Ga0070678_101004675 | 3300005456 | Bacteria | 767 |
| 69 | Ga0070662_100044474 | 3300005457 | Bacteria | 3181 |
| 70 | Ga0070662_100128993 | 3300005457 | Bacteria | 1947 |
| 71 | Ga0070662_100332782 | 3300005457 | Bacteria | 1241 |
| 72 | Ga0068867_100021713 | 3300005459 | Bacteria | 4581 |
| 73 | Ga0068867_100036820 | 3300005459 | Bacteria | 3554 |
| 74 | Ga0070685_10004948 | 3300005466 | Bacteria | 6745 |
| 75 | Ga0070679_100713075 | 3300005530 | Bacteria | 946 |
| 76 | Ga0070679_100988426 | 3300005530 | Bacteria | 785 |
| 77 | Ga0070684_100086852 | 3300005535 | Bacteria | 2777 |
| 78 | Ga0068853_100847867 | 3300005539 | Bacteria | 876 |
| 79 | Ga0070672_100011947 | 3300005543 | Bacteria | 6071 |
| 80 | Ga0070672_100034945 | 3300005543 | Bacteria | 3817 |
| 81 | Ga0070672_100052226 | 3300005543 | Bacteria | 3191 |
| 82 | Ga0070686_100063807 | 3300005544 | Bacteria | 2387 |
| 83 | Ga0070686_100207209 | 3300005544 | Bacteria | 1409 |
| 84 | Ga0070695_100396481 | 3300005545 | Bacteria | 1045 |
| 85 | Ga0070695_100961389 | 3300005545 | Bacteria | 693 |
| 86 | Ga0070696_100413326 | 3300005546 | Bacteria | 1058 |
| 87 | Ga0070696_100434558 | 3300005546 | Bacteria | 1033 |
| 88 | Ga0070693_100351430 | 3300005547 | Bacteria | 1009 |
| 89 | Ga0070665_100333268 | 3300005548 | Bacteria | 1522 |
| 90 | Ga0070665_100636462 | 3300005548 | Bacteria | 1080 |
| 91 | Ga0070665_100983682 | 3300005548 | Bacteria | 856 |
| 92 | Ga0070704_100036982 | 3300005549 | Bacteria | 3331 |
| 93 | Ga0070704_100236588 | 3300005549 | Bacteria | 1493 |
| 94 | Ga0068855_100000592 | 3300005563 | Bacteria | 44394 |
| 95 | Ga0068855_100848707 | 3300005563 | Bacteria | 968 |
| 96 | Ga0070664_100033747 | 3300005564 | Bacteria | 4289 |
| 97 | Ga0070664_100423364 | 3300005564 | Bacteria | 1220 |
| 98 | Ga0068857_100018195 | 3300005577 | Bacteria | 6162 |
| 99 | Ga0068857_100021815 | 3300005577 | Bacteria | 5637 |
| 100 | Ga0068854_100438015 | 3300005578 | Bacteria | 1089 |
| 101 | Ga0068856_100086602 | 3300005614 | Bacteria | 3113 |
| 102 | Ga0068856_100098495 | 3300005614 | Bacteria | 2914 |
| 103 | Ga0070702_100014488 | 3300005615 | Bacteria | 4000 |
| 104 | Ga0070702_100862519 | 3300005615 | Bacteria | 706 |
| 105 | Ga0068859_100007132 | 3300005617 | Bacteria | 11343 |
| 106 | Ga0068864_100018191 | 3300005618 | Bacteria | 5866 |
| 107 | Ga0068864_100349797 | 3300005618 | Bacteria | 1394 |
| 108 | Ga0068861_100000256 | 3300005719 | Bacteria | 29591 |
| 109 | Ga0068861_100010076 | 3300005719 | Bacteria | 6554 |
| 110 | Ga0068861_100011863 | 3300005719 | Bacteria | 6067 |
| 111 | Ga0068861_100017222 | 3300005719 | Bacteria | 5124 |
| 112 | Ga0068861_100296518 | 3300005719 | Bacteria | 1398 |
| 113 | Ga0068861_101529215 | 3300005719 | Bacteria | 656 |
| 114 | Ga0068870_10021396 | 3300005840 | Bacteria | 3163 |
| 115 | Ga0068870_10040720 | 3300005840 | Bacteria | 2411 |
| 116 | Ga0068870_10230120 | 3300005840 | Bacteria | 1139 |
| 117 | Ga0068863_100036792 | 3300005841 | Bacteria | 4661 |
| 118 | Ga0068863_101852005 | 3300005841 | Bacteria | 613 |
| 119 | Ga0068860_100057858 | 3300005843 | Bacteria | 3685 |
| 120 | Ga0068860_101185633 | 3300005843 | Bacteria | 784 |
| 121 | Ga0068862_100000878 | 3300005844 | Bacteria | 29297 |
| 122 | Ga0068862_100009915 | 3300005844 | Bacteria | 7868 |
| 123 | Ga0068862_100017462 | 3300005844 | Bacteria | 5977 |
| 124 | Ga0068862_100019648 | 3300005844 | Bacteria | 5641 |
| 125 | Ga0075364_10107807 | 3300006051 | Bacteria | 1857 |
| 126 | Ga0070715_10212121 | 3300006163 | Bacteria | 990 |
| 127 | Ga0070712_101215316 | 3300006175 | Bacteria | 656 |
| 128 | Ga0097621_100129456 | 3300006237 | Bacteria | 2147 |
| 129 | Ga0097621_100331324 | 3300006237 | Bacteria | 1350 |
| 130 | Ga0075370_10786249 | 3300006353 | Unclassified | 580 |
| 131 | Ga0068871_100029018 | 3300006358 | Bacteria | 4343 |
| 132 | Ga0068871_100329134 | 3300006358 | Bacteria | 1347 |
| 133 | Ga0075428_100001451 | 3300006844 | Bacteria | 25355 |
| 134 | Ga0075428_100168484 | 3300006844 | Bacteria | 2375 |
| 135 | Ga0075428_100246049 | 3300006844 | Bacteria | 1928 |
| 136 | Ga0075428_100478570 | 3300006844 | Bacteria | 1333 |
| 137 | Ga0075430_100001349 | 3300006846 | Bacteria | 19852 |
| 138 | Ga0075430_100005330 | 3300006846 | Bacteria | 10855 |
| 139 | Ga0075430_100010186 | 3300006846 | Bacteria | 7960 |
| 140 | Ga0075430_100029879 | 3300006846 | Bacteria | 4627 |
| 141 | Ga0075431_100004956 | 3300006847 | Bacteria | 13103 |
| 142 | Ga0075431_100033316 | 3300006847 | Bacteria | 5309 |
| 143 | Ga0075431_100074247 | 3300006847 | Bacteria | 3509 |
| 144 | Ga0075431_100445914 | 3300006847 | Bacteria | 1290 |
| 145 | Ga0075434_100144861 | 3300006871 | Bacteria | 2396 |
| 146 | Ga0075429_100001381 | 3300006880 | Bacteria | 19862 |
| 147 | Ga0075429_100029953 | 3300006880 | Bacteria | 4727 |
| 148 | Ga0075429_100042664 | 3300006880 | Bacteria | 3947 |
| 149 | Ga0075429_100109148 | 3300006880 | Bacteria | 2419 |
| 150 | Ga0075429_100213419 | 3300006880 | Bacteria | 1691 |
| 151 | Ga0075429_100389771 | 3300006880 | Bacteria | 1220 |
| 152 | Ga0068865_100057258 | 3300006881 | Bacteria | 2719 |
| 153 | Ga0068865_100911108 | 3300006881 | Bacteria | 765 |
| 154 | Ga0097620_100007132 | 3300006931 | Bacteria | 11343 |
| 155 | Ga0105244_10265795 | 3300009036 | Bacteria | 798 |
| 156 | Ga0105250_10073926 | 3300009092 | Bacteria | 1378 |
| 157 | Ga0105240_10053016 | 3300009093 | Bacteria | 5095 |
| 158 | Ga0105240_10095439 | 3300009093 | Bacteria | 3626 |
| 159 | Ga0105240_10133832 | 3300009093 | Bacteria | 2970 |
| 160 | Ga0105240_10135872 | 3300009093 | Bacteria | 2945 |
| 161 | Ga0105240_10453866 | 3300009093 | Bacteria | 1434 |
| 162 | Ga0111539_10004344 | 3300009094 | Bacteria | 18562 |
| 163 | Ga0111539_10012659 | 3300009094 | Bacteria | 10568 |
| 164 | Ga0111539_10046924 | 3300009094 | Bacteria | 5165 |
| 165 | Ga0111539_10053274 | 3300009094 | Bacteria | 4816 |
| 166 | Ga0111539_10065773 | 3300009094 | Bacteria | 4283 |
| 167 | Ga0111539_10066066 | 3300009094 | Bacteria | 4272 |
| 168 | Ga0105245_10037225 | 3300009098 | Bacteria | 4326 |
| 169 | Ga0105245_10881618 | 3300009098 | Unclassified | 936 |
| 170 | Ga0105247_10064863 | 3300009101 | Bacteria | 2270 |
| 171 | Ga0105247_10147661 | 3300009101 | Bacteria | 1547 |
| 172 | Ga0114129_10003124 | 3300009147 | Bacteria | 23226 |
| 173 | Ga0114129_10066065 | 3300009147 | Bacteria | 5045 |
| 174 | Ga0114129_12003377 | 3300009147 | Bacteria | 700 |
| 175 | Ga0105243_10021747 | 3300009148 | Bacteria | 4870 |
| 176 | Ga0105243_10037553 | 3300009148 | Bacteria | 3766 |
| 177 | Ga0105243_10155869 | 3300009148 | Bacteria | 1964 |
| 178 | Ga0105243_11248651 | 3300009148 | Bacteria | 758 |
| 179 | Ga0105241_10959760 | 3300009174 | Bacteria | 797 |
| 180 | Ga0105241_10969160 | 3300009174 | Unclassified | 794 |
| 181 | Ga0105242_10017403 | 3300009176 | Bacteria | 5602 |
| 182 | Ga0105242_11605763 | 3300009176 | Bacteria | 684 |
| 183 | Ga0105248_10001950 | 3300009177 | Bacteria | 22929 |
| 184 | Ga0105237_10210806 | 3300009545 | Bacteria | 1943 |
| 185 | Ga0105237_10235889 | 3300009545 | Bacteria | 1830 |
| 186 | Ga0105237_10271447 | 3300009545 | Bacteria | 1699 |
| 187 | Ga0105238_10240191 | 3300009551 | Bacteria | 1789 |
| 188 | Ga0105238_11645396 | 3300009551 | Bacteria | 672 |
| 189 | Ga0105249_10007767 | 3300009553 | Bacteria | 9348 |
| 190 | Ga0105249_10143321 | 3300009553 | Bacteria | 2293 |
| 191 | Ga0105249_12442636 | 3300009553 | Bacteria | 595 |
| 192 | Ga0105239_10319122 | 3300010375 | Bacteria | 1752 |
| 193 | Ga0105239_10617436 | 3300010375 | Bacteria | 1237 |
| 194 | Ga0105239_10976283 | 3300010375 | Bacteria | 974 |
| 195 | Ga0105239_11159321 | 3300010375 | Unclassified | 890 |
| 196 | Ga0105246_10006304 | 3300011119 | Bacteria | 7239 |
| 197 | Ga0157374_10201778 | 3300013296 | Bacteria | 1947 |
| 198 | Ga0157378_10065072 | 3300013297 | Bacteria | 3263 |
| 199 | Ga0157378_11092578 | 3300013297 | Bacteria | 834 |
| 200 | Ga0163162_10024984 | 3300013306 | Bacteria | 5902 |
| 201 | Ga0163162_11294765 | 3300013306 | Bacteria | 828 |
| 202 | Ga0157372_10180157 | 3300013307 | Bacteria | 2446 |
| 203 | Ga0157375_10038243 | 3300013308 | Bacteria | 4606 |
| 204 | Ga0157375_10344941 | 3300013308 | Bacteria | 1655 |
| 205 | Ga0163163_10026463 | 3300014325 | Bacteria | 5545 |
| 206 | Ga0157380_10006068 | 3300014326 | Bacteria | 8470 |
| 207 | Ga0157380_10290419 | 3300014326 | Bacteria | 1501 |
| 208 | Ga0157380_10562052 | 3300014326 | Bacteria | 1121 |
| 209 | Ga0157380_10892309 | 3300014326 | Bacteria | 914 |
| 210 | Ga0157380_10959941 | 3300014326 | Bacteria | 885 |
| 211 | Ga0157377_10001056 | 3300014745 | Bacteria | 11660 |
| 212 | Ga0157379_10692785 | 3300014968 | Bacteria | 956 |
| 213 | Ga0157379_10709054 | 3300014968 | Bacteria | 945 |
| 214 | Ga0163161_10099335 | 3300017792 | Bacteria | 2164 |
| 215 | Ga0163161_10500164 | 3300017792 | Bacteria | 990 |
| 216 | Ga0163161_11036524 | 3300017792 | Bacteria | 702 |
| 217 | Ga0206350_10161612 | 3300020080 | Bacteria | 1134 |
| 218 | Ga0213872_10000514 | 3300021361 | Bacteria | 30580 |
| 219 | Ga0213872_10074827 | 3300021361 | Bacteria | 1524 |
| 220 | Ga0209147_101571 | 3300025229 | Bacteria | 7779 |
| 221 | Ga0209673_1001821 | 3300025273 | Bacteria | 17473 |
| 222 | Ga0209025_1128520 | 3300025294 | Bacteria | 741 |
| 223 | Ga0207696_1019848 | 3300025711 | Bacteria | 2178 |
| 224 | Ga0207655_1001341 | 3300025728 | Bacteria | 23130 |
| 225 | Ga0207713_1000472 | 3300025735 | Bacteria | 41917 |
| 226 | Ga0207692_10395306 | 3300025898 | Bacteria | 861 |
| 227 | Ga0207642_10012826 | 3300025899 | Bacteria | 3038 |
| 228 | Ga0207710_10008538 | 3300025900 | Bacteria | 4319 |
| 229 | Ga0207710_10100405 | 3300025900 | Bacteria | 1364 |
| 230 | Ga0207688_10071683 | 3300025901 | Bacteria | 1967 |
| 231 | Ga0207680_10315621 | 3300025903 | Bacteria | 1092 |
| 232 | Ga0207685_10207650 | 3300025905 | Bacteria | 924 |
| 233 | Ga0207699_10176362 | 3300025906 | Bacteria | 1434 |
| 234 | Ga0207645_10005569 | 3300025907 | Bacteria | 9113 |
| 235 | Ga0207645_10083156 | 3300025907 | Bacteria | 2053 |
| 236 | Ga0207643_10015341 | 3300025908 | Bacteria | 4170 |
| 237 | Ga0207643_10028973 | 3300025908 | Bacteria | 3078 |
| 238 | Ga0207705_10349922 | 3300025909 | Bacteria | 1138 |
| 239 | Ga0207705_10980272 | 3300025909 | Unclassified | 653 |
| 240 | Ga0207695_10130671 | 3300025913 | Bacteria | 2469 |
| 241 | Ga0207695_10224533 | 3300025913 | Bacteria | 1785 |
| 242 | Ga0207695_10406886 | 3300025913 | Bacteria | 1245 |
| 243 | Ga0207695_10738339 | 3300025913 | Bacteria | 865 |
| 244 | Ga0207695_10749189 | 3300025913 | Bacteria | 857 |
| 245 | Ga0207671_10114232 | 3300025914 | Bacteria | 2058 |
| 246 | Ga0207671_10195680 | 3300025914 | Bacteria | 1577 |
| 247 | Ga0207671_10404758 | 3300025914 | Bacteria | 1085 |
| 248 | Ga0207660_10101854 | 3300025917 | Bacteria | 2146 |
| 249 | Ga0207660_10374835 | 3300025917 | Bacteria | 1143 |
| 250 | Ga0207662_10037651 | 3300025918 | Bacteria | 2832 |
| 251 | Ga0207662_10788673 | 3300025918 | Bacteria | 669 |
| 252 | Ga0207649_10168541 | 3300025920 | Bacteria | 1523 |
| 253 | Ga0207652_10383099 | 3300025921 | Bacteria | 1269 |
| 254 | Ga0207652_10413418 | 3300025921 | Bacteria | 1217 |
| 255 | Ga0207681_10021598 | 3300025923 | Bacteria | 4095 |
| 256 | Ga0207681_10094648 | 3300025923 | Bacteria | 2141 |
| 257 | Ga0207681_10265027 | 3300025923 | Bacteria | 1346 |
| 258 | Ga0207681_10310313 | 3300025923 | Bacteria | 1251 |
| 259 | Ga0207694_10001823 | 3300025924 | Bacteria | 17744 |
| 260 | Ga0207694_10016981 | 3300025924 | Bacteria | 5497 |
| 261 | Ga0207650_10053397 | 3300025925 | Bacteria | 2995 |
| 262 | Ga0207650_10496509 | 3300025925 | Bacteria | 1019 |
| 263 | Ga0207659_10010463 | 3300025926 | Bacteria | 5831 |
| 264 | Ga0207659_10211389 | 3300025926 | Bacteria | 1555 |
| 265 | Ga0207659_10668837 | 3300025926 | Bacteria | 888 |
| 266 | Ga0207687_10194604 | 3300025927 | Bacteria | 1581 |
| 267 | Ga0207687_10603955 | 3300025927 | Unclassified | 925 |
| 268 | Ga0207664_10010789 | 3300025929 | Bacteria | 6464 |
| 269 | Ga0207664_10711767 | 3300025929 | Bacteria | 903 |
| 270 | Ga0207644_10019360 | 3300025931 | Bacteria | 4617 |
| 271 | Ga0207644_10645115 | 3300025931 | Bacteria | 881 |
| 272 | Ga0207690_10173195 | 3300025932 | Bacteria | 1618 |
| 273 | Ga0207706_10005852 | 3300025933 | Bacteria | 11436 |
| 274 | Ga0207706_10022412 | 3300025933 | Bacteria | 5670 |
| 275 | Ga0207706_10084440 | 3300025933 | Bacteria | 2792 |
| 276 | Ga0207686_10266591 | 3300025934 | Bacteria | 1258 |
| 277 | Ga0207709_10011396 | 3300025935 | Bacteria | 4905 |
| 278 | Ga0207709_10385063 | 3300025935 | Unclassified | 1068 |
| 279 | Ga0207709_10506634 | 3300025935 | Bacteria | 943 |
| 280 | Ga0207670_10004031 | 3300025936 | Bacteria | 7853 |
| 281 | Ga0207670_10135651 | 3300025936 | Bacteria | 1809 |
| 282 | Ga0207669_10021850 | 3300025937 | Bacteria | 3387 |
| 283 | Ga0207704_10155243 | 3300025938 | Bacteria | 1621 |
| 284 | Ga0207704_10409003 | 3300025938 | Bacteria | 1073 |
| 285 | Ga0207704_10792149 | 3300025938 | Bacteria | 791 |
| 286 | Ga0207704_10961832 | 3300025938 | Bacteria | 721 |
| 287 | Ga0207691_10023246 | 3300025940 | Bacteria | 5836 |
| 288 | Ga0207691_10057873 | 3300025940 | Bacteria | 3527 |
| 289 | Ga0207711_10006071 | 3300025941 | Bacteria | 10206 |
| 290 | Ga0207689_10009129 | 3300025942 | Bacteria | 8580 |
| 291 | Ga0207689_10074642 | 3300025942 | Bacteria | 2786 |
| 292 | Ga0207689_10252163 | 3300025942 | Unclassified | 1459 |
| 293 | Ga0207689_10686150 | 3300025942 | Bacteria | 863 |
| 294 | Ga0207689_11306422 | 3300025942 | Bacteria | 609 |
| 295 | Ga0207679_10006042 | 3300025945 | Bacteria | 7629 |
| 296 | Ga0207679_10078858 | 3300025945 | Bacteria | 2510 |
| 297 | Ga0207667_10042294 | 3300025949 | Bacteria | 4844 |
| 298 | Ga0207667_10687442 | 3300025949 | Bacteria | 1026 |
| 299 | Ga0207651_10004828 | 3300025960 | Bacteria | 6863 |
| 300 | Ga0207712_10014997 | 3300025961 | Bacteria | 4993 |
| 301 | Ga0207668_10013314 | 3300025972 | Bacteria | 5060 |
| 302 | Ga0207668_10548382 | 3300025972 | Bacteria | 1001 |
| 303 | Ga0207640_10111925 | 3300025981 | Bacteria | 1937 |
| 304 | Ga0207678_10141799 | 3300026067 | Bacteria | 2051 |
| 305 | Ga0207678_10288954 | 3300026067 | Bacteria | 1408 |
| 306 | Ga0207708_10013991 | 3300026075 | Bacteria | 5994 |
| 307 | Ga0207708_10028460 | 3300026075 | Bacteria | 4231 |
| 308 | Ga0207708_10038857 | 3300026075 | Bacteria | 3626 |
| 309 | Ga0207702_10050849 | 3300026078 | Bacteria | 3500 |
| 310 | Ga0207702_10111968 | 3300026078 | Bacteria | 2428 |
| 311 | Ga0207641_10004245 | 3300026088 | Bacteria | 12488 |
| 312 | Ga0207641_10123034 | 3300026088 | Bacteria | 2318 |
| 313 | Ga0207648_10016032 | 3300026089 | Bacteria | 6865 |
| 314 | Ga0207648_10029655 | 3300026089 | Bacteria | 4851 |
| 315 | Ga0207676_10101344 | 3300026095 | Bacteria | 2387 |
| 316 | Ga0207676_10860230 | 3300026095 | Bacteria | 887 |
| 317 | Ga0207674_10023013 | 3300026116 | Bacteria | 6682 |
| 318 | Ga0207674_10026270 | 3300026116 | Bacteria | 6190 |
| 319 | Ga0207675_100001062 | 3300026118 | Bacteria | 27254 |
| 320 | Ga0207675_100001108 | 3300026118 | Bacteria | 26655 |
| 321 | Ga0207675_100007848 | 3300026118 | Bacteria | 10070 |
| 322 | Ga0207675_100017987 | 3300026118 | Bacteria | 6592 |
| 323 | Ga0207675_100028971 | 3300026118 | Bacteria | 5159 |
| 324 | Ga0207675_100273562 | 3300026118 | Bacteria | 1639 |
| 325 | Ga0207683_10030144 | 3300026121 | Bacteria | 4699 |
| 326 | Ga0207683_10290573 | 3300026121 | Bacteria | 1495 |
| 327 | Ga0209995_1050258 | 3300027471 | Unclassified | 707 |
| 328 | Ga0209970_1013824 | 3300027614 | Bacteria | 1340 |
| 329 | Ga0209983_1003117 | 3300027665 | Bacteria | 3562 |
| 330 | Ga0209971_1033429 | 3300027682 | Bacteria | 1235 |
| 331 | Ga0209998_10000777 | 3300027717 | Bacteria | 8268 |
| 332 | Ga0209974_10010067 | 3300027876 | Bacteria | 3196 |
| 333 | Ga0209974_10120213 | 3300027876 | Unclassified | 930 |
| 334 | Ga0207428_10014691 | 3300027907 | Bacteria | 6787 |
| 335 | Ga0207428_10019641 | 3300027907 | Bacteria | 5759 |
| 336 | Ga0207428_10047592 | 3300027907 | Bacteria | 3443 |
| 337 | Ga0207428_10119049 | 3300027907 | Bacteria | 2026 |
| 338 | Ga0207428_10198600 | 3300027907 | Bacteria | 1510 |
| 339 | Ga0268266_10005477 | 3300028379 | Bacteria | 11822 |
| 340 | Ga0268266_10243375 | 3300028379 | Bacteria | 1661 |
| 341 | Ga0268266_10265486 | 3300028379 | Bacteria | 1592 |
| 342 | Ga0268266_11117378 | 3300028379 | Bacteria | 762 |
| 343 | Ga0268265_10000559 | 3300028380 | Bacteria | 37946 |
| 344 | Ga0268265_10007663 | 3300028380 | Bacteria | 7287 |
| 345 | Ga0268265_10042522 | 3300028380 | Bacteria | 3372 |
| 346 | Ga0268265_10149190 | 3300028380 | Bacteria | 1970 |
| 347 | Ga0268264_10174279 | 3300028381 | Bacteria | 1948 |
| 348 | Ga0265336_10019739 | 3300028666 | Bacteria | 2171 |
| 349 | Ga0265338_10015048 | 3300028800 | Bacteria | 8538 |
| 350 | Ga0265328_10110850 | 3300031239 | Bacteria | 1020 |
| 351 | Ga0265331_10003256 | 3300031250 | Bacteria | 10585 |
| 352 | Ga0307513_10408641 | 3300031456 | Bacteria | 1090 |
| 353 | Ga0307408_100010613 | 3300031548 | Bacteria | 6077 |
| 354 | Ga0307408_100076616 | 3300031548 | Bacteria | 2488 |
| 355 | Ga0307408_100159822 | 3300031548 | Bacteria | 1789 |
| 356 | Ga0307408_100275942 | 3300031548 | Bacteria | 1398 |
| 357 | Ga0316575_10005923 | 3300031665 | Bacteria | 4375 |
| 358 | Ga0316579_10004986 | 3300031691 | Bacteria | 5323 |
| 359 | Ga0316579_10030530 | 3300031691 | Unclassified | 2464 |
| 360 | Ga0316579_10181842 | 3300031691 | Bacteria | 1016 |
| 361 | Ga0265314_10003713 | 3300031711 | Bacteria | 14618 |
| 362 | Ga0316576_10012929 | 3300031727 | Bacteria | 5526 |
| 363 | Ga0316576_10092883 | 3300031727 | Bacteria | 2248 |
| 364 | Ga0316578_10002481 | 3300031728 | Bacteria | 8124 |
| 365 | Ga0316578_10067143 | 3300031728 | Bacteria | 2119 |
| 366 | Ga0307405_10479437 | 3300031731 | Bacteria | 993 |
| 367 | Ga0316577_10236261 | 3300031733 | Bacteria | 1033 |
| 368 | Ga0307413_10146505 | 3300031824 | Bacteria | 1640 |
| 369 | Ga0307413_10357891 | 3300031824 | Bacteria | 1129 |
| 370 | Ga0307410_10063148 | 3300031852 | Bacteria | 2540 |
| 371 | Ga0307410_10492103 | 3300031852 | Bacteria | 1008 |
| 372 | Ga0307410_11091041 | 3300031852 | Bacteria | 692 |
| 373 | Ga0307410_11450691 | 3300031852 | Bacteria | 603 |
| 374 | Ga0307406_10192152 | 3300031901 | Bacteria | 1495 |
| 375 | Ga0307406_10269336 | 3300031901 | Bacteria | 1293 |
| 376 | Ga0307406_10428153 | 3300031901 | Bacteria | 1056 |
| 377 | Ga0307406_10755414 | 3300031901 | Bacteria | 817 |
| 378 | Ga0307406_11393677 | 3300031901 | Bacteria | 614 |
| 379 | Ga0307407_10467083 | 3300031903 | Bacteria | 919 |
| 380 | Ga0307407_10858452 | 3300031903 | Bacteria | 694 |
| 381 | Ga0307412_10117700 | 3300031911 | Bacteria | 1908 |
| 382 | Ga0307409_101477730 | 3300031995 | Bacteria | 707 |
| 383 | Ga0307416_100071953 | 3300032002 | Bacteria | 2875 |
| 384 | Ga0307416_100176825 | 3300032002 | Bacteria | 1995 |
| 385 | Ga0307416_100262339 | 3300032002 | Bacteria | 1689 |
| 386 | Ga0307416_100923954 | 3300032002 | Bacteria | 973 |
| 387 | Ga0307416_101502055 | 3300032002 | Bacteria | 779 |
| 388 | Ga0307416_102261761 | 3300032002 | Bacteria | 644 |
| 389 | Ga0307416_102264127 | 3300032002 | Bacteria | 644 |
| 390 | Ga0307411_10050935 | 3300032005 | Bacteria | 2699 |
| 391 | Ga0307411_10288486 | 3300032005 | Unclassified | 1310 |
| 392 | Ga0307411_10740214 | 3300032005 | Bacteria | 860 |
| 393 | Ga0307411_12048295 | 3300032005 | Bacteria | 535 |
| 394 | Ga0307415_101435002 | 3300032126 | Bacteria | 658 |
| 395 | Ga0316583_10039308 | 3300032133 | Unclassified | 1675 |
| 396 | Ga0316585_10004868 | 3300032137 | Bacteria | 3769 |
| 397 | Ga0316580_10004653 | 3300032139 | Bacteria | 3984 |
| 398 | Ga0316580_10182750 | 3300032139 | Bacteria | 645 |
| 399 | Ga0316593_10007229 | 3300032168 | Bacteria | 3042 |
| 400 | Ga0316593_10030927 | 3300032168 | Bacteria | 1741 |
| 401 | Ga0316592_1004098 | 3300033524 | Bacteria | 2685 |
| 402 | Ga0316588_1000288 | 3300033528 | Bacteria | 6270 |
| 403 | Ga0373940_0039046 | 3300035088 | Bacteria | 1298 |
| 404 | Ga0373940_0125956 | 3300035088 | Bacteria | 799 |
| 405 | Ga0373936_0138593 | 3300035113 | Bacteria | 1049 |
| 406 | Ga0373939_0026335 | 3300035114 | Bacteria | 1638 |
| 407 | Ga0373960_0065591 | 3300035121 | Bacteria | 1111 |
| 408 | Ga0373942_0020873 | 3300035207 | Bacteria | 1648 |
| 409 | Ga0373961_0204020 | 3300035241 | Bacteria | 699 |
| 410 | Ga0373962_0033158 | 3300035242 | Bacteria | 1424 |
| 411 | Ga0316574_0388611 | 3300035398 | Unclassified | 879 |
| 412 | Ga0373931_0253530 | 3300035691 | Bacteria | 1071 |
| 413 | Ga0373931_0290693 | 3300035691 | Bacteria | 1006 |
| 414 | Ga0373927_0763152 | 3300035695 | Bacteria | 639 |
| 415 | Ga0316582_0012410 | 3300036647 | Bacteria | 4754 |
| 416 | Ga0316582_0408366 | 3300036647 | Bacteria | 936 |
| 417 | Ga0316582_0630330 | 3300036647 | Unclassified | 737 |
| 418 | Ga0316584_0030605 | 3300036712 | Bacteria | 3975 |
| 419 | Ga0316584_0064963 | 3300036712 | Bacteria | 2733 |
| 420 | Ga0395899_0037139 | 3300037312 | Bacteria | 3652 |
| 421 | Ga0395899_0248203 | 3300037312 | Bacteria | 1222 |
| 422 | Ga0395900_0257425 | 3300037418 | Bacteria | 1744 |
| 423 | Ga0395898_0850017 | 3300037466 | Bacteria | 852 |
| 424 | Ga0395901_0156565 | 3300038443 | Bacteria | 2393 |
| 425 | Ga0436361_0206950 | 3300039447 | Bacteria | 229672 |
| 426 | Ga0436361_0278271 | 3300039447 | Bacteria | 1598 |
| 427 | Ga0451807_0905457 | 3300041486 | Bacteria | 634 |
| 428 | Ga0451839_0832343 | 3300041496 | Bacteria | 1059 |
| 429 | Ga0451849_0735254 | 3300041505 | Bacteria | 1541 |
| 430 | Ga0451843_0091166 | 3300041509 | Bacteria | 735 |
| 431 | Ga0439431_0066527 | 3300041997 | Bacteria | 955 |
| 432 | Ga0439442_086621 | 3300042002 | Unclassified | 672 |
| 433 | Ga0439435_0023736 | 3300042436 | Bacteria | 1613 |
| 434 | Ga0451577_0016709 | 3300042876 | Bacteria | 6786 |
| 435 | Ga0451577_0093219 | 3300042876 | Bacteria | 2689 |
| 436 | Ga0451577_0225991 | 3300042876 | Bacteria | 1692 |
| 437 | Ga0451577_0300670 | 3300042876 | Bacteria | 1454 |
| 438 | Ga0451577_1386959 | 3300042876 | Bacteria | 623 |
| 439 | Ga0439440_0046911 | 3300042993 | Bacteria | 1069 |
| 440 | Ga0453684_0026226 | 3300044712 | Bacteria | 8429 |
| 441 | Ga0453684_0059554 | 3300044712 | Bacteria | 4921 |
| 442 | Ga0453684_0152886 | 3300044712 | Bacteria | 2740 |
| 443 | Ga0453684_1093282 | 3300044712 | Bacteria | 843 |
| 444 | Ga0466957_0231919 | 3300044842 | Bacteria | 1222 |
| 445 | Ga0451576_0095049 | 3300045051 | Bacteria | 3100 |
| 446 | Ga0451576_0340881 | 3300045051 | Bacteria | 1569 |
| 447 | Ga0451576_0848943 | 3300045051 | Bacteria | 958 |
| 448 | Ga0451576_1329397 | 3300045051 | Bacteria | 749 |
| 449 | Ga0495603_0060561 | 3300046455 | Bacteria | 2237 |
| 450 | Ga0495650_0011192 | 3300046471 | Bacteria | 4938 |
| 451 | Ga0495584_0026762 | 3300046491 | Bacteria | 2923 |
| 452 | Ga0495585_0082098 | 3300046492 | Bacteria | 1745 |
| 453 | Ga0495594_0550188 | 3300046499 | Bacteria | 655 |
| 454 | Ga0495583_0174842 | 3300046506 | Bacteria | 881 |
| 455 | Ga0495666_0408072 | 3300046526 | Bacteria | 610 |
| 456 | Ga0495642_0074576 | 3300046528 | Bacteria | 1423 |
| 457 | Ga0495654_0149289 | 3300046530 | Bacteria | 1035 |
| 458 | Ga0495640_0247995 | 3300046533 | Bacteria | 1116 |
| 459 | Ga0495586_0237775 | 3300046535 | Bacteria | 1038 |
| 460 | Ga0495597_0288313 | 3300046542 | Bacteria | 638 |
| 461 | Ga0495597_0361530 | 3300046542 | Bacteria | 556 |
| 462 | Ga0495622_0001863 | 3300046557 | Bacteria | 10384 |
| 463 | Ga0495622_0013116 | 3300046557 | Bacteria | 3845 |
| 464 | Ga0495622_0121340 | 3300046557 | Bacteria | 1193 |
| 465 | Ga0495622_0135269 | 3300046557 | Bacteria | 1121 |
| 466 | Ga0495625_0003302 | 3300046660 | Bacteria | 16275 |
| 467 | Ga0495661_0251527 | 3300046665 | Bacteria | 902 |
| 468 | Ga0495588_0678296 | 3300046674 | Bacteria | 539 |
| 469 | Ga0495646_0268391 | 3300046680 | Bacteria | 910 |
| 470 | Ga0495658_0827217 | 3300046683 | Bacteria | 593 |
| 471 | Ga0495670_0496648 | 3300046691 | Bacteria | 662 |
| 472 | Ga0495670_0832801 | 3300046691 | Bacteria | 504 |
| 473 | Ga0495671_0355432 | 3300046692 | Bacteria | 702 |
| 474 | Ga0495649_0093864 | 3300046694 | Bacteria | 1597 |
| 475 | Ga0495649_0097282 | 3300046694 | Bacteria | 1566 |
| 476 | Ga0495589_0237558 | 3300046794 | Bacteria | 853 |
| 477 | Ga0495604_0262157 | 3300047317 | Bacteria | 1174 |
| 478 | Ga0495672_0096260 | 3300047320 | Bacteria | 1614 |
| 479 | Ga0495672_0192512 | 3300047320 | Bacteria | 1024 |
| 480 | Ga0495672_0355582 | 3300047320 | Bacteria | 679 |
| 481 | Ga0495683_0033315 | 3300047323 | Bacteria | 2622 |
| 482 | Ga0495675_0591902 | 3300047444 | Bacteria | 629 |
| 483 | Ga0495686_0135295 | 3300047472 | Bacteria | 1458 |
| 484 | Ga0495626_0061472 | 3300048091 | Bacteria | 1708 |
| 485 | Ga0496100_0017786 | 3300048903 | Bacteria | 4204 |
| 486 | Ga0496101_0090865 | 3300048904 | Bacteria | 2271 |
| 487 | Ga0496102_0013609 | 3300048905 | Bacteria | 7050 |
| 488 | Ga0496103_0008254 | 3300048906 | Bacteria | 6183 |
| 489 | Ga0496104_0004105 | 3300048907 | Bacteria | 12640 |
| 490 | Ga0496105_0006945 | 3300048908 | Bacteria | 8720 |
| 491 | Ga0496106_0003137 | 3300048909 | Bacteria | 12334 |
| 492 | Ga0496107_0121258 | 3300048910 | Bacteria | 1926 |
| 493 | Ga0496108_0000439 | 3300048911 | Bacteria | 33419 |
| 494 | Ga0496109_0012084 | 3300048912 | Bacteria | 7441 |
| 495 | Ga0496109_0050637 | 3300048912 | Bacteria | 3782 |
| 496 | Ga0496110_0038398 | 3300048913 | Bacteria | 4166 |
| 497 | Ga0496110_0097051 | 3300048913 | Bacteria | 2641 |
| 498 | Ga0496110_0157362 | 3300048913 | Bacteria | 2059 |
| 499 | Ga0496110_0743893 | 3300048913 | Bacteria | 883 |
| 500 | Ga0496111_0002013 | 3300048914 | Bacteria | 12084 |
| 501 | Ga0496112_0151100 | 3300048915 | Bacteria | 2289 |
| 502 | Ga0496112_0806207 | 3300048915 | Bacteria | 863 |
| 503 | Ga0496113_0003053 | 3300048916 | Bacteria | 9923 |
| 504 | Ga0496113_0010563 | 3300048916 | Bacteria | 6110 |
| 505 | Ga0496114_0051384 | 3300048917 | Bacteria | 3432 |
| 506 | Ga0496114_0308746 | 3300048917 | Bacteria | 1397 |
| 507 | Ga0496116_0007463 | 3300048919 | Bacteria | 9690 |
| 508 | Ga0496117_0030682 | 3300048920 | Bacteria | 4119 |
| 509 | Ga0496118_0061027 | 3300048921 | Bacteria | 2795 |
| 510 | Ga0496119_0001639 | 3300048922 | Bacteria | 26359 |
| 511 | Ga0496121_0133348 | 3300048924 | Bacteria | 1855 |
| 512 | Ga0496122_0010776 | 3300048925 | Bacteria | 9375 |
| 513 | Ga0496123_0047529 | 3300048926 | Bacteria | 2898 |
| 514 | Ga0496124_0231815 | 3300048927 | Bacteria | 1380 |
| 515 | Ga0496124_0340649 | 3300048927 | Bacteria | 1065 |
| 516 | Ga0496125_0011191 | 3300048928 | Bacteria | 8993 |
| 517 | Ga0496126_0005200 | 3300048929 | Bacteria | 15027 |
| 518 | Ga0496126_0416475 | 3300048929 | Bacteria | 1087 |
| 519 | Ga0501306_006040 | 3300049127 | Bacteria | 1408 |
| 520 | Ga0501309_007194 | 3300049129 | Bacteria | 1375 |
| 521 | Ga0501341_00934 | 3300049131 | Bacteria | 1363 |
| 522 | Ga0501305_007242 | 3300049161 | Bacteria | 1402 |
| 523 | Ga0501299_012310 | 3300049522 | Bacteria | 1457 |
| 524 | Ga0501311_003353 | 3300049527 | Bacteria | 1625 |
| 525 | Ga0501312_005299 | 3300049528 | Bacteria | 1560 |
| 526 | Ga0501312_079865 | 3300049528 | Bacteria | 591 |
| 527 | Ga0501313_001030 | 3300049529 | Bacteria | 2246 |
| 528 | Ga0501315_001241 | 3300049531 | Bacteria | 2121 |
| 529 | Ga0501316_000041 | 3300049532 | Bacteria | 5313 |
| 530 | Ga0501316_037266 | 3300049532 | Bacteria | 668 |
| 531 | Ga0501317_000055 | 3300049533 | Bacteria | 5224 |
| 532 | Ga0501318_000041 | 3300049534 | Bacteria | 5269 |
| 533 | Ga0501319_001286 | 3300049535 | Bacteria | 1422 |
| 534 | Ga0501320_002486 | 3300049536 | Bacteria | 1477 |
| 535 | Ga0501322_000303 | 3300049538 | Bacteria | 2186 |
| 536 | Ga0501323_001339 | 3300049539 | Bacteria | 2155 |
| 537 | Ga0501324_000661 | 3300049540 | Bacteria | 1984 |
| 538 | Ga0501326_00773 | 3300049542 | Bacteria | 1352 |
| 539 | Ga0501327_00858 | 3300049543 | Bacteria | 1350 |
| 540 | Ga0501328_00414 | 3300049544 | Bacteria | 1412 |
| 541 | Ga0501330_000576 | 3300049546 | Bacteria | 1621 |
| 542 | Ga0501330_000702 | 3300049546 | Bacteria | 1530 |
| 543 | Ga0501332_00916 | 3300049548 | Bacteria | 1434 |
| 544 | Ga0501334_00126 | 3300049550 | Bacteria | 2732 |
| 545 | Ga0501335_001289 | 3300049551 | Bacteria | 1899 |
| 546 | Ga0501338_00929 | 3300049554 | Bacteria | 1469 |
| 547 | Ga0501032_0204347 | 3300049569 | Bacteria | 1289 |
| 548 | Ga0501033_0113017 | 3300049570 | Bacteria | 1975 |
| 549 | Ga0501033_0686164 | 3300049570 | Bacteria | 698 |
| 550 | Ga0501034_0142026 | 3300049571 | Bacteria | 2380 |
| 551 | Ga0501037_0165220 | 3300049573 | Bacteria | 1576 |
| 552 | Ga0501039_1253613 | 3300049575 | Bacteria | 573 |
| 553 | Ga0501041_0859781 | 3300049577 | Bacteria | 582 |
| 554 | Ga0501042_0278558 | 3300049578 | Bacteria | 1208 |
| 555 | Ga0501043_0049648 | 3300049579 | Bacteria | 3299 |
| 556 | Ga0501046_0046018 | 3300049580 | Bacteria | 3464 |
| 557 | Ga0501046_0177478 | 3300049580 | Bacteria | 1595 |
| 558 | Ga0501046_0177669 | 3300049580 | Bacteria | 1594 |
| 559 | Ga0501047_0103849 | 3300049581 | Bacteria | 2722 |
| 560 | Ga0501047_0138814 | 3300049581 | Bacteria | 2310 |
| 561 | Ga0501070_0043737 | 3300049586 | Bacteria | 3727 |
| 562 | Ga0501070_0538095 | 3300049586 | Bacteria | 936 |
| 563 | Ga0501072_0397019 | 3300049588 | Bacteria | 1094 |
| 564 | Ga0501073_0441407 | 3300049589 | Bacteria | 900 |
| 565 | Ga0501075_0120353 | 3300049591 | Bacteria | 1998 |
| 566 | Ga0501206_099439 | 3300049653 | Bacteria | 526 |
| 567 | Ga0501217_126908 | 3300049661 | Bacteria | 745 |
| 568 | Ga0501253_061421 | 3300049683 | Bacteria | 811 |
| 569 | Ga0501245_047812 | 3300049708 | Bacteria | 751 |
| 570 | Ga0501079_0649130 | 3300049741 | Bacteria | 831 |
| 571 | Ga0501079_1622603 | 3300049741 | Bacteria | 509 |
| 572 | Ga0501080_0348399 | 3300049742 | Bacteria | 1338 |
| 573 | Ga0501080_0845063 | 3300049742 | Bacteria | 801 |
| 574 | Ga0501081_0400441 | 3300049743 | Bacteria | 1016 |
| 575 | Ga0501232_074106 | 3300049757 | Bacteria | 567 |
| 576 | Ga0501035_0034484 | 3300049822 | Bacteria | 4598 |
| 577 | Ga0501044_0030186 | 3300049823 | Bacteria | 5714 |
| 578 | Ga0501044_0137498 | 3300049823 | Bacteria | 2434 |
| 579 | Ga0501044_0230890 | 3300049823 | Bacteria | 1798 |
| 580 | nmdc:mga00v17_52782_c1 | 3300050491 | Bacteria | 2475 |
| 581 | nmdc:mga0yw44_52322_c1 | 3300050492 | Bacteria | 2475 |
| 582 | nmdc:mga06z11_977402_c1 | 3300050494 | Bacteria | 516 |
| 583 | nmdc:mga05p37_12690_c1 | 3300050507 | Bacteria | 10069 |
| 584 | nmdc:mga05p37_2097308_c1 | 3300050507 | Bacteria | 530 |
| 585 | nmdc:mga05p37_942147_c1 | 3300050507 | Bacteria | 925 |
| 586 | nmdc:mga09592_180578_c1 | 3300050508 | Bacteria | 1826 |
| 587 | nmdc:mga09592_3569_c1 | 3300050508 | Bacteria | 12561 |
| 588 | nmdc:mga09592_558458_c1 | 3300050508 | Bacteria | 983 |
| 589 | nmdc:mga09592_57438_c1 | 3300050508 | Bacteria | 3289 |
| 590 | nmdc:mga0qj67_18582_c1 | 3300050509 | Bacteria | 5298 |
| 591 | nmdc:mga0qj67_24831_c1 | 3300050509 | Bacteria | 4624 |
| 592 | nmdc:mga0qj67_58667_c1 | 3300050509 | Bacteria | 3052 |
| 593 | nmdc:mga0qj67_761181_c1 | 3300050509 | Bacteria | 768 |
| 594 | nmdc:mga0qj67_9189_c1 | 3300050509 | Bacteria | 7341 |
| 595 | nmdc:mga06r32_109833_c1 | 3300050510 | Bacteria | 2712 |
| 596 | nmdc:mga06r32_20977_c1 | 3300050510 | Bacteria | 6025 |
| 597 | nmdc:mga06r32_29_c1 | 3300050510 | Bacteria | 85620 |
| 598 | nmdc:mga06r32_69838_c1 | 3300050510 | Bacteria | 3396 |
| 599 | nmdc:mga06r32_745_c1 | 3300050510 | Bacteria | 28580 |
| 600 | nmdc:mga08y16_101800_c1 | 3300050511 | Bacteria | 2990 |
| 601 | nmdc:mga08y16_1085_c1 | 3300050511 | Bacteria | 26787 |
| 602 | nmdc:mga08y16_12457_c1 | 3300050511 | Bacteria | 8946 |
| 603 | nmdc:mga08y16_126615_c1 | 3300050511 | Bacteria | 2657 |
| 604 | nmdc:mga08y16_21601_c1 | 3300050511 | Bacteria | 6797 |
| 605 | nmdc:mga08y16_385305_c1 | 3300050511 | Bacteria | 1436 |
| 606 | nmdc:mga08y16_40025_c1 | 3300050511 | Bacteria | 4915 |
| 607 | nmdc:mga08y16_94823_c1 | 3300050511 | Bacteria | 3109 |
| 608 | nmdc:mga0n895_271212_c1 | 3300050512 | Bacteria | 1721 |
| 609 | Ga0500635_0389313 | 3300053080 | Bacteria | 552 |
| 610 | Ga0500578_0273891 | 3300053086 | Bacteria | 1009 |
| 611 | Ga0500583_0071895 | 3300053092 | Bacteria | 1656 |
| 612 | Ga0500583_0173687 | 3300053092 | Bacteria | 1073 |
| 613 | Ga0500651_0334610 | 3300053093 | Bacteria | 862 |
| 614 | Ga0500650_0183134 | 3300053098 | Bacteria | 959 |
| 615 | Ga0500556_0435124 | 3300053104 | Bacteria | 500 |
| 616 | Ga0500594_0237034 | 3300053118 | Bacteria | 605 |
| 617 | Ga0500595_005260 | 3300053119 | Bacteria | 5672 |
| 618 | Ga0500652_000461 | 3300053131 | Bacteria | 14425 |
| 619 | Ga0500655_030809 | 3300053133 | Bacteria | 1033 |
| 620 | Ga0500658_0195587 | 3300053134 | Bacteria | 924 |
| 621 | Ga0500588_0001145 | 3300053146 | Bacteria | 4874 |
| 622 | Ga0500588_0010637 | 3300053146 | Bacteria | 2229 |
| 623 | Ga0500604_0054172 | 3300053151 | Bacteria | 1245 |
| 624 | Ga0500622_0003682 | 3300053156 | Bacteria | 10060 |
| 625 | Ga0500622_0010223 | 3300053156 | Bacteria | 5158 |
| 626 | Ga0500637_0000274 | 3300053178 | Bacteria | 19244 |
| 627 | Ga0500637_0227349 | 3300053178 | Bacteria | 1052 |
| 628 | Ga0500637_0310866 | 3300053178 | Bacteria | 855 |
| 629 | Ga0500601_001029 | 3300053737 | Bacteria | 3201 |
| 630 | Ga0501084_0493529 | 3300054114 | Bacteria | 1035 |
| 631 | Ga0501084_1271753 | 3300054114 | Bacteria | 617 |
| 632 | Ga0590075_147239 | 3300059424 | Unclassified | 620 |
| 633 | Ga0587128_123185 | 3300059630 | Unclassified | 566 |
| 634 | Ga0587114_012855 | 3300059655 | Bacteria | 1068 |
| 635 | Ga0530510_0269732 | 3300061734 | Bacteria | 1270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046542 | Ga0495597_0361530 | Ga0495597_0361530_55_495 | 119 |
| 2 | 3300046557 | Ga0495622_0013116 | Ga0495622_0013116_1665_2105 | 119 |
| 3 | 3300046691 | Ga0495670_0832801 | Ga0495670_0832801_23_463 | 119 |
| 4 | 3300046694 | Ga0495649_0097282 | Ga0495649_0097282_44_484 | 119 |
| 5 | 3300026067 | Ga0207678_10288954 | Ga0207678_102889542 | 121 |
| 6 | 3300037466 | Ga0395898_0850017 | Ga0395898_0850017_281_679 | 121 |
| 7 | 3300003187 | JGI25151J46595_10010063 | JGI25151J46595_100100635 | 122 |
| 8 | 3300003316 | rootH1_10008501 | rootH1_100085017 | 122 |
| 9 | 3300003322 | rootL2_10034951 | rootL2_100349518 | 122 |
| 10 | 3300003323 | rootH1_10112062 | rootH1_101120622 | 122 |
| 11 | 3300003578 | Ga0006562J51391_1000948 | Ga0006562J51391_100094817 | 122 |
| 12 | 3300003758 | Ga0055532_1004114 | Ga0055532_10041143 | 122 |
| 13 | 3300005331 | Ga0070670_100466076 | Ga0070670_1004660762 | 122 |
| 14 | 3300005354 | Ga0070675_100104699 | Ga0070675_1001046992 | 122 |
| 15 | 3300005355 | Ga0070671_100013991 | Ga0070671_1000139913 | 122 |
| 16 | 3300005543 | Ga0070672_100011947 | Ga0070672_1000119475 | 122 |
| 17 | 3300005548 | Ga0070665_100333268 | Ga0070665_1003332682 | 122 |
| 18 | 3300006163 | Ga0070715_10212121 | Ga0070715_102121212 | 122 |
| 19 | 3300009036 | Ga0105244_10265795 | Ga0105244_102657951 | 122 |
| 20 | 3300009092 | Ga0105250_10073926 | Ga0105250_100739262 | 122 |
| 21 | 3300009098 | Ga0105245_10037225 | Ga0105245_100372255 | 122 |
| 22 | 3300009101 | Ga0105247_10064863 | Ga0105247_100648632 | 122 |
| 23 | 3300009148 | Ga0105243_10021747 | Ga0105243_100217475 | 122 |
| 24 | 3300009176 | Ga0105242_10017403 | Ga0105242_100174033 | 122 |
| 25 | 3300010375 | Ga0105239_10976283 | Ga0105239_109762832 | 122 |
| 26 | 3300011119 | Ga0105246_10006304 | Ga0105246_100063042 | 122 |
| 27 | 3300013296 | Ga0157374_10201778 | Ga0157374_102017782 | 122 |
| 28 | 3300013297 | Ga0157378_10065072 | Ga0157378_100650723 | 122 |
| 29 | 3300013307 | Ga0157372_10180157 | Ga0157372_101801572 | 122 |
| 30 | 3300025229 | Ga0209147_101571 | Ga0209147_1015713 | 122 |
| 31 | 3300025273 | Ga0209673_1001821 | Ga0209673_100182116 | 122 |
| 32 | 3300025294 | Ga0209025_1128520 | Ga0209025_11285201 | 122 |
| 33 | 3300025711 | Ga0207696_1019848 | Ga0207696_10198482 | 122 |
| 34 | 3300025728 | Ga0207655_1001341 | Ga0207655_100134116 | 122 |
| 35 | 3300025735 | Ga0207713_1000472 | Ga0207713_100047231 | 122 |
| 36 | 3300025900 | Ga0207710_10008538 | Ga0207710_100085382 | 122 |
| 37 | 3300025903 | Ga0207680_10315621 | Ga0207680_103156212 | 122 |
| 38 | 3300025905 | Ga0207685_10207650 | Ga0207685_102076502 | 122 |
| 39 | 3300025926 | Ga0207659_10668837 | Ga0207659_106688372 | 122 |
| 40 | 3300025927 | Ga0207687_10194604 | Ga0207687_101946042 | 122 |
| 41 | 3300025931 | Ga0207644_10019360 | Ga0207644_100193603 | 122 |
| 42 | 3300025934 | Ga0207686_10266591 | Ga0207686_102665912 | 122 |
| 43 | 3300025935 | Ga0207709_10011396 | Ga0207709_100113962 | 122 |
| 44 | 3300028379 | Ga0268266_10265486 | Ga0268266_102654862 | 122 |
| 45 | 3300031548 | Ga0307408_100076616 | Ga0307408_1000766163 | 122 |
| 46 | 3300031995 | Ga0307409_101477730 | Ga0307409_1014777302 | 122 |
| 47 | 3300032002 | Ga0307416_100071953 | Ga0307416_1000719533 | 122 |
| 48 | 3300046491 | Ga0495584_0026762 | Ga0495584_0026762_2186_2620 | 122 |
| 49 | 3300046492 | Ga0495585_0082098 | Ga0495585_0082098_574_1008 | 122 |
| 50 | 3300046557 | Ga0495622_0121340 | Ga0495622_0121340_395_829 | 122 |
| 51 | 3300046665 | Ga0495661_0251527 | Ga0495661_0251527_262_696 | 122 |
| 52 | 3300046674 | Ga0495588_0678296 | Ga0495588_0678296_49_483 | 122 |
| 53 | 3300046691 | Ga0495670_0496648 | Ga0495670_0496648_165_599 | 122 |
| 54 | 3300047323 | Ga0495683_0033315 | Ga0495683_0033315_302_736 | 122 |
| 55 | 3300048903 | Ga0496100_0017786 | Ga0496100_0017786_3702_4136 | 122 |
| 56 | 3300048904 | Ga0496101_0090865 | Ga0496101_0090865_769_1203 | 122 |
| 57 | 3300048905 | Ga0496102_0013609 | Ga0496102_0013609_2721_3155 | 122 |
| 58 | 3300048906 | Ga0496103_0008254 | Ga0496103_0008254_1837_2271 | 122 |
| 59 | 3300048907 | Ga0496104_0004105 | Ga0496104_0004105_3908_4342 | 122 |
| 60 | 3300048908 | Ga0496105_0006945 | Ga0496105_0006945_3774_4208 | 122 |
| 61 | 3300048909 | Ga0496106_0003137 | Ga0496106_0003137_1015_1449 | 122 |
| 62 | 3300048910 | Ga0496107_0121258 | Ga0496107_0121258_1179_1613 | 122 |
| 63 | 3300048911 | Ga0496108_0000439 | Ga0496108_0000439_24142_24576 | 122 |
| 64 | 3300048912 | Ga0496109_0012084 | Ga0496109_0012084_2721_3155 | 122 |
| 65 | 3300048913 | Ga0496110_0038398 | Ga0496110_0038398_1849_2283 | 122 |
| 66 | 3300048914 | Ga0496111_0002013 | Ga0496111_0002013_765_1199 | 122 |
| 67 | 3300048915 | Ga0496112_0806207 | Ga0496112_0806207_302_736 | 122 |
| 68 | 3300048916 | Ga0496113_0003053 | Ga0496113_0003053_4036_4470 | 122 |
| 69 | 3300048917 | Ga0496114_0051384 | Ga0496114_0051384_2619_3053 | 122 |
| 70 | 3300048919 | Ga0496116_0007463 | Ga0496116_0007463_4036_4470 | 122 |
| 71 | 3300048920 | Ga0496117_0030682 | Ga0496117_0030682_568_1002 | 122 |
| 72 | 3300048921 | Ga0496118_0061027 | Ga0496118_0061027_1586_2020 | 122 |
| 73 | 3300048922 | Ga0496119_0001639 | Ga0496119_0001639_25858_26292 | 122 |
| 74 | 3300048924 | Ga0496121_0133348 | Ga0496121_0133348_1394_1828 | 122 |
| 75 | 3300048925 | Ga0496122_0010776 | Ga0496122_0010776_2212_2646 | 122 |
| 76 | 3300048926 | Ga0496123_0047529 | Ga0496123_0047529_540_974 | 122 |
| 77 | 3300048927 | Ga0496124_0231815 | Ga0496124_0231815_363_797 | 122 |
| 78 | 3300048928 | Ga0496125_0011191 | Ga0496125_0011191_51_485 | 122 |
| 79 | 3300048929 | Ga0496126_0005200 | Ga0496126_0005200_3912_4346 | 122 |
| 80 | 3300049127 | Ga0501306_006040 | Ga0501306_006040_897_1331 | 122 |
| 81 | 3300049129 | Ga0501309_007194 | Ga0501309_007194_898_1332 | 122 |
| 82 | 3300049131 | Ga0501341_00934 | Ga0501341_00934_41_475 | 122 |
| 83 | 3300049161 | Ga0501305_007242 | Ga0501305_007242_61_495 | 122 |
| 84 | 3300049527 | Ga0501311_003353 | Ga0501311_003353_889_1323 | 122 |
| 85 | 3300049528 | Ga0501312_005299 | Ga0501312_005299_888_1322 | 122 |
| 86 | 3300049529 | Ga0501313_001030 | Ga0501313_001030_404_838 | 122 |
| 87 | 3300049531 | Ga0501315_001241 | Ga0501315_001241_1616_2050 | 122 |
| 88 | 3300049532 | Ga0501316_000041 | Ga0501316_000041_3388_3822 | 122 |
| 89 | 3300049533 | Ga0501317_000055 | Ga0501317_000055_3386_3820 | 122 |
| 90 | 3300049534 | Ga0501318_000041 | Ga0501318_000041_3386_3820 | 122 |
| 91 | 3300049535 | Ga0501319_001286 | Ga0501319_001286_44_478 | 122 |
| 92 | 3300049536 | Ga0501320_002486 | Ga0501320_002486_997_1431 | 122 |
| 93 | 3300049538 | Ga0501322_000303 | Ga0501322_000303_378_812 | 122 |
| 94 | 3300049539 | Ga0501323_001339 | Ga0501323_001339_1380_1814 | 122 |
| 95 | 3300049540 | Ga0501324_000661 | Ga0501324_000661_103_537 | 122 |
| 96 | 3300049542 | Ga0501326_00773 | Ga0501326_00773_25_459 | 122 |
| 97 | 3300049543 | Ga0501327_00858 | Ga0501327_00858_25_459 | 122 |
| 98 | 3300049544 | Ga0501328_00414 | Ga0501328_00414_47_481 | 122 |
| 99 | 3300049546 | Ga0501330_000576 | Ga0501330_000576_267_701 | 122 |
| 100 | 3300049548 | Ga0501332_00916 | Ga0501332_00916_78_512 | 122 |
| 101 | 3300049551 | Ga0501335_001289 | Ga0501335_001289_25_459 | 122 |
| 102 | 3300049554 | Ga0501338_00929 | Ga0501338_00929_22_456 | 122 |
| 103 | 3300049653 | Ga0501206_099439 | Ga0501206_099439_50_484 | 122 |
| 104 | 3300049661 | Ga0501217_126908 | Ga0501217_126908_262_696 | 122 |
| 105 | 3300049683 | Ga0501253_061421 | Ga0501253_061421_215_649 | 122 |
| 106 | 3300049708 | Ga0501245_047812 | Ga0501245_047812_103_537 | 122 |
| 107 | 3300049757 | Ga0501232_074106 | Ga0501232_074106_40_474 | 122 |
| 108 | 3300061734 | Ga0530510_0269732 | Ga0530510_0269732_571_1005 | 122 |
| 109 | 3300050511 | nmdc:mga08y16_126615_c1 | nmdc:mga08y16_126615_c1_2238_2636 | 124 |
| 110 | 3300049578 | Ga0501042_0278558 | Ga0501042_0278558_291_713 | 136 |
| 111 | 3300049591 | Ga0501075_0120353 | Ga0501075_0120353_1387_1809 | 136 |
| 112 | 3300049741 | Ga0501079_1622603 | Ga0501079_1622603_71_493 | 136 |
| 113 | 3300054114 | Ga0501084_1271753 | Ga0501084_1271753_129_551 | 136 |
| 114 | iso_pu_bacteria | 2977254563 | 2977256002 | 137 |
| 115 | iso_pu_bacteria | 3001892409 | 3001895290 | 137 |
| 116 | iso_pu_bacteria | 2990275345 | 2990276848 | 138 |
| 117 | 3300010375 | Ga0105239_11159321 | Ga0105239_111593212 | 139 |
| 118 | 3300049743 | Ga0501081_0400441 | Ga0501081_0400441_109_549 | 139 |
| 119 | 3300046557 | Ga0495622_0135269 | Ga0495622_0135269_263_706 | 140 |
| 120 | 3300048913 | Ga0496110_0743893 | Ga0496110_0743893_349_792 | 140 |
| 121 | 3300049546 | Ga0501330_000702 | Ga0501330_000702_200_643 | 140 |
| 122 | 3300049586 | Ga0501070_0538095 | Ga0501070_0538095_233_679 | 140 |
| 123 | 3300049741 | Ga0501079_0649130 | Ga0501079_0649130_58_498 | 140 |
| 124 | 3300049823 | Ga0501044_0230890 | Ga0501044_0230890_639_1085 | 140 |
| 125 | 3300054114 | Ga0501084_0493529 | Ga0501084_0493529_137_577 | 140 |
| 126 | 3300006175 | Ga0070712_101215316 | Ga0070712_1012153162 | 141 |
| 127 | 3300049528 | Ga0501312_079865 | Ga0501312_079865_132_575 | 141 |
| 128 | 3300049532 | Ga0501316_037266 | Ga0501316_037266_44_487 | 141 |
| 129 | 3300049550 | Ga0501334_00126 | Ga0501334_00126_54_500 | 141 |
| 130 | 3300005434 | Ga0070709_10338902 | Ga0070709_103389022 | 142 |
| 131 | 3300005435 | Ga0070714_100704938 | Ga0070714_1007049381 | 142 |
| 132 | 3300005437 | Ga0070710_10170391 | Ga0070710_101703911 | 142 |
| 133 | 3300006846 | Ga0075430_100029879 | Ga0075430_1000298795 | 142 |
| 134 | 3300025898 | Ga0207692_10395306 | Ga0207692_103953061 | 142 |
| 135 | 3300025906 | Ga0207699_10176362 | Ga0207699_101763622 | 142 |
| 136 | 3300025929 | Ga0207664_10711767 | Ga0207664_107117671 | 142 |
| 137 | 3300050509 | nmdc:mga0qj67_24831_c1 | nmdc:mga0qj67_24831_c1_2345_2821 | 142 |
| 138 | 3300025942 | Ga0207689_10074642 | Ga0207689_100746423 | 143 |
| 139 | 3300026088 | Ga0207641_10123034 | Ga0207641_101230342 | 144 |
| 140 | 3300031727 | Ga0316576_10012929 | Ga0316576_100129293 | 144 |
| 141 | 3300031728 | Ga0316578_10002481 | Ga0316578_100024817 | 144 |
| 142 | 3300032139 | Ga0316580_10182750 | Ga0316580_101827501 | 144 |
| 143 | 3300035088 | Ga0373940_0039046 | Ga0373940_0039046_148_612 | 144 |
| 144 | 3300035114 | Ga0373939_0026335 | Ga0373939_0026335_232_696 | 144 |
| 145 | 3300035207 | Ga0373942_0020873 | Ga0373942_0020873_1126_1590 | 144 |
| 146 | 3300035695 | Ga0373927_0763152 | Ga0373927_0763152_140_604 | 144 |
| 147 | 3300036647 | Ga0316582_0630330 | Ga0316582_0630330_150_605 | 144 |
| 148 | 3300036712 | Ga0316584_0064963 | Ga0316584_0064963_486_941 | 144 |
| 149 | 3300046455 | Ga0495603_0060561 | Ga0495603_0060561_625_1089 | 144 |
| 150 | 3300046499 | Ga0495594_0550188 | Ga0495594_0550188_136_600 | 144 |
| 151 | 3300046506 | Ga0495583_0174842 | Ga0495583_0174842_80_544 | 144 |
| 152 | 3300046528 | Ga0495642_0074576 | Ga0495642_0074576_851_1315 | 144 |
| 153 | 3300046530 | Ga0495654_0149289 | Ga0495654_0149289_279_743 | 144 |
| 154 | 3300046542 | Ga0495597_0288313 | Ga0495597_0288313_97_564 | 144 |
| 155 | 3300046557 | Ga0495622_0001863 | Ga0495622_0001863_41_508 | 144 |
| 156 | 3300046692 | Ga0495671_0355432 | Ga0495671_0355432_180_644 | 144 |
| 157 | 3300046694 | Ga0495649_0093864 | Ga0495649_0093864_231_695 | 144 |
| 158 | 3300046794 | Ga0495589_0237558 | Ga0495589_0237558_273_737 | 144 |
| 159 | 3300047320 | Ga0495672_0192512 | Ga0495672_0192512_387_851 | 144 |
| 160 | 3300048091 | Ga0495626_0061472 | Ga0495626_0061472_943_1407 | 144 |
| 161 | 3300053080 | Ga0500635_0389313 | Ga0500635_0389313_27_494 | 144 |
| 162 | 3300053086 | Ga0500578_0273891 | Ga0500578_0273891_420_884 | 144 |
| 163 | 3300053133 | Ga0500655_030809 | Ga0500655_030809_37_504 | 144 |
| 164 | 3300053178 | Ga0500637_0000274 | Ga0500637_0000274_14263_14736 | 144 |
| 165 | 3300053178 | Ga0500637_0310866 | Ga0500637_0310866_211_675 | 144 |
| 166 | 3300004803 | Ga0058862_11585074 | Ga0058862_115850743 | 145 |
| 167 | 3300005334 | Ga0068869_100065870 | Ga0068869_1000658703 | 145 |
| 168 | 3300005341 | Ga0070691_10365677 | Ga0070691_103656772 | 145 |
| 169 | 3300005344 | Ga0070661_100393101 | Ga0070661_1003931012 | 145 |
| 170 | 3300005345 | Ga0070692_10022839 | Ga0070692_100228395 | 145 |
| 171 | 3300005354 | Ga0070675_101620232 | Ga0070675_1016202322 | 145 |
| 172 | 3300005364 | Ga0070673_101605862 | Ga0070673_1016058622 | 145 |
| 173 | 3300005365 | Ga0070688_100614490 | Ga0070688_1006144902 | 145 |
| 174 | 3300005438 | Ga0070701_10006243 | Ga0070701_100062432 | 145 |
| 175 | 3300005441 | Ga0070700_100042341 | Ga0070700_1000423412 | 145 |
| 176 | 3300005444 | Ga0070694_100458500 | Ga0070694_1004585002 | 145 |
| 177 | 3300005459 | Ga0068867_100036820 | Ga0068867_1000368205 | 145 |
| 178 | 3300005545 | Ga0070695_100396481 | Ga0070695_1003964811 | 145 |
| 179 | 3300005549 | Ga0070704_100036982 | Ga0070704_1000369822 | 145 |
| 180 | 3300005719 | Ga0068861_100017222 | Ga0068861_1000172222 | 145 |
| 181 | 3300005719 | Ga0068861_101529215 | Ga0068861_1015292151 | 145 |
| 182 | 3300005840 | Ga0068870_10230120 | Ga0068870_102301202 | 145 |
| 183 | 3300005844 | Ga0068862_100009915 | Ga0068862_1000099157 | 145 |
| 184 | 3300006846 | Ga0075430_100010186 | Ga0075430_10001018610 | 145 |
| 185 | 3300006880 | Ga0075429_100029953 | Ga0075429_1000299535 | 145 |
| 186 | 3300009093 | Ga0105240_10053016 | Ga0105240_100530163 | 145 |
| 187 | 3300009094 | Ga0111539_10012659 | Ga0111539_100126595 | 145 |
| 188 | 3300009098 | Ga0105245_10881618 | Ga0105245_108816182 | 145 |
| 189 | 3300009148 | Ga0105243_10155869 | Ga0105243_101558692 | 145 |
| 190 | 3300010375 | Ga0105239_10319122 | Ga0105239_103191222 | 145 |
| 191 | 3300014326 | Ga0157380_10562052 | Ga0157380_105620522 | 145 |
| 192 | 3300020080 | Ga0206350_10161612 | Ga0206350_101616123 | 145 |
| 193 | 3300021361 | Ga0213872_10000514 | Ga0213872_100005143 | 145 |
| 194 | 3300021361 | Ga0213872_10074827 | Ga0213872_100748272 | 145 |
| 195 | 3300025913 | Ga0207695_10130671 | Ga0207695_101306713 | 145 |
| 196 | 3300025917 | Ga0207660_10101854 | Ga0207660_101018543 | 145 |
| 197 | 3300025918 | Ga0207662_10788673 | Ga0207662_107886731 | 145 |
| 198 | 3300025926 | Ga0207659_10211389 | Ga0207659_102113892 | 145 |
| 199 | 3300025927 | Ga0207687_10603955 | Ga0207687_106039552 | 145 |
| 200 | 3300025935 | Ga0207709_10385063 | Ga0207709_103850632 | 145 |
| 201 | 3300025936 | Ga0207670_10135651 | Ga0207670_101356512 | 145 |
| 202 | 3300025938 | Ga0207704_10409003 | Ga0207704_104090032 | 145 |
| 203 | 3300025942 | Ga0207689_10252163 | Ga0207689_102521632 | 145 |
| 204 | 3300026075 | Ga0207708_10013991 | Ga0207708_100139913 | 145 |
| 205 | 3300026089 | Ga0207648_10029655 | Ga0207648_100296555 | 145 |
| 206 | 3300026118 | Ga0207675_100028971 | Ga0207675_1000289712 | 145 |
| 207 | 3300026118 | Ga0207675_100273562 | Ga0207675_1002735621 | 145 |
| 208 | 3300027471 | Ga0209995_1050258 | Ga0209995_10502582 | 145 |
| 209 | 3300027876 | Ga0209974_10120213 | Ga0209974_101202132 | 145 |
| 210 | 3300027907 | Ga0207428_10119049 | Ga0207428_101190492 | 145 |
| 211 | 3300028380 | Ga0268265_10007663 | Ga0268265_100076636 | 145 |
| 212 | 3300028666 | Ga0265336_10019739 | Ga0265336_100197392 | 145 |
| 213 | 3300028800 | Ga0265338_10015048 | Ga0265338_100150487 | 145 |
| 214 | 3300031239 | Ga0265328_10110850 | Ga0265328_101108502 | 145 |
| 215 | 3300031250 | Ga0265331_10003256 | Ga0265331_100032567 | 145 |
| 216 | 3300031711 | Ga0265314_10003713 | Ga0265314_100037138 | 145 |
| 217 | 3300032002 | Ga0307416_101502055 | Ga0307416_1015020552 | 145 |
| 218 | 3300035691 | Ga0373931_0290693 | Ga0373931_0290693_138_590 | 145 |
| 219 | 3300039447 | Ga0436361_0206950 | Ga0436361_0206950_120043_120504 | 145 |
| 220 | 3300039447 | Ga0436361_0278271 | Ga0436361_0278271_565_1029 | 145 |
| 221 | 3300047472 | Ga0495686_0135295 | Ga0495686_0135295_69_533 | 145 |
| 222 | 3300049569 | Ga0501032_0204347 | Ga0501032_0204347_85_546 | 145 |
| 223 | 3300049570 | Ga0501033_0113017 | Ga0501033_0113017_699_1148 | 145 |
| 224 | 3300049571 | Ga0501034_0142026 | Ga0501034_0142026_1171_1632 | 145 |
| 225 | 3300049573 | Ga0501037_0165220 | Ga0501037_0165220_675_1124 | 145 |
| 226 | 3300049579 | Ga0501043_0049648 | Ga0501043_0049648_980_1429 | 145 |
| 227 | 3300049580 | Ga0501046_0177478 | Ga0501046_0177478_946_1407 | 145 |
| 228 | 3300049580 | Ga0501046_0177669 | Ga0501046_0177669_825_1274 | 145 |
| 229 | 3300049581 | Ga0501047_0103849 | Ga0501047_0103849_661_1110 | 145 |
| 230 | 3300049581 | Ga0501047_0138814 | Ga0501047_0138814_1309_1770 | 145 |
| 231 | 3300049586 | Ga0501070_0043737 | Ga0501070_0043737_864_1313 | 145 |
| 232 | 3300049588 | Ga0501072_0397019 | Ga0501072_0397019_626_1078 | 145 |
| 233 | 3300049589 | Ga0501073_0441407 | Ga0501073_0441407_184_633 | 145 |
| 234 | 3300049742 | Ga0501080_0348399 | Ga0501080_0348399_471_920 | 145 |
| 235 | 3300049742 | Ga0501080_0845063 | Ga0501080_0845063_148_600 | 145 |
| 236 | 3300049822 | Ga0501035_0034484 | Ga0501035_0034484_992_1441 | 145 |
| 237 | 3300049823 | Ga0501044_0030186 | Ga0501044_0030186_2815_3264 | 145 |
| 238 | 3300049823 | Ga0501044_0137498 | Ga0501044_0137498_812_1273 | 145 |
| 239 | 3300050492 | nmdc:mga0yw44_52322_c1 | nmdc:mga0yw44_52322_c1_2004_2444 | 145 |
| 240 | 3300050508 | nmdc:mga09592_57438_c1 | nmdc:mga09592_57438_c1_1091_1543 | 145 |
| 241 | 3300050509 | nmdc:mga0qj67_18582_c1 | nmdc:mga0qj67_18582_c1_3698_4150 | 145 |
| 242 | 3300050511 | nmdc:mga08y16_101800_c1 | nmdc:mga08y16_101800_c1_2338_2790 | 145 |
| 243 | 3300050511 | nmdc:mga08y16_21601_c1 | nmdc:mga08y16_21601_c1_3095_3547 | 145 |
| 244 | 3300050511 | nmdc:mga08y16_385305_c1 | nmdc:mga08y16_385305_c1_390_842 | 145 |
| 245 | 3300053131 | Ga0500652_000461 | Ga0500652_000461_11691_12167 | 145 |
| 246 | 3300053737 | Ga0500601_001029 | Ga0500601_001029_1368_1841 | 145 |
| 247 | 3300059630 | Ga0587128_123185 | Ga0587128_123185_54_500 | 145 |
| 248 | 3300059655 | Ga0587114_012855 | Ga0587114_012855_290_736 | 145 |
| 249 | 3300005367 | Ga0070667_101041581 | Ga0070667_1010415811 | 146 |
| 250 | 3300005530 | Ga0070679_100988426 | Ga0070679_1009884262 | 146 |
| 251 | 3300005563 | Ga0068855_100848707 | Ga0068855_1008487072 | 146 |
| 252 | 3300005614 | Ga0068856_100098495 | Ga0068856_1000984952 | 146 |
| 253 | 3300009093 | Ga0105240_10095439 | Ga0105240_100954392 | 146 |
| 254 | 3300009093 | Ga0105240_10133832 | Ga0105240_101338322 | 146 |
| 255 | 3300009093 | Ga0105240_10453866 | Ga0105240_104538662 | 146 |
| 256 | 3300009174 | Ga0105241_10959760 | Ga0105241_109597602 | 146 |
| 257 | 3300009174 | Ga0105241_10969160 | Ga0105241_109691602 | 146 |
| 258 | 3300009545 | Ga0105237_10210806 | Ga0105237_102108064 | 146 |
| 259 | 3300009545 | Ga0105237_10235889 | Ga0105237_102358892 | 146 |
| 260 | 3300009551 | Ga0105238_10240191 | Ga0105238_102401913 | 146 |
| 261 | 3300009551 | Ga0105238_11645396 | Ga0105238_116453962 | 146 |
| 262 | 3300025913 | Ga0207695_10224533 | Ga0207695_102245332 | 146 |
| 263 | 3300025913 | Ga0207695_10738339 | Ga0207695_107383392 | 146 |
| 264 | 3300025913 | Ga0207695_10749189 | Ga0207695_107491892 | 146 |
| 265 | 3300025914 | Ga0207671_10114232 | Ga0207671_101142322 | 146 |
| 266 | 3300025914 | Ga0207671_10404758 | Ga0207671_104047583 | 146 |
| 267 | 3300025924 | Ga0207694_10001823 | Ga0207694_1000182313 | 146 |
| 268 | 3300025949 | Ga0207667_10687442 | Ga0207667_106874422 | 146 |
| 269 | 3300026078 | Ga0207702_10111968 | Ga0207702_101119685 | 146 |
| 270 | 3300031665 | Ga0316575_10005923 | Ga0316575_100059232 | 146 |
| 271 | 3300031691 | Ga0316579_10004986 | Ga0316579_100049862 | 146 |
| 272 | 3300031691 | Ga0316579_10030530 | Ga0316579_100305303 | 146 |
| 273 | 3300031691 | Ga0316579_10181842 | Ga0316579_101818422 | 146 |
| 274 | 3300031727 | Ga0316576_10092883 | Ga0316576_100928832 | 146 |
| 275 | 3300031728 | Ga0316578_10067143 | Ga0316578_100671432 | 146 |
| 276 | 3300031733 | Ga0316577_10236261 | Ga0316577_102362612 | 146 |
| 277 | 3300032133 | Ga0316583_10039308 | Ga0316583_100393082 | 146 |
| 278 | 3300032137 | Ga0316585_10004868 | Ga0316585_100048682 | 146 |
| 279 | 3300032139 | Ga0316580_10004653 | Ga0316580_100046532 | 146 |
| 280 | 3300032168 | Ga0316593_10007229 | Ga0316593_100072293 | 146 |
| 281 | 3300032168 | Ga0316593_10030927 | Ga0316593_100309273 | 146 |
| 282 | 3300033524 | Ga0316592_1004098 | Ga0316592_10040982 | 146 |
| 283 | 3300033528 | Ga0316588_1000288 | Ga0316588_10002883 | 146 |
| 284 | 3300035398 | Ga0316574_0388611 | Ga0316574_0388611_114_569 | 146 |
| 285 | 3300036647 | Ga0316582_0012410 | Ga0316582_0012410_3920_4375 | 146 |
| 286 | 3300036647 | Ga0316582_0408366 | Ga0316582_0408366_174_638 | 146 |
| 287 | 3300036712 | Ga0316584_0030605 | Ga0316584_0030605_3279_3734 | 146 |
| 288 | 3300037312 | Ga0395899_0037139 | Ga0395899_0037139_2816_3283 | 146 |
| 289 | 3300037312 | Ga0395899_0248203 | Ga0395899_0248203_48_515 | 146 |
| 290 | 3300037418 | Ga0395900_0257425 | Ga0395900_0257425_516_983 | 146 |
| 291 | 3300038443 | Ga0395901_0156565 | Ga0395901_0156565_1153_1620 | 146 |
| 292 | 3300053098 | Ga0500650_0183134 | Ga0500650_0183134_357_824 | 146 |
| 293 | 3300053146 | Ga0500588_0010637 | Ga0500588_0010637_595_1062 | 146 |
| 294 | 2162886007 | SwRhRL2b_contig_1005527 | SwRhRL2b_0962.00003360 | 147 |
| 295 | 2162886012 | MBSR1b_contig_1214556 | MBSR1b_0359.00000110 | 147 |
| 296 | 3300002070 | JGI24750J21931_1041354 | JGI24750J21931_10413542 | 147 |
| 297 | 3300005289 | Ga0065704_10000411 | Ga0065704_1000041128 | 147 |
| 298 | 3300005290 | Ga0065712_10003849 | Ga0065712_100038493 | 147 |
| 299 | 3300005293 | Ga0065715_10092544 | Ga0065715_100925445 | 147 |
| 300 | 3300005295 | Ga0065707_10081966 | Ga0065707_1008196625 | 147 |
| 301 | 3300005327 | Ga0070658_10323747 | Ga0070658_103237471 | 147 |
| 302 | 3300005328 | Ga0070676_10032981 | Ga0070676_100329816 | 147 |
| 303 | 3300005328 | Ga0070676_10178973 | Ga0070676_101789733 | 147 |
| 304 | 3300005328 | Ga0070676_10668482 | Ga0070676_106684821 | 147 |
| 305 | 3300005331 | Ga0070670_100022137 | Ga0070670_1000221374 | 147 |
| 306 | 3300005331 | Ga0070670_100173857 | Ga0070670_1001738572 | 147 |
| 307 | 3300005334 | Ga0068869_100017831 | Ga0068869_1000178314 | 147 |
| 308 | 3300005334 | Ga0068869_100757560 | Ga0068869_1007575602 | 147 |
| 309 | 3300005336 | Ga0070680_100014471 | Ga0070680_1000144717 | 147 |
| 310 | 3300005336 | Ga0070680_100082155 | Ga0070680_1000821553 | 147 |
| 311 | 3300005337 | Ga0070682_100117396 | Ga0070682_1001173962 | 147 |
| 312 | 3300005337 | Ga0070682_100801400 | Ga0070682_1008014001 | 147 |
| 313 | 3300005338 | Ga0068868_100026036 | Ga0068868_1000260365 | 147 |
| 314 | 3300005340 | Ga0070689_100008629 | Ga0070689_1000086295 | 147 |
| 315 | 3300005343 | Ga0070687_100139086 | Ga0070687_1001390861 | 147 |
| 316 | 3300005344 | Ga0070661_100007962 | Ga0070661_1000079622 | 147 |
| 317 | 3300005344 | Ga0070661_101086293 | Ga0070661_1010862932 | 147 |
| 318 | 3300005345 | Ga0070692_10268656 | Ga0070692_102686562 | 147 |
| 319 | 3300005347 | Ga0070668_100031631 | Ga0070668_1000316313 | 147 |
| 320 | 3300005347 | Ga0070668_100367843 | Ga0070668_1003678432 | 147 |
| 321 | 3300005353 | Ga0070669_100016708 | Ga0070669_1000167082 | 147 |
| 322 | 3300005353 | Ga0070669_100050901 | Ga0070669_1000509016 | 147 |
| 323 | 3300005353 | Ga0070669_100397597 | Ga0070669_1003975972 | 147 |
| 324 | 3300005354 | Ga0070675_100010875 | Ga0070675_1000108754 | 147 |
| 325 | 3300005354 | Ga0070675_100545840 | Ga0070675_1005458402 | 147 |
| 326 | 3300005356 | Ga0070674_100020865 | Ga0070674_1000208652 | 147 |
| 327 | 3300005356 | Ga0070674_100060672 | Ga0070674_1000606724 | 147 |
| 328 | 3300005364 | Ga0070673_100006740 | Ga0070673_1000067405 | 147 |
| 329 | 3300005365 | Ga0070688_100024750 | Ga0070688_1000247504 | 147 |
| 330 | 3300005435 | Ga0070714_100017134 | Ga0070714_1000171342 | 147 |
| 331 | 3300005436 | Ga0070713_100371294 | Ga0070713_1003712942 | 147 |
| 332 | 3300005441 | Ga0070700_100076162 | Ga0070700_1000761624 | 147 |
| 333 | 3300005441 | Ga0070700_100426068 | Ga0070700_1004260682 | 147 |
| 334 | 3300005444 | Ga0070694_100582736 | Ga0070694_1005827361 | 147 |
| 335 | 3300005455 | Ga0070663_100284866 | Ga0070663_1002848662 | 147 |
| 336 | 3300005456 | Ga0070678_101004675 | Ga0070678_1010046752 | 147 |
| 337 | 3300005457 | Ga0070662_100044474 | Ga0070662_1000444743 | 147 |
| 338 | 3300005457 | Ga0070662_100128993 | Ga0070662_1001289934 | 147 |
| 339 | 3300005457 | Ga0070662_100332782 | Ga0070662_1003327822 | 147 |
| 340 | 3300005459 | Ga0068867_100021713 | Ga0068867_1000217133 | 147 |
| 341 | 3300005466 | Ga0070685_10004948 | Ga0070685_100049487 | 147 |
| 342 | 3300005530 | Ga0070679_100713075 | Ga0070679_1007130752 | 147 |
| 343 | 3300005535 | Ga0070684_100086852 | Ga0070684_1000868522 | 147 |
| 344 | 3300005539 | Ga0068853_100847867 | Ga0068853_1008478671 | 147 |
| 345 | 3300005543 | Ga0070672_100034945 | Ga0070672_1000349454 | 147 |
| 346 | 3300005543 | Ga0070672_100052226 | Ga0070672_1000522263 | 147 |
| 347 | 3300005544 | Ga0070686_100063807 | Ga0070686_1000638072 | 147 |
| 348 | 3300005544 | Ga0070686_100207209 | Ga0070686_1002072093 | 147 |
| 349 | 3300005545 | Ga0070695_100961389 | Ga0070695_1009613892 | 147 |
| 350 | 3300005546 | Ga0070696_100413326 | Ga0070696_1004133262 | 147 |
| 351 | 3300005546 | Ga0070696_100434558 | Ga0070696_1004345581 | 147 |
| 352 | 3300005547 | Ga0070693_100351430 | Ga0070693_1003514302 | 147 |
| 353 | 3300005548 | Ga0070665_100636462 | Ga0070665_1006364621 | 147 |
| 354 | 3300005548 | Ga0070665_100983682 | Ga0070665_1009836822 | 147 |
| 355 | 3300005549 | Ga0070704_100236588 | Ga0070704_1002365881 | 147 |
| 356 | 3300005563 | Ga0068855_100000592 | Ga0068855_1000005925 | 147 |
| 357 | 3300005564 | Ga0070664_100033747 | Ga0070664_1000337475 | 147 |
| 358 | 3300005564 | Ga0070664_100423364 | Ga0070664_1004233642 | 147 |
| 359 | 3300005577 | Ga0068857_100018195 | Ga0068857_1000181956 | 147 |
| 360 | 3300005577 | Ga0068857_100021815 | Ga0068857_1000218156 | 147 |
| 361 | 3300005578 | Ga0068854_100438015 | Ga0068854_1004380152 | 147 |
| 362 | 3300005614 | Ga0068856_100086602 | Ga0068856_1000866022 | 147 |
| 363 | 3300005615 | Ga0070702_100014488 | Ga0070702_1000144882 | 147 |
| 364 | 3300005615 | Ga0070702_100862519 | Ga0070702_1008625191 | 147 |
| 365 | 3300005617 | Ga0068859_100007132 | Ga0068859_1000071328 | 147 |
| 366 | 3300005618 | Ga0068864_100018191 | Ga0068864_1000181913 | 147 |
| 367 | 3300005618 | Ga0068864_100349797 | Ga0068864_1003497972 | 147 |
| 368 | 3300005719 | Ga0068861_100000256 | Ga0068861_10000025617 | 147 |
| 369 | 3300005719 | Ga0068861_100010076 | Ga0068861_1000100765 | 147 |
| 370 | 3300005719 | Ga0068861_100011863 | Ga0068861_1000118633 | 147 |
| 371 | 3300005719 | Ga0068861_100296518 | Ga0068861_1002965182 | 147 |
| 372 | 3300005840 | Ga0068870_10021396 | Ga0068870_100213962 | 147 |
| 373 | 3300005840 | Ga0068870_10040720 | Ga0068870_100407203 | 147 |
| 374 | 3300005841 | Ga0068863_100036792 | Ga0068863_1000367924 | 147 |
| 375 | 3300005841 | Ga0068863_101852005 | Ga0068863_1018520052 | 147 |
| 376 | 3300005843 | Ga0068860_100057858 | Ga0068860_1000578584 | 147 |
| 377 | 3300005843 | Ga0068860_101185633 | Ga0068860_1011856332 | 147 |
| 378 | 3300005844 | Ga0068862_100000878 | Ga0068862_10000087823 | 147 |
| 379 | 3300005844 | Ga0068862_100017462 | Ga0068862_1000174623 | 147 |
| 380 | 3300005844 | Ga0068862_100019648 | Ga0068862_1000196483 | 147 |
| 381 | 3300006051 | Ga0075364_10107807 | Ga0075364_101078072 | 147 |
| 382 | 3300006237 | Ga0097621_100129456 | Ga0097621_1001294562 | 147 |
| 383 | 3300006237 | Ga0097621_100331324 | Ga0097621_1003313242 | 147 |
| 384 | 3300006353 | Ga0075370_10786249 | Ga0075370_107862492 | 147 |
| 385 | 3300006358 | Ga0068871_100029018 | Ga0068871_1000290183 | 147 |
| 386 | 3300006358 | Ga0068871_100329134 | Ga0068871_1003291342 | 147 |
| 387 | 3300006844 | Ga0075428_100001451 | Ga0075428_10000145112 | 147 |
| 388 | 3300006844 | Ga0075428_100168484 | Ga0075428_1001684845 | 147 |
| 389 | 3300006844 | Ga0075428_100246049 | Ga0075428_1002460492 | 147 |
| 390 | 3300006844 | Ga0075428_100478570 | Ga0075428_1004785702 | 147 |
| 391 | 3300006846 | Ga0075430_100001349 | Ga0075430_10000134921 | 147 |
| 392 | 3300006846 | Ga0075430_100005330 | Ga0075430_1000053308 | 147 |
| 393 | 3300006847 | Ga0075431_100004956 | Ga0075431_10000495612 | 147 |
| 394 | 3300006847 | Ga0075431_100033316 | Ga0075431_1000333165 | 147 |
| 395 | 3300006847 | Ga0075431_100074247 | Ga0075431_1000742474 | 147 |
| 396 | 3300006847 | Ga0075431_100445914 | Ga0075431_1004459142 | 147 |
| 397 | 3300006871 | Ga0075434_100144861 | Ga0075434_1001448612 | 147 |
| 398 | 3300006880 | Ga0075429_100001381 | Ga0075429_10000138112 | 147 |
| 399 | 3300006880 | Ga0075429_100042664 | Ga0075429_1000426642 | 147 |
| 400 | 3300006880 | Ga0075429_100109148 | Ga0075429_1001091485 | 147 |
| 401 | 3300006880 | Ga0075429_100213419 | Ga0075429_1002134192 | 147 |
| 402 | 3300006880 | Ga0075429_100389771 | Ga0075429_1003897712 | 147 |
| 403 | 3300006881 | Ga0068865_100057258 | Ga0068865_1000572583 | 147 |
| 404 | 3300006881 | Ga0068865_100911108 | Ga0068865_1009111081 | 147 |
| 405 | 3300006931 | Ga0097620_100007132 | Ga0097620_1000071328 | 147 |
| 406 | 3300009093 | Ga0105240_10135872 | Ga0105240_101358722 | 147 |
| 407 | 3300009094 | Ga0111539_10004344 | Ga0111539_1000434410 | 147 |
| 408 | 3300009094 | Ga0111539_10046924 | Ga0111539_100469245 | 147 |
| 409 | 3300009094 | Ga0111539_10053274 | Ga0111539_100532743 | 147 |
| 410 | 3300009094 | Ga0111539_10065773 | Ga0111539_100657735 | 147 |
| 411 | 3300009094 | Ga0111539_10066066 | Ga0111539_100660662 | 147 |
| 412 | 3300009101 | Ga0105247_10147661 | Ga0105247_101476612 | 147 |
| 413 | 3300009147 | Ga0114129_10003124 | Ga0114129_1000312419 | 147 |
| 414 | 3300009147 | Ga0114129_10066065 | Ga0114129_100660655 | 147 |
| 415 | 3300009147 | Ga0114129_12003377 | Ga0114129_120033772 | 147 |
| 416 | 3300009148 | Ga0105243_10037553 | Ga0105243_100375533 | 147 |
| 417 | 3300009148 | Ga0105243_11248651 | Ga0105243_112486512 | 147 |
| 418 | 3300009176 | Ga0105242_11605763 | Ga0105242_116057631 | 147 |
| 419 | 3300009177 | Ga0105248_10001950 | Ga0105248_1000195020 | 147 |
| 420 | 3300009545 | Ga0105237_10271447 | Ga0105237_102714473 | 147 |
| 421 | 3300009553 | Ga0105249_10007767 | Ga0105249_100077675 | 147 |
| 422 | 3300009553 | Ga0105249_10143321 | Ga0105249_101433213 | 147 |
| 423 | 3300009553 | Ga0105249_12442636 | Ga0105249_124426362 | 147 |
| 424 | 3300010375 | Ga0105239_10617436 | Ga0105239_106174363 | 147 |
| 425 | 3300013297 | Ga0157378_11092578 | Ga0157378_110925782 | 147 |
| 426 | 3300013306 | Ga0163162_10024984 | Ga0163162_100249843 | 147 |
| 427 | 3300013306 | Ga0163162_11294765 | Ga0163162_112947652 | 147 |
| 428 | 3300013308 | Ga0157375_10038243 | Ga0157375_100382435 | 147 |
| 429 | 3300013308 | Ga0157375_10344941 | Ga0157375_103449412 | 147 |
| 430 | 3300014325 | Ga0163163_10026463 | Ga0163163_100264634 | 147 |
| 431 | 3300014326 | Ga0157380_10006068 | Ga0157380_100060683 | 147 |
| 432 | 3300014326 | Ga0157380_10290419 | Ga0157380_102904192 | 147 |
| 433 | 3300014326 | Ga0157380_10892309 | Ga0157380_108923092 | 147 |
| 434 | 3300014326 | Ga0157380_10959941 | Ga0157380_109599412 | 147 |
| 435 | 3300014745 | Ga0157377_10001056 | Ga0157377_100010567 | 147 |
| 436 | 3300014968 | Ga0157379_10692785 | Ga0157379_106927852 | 147 |
| 437 | 3300014968 | Ga0157379_10709054 | Ga0157379_107090542 | 147 |
| 438 | 3300017792 | Ga0163161_10099335 | Ga0163161_100993352 | 147 |
| 439 | 3300017792 | Ga0163161_10500164 | Ga0163161_105001642 | 147 |
| 440 | 3300017792 | Ga0163161_11036524 | Ga0163161_110365242 | 147 |
| 441 | 3300025899 | Ga0207642_10012826 | Ga0207642_100128262 | 147 |
| 442 | 3300025900 | Ga0207710_10100405 | Ga0207710_101004052 | 147 |
| 443 | 3300025901 | Ga0207688_10071683 | Ga0207688_100716832 | 147 |
| 444 | 3300025907 | Ga0207645_10005569 | Ga0207645_100055697 | 147 |
| 445 | 3300025907 | Ga0207645_10083156 | Ga0207645_100831562 | 147 |
| 446 | 3300025908 | Ga0207643_10015341 | Ga0207643_100153414 | 147 |
| 447 | 3300025908 | Ga0207643_10028973 | Ga0207643_100289732 | 147 |
| 448 | 3300025909 | Ga0207705_10349922 | Ga0207705_103499222 | 147 |
| 449 | 3300025909 | Ga0207705_10980272 | Ga0207705_109802721 | 147 |
| 450 | 3300025913 | Ga0207695_10406886 | Ga0207695_104068862 | 147 |
| 451 | 3300025914 | Ga0207671_10195680 | Ga0207671_101956802 | 147 |
| 452 | 3300025917 | Ga0207660_10374835 | Ga0207660_103748352 | 147 |
| 453 | 3300025918 | Ga0207662_10037651 | Ga0207662_100376514 | 147 |
| 454 | 3300025920 | Ga0207649_10168541 | Ga0207649_101685413 | 147 |
| 455 | 3300025921 | Ga0207652_10383099 | Ga0207652_103830992 | 147 |
| 456 | 3300025921 | Ga0207652_10413418 | Ga0207652_104134182 | 147 |
| 457 | 3300025923 | Ga0207681_10021598 | Ga0207681_100215985 | 147 |
| 458 | 3300025923 | Ga0207681_10094648 | Ga0207681_100946482 | 147 |
| 459 | 3300025923 | Ga0207681_10265027 | Ga0207681_102650272 | 147 |
| 460 | 3300025923 | Ga0207681_10310313 | Ga0207681_103103132 | 147 |
| 461 | 3300025924 | Ga0207694_10016981 | Ga0207694_100169817 | 147 |
| 462 | 3300025925 | Ga0207650_10053397 | Ga0207650_100533974 | 147 |
| 463 | 3300025925 | Ga0207650_10496509 | Ga0207650_104965091 | 147 |
| 464 | 3300025926 | Ga0207659_10010463 | Ga0207659_100104635 | 147 |
| 465 | 3300025929 | Ga0207664_10010789 | Ga0207664_100107892 | 147 |
| 466 | 3300025931 | Ga0207644_10645115 | Ga0207644_106451152 | 147 |
| 467 | 3300025932 | Ga0207690_10173195 | Ga0207690_101731952 | 147 |
| 468 | 3300025933 | Ga0207706_10005852 | Ga0207706_100058526 | 147 |
| 469 | 3300025933 | Ga0207706_10022412 | Ga0207706_100224125 | 147 |
| 470 | 3300025933 | Ga0207706_10084440 | Ga0207706_100844403 | 147 |
| 471 | 3300025935 | Ga0207709_10506634 | Ga0207709_105066342 | 147 |
| 472 | 3300025936 | Ga0207670_10004031 | Ga0207670_100040314 | 147 |
| 473 | 3300025937 | Ga0207669_10021850 | Ga0207669_100218505 | 147 |
| 474 | 3300025938 | Ga0207704_10155243 | Ga0207704_101552432 | 147 |
| 475 | 3300025938 | Ga0207704_10792149 | Ga0207704_107921492 | 147 |
| 476 | 3300025938 | Ga0207704_10961832 | Ga0207704_109618321 | 147 |
| 477 | 3300025940 | Ga0207691_10023246 | Ga0207691_100232463 | 147 |
| 478 | 3300025940 | Ga0207691_10057873 | Ga0207691_100578734 | 147 |
| 479 | 3300025941 | Ga0207711_10006071 | Ga0207711_100060718 | 147 |
| 480 | 3300025942 | Ga0207689_10009129 | Ga0207689_100091296 | 147 |
| 481 | 3300025942 | Ga0207689_10686150 | Ga0207689_106861502 | 147 |
| 482 | 3300025942 | Ga0207689_11306422 | Ga0207689_113064221 | 147 |
| 483 | 3300025945 | Ga0207679_10006042 | Ga0207679_100060424 | 147 |
| 484 | 3300025945 | Ga0207679_10078858 | Ga0207679_100788582 | 147 |
| 485 | 3300025949 | Ga0207667_10042294 | Ga0207667_100422944 | 147 |
| 486 | 3300025960 | Ga0207651_10004828 | Ga0207651_100048282 | 147 |
| 487 | 3300025961 | Ga0207712_10014997 | Ga0207712_100149975 | 147 |
| 488 | 3300025972 | Ga0207668_10013314 | Ga0207668_100133143 | 147 |
| 489 | 3300025972 | Ga0207668_10548382 | Ga0207668_105483822 | 147 |
| 490 | 3300025981 | Ga0207640_10111925 | Ga0207640_101119254 | 147 |
| 491 | 3300026067 | Ga0207678_10141799 | Ga0207678_101417992 | 147 |
| 492 | 3300026075 | Ga0207708_10028460 | Ga0207708_100284605 | 147 |
| 493 | 3300026075 | Ga0207708_10038857 | Ga0207708_100388574 | 147 |
| 494 | 3300026078 | Ga0207702_10050849 | Ga0207702_100508494 | 147 |
| 495 | 3300026088 | Ga0207641_10004245 | Ga0207641_100042455 | 147 |
| 496 | 3300026089 | Ga0207648_10016032 | Ga0207648_100160324 | 147 |
| 497 | 3300026095 | Ga0207676_10101344 | Ga0207676_101013442 | 147 |
| 498 | 3300026095 | Ga0207676_10860230 | Ga0207676_108602302 | 147 |
| 499 | 3300026116 | Ga0207674_10023013 | Ga0207674_100230137 | 147 |
| 500 | 3300026116 | Ga0207674_10026270 | Ga0207674_100262702 | 147 |
| 501 | 3300026118 | Ga0207675_100001062 | Ga0207675_1000010625 | 147 |
| 502 | 3300026118 | Ga0207675_100001108 | Ga0207675_10000110816 | 147 |
| 503 | 3300026118 | Ga0207675_100007848 | Ga0207675_1000078485 | 147 |
| 504 | 3300026118 | Ga0207675_100017987 | Ga0207675_1000179873 | 147 |
| 505 | 3300026121 | Ga0207683_10030144 | Ga0207683_100301445 | 147 |
| 506 | 3300026121 | Ga0207683_10290573 | Ga0207683_102905732 | 147 |
| 507 | 3300027614 | Ga0209970_1013824 | Ga0209970_10138242 | 147 |
| 508 | 3300027665 | Ga0209983_1003117 | Ga0209983_10031174 | 147 |
| 509 | 3300027682 | Ga0209971_1033429 | Ga0209971_10334292 | 147 |
| 510 | 3300027717 | Ga0209998_10000777 | Ga0209998_100007776 | 147 |
| 511 | 3300027876 | Ga0209974_10010067 | Ga0209974_100100676 | 147 |
| 512 | 3300027907 | Ga0207428_10014691 | Ga0207428_100146917 | 147 |
| 513 | 3300027907 | Ga0207428_10019641 | Ga0207428_100196413 | 147 |
| 514 | 3300027907 | Ga0207428_10047592 | Ga0207428_100475923 | 147 |
| 515 | 3300027907 | Ga0207428_10198600 | Ga0207428_101986001 | 147 |
| 516 | 3300028379 | Ga0268266_10005477 | Ga0268266_1000547714 | 147 |
| 517 | 3300028379 | Ga0268266_10243375 | Ga0268266_102433752 | 147 |
| 518 | 3300028379 | Ga0268266_11117378 | Ga0268266_111173782 | 147 |
| 519 | 3300028380 | Ga0268265_10000559 | Ga0268265_1000055934 | 147 |
| 520 | 3300028380 | Ga0268265_10042522 | Ga0268265_100425225 | 147 |
| 521 | 3300028380 | Ga0268265_10149190 | Ga0268265_101491902 | 147 |
| 522 | 3300028381 | Ga0268264_10174279 | Ga0268264_101742793 | 147 |
| 523 | 3300031456 | Ga0307513_10408641 | Ga0307513_104086412 | 147 |
| 524 | 3300031548 | Ga0307408_100010613 | Ga0307408_1000106133 | 147 |
| 525 | 3300031548 | Ga0307408_100159822 | Ga0307408_1001598222 | 147 |
| 526 | 3300031548 | Ga0307408_100275942 | Ga0307408_1002759422 | 147 |
| 527 | 3300031731 | Ga0307405_10479437 | Ga0307405_104794371 | 147 |
| 528 | 3300031824 | Ga0307413_10146505 | Ga0307413_101465054 | 147 |
| 529 | 3300031824 | Ga0307413_10357891 | Ga0307413_103578912 | 147 |
| 530 | 3300031852 | Ga0307410_10063148 | Ga0307410_100631485 | 147 |
| 531 | 3300031852 | Ga0307410_10492103 | Ga0307410_104921032 | 147 |
| 532 | 3300031852 | Ga0307410_11091041 | Ga0307410_110910411 | 147 |
| 533 | 3300031852 | Ga0307410_11450691 | Ga0307410_114506912 | 147 |
| 534 | 3300031901 | Ga0307406_10192152 | Ga0307406_101921522 | 147 |
| 535 | 3300031901 | Ga0307406_10269336 | Ga0307406_102693362 | 147 |
| 536 | 3300031901 | Ga0307406_10428153 | Ga0307406_104281532 | 147 |
| 537 | 3300031901 | Ga0307406_10755414 | Ga0307406_107554142 | 147 |
| 538 | 3300031901 | Ga0307406_11393677 | Ga0307406_113936771 | 147 |
| 539 | 3300031903 | Ga0307407_10467083 | Ga0307407_104670832 | 147 |
| 540 | 3300031903 | Ga0307407_10858452 | Ga0307407_108584522 | 147 |
| 541 | 3300031911 | Ga0307412_10117700 | Ga0307412_101177001 | 147 |
| 542 | 3300032002 | Ga0307416_100176825 | Ga0307416_1001768252 | 147 |
| 543 | 3300032002 | Ga0307416_100262339 | Ga0307416_1002623392 | 147 |
| 544 | 3300032002 | Ga0307416_100923954 | Ga0307416_1009239542 | 147 |
| 545 | 3300032002 | Ga0307416_102261761 | Ga0307416_1022617611 | 147 |
| 546 | 3300032002 | Ga0307416_102264127 | Ga0307416_1022641271 | 147 |
| 547 | 3300032005 | Ga0307411_10050935 | Ga0307411_100509355 | 147 |
| 548 | 3300032005 | Ga0307411_10288486 | Ga0307411_102884862 | 147 |
| 549 | 3300032005 | Ga0307411_10740214 | Ga0307411_107402142 | 147 |
| 550 | 3300032005 | Ga0307411_12048295 | Ga0307411_120482951 | 147 |
| 551 | 3300032126 | Ga0307415_101435002 | Ga0307415_1014350021 | 147 |
| 552 | 3300035088 | Ga0373940_0125956 | Ga0373940_0125956_328_783 | 147 |
| 553 | 3300035113 | Ga0373936_0138593 | Ga0373936_0138593_568_1014 | 147 |
| 554 | 3300035121 | Ga0373960_0065591 | Ga0373960_0065591_99_545 | 147 |
| 555 | 3300035241 | Ga0373961_0204020 | Ga0373961_0204020_149_595 | 147 |
| 556 | 3300035242 | Ga0373962_0033158 | Ga0373962_0033158_209_664 | 147 |
| 557 | 3300035691 | Ga0373931_0253530 | Ga0373931_0253530_415_861 | 147 |
| 558 | 3300041486 | Ga0451807_0905457 | Ga0451807_0905457_155_601 | 147 |
| 559 | 3300041496 | Ga0451839_0832343 | Ga0451839_0832343_457_903 | 147 |
| 560 | 3300041505 | Ga0451849_0735254 | Ga0451849_0735254_847_1293 | 147 |
| 561 | 3300041509 | Ga0451843_0091166 | Ga0451843_0091166_149_595 | 147 |
| 562 | 3300041997 | Ga0439431_0066527 | Ga0439431_0066527_381_827 | 147 |
| 563 | 3300042002 | Ga0439442_086621 | Ga0439442_086621_129_575 | 147 |
| 564 | 3300042436 | Ga0439435_0023736 | Ga0439435_0023736_412_858 | 147 |
| 565 | 3300042876 | Ga0451577_0016709 | Ga0451577_0016709_3381_3824 | 147 |
| 566 | 3300042876 | Ga0451577_0093219 | Ga0451577_0093219_2023_2466 | 147 |
| 567 | 3300042876 | Ga0451577_0225991 | Ga0451577_0225991_1103_1546 | 147 |
| 568 | 3300042876 | Ga0451577_0300670 | Ga0451577_0300670_969_1412 | 147 |
| 569 | 3300042876 | Ga0451577_1386959 | Ga0451577_1386959_83_526 | 147 |
| 570 | 3300042993 | Ga0439440_0046911 | Ga0439440_0046911_471_917 | 147 |
| 571 | 3300044712 | Ga0453684_0026226 | Ga0453684_0026226_4422_4865 | 147 |
| 572 | 3300044712 | Ga0453684_0059554 | Ga0453684_0059554_2353_2796 | 147 |
| 573 | 3300044712 | Ga0453684_0152886 | Ga0453684_0152886_1115_1558 | 147 |
| 574 | 3300044712 | Ga0453684_1093282 | Ga0453684_1093282_319_762 | 147 |
| 575 | 3300044842 | Ga0466957_0231919 | Ga0466957_0231919_267_713 | 147 |
| 576 | 3300045051 | Ga0451576_0095049 | Ga0451576_0095049_1995_2438 | 147 |
| 577 | 3300045051 | Ga0451576_0340881 | Ga0451576_0340881_1054_1500 | 147 |
| 578 | 3300045051 | Ga0451576_0848943 | Ga0451576_0848943_471_917 | 147 |
| 579 | 3300045051 | Ga0451576_1329397 | Ga0451576_1329397_125_568 | 147 |
| 580 | 3300046471 | Ga0495650_0011192 | Ga0495650_0011192_1600_2046 | 147 |
| 581 | 3300046526 | Ga0495666_0408072 | Ga0495666_0408072_109_573 | 147 |
| 582 | 3300046533 | Ga0495640_0247995 | Ga0495640_0247995_619_1083 | 147 |
| 583 | 3300046535 | Ga0495586_0237775 | Ga0495586_0237775_114_605 | 147 |
| 584 | 3300046660 | Ga0495625_0003302 | Ga0495625_0003302_4927_5379 | 147 |
| 585 | 3300046680 | Ga0495646_0268391 | Ga0495646_0268391_373_864 | 147 |
| 586 | 3300046683 | Ga0495658_0827217 | Ga0495658_0827217_10_465 | 147 |
| 587 | 3300047317 | Ga0495604_0262157 | Ga0495604_0262157_494_985 | 147 |
| 588 | 3300047320 | Ga0495672_0096260 | Ga0495672_0096260_119_565 | 147 |
| 589 | 3300047320 | Ga0495672_0355582 | Ga0495672_0355582_14_460 | 147 |
| 590 | 3300047444 | Ga0495675_0591902 | Ga0495675_0591902_15_506 | 147 |
| 591 | 3300048912 | Ga0496109_0050637 | Ga0496109_0050637_2656_3102 | 147 |
| 592 | 3300048913 | Ga0496110_0097051 | Ga0496110_0097051_1497_1943 | 147 |
| 593 | 3300048913 | Ga0496110_0157362 | Ga0496110_0157362_1291_1737 | 147 |
| 594 | 3300048915 | Ga0496112_0151100 | Ga0496112_0151100_1025_1471 | 147 |
| 595 | 3300048916 | Ga0496113_0010563 | Ga0496113_0010563_2996_3442 | 147 |
| 596 | 3300048917 | Ga0496114_0308746 | Ga0496114_0308746_19_465 | 147 |
| 597 | 3300048927 | Ga0496124_0340649 | Ga0496124_0340649_343_789 | 147 |
| 598 | 3300048929 | Ga0496126_0416475 | Ga0496126_0416475_280_762 | 147 |
| 599 | 3300049522 | Ga0501299_012310 | Ga0501299_012310_599_1054 | 147 |
| 600 | 3300049570 | Ga0501033_0686164 | Ga0501033_0686164_114_560 | 147 |
| 601 | 3300049575 | Ga0501039_1253613 | Ga0501039_1253613_77_523 | 147 |
| 602 | 3300049577 | Ga0501041_0859781 | Ga0501041_0859781_14_460 | 147 |
| 603 | 3300049580 | Ga0501046_0046018 | Ga0501046_0046018_1448_1894 | 147 |
| 604 | 3300050491 | nmdc:mga00v17_52782_c1 | nmdc:mga00v17_52782_c1_1578_2042 | 147 |
| 605 | 3300050494 | nmdc:mga06z11_977402_c1 | nmdc:mga06z11_977402_c1_16_480 | 147 |
| 606 | 3300050507 | nmdc:mga05p37_12690_c1 | nmdc:mga05p37_12690_c1_5992_6438 | 147 |
| 607 | 3300050507 | nmdc:mga05p37_2097308_c1 | nmdc:mga05p37_2097308_c1_12_458 | 147 |
| 608 | 3300050507 | nmdc:mga05p37_942147_c1 | nmdc:mga05p37_942147_c1_251_694 | 147 |
| 609 | 3300050508 | nmdc:mga09592_180578_c1 | nmdc:mga09592_180578_c1_1028_1474 | 147 |
| 610 | 3300050508 | nmdc:mga09592_3569_c1 | nmdc:mga09592_3569_c1_7412_7858 | 147 |
| 611 | 3300050508 | nmdc:mga09592_558458_c1 | nmdc:mga09592_558458_c1_325_771 | 147 |
| 612 | 3300050509 | nmdc:mga0qj67_58667_c1 | nmdc:mga0qj67_58667_c1_247_693 | 147 |
| 613 | 3300050509 | nmdc:mga0qj67_761181_c1 | nmdc:mga0qj67_761181_c1_298_744 | 147 |
| 614 | 3300050509 | nmdc:mga0qj67_9189_c1 | nmdc:mga0qj67_9189_c1_3253_3699 | 147 |
| 615 | 3300050510 | nmdc:mga06r32_109833_c1 | nmdc:mga06r32_109833_c1_525_971 | 147 |
| 616 | 3300050510 | nmdc:mga06r32_20977_c1 | nmdc:mga06r32_20977_c1_3743_4210 | 147 |
| 617 | 3300050510 | nmdc:mga06r32_29_c1 | nmdc:mga06r32_29_c1_9869_10315 | 147 |
| 618 | 3300050510 | nmdc:mga06r32_69838_c1 | nmdc:mga06r32_69838_c1_2171_2617 | 147 |
| 619 | 3300050510 | nmdc:mga06r32_745_c1 | nmdc:mga06r32_745_c1_9558_10004 | 147 |
| 620 | 3300050511 | nmdc:mga08y16_1085_c1 | nmdc:mga08y16_1085_c1_11195_11641 | 147 |
| 621 | 3300050511 | nmdc:mga08y16_12457_c1 | nmdc:mga08y16_12457_c1_265_711 | 147 |
| 622 | 3300050511 | nmdc:mga08y16_40025_c1 | nmdc:mga08y16_40025_c1_1020_1466 | 147 |
| 623 | 3300050511 | nmdc:mga08y16_94823_c1 | nmdc:mga08y16_94823_c1_544_990 | 147 |
| 624 | 3300050512 | nmdc:mga0n895_271212_c1 | nmdc:mga0n895_271212_c1_842_1288 | 147 |
| 625 | 3300053092 | Ga0500583_0071895 | Ga0500583_0071895_653_1099 | 147 |
| 626 | 3300053092 | Ga0500583_0173687 | Ga0500583_0173687_105_551 | 147 |
| 627 | 3300053093 | Ga0500651_0334610 | Ga0500651_0334610_61_507 | 147 |
| 628 | 3300053104 | Ga0500556_0435124 | Ga0500556_0435124_27_473 | 147 |
| 629 | 3300053118 | Ga0500594_0237034 | Ga0500594_0237034_29_475 | 147 |
| 630 | 3300053119 | Ga0500595_005260 | Ga0500595_005260_3333_3815 | 147 |
| 631 | 3300053134 | Ga0500658_0195587 | Ga0500658_0195587_235_681 | 147 |
| 632 | 3300053146 | Ga0500588_0001145 | Ga0500588_0001145_2283_2729 | 147 |
| 633 | 3300053151 | Ga0500604_0054172 | Ga0500604_0054172_643_1089 | 147 |
| 634 | 3300053156 | Ga0500622_0003682 | Ga0500622_0003682_6776_7222 | 147 |
| 635 | 3300053156 | Ga0500622_0010223 | Ga0500622_0010223_2658_3104 | 147 |
| 636 | 3300053178 | Ga0500637_0227349 | Ga0500637_0227349_68_514 | 147 |
| 637 | 3300059424 | Ga0590075_147239 | Ga0590075_147239_34_480 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jzw-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9579 | 2 | 138 |
| 6jzw-assembly2.cif.gz_B | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9416 | 2 | 138 |
| 6a6f-assembly1.cif.gz_B | crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 | 0.94 | 5 | 138 |
| 2qq4-assembly2.cif.gz_D | crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 | 0.9353 | 1 | 138 |
| 6jzv-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis | 0.9315 | 2 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9462 | 1 | 138 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.933 | 1 | 138 | 3.90.1010.10 |
| af_O53156_2_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9326 | 3 | 140 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9024 | 2 | 137 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8898 | 2 | 137 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3D5D7-F1-model_v4 | deleted | 0.9855 | 5 | 95 |
|
| AF-A0A7W1K4Z9-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9793 | 1 | 88 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A6N6Z0K4-F1-model_v4 | Nitrogen fixation protein NifU | 0.9754 | 2 | 146 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A550H1A1-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.9712 | 10 | 86 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A1Q7PZQ5-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9703 | 7 | 140 |
GO:0005506
GO:0016226 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar