F471400
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 637 | 374 | 621 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10085284|rootH1_100852842 |
| Length | 273 |
| Sequence | MTAFAKTPGWLDWCGQPSKPRFELPPHAVDAHCHVFGPGHQFPYAPERKYTPCDASKAQLFALRDHLGFARNVIVQATCHGADNRAMVDACRESGGRARGVATVKRAVTDAEAARVFAFGWHVVLYFEAQDLPELWDTMAALPNIVVIDHLGRPDVSQPVDGPAFSLFLRLLREHPNVWTKVSCPERLSVSGPPAIDGERAPYQDVVPFARLVVESFPDRVLWGTDWPHPNLKGHMPDDGLLVDFIPHLAPTPELQQKLLVANPRRLYWPEET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 4 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 5 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 6 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 7 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 8 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 9 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 10 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 11 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 12 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 13 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 14 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 15 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 98 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 210 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 254 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 255 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 256 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 257 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 264 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 265 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 266 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 267 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 268 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 269 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 270 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 271 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 274 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 347 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 355 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 356 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 370 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 373 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.49 |
| Metatranscriptomes | 0 |
| Isolates | 2.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.67 |
| Nodule | 0.78 |
| Rhizoplane | 2.04 |
| Rhizosphere | 86.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1005088 | 3300002076 | Bacteria | 1844 |
| 2 | JGI25406J46586_10000721 | 3300003203 | Bacteria | 15439 |
| 3 | JGI25406J46586_10004727 | 3300003203 | Bacteria | 6337 |
| 4 | JGI25406J46586_10019628 | 3300003203 | Bacteria | 2749 |
| 5 | JGI25406J46586_10020738 | 3300003203 | Bacteria | 2651 |
| 6 | rootH2_10247225 | 3300003320 | Bacteria | 2227 |
| 7 | rootL2_10017603 | 3300003322 | Bacteria | 18297 |
| 8 | rootH1_10085284 | 3300003323 | Bacteria | 2993 |
| 9 | Ga0055531_10008251 | 3300003794 | Bacteria | 5538 |
| 10 | Ga0065712_10078880 | 3300005290 | Bacteria | 3287 |
| 11 | Ga0065707_10092192 | 3300005295 | Bacteria | 3810 |
| 12 | Ga0070676_10003564 | 3300005328 | Bacteria | 8141 |
| 13 | Ga0070676_10008828 | 3300005328 | Bacteria | 5442 |
| 14 | Ga0070676_10050389 | 3300005328 | Bacteria | 2441 |
| 15 | Ga0070690_100001736 | 3300005330 | Bacteria | 11511 |
| 16 | Ga0070690_100023070 | 3300005330 | Bacteria | 3813 |
| 17 | Ga0070670_100072240 | 3300005331 | Bacteria | 2963 |
| 18 | Ga0070670_100106230 | 3300005331 | Bacteria | 2419 |
| 19 | Ga0070677_10001442 | 3300005333 | Bacteria | 7540 |
| 20 | Ga0070677_10015588 | 3300005333 | Bacteria | 2693 |
| 21 | Ga0068869_100001494 | 3300005334 | Bacteria | 13854 |
| 22 | Ga0068869_100023320 | 3300005334 | Bacteria | 4272 |
| 23 | Ga0068869_100111702 | 3300005334 | Bacteria | 2080 |
| 24 | Ga0068869_100153986 | 3300005334 | Bacteria | 1785 |
| 25 | Ga0070666_10198159 | 3300005335 | Bacteria | 1412 |
| 26 | Ga0070680_100079923 | 3300005336 | Bacteria | 2696 |
| 27 | Ga0070682_100000252 | 3300005337 | Bacteria | 38842 |
| 28 | Ga0068868_100082908 | 3300005338 | Bacteria | 2573 |
| 29 | Ga0070689_100055212 | 3300005340 | Bacteria | 3077 |
| 30 | Ga0070668_100037286 | 3300005347 | Bacteria | 3712 |
| 31 | Ga0070668_100114143 | 3300005347 | Bacteria | 2152 |
| 32 | Ga0070669_100014516 | 3300005353 | Bacteria | 5603 |
| 33 | Ga0070669_100029077 | 3300005353 | Bacteria | 3982 |
| 34 | Ga0070669_100069805 | 3300005353 | Bacteria | 2595 |
| 35 | Ga0070669_100311232 | 3300005353 | Bacteria | 1269 |
| 36 | Ga0070675_100006367 | 3300005354 | Bacteria | 9066 |
| 37 | Ga0070675_100022719 | 3300005354 | Bacteria | 5011 |
| 38 | Ga0070675_100028795 | 3300005354 | Bacteria | 4474 |
| 39 | Ga0070675_100032453 | 3300005354 | Bacteria | 4227 |
| 40 | Ga0070675_100102569 | 3300005354 | Bacteria | 2411 |
| 41 | Ga0070675_100232826 | 3300005354 | Bacteria | 1607 |
| 42 | Ga0070671_100003098 | 3300005355 | Bacteria | 12944 |
| 43 | Ga0070671_100058005 | 3300005355 | Bacteria | 3223 |
| 44 | Ga0070671_100285572 | 3300005355 | Bacteria | 1404 |
| 45 | Ga0070674_100002446 | 3300005356 | Bacteria | 10278 |
| 46 | Ga0070674_100419066 | 3300005356 | Bacteria | 1098 |
| 47 | Ga0070673_100013595 | 3300005364 | Bacteria | 5639 |
| 48 | Ga0070673_100047176 | 3300005364 | Bacteria | 3350 |
| 49 | Ga0070673_100064065 | 3300005364 | Bacteria | 2927 |
| 50 | Ga0070673_100216214 | 3300005364 | Bacteria | 1657 |
| 51 | Ga0070688_100401963 | 3300005365 | Bacteria | 1014 |
| 52 | Ga0070659_100115927 | 3300005366 | Bacteria | 2165 |
| 53 | Ga0070667_100022678 | 3300005367 | Bacteria | 5205 |
| 54 | Ga0070667_100384703 | 3300005367 | Bacteria | 1275 |
| 55 | Ga0070709_10002985 | 3300005434 | Bacteria | 9106 |
| 56 | Ga0070714_100013754 | 3300005435 | Bacteria | 6490 |
| 57 | Ga0070714_100143267 | 3300005435 | Bacteria | 2147 |
| 58 | Ga0070710_10005127 | 3300005437 | Bacteria | 6199 |
| 59 | Ga0070701_10163816 | 3300005438 | Bacteria | 1290 |
| 60 | Ga0070711_100008828 | 3300005439 | Bacteria | 6185 |
| 61 | Ga0070700_100001670 | 3300005441 | Bacteria | 11111 |
| 62 | Ga0070700_100316577 | 3300005441 | Bacteria | 1145 |
| 63 | Ga0070663_100292284 | 3300005455 | Bacteria | 1302 |
| 64 | Ga0070678_100005422 | 3300005456 | Bacteria | 7367 |
| 65 | Ga0070678_100093766 | 3300005456 | Bacteria | 2309 |
| 66 | Ga0070678_100229592 | 3300005456 | Bacteria | 1546 |
| 67 | Ga0070662_100008793 | 3300005457 | Bacteria | 6587 |
| 68 | Ga0068867_100006363 | 3300005459 | Bacteria | 8348 |
| 69 | Ga0068867_100011208 | 3300005459 | Bacteria | 6324 |
| 70 | Ga0068867_100060453 | 3300005459 | Bacteria | 2811 |
| 71 | Ga0068867_100072962 | 3300005459 | Bacteria | 2570 |
| 72 | Ga0068867_100142478 | 3300005459 | Bacteria | 1875 |
| 73 | Ga0070685_10074933 | 3300005466 | Bacteria | 2015 |
| 74 | Ga0070706_100139518 | 3300005467 | Bacteria | 2263 |
| 75 | Ga0070706_100315058 | 3300005467 | Bacteria | 1459 |
| 76 | Ga0070707_100108691 | 3300005468 | Bacteria | 2690 |
| 77 | Ga0070698_100248102 | 3300005471 | Bacteria | 1713 |
| 78 | Ga0070699_100011663 | 3300005518 | Bacteria | 7587 |
| 79 | Ga0068853_100387645 | 3300005539 | Bacteria | 1306 |
| 80 | Ga0070672_100026250 | 3300005543 | Bacteria | 4331 |
| 81 | Ga0070672_100041640 | 3300005543 | Bacteria | 3532 |
| 82 | Ga0070672_100055765 | 3300005543 | Bacteria | 3096 |
| 83 | Ga0070672_100094115 | 3300005543 | Bacteria | 2422 |
| 84 | Ga0070672_100133926 | 3300005543 | Bacteria | 2039 |
| 85 | Ga0070686_100020402 | 3300005544 | Bacteria | 3920 |
| 86 | Ga0070665_100050187 | 3300005548 | Bacteria | 4187 |
| 87 | Ga0070665_100074498 | 3300005548 | Bacteria | 3401 |
| 88 | Ga0070704_100036796 | 3300005549 | Bacteria | 3338 |
| 89 | Ga0070704_100041535 | 3300005549 | Bacteria | 3175 |
| 90 | Ga0068855_100101520 | 3300005563 | Bacteria | 3312 |
| 91 | Ga0070664_100028196 | 3300005564 | Bacteria | 4670 |
| 92 | Ga0070664_100088159 | 3300005564 | Bacteria | 2683 |
| 93 | Ga0068857_100143182 | 3300005577 | Bacteria | 2162 |
| 94 | Ga0068856_100156024 | 3300005614 | Bacteria | 2293 |
| 95 | Ga0068852_100007943 | 3300005616 | Bacteria | 7776 |
| 96 | Ga0068859_100032369 | 3300005617 | Bacteria | 5253 |
| 97 | Ga0068864_100044342 | 3300005618 | Bacteria | 3811 |
| 98 | Ga0068864_100376880 | 3300005618 | Bacteria | 1344 |
| 99 | Ga0068861_100024692 | 3300005719 | Bacteria | 4349 |
| 100 | Ga0068861_100215269 | 3300005719 | Bacteria | 1621 |
| 101 | Ga0068851_10081246 | 3300005834 | Bacteria | 1693 |
| 102 | Ga0068870_10007969 | 3300005840 | Bacteria | 4743 |
| 103 | Ga0068870_10164894 | 3300005840 | Bacteria | 1317 |
| 104 | Ga0068863_100011364 | 3300005841 | Bacteria | 8621 |
| 105 | Ga0068863_100491331 | 3300005841 | Bacteria | 1208 |
| 106 | Ga0068858_100201132 | 3300005842 | Bacteria | 1884 |
| 107 | Ga0068858_100260154 | 3300005842 | Bacteria | 1649 |
| 108 | Ga0068860_100046850 | 3300005843 | Bacteria | 4121 |
| 109 | Ga0068862_100004814 | 3300005844 | Bacteria | 11365 |
| 110 | Ga0068862_100022389 | 3300005844 | Bacteria | 5286 |
| 111 | Ga0068862_100261277 | 3300005844 | Bacteria | 1580 |
| 112 | Ga0081455_10008730 | 3300005937 | Bacteria | 10495 |
| 113 | Ga0081455_10012116 | 3300005937 | Bacteria | 8619 |
| 114 | Ga0081455_10027965 | 3300005937 | Bacteria | 5158 |
| 115 | Ga0081455_10182845 | 3300005937 | Bacteria | 1585 |
| 116 | Ga0081540_1003649 | 3300005983 | Bacteria | 12076 |
| 117 | Ga0081540_1008233 | 3300005983 | Bacteria | 7307 |
| 118 | Ga0081540_1030795 | 3300005983 | Bacteria | 2965 |
| 119 | Ga0081540_1057475 | 3300005983 | Bacteria | 1881 |
| 120 | Ga0081539_10000133 | 3300005985 | Bacteria | 173855 |
| 121 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 122 | Ga0081539_10000329 | 3300005985 | Bacteria | 105307 |
| 123 | Ga0081539_10000748 | 3300005985 | Bacteria | 64594 |
| 124 | Ga0081539_10076850 | 3300005985 | Bacteria | 1768 |
| 125 | Ga0070717_10016495 | 3300006028 | Bacteria | 5727 |
| 126 | Ga0070715_10001596 | 3300006163 | Bacteria | 6680 |
| 127 | Ga0070716_100003246 | 3300006173 | Bacteria | 7637 |
| 128 | Ga0070712_100012263 | 3300006175 | Bacteria | 5448 |
| 129 | Ga0075362_10009885 | 3300006177 | Bacteria | 3705 |
| 130 | Ga0075366_10002436 | 3300006195 | Bacteria | 9534 |
| 131 | Ga0075366_10045747 | 3300006195 | Bacteria | 2593 |
| 132 | Ga0075370_10033291 | 3300006353 | Bacteria | 2885 |
| 133 | Ga0068871_100029013 | 3300006358 | Bacteria | 4343 |
| 134 | Ga0068871_100255259 | 3300006358 | Bacteria | 1528 |
| 135 | Ga0068871_100263221 | 3300006358 | Bacteria | 1505 |
| 136 | Ga0075428_100010461 | 3300006844 | Bacteria | 10306 |
| 137 | Ga0075428_100035390 | 3300006844 | Bacteria | 5505 |
| 138 | Ga0075428_100042766 | 3300006844 | Bacteria | 4981 |
| 139 | Ga0075428_100188845 | 3300006844 | Bacteria | 2229 |
| 140 | Ga0075430_100001888 | 3300006846 | Bacteria | 17166 |
| 141 | Ga0075430_100011647 | 3300006846 | Bacteria | 7482 |
| 142 | Ga0075430_100057775 | 3300006846 | Bacteria | 3262 |
| 143 | Ga0075431_100005130 | 3300006847 | Bacteria | 12882 |
| 144 | Ga0075431_100006116 | 3300006847 | Bacteria | 11940 |
| 145 | Ga0075431_100009127 | 3300006847 | Bacteria | 9944 |
| 146 | Ga0075433_10000801 | 3300006852 | Bacteria | 21822 |
| 147 | Ga0075433_10011067 | 3300006852 | Bacteria | 7255 |
| 148 | Ga0075433_10032292 | 3300006852 | Bacteria | 4484 |
| 149 | Ga0075433_10045435 | 3300006852 | Bacteria | 3818 |
| 150 | Ga0075434_100046860 | 3300006871 | Bacteria | 4289 |
| 151 | Ga0075434_100050560 | 3300006871 | Bacteria | 4130 |
| 152 | Ga0075434_100087405 | 3300006871 | Bacteria | 3118 |
| 153 | Ga0075434_100424156 | 3300006871 | Bacteria | 1351 |
| 154 | Ga0075429_100022932 | 3300006880 | Bacteria | 5412 |
| 155 | Ga0075429_100027210 | 3300006880 | Bacteria | 4963 |
| 156 | Ga0075429_100086913 | 3300006880 | Bacteria | 2725 |
| 157 | Ga0068865_100015587 | 3300006881 | Bacteria | 4849 |
| 158 | Ga0068865_100030497 | 3300006881 | Bacteria | 3587 |
| 159 | Ga0075436_100206257 | 3300006914 | Bacteria | 1393 |
| 160 | Ga0097620_100032371 | 3300006931 | Bacteria | 5253 |
| 161 | Ga0097620_100166569 | 3300006931 | Bacteria | 2284 |
| 162 | Ga0099823_1000138 | 3300006944 | Bacteria | 37983 |
| 163 | Ga0079104_1000724 | 3300006946 | Bacteria | 29488 |
| 164 | Ga0075435_100018531 | 3300007076 | Bacteria | 5298 |
| 165 | Ga0075435_100022855 | 3300007076 | Bacteria | 4828 |
| 166 | Ga0075435_100037441 | 3300007076 | Bacteria | 3863 |
| 167 | Ga0099794_10017152 | 3300007265 | Bacteria | 3223 |
| 168 | Ga0099795_10077249 | 3300007788 | Bacteria | 1268 |
| 169 | Ga0105250_10000186 | 3300009092 | Bacteria | 53643 |
| 170 | Ga0105240_10147690 | 3300009093 | Bacteria | 2803 |
| 171 | Ga0105240_10373678 | 3300009093 | Bacteria | 1611 |
| 172 | Ga0111539_10002454 | 3300009094 | Bacteria | 24635 |
| 173 | Ga0111539_10007541 | 3300009094 | Bacteria | 13914 |
| 174 | Ga0111539_10025554 | 3300009094 | Bacteria | 7240 |
| 175 | Ga0111539_10049394 | 3300009094 | Bacteria | 5017 |
| 176 | Ga0111539_10072504 | 3300009094 | Bacteria | 4061 |
| 177 | Ga0111539_10099831 | 3300009094 | Bacteria | 3408 |
| 178 | Ga0111539_10100666 | 3300009094 | Bacteria | 3393 |
| 179 | Ga0111539_10357549 | 3300009094 | Bacteria | 1699 |
| 180 | Ga0105245_10118739 | 3300009098 | Bacteria | 2468 |
| 181 | Ga0105247_10022846 | 3300009101 | Bacteria | 3768 |
| 182 | Ga0114129_10008622 | 3300009147 | Bacteria | 14537 |
| 183 | Ga0114129_10031159 | 3300009147 | Bacteria | 7542 |
| 184 | Ga0114129_10129102 | 3300009147 | Bacteria | 3474 |
| 185 | Ga0105243_10004635 | 3300009148 | Bacteria | 10832 |
| 186 | Ga0105243_10043540 | 3300009148 | Bacteria | 3518 |
| 187 | Ga0105241_10380060 | 3300009174 | Bacteria | 1234 |
| 188 | Ga0105242_10004078 | 3300009176 | Bacteria | 11354 |
| 189 | Ga0105248_10037611 | 3300009177 | Bacteria | 5415 |
| 190 | Ga0105237_10011248 | 3300009545 | Bacteria | 9471 |
| 191 | Ga0105238_10022610 | 3300009551 | Bacteria | 6408 |
| 192 | Ga0105238_10082606 | 3300009551 | Bacteria | 3202 |
| 193 | Ga0105239_10010532 | 3300010375 | Bacteria | 10337 |
| 194 | Ga0105246_10011917 | 3300011119 | Bacteria | 5410 |
| 195 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 196 | Ga0157374_10140135 | 3300013296 | Bacteria | 2347 |
| 197 | Ga0163162_10051286 | 3300013306 | Bacteria | 4140 |
| 198 | Ga0157372_10228433 | 3300013307 | Bacteria | 2157 |
| 199 | Ga0157375_10134975 | 3300013308 | Bacteria | 2590 |
| 200 | Ga0163163_10139391 | 3300014325 | Bacteria | 2467 |
| 201 | Ga0157380_10059007 | 3300014326 | Bacteria | 3061 |
| 202 | Ga0157377_10012486 | 3300014745 | Bacteria | 4273 |
| 203 | Ga0157379_10000207 | 3300014968 | Bacteria | 45489 |
| 204 | Ga0157379_10035730 | 3300014968 | Bacteria | 4430 |
| 205 | Ga0157376_10039405 | 3300014969 | Bacteria | 3853 |
| 206 | Ga0182006_1013759 | 3300015261 | Bacteria | 3500 |
| 207 | Ga0182007_10000236 | 3300015262 | Bacteria | 37233 |
| 208 | Ga0182005_1000110 | 3300015265 | Bacteria | 58820 |
| 209 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 210 | Ga0163161_10023578 | 3300017792 | Bacteria | 4342 |
| 211 | Ga0163161_10052190 | 3300017792 | Bacteria | 2964 |
| 212 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 213 | Ga0213872_10000134 | 3300021361 | Bacteria | 67449 |
| 214 | Ga0213876_10067866 | 3300021384 | Bacteria | 1884 |
| 215 | Ga0209258_103215 | 3300025242 | Bacteria | 3649 |
| 216 | Ga0209677_100280 | 3300025253 | Bacteria | 34034 |
| 217 | Ga0209455_1001166 | 3300025272 | Bacteria | 12650 |
| 218 | Ga0209455_1009352 | 3300025272 | Bacteria | 2583 |
| 219 | Ga0209050_1005408 | 3300025298 | Bacteria | 8053 |
| 220 | Ga0209256_1000840 | 3300025299 | Bacteria | 38531 |
| 221 | Ga0209051_1004454 | 3300025303 | Bacteria | 8621 |
| 222 | Ga0209257_1004031 | 3300025304 | Bacteria | 11813 |
| 223 | Ga0207697_10002977 | 3300025315 | Bacteria | 8550 |
| 224 | Ga0207656_10040913 | 3300025321 | Bacteria | 1967 |
| 225 | Ga0207696_1000072 | 3300025711 | Bacteria | 224214 |
| 226 | Ga0207682_10007560 | 3300025893 | Bacteria | 4326 |
| 227 | Ga0207682_10015707 | 3300025893 | Bacteria | 2949 |
| 228 | Ga0207692_10000318 | 3300025898 | Bacteria | 16715 |
| 229 | Ga0207642_10002274 | 3300025899 | Bacteria | 5979 |
| 230 | Ga0207710_10011222 | 3300025900 | Bacteria | 3773 |
| 231 | Ga0207688_10006362 | 3300025901 | Bacteria | 6431 |
| 232 | Ga0207688_10009797 | 3300025901 | Bacteria | 5215 |
| 233 | Ga0207688_10063844 | 3300025901 | Bacteria | 2077 |
| 234 | Ga0207688_10096916 | 3300025901 | Bacteria | 1699 |
| 235 | Ga0207647_10174612 | 3300025904 | Bacteria | 1250 |
| 236 | Ga0207685_10003083 | 3300025905 | Bacteria | 3977 |
| 237 | Ga0207645_10008417 | 3300025907 | Bacteria | 7196 |
| 238 | Ga0207645_10012643 | 3300025907 | Bacteria | 5721 |
| 239 | Ga0207645_10049304 | 3300025907 | Bacteria | 2689 |
| 240 | Ga0207645_10088256 | 3300025907 | Bacteria | 1993 |
| 241 | Ga0207643_10003472 | 3300025908 | Bacteria | 8482 |
| 242 | Ga0207643_10007174 | 3300025908 | Bacteria | 5981 |
| 243 | Ga0207643_10029841 | 3300025908 | Bacteria | 3033 |
| 244 | Ga0207643_10069949 | 3300025908 | Bacteria | 2018 |
| 245 | Ga0207671_10002832 | 3300025914 | Bacteria | 18036 |
| 246 | Ga0207671_10242215 | 3300025914 | Bacteria | 1417 |
| 247 | Ga0207693_10003071 | 3300025915 | Bacteria | 14397 |
| 248 | Ga0207693_10003980 | 3300025915 | Bacteria | 12554 |
| 249 | Ga0207663_10001512 | 3300025916 | Bacteria | 10861 |
| 250 | Ga0207660_10263302 | 3300025917 | Bacteria | 1364 |
| 251 | Ga0207662_10152589 | 3300025918 | Bacteria | 1470 |
| 252 | Ga0207662_10195283 | 3300025918 | Bacteria | 1307 |
| 253 | Ga0207646_10113021 | 3300025922 | Bacteria | 2438 |
| 254 | Ga0207681_10007252 | 3300025923 | Bacteria | 6796 |
| 255 | Ga0207681_10162526 | 3300025923 | Bacteria | 1685 |
| 256 | Ga0207694_10012688 | 3300025924 | Bacteria | 6348 |
| 257 | Ga0207694_10022799 | 3300025924 | Bacteria | 4749 |
| 258 | Ga0207694_10188764 | 3300025924 | Bacteria | 1673 |
| 259 | Ga0207659_10017867 | 3300025926 | Bacteria | 4641 |
| 260 | Ga0207659_10018075 | 3300025926 | Bacteria | 4616 |
| 261 | Ga0207659_10023808 | 3300025926 | Bacteria | 4093 |
| 262 | Ga0207659_10028501 | 3300025926 | Bacteria | 3796 |
| 263 | Ga0207659_10051984 | 3300025926 | Bacteria | 2917 |
| 264 | Ga0207687_10149517 | 3300025927 | Bacteria | 1780 |
| 265 | Ga0207664_10191918 | 3300025929 | Bacteria | 1759 |
| 266 | Ga0207644_10015400 | 3300025931 | Bacteria | 5131 |
| 267 | Ga0207644_10053989 | 3300025931 | Bacteria | 2893 |
| 268 | Ga0207644_10166434 | 3300025931 | Bacteria | 1718 |
| 269 | Ga0207644_10310841 | 3300025931 | Bacteria | 1272 |
| 270 | Ga0207706_10000606 | 3300025933 | Bacteria | 38141 |
| 271 | Ga0207706_10017818 | 3300025933 | Bacteria | 6398 |
| 272 | Ga0207686_10004843 | 3300025934 | Bacteria | 7234 |
| 273 | Ga0207709_10000172 | 3300025935 | Bacteria | 86654 |
| 274 | Ga0207709_10074108 | 3300025935 | Bacteria | 2171 |
| 275 | Ga0207670_10074293 | 3300025936 | Bacteria | 2359 |
| 276 | Ga0207669_10001682 | 3300025937 | Bacteria | 9406 |
| 277 | Ga0207669_10010408 | 3300025937 | Bacteria | 4477 |
| 278 | Ga0207704_10011309 | 3300025938 | Bacteria | 4388 |
| 279 | Ga0207665_10008158 | 3300025939 | Bacteria | 6912 |
| 280 | Ga0207691_10002506 | 3300025940 | Bacteria | 17971 |
| 281 | Ga0207691_10028712 | 3300025940 | Bacteria | 5206 |
| 282 | Ga0207691_10038014 | 3300025940 | Bacteria | 4454 |
| 283 | Ga0207691_10063199 | 3300025940 | Bacteria | 3358 |
| 284 | Ga0207711_10236470 | 3300025941 | Bacteria | 1674 |
| 285 | Ga0207711_10278895 | 3300025941 | Bacteria | 1539 |
| 286 | Ga0207689_10006281 | 3300025942 | Bacteria | 10527 |
| 287 | Ga0207689_10032696 | 3300025942 | Bacteria | 4325 |
| 288 | Ga0207689_10061790 | 3300025942 | Bacteria | 3081 |
| 289 | Ga0207689_10167957 | 3300025942 | Bacteria | 1807 |
| 290 | Ga0207661_10183457 | 3300025944 | Bacteria | 1830 |
| 291 | Ga0207679_10022786 | 3300025945 | Bacteria | 4270 |
| 292 | Ga0207679_10057924 | 3300025945 | Bacteria | 2868 |
| 293 | Ga0207667_10058805 | 3300025949 | Bacteria | 4030 |
| 294 | Ga0207667_10068267 | 3300025949 | Bacteria | 3702 |
| 295 | Ga0207651_10015114 | 3300025960 | Bacteria | 4476 |
| 296 | Ga0207651_10018013 | 3300025960 | Bacteria | 4190 |
| 297 | Ga0207712_10088688 | 3300025961 | Bacteria | 2272 |
| 298 | Ga0207712_10156377 | 3300025961 | Bacteria | 1766 |
| 299 | Ga0207668_10052464 | 3300025972 | Bacteria | 2821 |
| 300 | Ga0207668_10078772 | 3300025972 | Bacteria | 2381 |
| 301 | Ga0207677_10077706 | 3300026023 | Bacteria | 2368 |
| 302 | Ga0207677_10103657 | 3300026023 | Bacteria | 2101 |
| 303 | Ga0207703_10039908 | 3300026035 | Bacteria | 3754 |
| 304 | Ga0207708_10012429 | 3300026075 | Bacteria | 6347 |
| 305 | Ga0207708_10018035 | 3300026075 | Bacteria | 5311 |
| 306 | Ga0207708_10094077 | 3300026075 | Bacteria | 2313 |
| 307 | Ga0207708_10311893 | 3300026075 | Bacteria | 1282 |
| 308 | Ga0207702_10021218 | 3300026078 | Bacteria | 5376 |
| 309 | Ga0207648_10000429 | 3300026089 | Bacteria | 46380 |
| 310 | Ga0207648_10002321 | 3300026089 | Bacteria | 20531 |
| 311 | Ga0207648_10023693 | 3300026089 | Bacteria | 5494 |
| 312 | Ga0207648_10123942 | 3300026089 | Bacteria | 2273 |
| 313 | Ga0207676_10075540 | 3300026095 | Bacteria | 2719 |
| 314 | Ga0207676_10133597 | 3300026095 | Bacteria | 2114 |
| 315 | Ga0207674_10067184 | 3300026116 | Bacteria | 3610 |
| 316 | Ga0207675_100015598 | 3300026118 | Bacteria | 7087 |
| 317 | Ga0207675_100022127 | 3300026118 | Bacteria | 5918 |
| 318 | Ga0207675_100142047 | 3300026118 | Bacteria | 2281 |
| 319 | Ga0207675_100158338 | 3300026118 | Bacteria | 2159 |
| 320 | Ga0207675_100296051 | 3300026118 | Bacteria | 1575 |
| 321 | Ga0207683_10009916 | 3300026121 | Bacteria | 8123 |
| 322 | Ga0207683_10029975 | 3300026121 | Bacteria | 4713 |
| 323 | Ga0207683_10030376 | 3300026121 | Bacteria | 4682 |
| 324 | Ga0207683_10035523 | 3300026121 | Bacteria | 4335 |
| 325 | Ga0207683_10049653 | 3300026121 | Bacteria | 3674 |
| 326 | Ga0207683_10102494 | 3300026121 | Bacteria | 2556 |
| 327 | Ga0207683_10340193 | 3300026121 | Bacteria | 1376 |
| 328 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 329 | Ga0209179_1007240 | 3300027512 | Bacteria | 1825 |
| 330 | Ga0209983_1004273 | 3300027665 | Bacteria | 3011 |
| 331 | Ga0209588_1041323 | 3300027671 | Bacteria | 1489 |
| 332 | Ga0209971_1003504 | 3300027682 | Bacteria | 3717 |
| 333 | Ga0209974_10010132 | 3300027876 | Bacteria | 3185 |
| 334 | Ga0209974_10032498 | 3300027876 | Bacteria | 1729 |
| 335 | Ga0207428_10002055 | 3300027907 | Bacteria | 20307 |
| 336 | Ga0207428_10007334 | 3300027907 | Bacteria | 10065 |
| 337 | Ga0207428_10010695 | 3300027907 | Bacteria | 8184 |
| 338 | Ga0207428_10015486 | 3300027907 | Bacteria | 6596 |
| 339 | Ga0207428_10052578 | 3300027907 | Bacteria | 3252 |
| 340 | Ga0207428_10186520 | 3300027907 | Bacteria | 1565 |
| 341 | Ga0268266_10148552 | 3300028379 | Bacteria | 2110 |
| 342 | Ga0268266_10316136 | 3300028379 | Bacteria | 1460 |
| 343 | Ga0268265_10008126 | 3300028380 | Bacteria | 7091 |
| 344 | Ga0268265_10405751 | 3300028380 | Bacteria | 1261 |
| 345 | Ga0268265_10486324 | 3300028380 | Bacteria | 1160 |
| 346 | Ga0268264_10024489 | 3300028381 | Bacteria | 4928 |
| 347 | Ga0265337_1001439 | 3300028556 | Bacteria | 11715 |
| 348 | Ga0265326_10001380 | 3300028558 | Bacteria | 8553 |
| 349 | Ga0265319_1002798 | 3300028563 | Bacteria | 9365 |
| 350 | Ga0265334_10005260 | 3300028573 | Bacteria | 5665 |
| 351 | Ga0265318_10000962 | 3300028577 | Bacteria | 18486 |
| 352 | Ga0265318_10003474 | 3300028577 | Bacteria | 7906 |
| 353 | Ga0265323_10000992 | 3300028653 | Bacteria | 14760 |
| 354 | Ga0265336_10000063 | 3300028666 | Bacteria | 98413 |
| 355 | Ga0307515_10000292 | 3300028794 | Bacteria | 123160 |
| 356 | Ga0307515_10000494 | 3300028794 | Bacteria | 94354 |
| 357 | Ga0307515_10033589 | 3300028794 | Bacteria | 8436 |
| 358 | Ga0307515_10039959 | 3300028794 | Bacteria | 7435 |
| 359 | Ga0265338_10000154 | 3300028800 | Bacteria | 125708 |
| 360 | Ga0265324_10001590 | 3300029957 | Bacteria | 12642 |
| 361 | Ga0307512_10037887 | 3300030522 | Bacteria | 4066 |
| 362 | Ga0265332_10003324 | 3300031238 | Bacteria | 7803 |
| 363 | Ga0265320_10010219 | 3300031240 | Bacteria | 5603 |
| 364 | Ga0265325_10017195 | 3300031241 | Bacteria | 4022 |
| 365 | Ga0265340_10005895 | 3300031247 | Bacteria | 6775 |
| 366 | Ga0265339_10001335 | 3300031249 | Bacteria | 18436 |
| 367 | Ga0265327_10005550 | 3300031251 | Bacteria | 10474 |
| 368 | Ga0265316_10131364 | 3300031344 | Bacteria | 1886 |
| 369 | Ga0307513_10012018 | 3300031456 | Bacteria | 10714 |
| 370 | Ga0307513_10012594 | 3300031456 | Bacteria | 10427 |
| 371 | Ga0307513_10062057 | 3300031456 | Bacteria | 3952 |
| 372 | Ga0307509_10024290 | 3300031507 | Bacteria | 6789 |
| 373 | Ga0307509_10329973 | 3300031507 | Bacteria | 1258 |
| 374 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 375 | Ga0307408_100015068 | 3300031548 | Bacteria | 5144 |
| 376 | Ga0307408_100086750 | 3300031548 | Bacteria | 2353 |
| 377 | Ga0265313_10000779 | 3300031595 | Bacteria | 32214 |
| 378 | Ga0265313_10001164 | 3300031595 | Bacteria | 25145 |
| 379 | Ga0265313_10004883 | 3300031595 | Bacteria | 10056 |
| 380 | Ga0307508_10000096 | 3300031616 | Bacteria | 103730 |
| 381 | Ga0307508_10113029 | 3300031616 | Bacteria | 2315 |
| 382 | Ga0307514_10001887 | 3300031649 | Bacteria | 23094 |
| 383 | Ga0265314_10015177 | 3300031711 | Bacteria | 6122 |
| 384 | Ga0265314_10027734 | 3300031711 | Bacteria | 4237 |
| 385 | Ga0265314_10034777 | 3300031711 | Bacteria | 3677 |
| 386 | Ga0265314_10109375 | 3300031711 | Bacteria | 1759 |
| 387 | Ga0265342_10023837 | 3300031712 | Bacteria | 3867 |
| 388 | Ga0265342_10144661 | 3300031712 | Bacteria | 1324 |
| 389 | Ga0307516_10001367 | 3300031730 | Bacteria | 33805 |
| 390 | Ga0307516_10003526 | 3300031730 | Bacteria | 20030 |
| 391 | Ga0307516_10053532 | 3300031730 | Bacteria | 3945 |
| 392 | Ga0307516_10140117 | 3300031730 | Bacteria | 2189 |
| 393 | Ga0307405_10001234 | 3300031731 | Bacteria | 10638 |
| 394 | Ga0307413_10002493 | 3300031824 | Bacteria | 7503 |
| 395 | Ga0307413_10124258 | 3300031824 | Bacteria | 1754 |
| 396 | Ga0307410_10010279 | 3300031852 | Bacteria | 5291 |
| 397 | Ga0307406_10012325 | 3300031901 | Bacteria | 4875 |
| 398 | Ga0307412_10004520 | 3300031911 | Bacteria | 7750 |
| 399 | Ga0307412_10379705 | 3300031911 | Bacteria | 1144 |
| 400 | Ga0307409_100005343 | 3300031995 | Bacteria | 7374 |
| 401 | Ga0307416_100005644 | 3300032002 | Bacteria | 7724 |
| 402 | Ga0307416_100447918 | 3300032002 | Bacteria | 1343 |
| 403 | Ga0307416_100475880 | 3300032002 | Bacteria | 1308 |
| 404 | Ga0307411_10003401 | 3300032005 | Bacteria | 7374 |
| 405 | Ga0316583_10026639 | 3300032133 | Bacteria | 2064 |
| 406 | Ga0373926_0027932 | 3300035083 | Bacteria | 1979 |
| 407 | Ga0373944_0047809 | 3300035089 | Bacteria | 1341 |
| 408 | Ga0373936_0001944 | 3300035113 | Bacteria | 7639 |
| 409 | Ga0373936_0116030 | 3300035113 | Bacteria | 1140 |
| 410 | Ga0373953_0006315 | 3300035117 | Bacteria | 3899 |
| 411 | Ga0373954_0075076 | 3300035118 | Bacteria | 1609 |
| 412 | Ga0373956_0171409 | 3300035119 | Bacteria | 1024 |
| 413 | Ga0373946_0043886 | 3300035171 | Bacteria | 1844 |
| 414 | Ga0373961_0024428 | 3300035241 | Bacteria | 1635 |
| 415 | Ga0373935_0014829 | 3300035692 | Bacteria | 4705 |
| 416 | Ga0373927_0001069 | 3300035695 | Bacteria | 20955 |
| 417 | Ga0373927_0010672 | 3300035695 | Bacteria | 6119 |
| 418 | Ga0373947_0007770 | 3300035725 | Bacteria | 6196 |
| 419 | Ga0373937_0037618 | 3300036401 | Bacteria | 4410 |
| 420 | Ga0373937_0044534 | 3300036401 | Bacteria | 4054 |
| 421 | Ga0373925_0003237 | 3300037068 | Bacteria | 12714 |
| 422 | Ga0373925_0206479 | 3300037068 | Bacteria | 1564 |
| 423 | Ga0373925_0554371 | 3300037068 | Bacteria | 945 |
| 424 | Ga0395899_0219652 | 3300037312 | Bacteria | 1317 |
| 425 | Ga0395900_0016357 | 3300037418 | Bacteria | 7561 |
| 426 | Ga0395898_0123687 | 3300037466 | Bacteria | 2479 |
| 427 | Ga0395898_0243873 | 3300037466 | Bacteria | 1714 |
| 428 | Ga0395905_0002341 | 3300037471 | Bacteria | 21134 |
| 429 | Ga0395905_0010810 | 3300037471 | Bacteria | 8844 |
| 430 | Ga0395905_0034060 | 3300037471 | Bacteria | 4782 |
| 431 | Ga0395905_0045282 | 3300037471 | Bacteria | 4126 |
| 432 | Ga0395905_0060217 | 3300037471 | Bacteria | 3550 |
| 433 | Ga0395905_0347746 | 3300037471 | Bacteria | 1374 |
| 434 | Ga0395901_0118960 | 3300038443 | Bacteria | 2776 |
| 435 | Ga0400490_35285 | 3300038726 | Bacteria | 7917 |
| 436 | Ga0400491_04233 | 3300038727 | Bacteria | 1718 |
| 437 | Ga0400488_34208 | 3300038741 | Bacteria | 12154 |
| 438 | Ga0400483_215880 | 3300039062 | Bacteria | 4205 |
| 439 | Ga0400487_20550 | 3300039110 | Bacteria | 1889 |
| 440 | Ga0400487_34028 | 3300039110 | Bacteria | 26819 |
| 441 | Ga0436365_0151425 | 3300039437 | Bacteria | 1709 |
| 442 | Ga0436365_0476641 | 3300039437 | Bacteria | 1840 |
| 443 | Ga0436360_0109312 | 3300039438 | Bacteria | 1729 |
| 444 | Ga0436360_1087288 | 3300039438 | Bacteria | 2846 |
| 445 | Ga0436360_1192691 | 3300039438 | Bacteria | 3786 |
| 446 | Ga0436361_0028664 | 3300039447 | Bacteria | 69721 |
| 447 | Ga0436361_0193139 | 3300039447 | Bacteria | 16854 |
| 448 | Ga0436361_0455065 | 3300039447 | Bacteria | 73475 |
| 449 | Ga0436363_1505079 | 3300039450 | Bacteria | 1391 |
| 450 | Ga0436362_1236534 | 3300039453 | Bacteria | 1812 |
| 451 | Ga0439433_0018131 | 3300041999 | Bacteria | 1565 |
| 452 | Ga0439449_0005387 | 3300042007 | Bacteria | 4903 |
| 453 | Ga0439450_009025 | 3300042008 | Bacteria | 1880 |
| 454 | Ga0450911_001989 | 3300042115 | Bacteria | 4252 |
| 455 | Ga0439434_0060106 | 3300042435 | Bacteria | 1187 |
| 456 | Ga0439435_0024205 | 3300042436 | Bacteria | 1600 |
| 457 | Ga0439460_0118575 | 3300042461 | Bacteria | 864 |
| 458 | Ga0450918_000016 | 3300042531 | Bacteria | 34446 |
| 459 | Ga0450893_0004350 | 3300042532 | Bacteria | 2256 |
| 460 | Ga0451577_0000235 | 3300042876 | Bacteria | 109693 |
| 461 | Ga0451577_0288313 | 3300042876 | Bacteria | 1487 |
| 462 | Ga0466969_0118683 | 3300044656 | Bacteria | 1233 |
| 463 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 464 | Ga0453684_0000906 | 3300044712 | Bacteria | 98768 |
| 465 | Ga0453684_0069104 | 3300044712 | Bacteria | 4482 |
| 466 | Ga0453684_0422095 | 3300044712 | Bacteria | 1489 |
| 467 | Ga0451576_0015435 | 3300045051 | Bacteria | 8461 |
| 468 | Ga0451576_0124675 | 3300045051 | Bacteria | 2683 |
| 469 | Ga0495592_0019534 | 3300046454 | Bacteria | 5154 |
| 470 | Ga0495603_0000064 | 3300046455 | Bacteria | 46716 |
| 471 | Ga0495603_0155368 | 3300046455 | Bacteria | 1328 |
| 472 | Ga0495629_0001770 | 3300046459 | Bacteria | 16944 |
| 473 | Ga0495629_0105467 | 3300046459 | Bacteria | 1966 |
| 474 | Ga0495638_0000710 | 3300046460 | Bacteria | 35874 |
| 475 | Ga0495641_0004409 | 3300046461 | Bacteria | 9961 |
| 476 | Ga0495651_0029648 | 3300046462 | Bacteria | 4266 |
| 477 | Ga0495650_0001530 | 3300046471 | Bacteria | 21964 |
| 478 | Ga0495580_0002618 | 3300046472 | Bacteria | 15620 |
| 479 | Ga0495582_0000197 | 3300046473 | Bacteria | 33437 |
| 480 | Ga0495639_0001620 | 3300046475 | Bacteria | 10038 |
| 481 | Ga0495639_0035744 | 3300046475 | Bacteria | 2223 |
| 482 | Ga0495662_0012317 | 3300046476 | Bacteria | 4174 |
| 483 | Ga0495664_0011941 | 3300046477 | Bacteria | 4907 |
| 484 | Ga0495664_0036973 | 3300046477 | Bacteria | 2880 |
| 485 | Ga0495584_0031775 | 3300046491 | Bacteria | 2672 |
| 486 | Ga0495594_0004585 | 3300046499 | Bacteria | 7112 |
| 487 | Ga0495596_0000604 | 3300046500 | Bacteria | 22532 |
| 488 | Ga0495596_0010570 | 3300046500 | Bacteria | 4013 |
| 489 | Ga0495607_0041240 | 3300046501 | Bacteria | 2743 |
| 490 | Ga0495610_0044439 | 3300046512 | Bacteria | 2205 |
| 491 | Ga0495618_0023879 | 3300046514 | Bacteria | 3786 |
| 492 | Ga0495628_0049588 | 3300046516 | Bacteria | 3324 |
| 493 | Ga0495630_0005383 | 3300046517 | Bacteria | 9031 |
| 494 | Ga0495632_0017507 | 3300046519 | Bacteria | 3953 |
| 495 | Ga0495632_0024422 | 3300046519 | Bacteria | 3210 |
| 496 | Ga0495632_0051562 | 3300046519 | Bacteria | 2025 |
| 497 | Ga0495643_0003067 | 3300046522 | Bacteria | 12559 |
| 498 | Ga0495643_0029686 | 3300046522 | Bacteria | 3058 |
| 499 | Ga0495644_0017097 | 3300046523 | Bacteria | 2775 |
| 500 | Ga0495648_0000070 | 3300046524 | Bacteria | 136680 |
| 501 | Ga0495642_0030338 | 3300046528 | Bacteria | 2162 |
| 502 | Ga0495652_0040068 | 3300046529 | Bacteria | 4049 |
| 503 | Ga0495652_0061314 | 3300046529 | Bacteria | 3175 |
| 504 | Ga0495665_0000902 | 3300046531 | Bacteria | 15623 |
| 505 | Ga0495640_0001505 | 3300046533 | Bacteria | 18356 |
| 506 | Ga0495609_0028193 | 3300046538 | Bacteria | 2563 |
| 507 | Ga0495621_0096422 | 3300046539 | Bacteria | 1121 |
| 508 | Ga0495597_0003270 | 3300046542 | Bacteria | 9606 |
| 509 | Ga0495622_0001436 | 3300046557 | Bacteria | 12023 |
| 510 | Ga0495656_0015604 | 3300046615 | Bacteria | 2871 |
| 511 | Ga0495656_0173623 | 3300046615 | Bacteria | 1055 |
| 512 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 513 | Ga0495668_0001435 | 3300046616 | Bacteria | 23071 |
| 514 | Ga0495611_0006888 | 3300046648 | Bacteria | 4831 |
| 515 | Ga0495625_0042913 | 3300046660 | Bacteria | 3283 |
| 516 | Ga0495635_0000356 | 3300046663 | Bacteria | 29094 |
| 517 | Ga0495661_0053208 | 3300046665 | Bacteria | 2435 |
| 518 | Ga0495588_0000619 | 3300046674 | Bacteria | 16696 |
| 519 | Ga0495599_0015026 | 3300046678 | Bacteria | 4799 |
| 520 | Ga0495623_0089260 | 3300046679 | Bacteria | 1895 |
| 521 | Ga0495647_0022565 | 3300046681 | Bacteria | 2274 |
| 522 | Ga0495658_0003461 | 3300046683 | Bacteria | 7799 |
| 523 | Ga0495669_0228473 | 3300046684 | Bacteria | 893 |
| 524 | Ga0495613_0004786 | 3300046689 | Bacteria | 10156 |
| 525 | Ga0495613_0050119 | 3300046689 | Bacteria | 3080 |
| 526 | Ga0495624_0001264 | 3300046690 | Bacteria | 19934 |
| 527 | Ga0495670_0012551 | 3300046691 | Bacteria | 4167 |
| 528 | Ga0495670_0056496 | 3300046691 | Bacteria | 1969 |
| 529 | Ga0495589_0037901 | 3300046794 | Bacteria | 2414 |
| 530 | Ga0495660_0025343 | 3300046810 | Bacteria | 3369 |
| 531 | Ga0495581_0002800 | 3300047315 | Bacteria | 9952 |
| 532 | Ga0495604_0091766 | 3300047317 | Bacteria | 2251 |
| 533 | Ga0495674_0069526 | 3300047319 | Bacteria | 3044 |
| 534 | Ga0495672_0086533 | 3300047320 | Bacteria | 1733 |
| 535 | Ga0495672_0087269 | 3300047320 | Bacteria | 1723 |
| 536 | Ga0495680_0016989 | 3300047322 | Bacteria | 6230 |
| 537 | Ga0495685_022972 | 3300047447 | Bacteria | 2146 |
| 538 | Ga0495593_0000053 | 3300047673 | Bacteria | 47697 |
| 539 | Ga0495602_0171272 | 3300048088 | Bacteria | 1685 |
| 540 | Ga0495602_0195990 | 3300048088 | Bacteria | 1545 |
| 541 | Ga0495614_0035545 | 3300048089 | Bacteria | 2141 |
| 542 | Ga0495626_0000868 | 3300048091 | Bacteria | 26883 |
| 543 | Ga0495626_0020961 | 3300048091 | Bacteria | 3250 |
| 544 | Ga0496101_0004586 | 3300048904 | Bacteria | 8729 |
| 545 | Ga0496102_0007305 | 3300048905 | Bacteria | 9429 |
| 546 | Ga0496104_0163229 | 3300048907 | Bacteria | 2136 |
| 547 | Ga0496104_0167719 | 3300048907 | Bacteria | 2105 |
| 548 | Ga0496104_0184256 | 3300048907 | Bacteria | 1998 |
| 549 | Ga0496105_0000572 | 3300048908 | Bacteria | 24357 |
| 550 | Ga0496105_0022207 | 3300048908 | Bacteria | 5139 |
| 551 | Ga0496105_0066814 | 3300048908 | Bacteria | 2969 |
| 552 | Ga0496106_0420367 | 3300048909 | Bacteria | 1074 |
| 553 | Ga0496107_0000808 | 3300048910 | Bacteria | 18176 |
| 554 | Ga0496107_0211643 | 3300048910 | Bacteria | 1442 |
| 555 | Ga0496111_0045887 | 3300048914 | Bacteria | 3145 |
| 556 | Ga0496115_0059959 | 3300048918 | Bacteria | 3065 |
| 557 | Ga0496116_0057566 | 3300048919 | Bacteria | 2540 |
| 558 | Ga0496121_0057214 | 3300048924 | Bacteria | 3233 |
| 559 | Ga0496121_0178566 | 3300048924 | Bacteria | 1535 |
| 560 | Ga0496124_0007054 | 3300048927 | Bacteria | 12039 |
| 561 | Ga0496124_0106707 | 3300048927 | Bacteria | 2261 |
| 562 | Ga0496125_0038093 | 3300048928 | Bacteria | 4168 |
| 563 | Ga0496125_0040603 | 3300048928 | Bacteria | 3989 |
| 564 | Ga0496125_0056205 | 3300048928 | Bacteria | 3198 |
| 565 | Ga0496125_0087591 | 3300048928 | Bacteria | 2351 |
| 566 | Ga0496126_0284820 | 3300048929 | Bacteria | 1368 |
| 567 | Ga0496126_0310800 | 3300048929 | Bacteria | 1297 |
| 568 | Ga0495678_003261 | 3300049459 | Bacteria | 10144 |
| 569 | Ga0495682_0019068 | 3300049460 | Bacteria | 2582 |
| 570 | Ga0501031_0001824 | 3300049568 | Bacteria | 13399 |
| 571 | Ga0501034_0186886 | 3300049571 | Bacteria | 2035 |
| 572 | Ga0501067_0023296 | 3300049583 | Bacteria | 3431 |
| 573 | Ga0501067_0028047 | 3300049583 | Bacteria | 3120 |
| 574 | Ga0501198_000037 | 3300049649 | Bacteria | 52054 |
| 575 | Ga0501222_000032 | 3300049662 | Bacteria | 55723 |
| 576 | Ga0501259_017361 | 3300049688 | Bacteria | 1247 |
| 577 | Ga0501225_0055146 | 3300049705 | Bacteria | 1112 |
| 578 | nmdc:mga0k408_23715_c1 | 3300050493 | Bacteria | 3464 |
| 579 | nmdc:mga07m45_5721_c1 | 3300050496 | Bacteria | 6218 |
| 580 | nmdc:mga05p37_180532_c1 | 3300050507 | Bacteria | 2568 |
| 581 | nmdc:mga05p37_19865_c1 | 3300050507 | Bacteria | 8128 |
| 582 | nmdc:mga05p37_208757_c1 | 3300050507 | Bacteria | 2362 |
| 583 | nmdc:mga05p37_52613_c1 | 3300050507 | Bacteria | 5006 |
| 584 | nmdc:mga09592_11616_c1 | 3300050508 | Bacteria | 7161 |
| 585 | nmdc:mga09592_190386_c1 | 3300050508 | Bacteria | 1776 |
| 586 | nmdc:mga09592_23749_c1 | 3300050508 | Bacteria | 5065 |
| 587 | nmdc:mga09592_76368_c1 | 3300050508 | Bacteria | 2849 |
| 588 | nmdc:mga0qj67_1010_c1 | 3300050509 | Bacteria | 19413 |
| 589 | nmdc:mga0qj67_112735_c1 | 3300050509 | Bacteria | 2196 |
| 590 | nmdc:mga0qj67_199451_c1 | 3300050509 | Bacteria | 1626 |
| 591 | nmdc:mga06r32_3055_c1 | 3300050510 | Bacteria | 14984 |
| 592 | nmdc:mga06r32_36396_c1 | 3300050510 | Bacteria | 4650 |
| 593 | nmdc:mga06r32_39835_c1 | 3300050510 | Bacteria | 4460 |
| 594 | nmdc:mga06r32_78341_c1 | 3300050510 | Bacteria | 3213 |
| 595 | nmdc:mga08y16_148858_c1 | 3300050511 | Bacteria | 2433 |
| 596 | nmdc:mga08y16_1998_c1 | 3300050511 | Bacteria | 20844 |
| 597 | nmdc:mga08y16_23677_c1 | 3300050511 | Bacteria | 6484 |
| 598 | nmdc:mga08y16_5088_c1 | 3300050511 | Bacteria | 13743 |
| 599 | nmdc:mga08y16_51502_c1 | 3300050511 | Bacteria | 4307 |
| 600 | nmdc:mga08y16_547333_c1 | 3300050511 | Bacteria | 1172 |
| 601 | nmdc:mga08y16_5509_c1 | 3300050511 | Bacteria | 13243 |
| 602 | nmdc:mga08y16_596848_c1 | 3300050511 | Bacteria | 1113 |
| 603 | nmdc:mga0n895_2763_c1 | 3300050512 | Bacteria | 13867 |
| 604 | nmdc:mga0n895_3027_c1 | 3300050512 | Bacteria | 13368 |
| 605 | nmdc:mga0n895_38591_c1 | 3300050512 | Bacteria | 4629 |
| 606 | nmdc:mga0n895_412338_c1 | 3300050512 | Bacteria | 1366 |
| 607 | nmdc:mga0n895_67403_c1 | 3300050512 | Bacteria | 3545 |
| 608 | nmdc:mga0rr50_142109_c1 | 3300050513 | Bacteria | 1932 |
| 609 | nmdc:mga0rr50_231643_c1 | 3300050513 | Bacteria | 1528 |
| 610 | nmdc:mga0rr50_43386_c1 | 3300050513 | Bacteria | 3291 |
| 611 | nmdc:mga0a205_108192_c1 | 3300050515 | Bacteria | 2678 |
| 612 | nmdc:mga0a205_1255_c1 | 3300050515 | Bacteria | 21291 |
| 613 | nmdc:mga0a205_3105_c1 | 3300050515 | Bacteria | 14729 |
| 614 | nmdc:mga0a205_447_c1 | 3300050515 | Bacteria | 31860 |
| 615 | nmdc:mga0a205_85247_c1 | 3300050515 | Bacteria | 3051 |
| 616 | Ga0495655_0004612 | 3300053083 | Bacteria | 2371 |
| 617 | Ga0500650_0088102 | 3300053098 | Bacteria | 1453 |
| 618 | Ga0500593_000250 | 3300053117 | Bacteria | 22072 |
| 619 | Ga0501084_0291317 | 3300054114 | Bacteria | 1379 |
| 620 | Ga0590074_015400 | 3300059423 | Bacteria | 1299 |
| 621 | Ga0501082_0294796 | 3300060353 | Bacteria | 1412 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007788 | Ga0099795_10077249 | Ga0099795_100772492 | 266 |
| 2 | 3300046519 | Ga0495632_0051562 | Ga0495632_0051562_41_859 | 267 |
| 3 | 3300037068 | Ga0373925_0554371 | Ga0373925_0554371_97_912 | 268 |
| 4 | 3300037471 | Ga0395905_0347746 | Ga0395905_0347746_524_1345 | 268 |
| 5 | 3300042461 | Ga0439460_0118575 | Ga0439460_0118575_19_825 | 268 |
| 6 | 3300046684 | Ga0495669_0228473 | Ga0495669_0228473_55_861 | 268 |
| 7 | 3300003323 | rootH1_10085284 | rootH1_100852842 | 269 |
| 8 | 3300035113 | Ga0373936_0116030 | Ga0373936_0116030_41_874 | 274 |
| 9 | 3300035692 | Ga0373935_0014829 | Ga0373935_0014829_3835_4668 | 274 |
| 10 | 3300037466 | Ga0395898_0123687 | Ga0395898_0123687_19_861 | 274 |
| 11 | 3300060353 | Ga0501082_0294796 | Ga0501082_0294796_162_995 | 274 |
| 12 | 3300025941 | Ga0207711_10236470 | Ga0207711_102364702 | 282 |
| 13 | 3300014325 | Ga0163163_10139391 | Ga0163163_101393913 | 289 |
| 14 | 3300028794 | Ga0307515_10033589 | Ga0307515_100335894 | 289 |
| 15 | 3300037068 | Ga0373925_0206479 | Ga0373925_0206479_244_1140 | 292 |
| 16 | 3300050515 | nmdc:mga0a205_108192_c1 | nmdc:mga0a205_108192_c1_1624_2529 | 292 |
| 17 | 3300031238 | Ga0265332_10003324 | Ga0265332_100033244 | 293 |
| 18 | 3300005459 | Ga0068867_100011208 | Ga0068867_1000112085 | 294 |
| 19 | 3300005844 | Ga0068862_100022389 | Ga0068862_1000223892 | 294 |
| 20 | 3300015262 | Ga0182007_10000236 | Ga0182007_1000023629 | 294 |
| 21 | 3300015265 | Ga0182005_1000110 | Ga0182005_100011051 | 294 |
| 22 | 3300025933 | Ga0207706_10000606 | Ga0207706_1000060621 | 294 |
| 23 | 3300025940 | Ga0207691_10002506 | Ga0207691_1000250613 | 294 |
| 24 | 3300025961 | Ga0207712_10156377 | Ga0207712_101563772 | 294 |
| 25 | 3300026075 | Ga0207708_10094077 | Ga0207708_100940772 | 294 |
| 26 | 3300026089 | Ga0207648_10002321 | Ga0207648_100023216 | 294 |
| 27 | 3300026118 | Ga0207675_100015598 | Ga0207675_1000155984 | 294 |
| 28 | 3300027665 | Ga0209983_1004273 | Ga0209983_10042732 | 294 |
| 29 | 3300028577 | Ga0265318_10000962 | Ga0265318_100009622 | 294 |
| 30 | 3300031241 | Ga0265325_10017195 | Ga0265325_100171952 | 294 |
| 31 | 3300031344 | Ga0265316_10131364 | Ga0265316_101313642 | 294 |
| 32 | 3300031595 | Ga0265313_10000779 | Ga0265313_1000077928 | 294 |
| 33 | 3300031595 | Ga0265313_10001164 | Ga0265313_100011648 | 294 |
| 34 | 3300031711 | Ga0265314_10015177 | Ga0265314_100151772 | 294 |
| 35 | 3300032133 | Ga0316583_10026639 | Ga0316583_100266393 | 294 |
| 36 | 3300047320 | Ga0495672_0087269 | Ga0495672_0087269_777_1667 | 294 |
| 37 | 3300048914 | Ga0496111_0045887 | Ga0496111_0045887_778_1668 | 294 |
| 38 | 3300048919 | Ga0496116_0057566 | Ga0496116_0057566_719_1609 | 294 |
| 39 | 3300048924 | Ga0496121_0178566 | Ga0496121_0178566_521_1411 | 294 |
| 40 | 3300048927 | Ga0496124_0007054 | Ga0496124_0007054_3044_3934 | 294 |
| 41 | 3300048928 | Ga0496125_0040603 | Ga0496125_0040603_2936_3826 | 294 |
| 42 | 3300050508 | nmdc:mga09592_76368_c1 | nmdc:mga09592_76368_c1_1765_2724 | 294 |
| 43 | 3300005295 | Ga0065707_10092192 | Ga0065707_100921921 | 297 |
| 44 | 3300009092 | Ga0105250_10000186 | Ga0105250_100001867 | 297 |
| 45 | 3300025711 | Ga0207696_1000072 | Ga0207696_1000072199 | 297 |
| 46 | 3300031711 | Ga0265314_10109375 | Ga0265314_101093751 | 297 |
| 47 | 3300050509 | nmdc:mga0qj67_199451_c1 | nmdc:mga0qj67_199451_c1_479_1372 | 297 |
| 48 | 3300050510 | nmdc:mga06r32_39835_c1 | nmdc:mga06r32_39835_c1_2631_3524 | 297 |
| 49 | iso_pu_bacteria | 2574179768 | 2574433012 | 297 |
| 50 | iso_pu_bacteria | 2585428062 | 2587756656 | 297 |
| 51 | iso_pu_bacteria | 2643221644 | 2644247498 | 297 |
| 52 | iso_pu_bacteria | 2721755763 | 2723879019 | 297 |
| 53 | iso_pu_bacteria | 2904479285 | 2904482829 | 297 |
| 54 | iso_pu_bacteria | 2643221609 | 2644058346 | 298 |
| 55 | iso_pu_bacteria | 2643221611 | 2644073398 | 298 |
| 56 | iso_pu_bacteria | 2721755523 | 2722883082 | 298 |
| 57 | iso_pu_bacteria | 2839138175 | 2839141439 | 298 |
| 58 | iso_pu_bacteria | 2932422444 | 2932422646 | 298 |
| 59 | 3300005539 | Ga0068853_100387645 | Ga0068853_1003876451 | 299 |
| 60 | 3300048928 | Ga0496125_0056205 | Ga0496125_0056205_679_1596 | 299 |
| 61 | 3300049705 | Ga0501225_0055146 | Ga0501225_0055146_147_1067 | 299 |
| 62 | 3300005354 | Ga0070675_100032453 | Ga0070675_1000324532 | 300 |
| 63 | 3300005355 | Ga0070671_100058005 | Ga0070671_1000580052 | 300 |
| 64 | 3300005841 | Ga0068863_100491331 | Ga0068863_1004913312 | 300 |
| 65 | 3300006358 | Ga0068871_100255259 | Ga0068871_1002552592 | 300 |
| 66 | 3300006844 | Ga0075428_100042766 | Ga0075428_1000427663 | 300 |
| 67 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001215 | 300 |
| 68 | 3300025926 | Ga0207659_10018075 | Ga0207659_100180752 | 300 |
| 69 | 3300025931 | Ga0207644_10166434 | Ga0207644_101664342 | 300 |
| 70 | 3300032002 | Ga0307416_100447918 | Ga0307416_1004479182 | 300 |
| 71 | 3300039447 | Ga0436361_0028664 | Ga0436361_0028664_58572_59510 | 300 |
| 72 | 3300047320 | Ga0495672_0086533 | Ga0495672_0086533_467_1375 | 300 |
| 73 | 3300053098 | Ga0500650_0088102 | Ga0500650_0088102_106_1041 | 300 |
| 74 | 3300002076 | JGI24749J21850_1005088 | JGI24749J21850_10050881 | 301 |
| 75 | 3300003203 | JGI25406J46586_10000721 | JGI25406J46586_100007217 | 301 |
| 76 | 3300003203 | JGI25406J46586_10004727 | JGI25406J46586_100047274 | 301 |
| 77 | 3300003203 | JGI25406J46586_10019628 | JGI25406J46586_100196282 | 301 |
| 78 | 3300003203 | JGI25406J46586_10020738 | JGI25406J46586_100207382 | 301 |
| 79 | 3300003320 | rootH2_10247225 | rootH2_102472253 | 301 |
| 80 | 3300003322 | rootL2_10017603 | rootL2_1001760312 | 301 |
| 81 | 3300003794 | Ga0055531_10008251 | Ga0055531_100082517 | 301 |
| 82 | 3300005290 | Ga0065712_10078880 | Ga0065712_100788803 | 301 |
| 83 | 3300005328 | Ga0070676_10003564 | Ga0070676_100035644 | 301 |
| 84 | 3300005328 | Ga0070676_10008828 | Ga0070676_100088285 | 301 |
| 85 | 3300005328 | Ga0070676_10050389 | Ga0070676_100503892 | 301 |
| 86 | 3300005330 | Ga0070690_100001736 | Ga0070690_1000017367 | 301 |
| 87 | 3300005330 | Ga0070690_100023070 | Ga0070690_1000230701 | 301 |
| 88 | 3300005331 | Ga0070670_100072240 | Ga0070670_1000722402 | 301 |
| 89 | 3300005331 | Ga0070670_100106230 | Ga0070670_1001062302 | 301 |
| 90 | 3300005333 | Ga0070677_10001442 | Ga0070677_100014422 | 301 |
| 91 | 3300005333 | Ga0070677_10015588 | Ga0070677_100155883 | 301 |
| 92 | 3300005334 | Ga0068869_100001494 | Ga0068869_10000149411 | 301 |
| 93 | 3300005334 | Ga0068869_100023320 | Ga0068869_1000233204 | 301 |
| 94 | 3300005334 | Ga0068869_100111702 | Ga0068869_1001117022 | 301 |
| 95 | 3300005334 | Ga0068869_100153986 | Ga0068869_1001539862 | 301 |
| 96 | 3300005335 | Ga0070666_10198159 | Ga0070666_101981591 | 301 |
| 97 | 3300005336 | Ga0070680_100079923 | Ga0070680_1000799233 | 301 |
| 98 | 3300005337 | Ga0070682_100000252 | Ga0070682_10000025214 | 301 |
| 99 | 3300005338 | Ga0068868_100082908 | Ga0068868_1000829082 | 301 |
| 100 | 3300005340 | Ga0070689_100055212 | Ga0070689_1000552121 | 301 |
| 101 | 3300005347 | Ga0070668_100037286 | Ga0070668_1000372864 | 301 |
| 102 | 3300005347 | Ga0070668_100114143 | Ga0070668_1001141432 | 301 |
| 103 | 3300005353 | Ga0070669_100014516 | Ga0070669_1000145163 | 301 |
| 104 | 3300005353 | Ga0070669_100029077 | Ga0070669_1000290772 | 301 |
| 105 | 3300005353 | Ga0070669_100069805 | Ga0070669_1000698052 | 301 |
| 106 | 3300005353 | Ga0070669_100311232 | Ga0070669_1003112322 | 301 |
| 107 | 3300005354 | Ga0070675_100006367 | Ga0070675_1000063678 | 301 |
| 108 | 3300005354 | Ga0070675_100022719 | Ga0070675_1000227194 | 301 |
| 109 | 3300005354 | Ga0070675_100028795 | Ga0070675_1000287953 | 301 |
| 110 | 3300005354 | Ga0070675_100102569 | Ga0070675_1001025693 | 301 |
| 111 | 3300005354 | Ga0070675_100232826 | Ga0070675_1002328262 | 301 |
| 112 | 3300005355 | Ga0070671_100003098 | Ga0070671_1000030983 | 301 |
| 113 | 3300005355 | Ga0070671_100285572 | Ga0070671_1002855722 | 301 |
| 114 | 3300005356 | Ga0070674_100002446 | Ga0070674_1000024462 | 301 |
| 115 | 3300005356 | Ga0070674_100419066 | Ga0070674_1004190661 | 301 |
| 116 | 3300005364 | Ga0070673_100013595 | Ga0070673_1000135954 | 301 |
| 117 | 3300005364 | Ga0070673_100047176 | Ga0070673_1000471764 | 301 |
| 118 | 3300005364 | Ga0070673_100064065 | Ga0070673_1000640653 | 301 |
| 119 | 3300005364 | Ga0070673_100216214 | Ga0070673_1002162142 | 301 |
| 120 | 3300005365 | Ga0070688_100401963 | Ga0070688_1004019631 | 301 |
| 121 | 3300005366 | Ga0070659_100115927 | Ga0070659_1001159272 | 301 |
| 122 | 3300005367 | Ga0070667_100022678 | Ga0070667_1000226784 | 301 |
| 123 | 3300005367 | Ga0070667_100384703 | Ga0070667_1003847031 | 301 |
| 124 | 3300005434 | Ga0070709_10002985 | Ga0070709_100029855 | 301 |
| 125 | 3300005435 | Ga0070714_100013754 | Ga0070714_1000137542 | 301 |
| 126 | 3300005435 | Ga0070714_100143267 | Ga0070714_1001432673 | 301 |
| 127 | 3300005437 | Ga0070710_10005127 | Ga0070710_100051275 | 301 |
| 128 | 3300005438 | Ga0070701_10163816 | Ga0070701_101638162 | 301 |
| 129 | 3300005439 | Ga0070711_100008828 | Ga0070711_1000088282 | 301 |
| 130 | 3300005441 | Ga0070700_100001670 | Ga0070700_1000016703 | 301 |
| 131 | 3300005441 | Ga0070700_100316577 | Ga0070700_1003165771 | 301 |
| 132 | 3300005455 | Ga0070663_100292284 | Ga0070663_1002922842 | 301 |
| 133 | 3300005456 | Ga0070678_100005422 | Ga0070678_1000054225 | 301 |
| 134 | 3300005456 | Ga0070678_100093766 | Ga0070678_1000937661 | 301 |
| 135 | 3300005456 | Ga0070678_100229592 | Ga0070678_1002295922 | 301 |
| 136 | 3300005457 | Ga0070662_100008793 | Ga0070662_1000087934 | 301 |
| 137 | 3300005459 | Ga0068867_100006363 | Ga0068867_1000063636 | 301 |
| 138 | 3300005459 | Ga0068867_100060453 | Ga0068867_1000604533 | 301 |
| 139 | 3300005459 | Ga0068867_100072962 | Ga0068867_1000729622 | 301 |
| 140 | 3300005459 | Ga0068867_100142478 | Ga0068867_1001424782 | 301 |
| 141 | 3300005466 | Ga0070685_10074933 | Ga0070685_100749331 | 301 |
| 142 | 3300005467 | Ga0070706_100139518 | Ga0070706_1001395183 | 301 |
| 143 | 3300005467 | Ga0070706_100315058 | Ga0070706_1003150582 | 301 |
| 144 | 3300005468 | Ga0070707_100108691 | Ga0070707_1001086912 | 301 |
| 145 | 3300005471 | Ga0070698_100248102 | Ga0070698_1002481022 | 301 |
| 146 | 3300005518 | Ga0070699_100011663 | Ga0070699_1000116636 | 301 |
| 147 | 3300005543 | Ga0070672_100026250 | Ga0070672_1000262504 | 301 |
| 148 | 3300005543 | Ga0070672_100041640 | Ga0070672_1000416402 | 301 |
| 149 | 3300005543 | Ga0070672_100055765 | Ga0070672_1000557653 | 301 |
| 150 | 3300005543 | Ga0070672_100094115 | Ga0070672_1000941152 | 301 |
| 151 | 3300005543 | Ga0070672_100133926 | Ga0070672_1001339263 | 301 |
| 152 | 3300005544 | Ga0070686_100020402 | Ga0070686_1000204021 | 301 |
| 153 | 3300005548 | Ga0070665_100050187 | Ga0070665_1000501871 | 301 |
| 154 | 3300005548 | Ga0070665_100074498 | Ga0070665_1000744983 | 301 |
| 155 | 3300005549 | Ga0070704_100036796 | Ga0070704_1000367962 | 301 |
| 156 | 3300005549 | Ga0070704_100041535 | Ga0070704_1000415354 | 301 |
| 157 | 3300005563 | Ga0068855_100101520 | Ga0068855_1001015202 | 301 |
| 158 | 3300005564 | Ga0070664_100028196 | Ga0070664_1000281964 | 301 |
| 159 | 3300005564 | Ga0070664_100088159 | Ga0070664_1000881591 | 301 |
| 160 | 3300005577 | Ga0068857_100143182 | Ga0068857_1001431821 | 301 |
| 161 | 3300005614 | Ga0068856_100156024 | Ga0068856_1001560242 | 301 |
| 162 | 3300005616 | Ga0068852_100007943 | Ga0068852_10000794312 | 301 |
| 163 | 3300005617 | Ga0068859_100032369 | Ga0068859_1000323693 | 301 |
| 164 | 3300005618 | Ga0068864_100044342 | Ga0068864_1000443423 | 301 |
| 165 | 3300005618 | Ga0068864_100376880 | Ga0068864_1003768802 | 301 |
| 166 | 3300005719 | Ga0068861_100024692 | Ga0068861_1000246922 | 301 |
| 167 | 3300005719 | Ga0068861_100215269 | Ga0068861_1002152692 | 301 |
| 168 | 3300005834 | Ga0068851_10081246 | Ga0068851_100812462 | 301 |
| 169 | 3300005840 | Ga0068870_10007969 | Ga0068870_100079693 | 301 |
| 170 | 3300005840 | Ga0068870_10164894 | Ga0068870_101648942 | 301 |
| 171 | 3300005841 | Ga0068863_100011364 | Ga0068863_1000113646 | 301 |
| 172 | 3300005842 | Ga0068858_100201132 | Ga0068858_1002011322 | 301 |
| 173 | 3300005842 | Ga0068858_100260154 | Ga0068858_1002601542 | 301 |
| 174 | 3300005843 | Ga0068860_100046850 | Ga0068860_1000468504 | 301 |
| 175 | 3300005844 | Ga0068862_100004814 | Ga0068862_1000048143 | 301 |
| 176 | 3300005844 | Ga0068862_100261277 | Ga0068862_1002612771 | 301 |
| 177 | 3300005937 | Ga0081455_10008730 | Ga0081455_100087301 | 301 |
| 178 | 3300005937 | Ga0081455_10012116 | Ga0081455_1001211611 | 301 |
| 179 | 3300005937 | Ga0081455_10027965 | Ga0081455_100279656 | 301 |
| 180 | 3300005937 | Ga0081455_10182845 | Ga0081455_101828452 | 301 |
| 181 | 3300005983 | Ga0081540_1003649 | Ga0081540_10036496 | 301 |
| 182 | 3300005983 | Ga0081540_1008233 | Ga0081540_10082334 | 301 |
| 183 | 3300005983 | Ga0081540_1030795 | Ga0081540_10307954 | 301 |
| 184 | 3300005983 | Ga0081540_1057475 | Ga0081540_10574752 | 301 |
| 185 | 3300005985 | Ga0081539_10000133 | Ga0081539_1000013369 | 301 |
| 186 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022011 | 301 |
| 187 | 3300005985 | Ga0081539_10000329 | Ga0081539_1000032986 | 301 |
| 188 | 3300005985 | Ga0081539_10000748 | Ga0081539_1000074855 | 301 |
| 189 | 3300005985 | Ga0081539_10076850 | Ga0081539_100768502 | 301 |
| 190 | 3300006028 | Ga0070717_10016495 | Ga0070717_100164954 | 301 |
| 191 | 3300006163 | Ga0070715_10001596 | Ga0070715_100015964 | 301 |
| 192 | 3300006173 | Ga0070716_100003246 | Ga0070716_1000032465 | 301 |
| 193 | 3300006175 | Ga0070712_100012263 | Ga0070712_1000122632 | 301 |
| 194 | 3300006177 | Ga0075362_10009885 | Ga0075362_100098852 | 301 |
| 195 | 3300006195 | Ga0075366_10002436 | Ga0075366_100024366 | 301 |
| 196 | 3300006195 | Ga0075366_10045747 | Ga0075366_100457473 | 301 |
| 197 | 3300006353 | Ga0075370_10033291 | Ga0075370_100332912 | 301 |
| 198 | 3300006358 | Ga0068871_100029013 | Ga0068871_1000290133 | 301 |
| 199 | 3300006358 | Ga0068871_100263221 | Ga0068871_1002632211 | 301 |
| 200 | 3300006844 | Ga0075428_100010461 | Ga0075428_1000104616 | 301 |
| 201 | 3300006844 | Ga0075428_100035390 | Ga0075428_1000353904 | 301 |
| 202 | 3300006844 | Ga0075428_100188845 | Ga0075428_1001888452 | 301 |
| 203 | 3300006846 | Ga0075430_100001888 | Ga0075430_1000018889 | 301 |
| 204 | 3300006846 | Ga0075430_100011647 | Ga0075430_1000116474 | 301 |
| 205 | 3300006846 | Ga0075430_100057775 | Ga0075430_1000577753 | 301 |
| 206 | 3300006847 | Ga0075431_100005130 | Ga0075431_10000513011 | 301 |
| 207 | 3300006847 | Ga0075431_100006116 | Ga0075431_1000061166 | 301 |
| 208 | 3300006847 | Ga0075431_100009127 | Ga0075431_1000091275 | 301 |
| 209 | 3300006852 | Ga0075433_10000801 | Ga0075433_1000080112 | 301 |
| 210 | 3300006852 | Ga0075433_10011067 | Ga0075433_100110676 | 301 |
| 211 | 3300006852 | Ga0075433_10032292 | Ga0075433_100322922 | 301 |
| 212 | 3300006852 | Ga0075433_10045435 | Ga0075433_100454354 | 301 |
| 213 | 3300006871 | Ga0075434_100046860 | Ga0075434_1000468602 | 301 |
| 214 | 3300006871 | Ga0075434_100050560 | Ga0075434_1000505604 | 301 |
| 215 | 3300006871 | Ga0075434_100087405 | Ga0075434_1000874052 | 301 |
| 216 | 3300006871 | Ga0075434_100424156 | Ga0075434_1004241562 | 301 |
| 217 | 3300006880 | Ga0075429_100022932 | Ga0075429_1000229323 | 301 |
| 218 | 3300006880 | Ga0075429_100027210 | Ga0075429_1000272103 | 301 |
| 219 | 3300006880 | Ga0075429_100086913 | Ga0075429_1000869131 | 301 |
| 220 | 3300006881 | Ga0068865_100015587 | Ga0068865_1000155871 | 301 |
| 221 | 3300006881 | Ga0068865_100030497 | Ga0068865_1000304972 | 301 |
| 222 | 3300006914 | Ga0075436_100206257 | Ga0075436_1002062572 | 301 |
| 223 | 3300006931 | Ga0097620_100032371 | Ga0097620_1000323714 | 301 |
| 224 | 3300006931 | Ga0097620_100166569 | Ga0097620_1001665692 | 301 |
| 225 | 3300006944 | Ga0099823_1000138 | Ga0099823_100013832 | 301 |
| 226 | 3300006946 | Ga0079104_1000724 | Ga0079104_10007243 | 301 |
| 227 | 3300007076 | Ga0075435_100018531 | Ga0075435_1000185316 | 301 |
| 228 | 3300007076 | Ga0075435_100022855 | Ga0075435_1000228552 | 301 |
| 229 | 3300007076 | Ga0075435_100037441 | Ga0075435_1000374412 | 301 |
| 230 | 3300007265 | Ga0099794_10017152 | Ga0099794_100171523 | 301 |
| 231 | 3300009093 | Ga0105240_10147690 | Ga0105240_101476904 | 301 |
| 232 | 3300009093 | Ga0105240_10373678 | Ga0105240_103736782 | 301 |
| 233 | 3300009094 | Ga0111539_10002454 | Ga0111539_1000245416 | 301 |
| 234 | 3300009094 | Ga0111539_10007541 | Ga0111539_100075418 | 301 |
| 235 | 3300009094 | Ga0111539_10025554 | Ga0111539_100255542 | 301 |
| 236 | 3300009094 | Ga0111539_10049394 | Ga0111539_100493943 | 301 |
| 237 | 3300009094 | Ga0111539_10072504 | Ga0111539_100725043 | 301 |
| 238 | 3300009094 | Ga0111539_10099831 | Ga0111539_100998312 | 301 |
| 239 | 3300009094 | Ga0111539_10100666 | Ga0111539_101006662 | 301 |
| 240 | 3300009094 | Ga0111539_10357549 | Ga0111539_103575492 | 301 |
| 241 | 3300009098 | Ga0105245_10118739 | Ga0105245_101187393 | 301 |
| 242 | 3300009101 | Ga0105247_10022846 | Ga0105247_100228462 | 301 |
| 243 | 3300009147 | Ga0114129_10008622 | Ga0114129_1000862211 | 301 |
| 244 | 3300009147 | Ga0114129_10031159 | Ga0114129_100311593 | 301 |
| 245 | 3300009147 | Ga0114129_10129102 | Ga0114129_101291024 | 301 |
| 246 | 3300009148 | Ga0105243_10004635 | Ga0105243_1000463510 | 301 |
| 247 | 3300009148 | Ga0105243_10043540 | Ga0105243_100435402 | 301 |
| 248 | 3300009174 | Ga0105241_10380060 | Ga0105241_103800601 | 301 |
| 249 | 3300009176 | Ga0105242_10004078 | Ga0105242_100040787 | 301 |
| 250 | 3300009177 | Ga0105248_10037611 | Ga0105248_100376113 | 301 |
| 251 | 3300009545 | Ga0105237_10011248 | Ga0105237_100112489 | 301 |
| 252 | 3300009551 | Ga0105238_10022610 | Ga0105238_100226102 | 301 |
| 253 | 3300009551 | Ga0105238_10082606 | Ga0105238_100826063 | 301 |
| 254 | 3300010375 | Ga0105239_10010532 | Ga0105239_100105326 | 301 |
| 255 | 3300011119 | Ga0105246_10011917 | Ga0105246_100119173 | 301 |
| 256 | 3300013102 | Ga0157371_10000013 | Ga0157371_10000013317 | 301 |
| 257 | 3300013296 | Ga0157374_10140135 | Ga0157374_101401352 | 301 |
| 258 | 3300013306 | Ga0163162_10051286 | Ga0163162_100512862 | 301 |
| 259 | 3300013307 | Ga0157372_10228433 | Ga0157372_102284332 | 301 |
| 260 | 3300013308 | Ga0157375_10134975 | Ga0157375_101349752 | 301 |
| 261 | 3300014326 | Ga0157380_10059007 | Ga0157380_100590072 | 301 |
| 262 | 3300014745 | Ga0157377_10012486 | Ga0157377_100124862 | 301 |
| 263 | 3300014968 | Ga0157379_10000207 | Ga0157379_1000020739 | 301 |
| 264 | 3300014968 | Ga0157379_10035730 | Ga0157379_100357302 | 301 |
| 265 | 3300014969 | Ga0157376_10039405 | Ga0157376_100394054 | 301 |
| 266 | 3300015261 | Ga0182006_1013759 | Ga0182006_10137594 | 301 |
| 267 | 3300015683 | Ga0183362_10002 | Ga0183362_10002610 | 301 |
| 268 | 3300017792 | Ga0163161_10023578 | Ga0163161_100235783 | 301 |
| 269 | 3300017792 | Ga0163161_10052190 | Ga0163161_100521903 | 301 |
| 270 | 3300021361 | Ga0213872_10000134 | Ga0213872_100001349 | 301 |
| 271 | 3300021384 | Ga0213876_10067866 | Ga0213876_100678663 | 301 |
| 272 | 3300025242 | Ga0209258_103215 | Ga0209258_1032153 | 301 |
| 273 | 3300025253 | Ga0209677_100280 | Ga0209677_1002809 | 301 |
| 274 | 3300025272 | Ga0209455_1001166 | Ga0209455_10011668 | 301 |
| 275 | 3300025272 | Ga0209455_1009352 | Ga0209455_10093522 | 301 |
| 276 | 3300025298 | Ga0209050_1005408 | Ga0209050_10054088 | 301 |
| 277 | 3300025299 | Ga0209256_1000840 | Ga0209256_100084026 | 301 |
| 278 | 3300025303 | Ga0209051_1004454 | Ga0209051_10044547 | 301 |
| 279 | 3300025304 | Ga0209257_1004031 | Ga0209257_10040318 | 301 |
| 280 | 3300025315 | Ga0207697_10002977 | Ga0207697_100029773 | 301 |
| 281 | 3300025321 | Ga0207656_10040913 | Ga0207656_100409133 | 301 |
| 282 | 3300025893 | Ga0207682_10007560 | Ga0207682_100075604 | 301 |
| 283 | 3300025893 | Ga0207682_10015707 | Ga0207682_100157072 | 301 |
| 284 | 3300025898 | Ga0207692_10000318 | Ga0207692_100003183 | 301 |
| 285 | 3300025899 | Ga0207642_10002274 | Ga0207642_100022744 | 301 |
| 286 | 3300025900 | Ga0207710_10011222 | Ga0207710_100112224 | 301 |
| 287 | 3300025901 | Ga0207688_10006362 | Ga0207688_100063625 | 301 |
| 288 | 3300025901 | Ga0207688_10009797 | Ga0207688_100097974 | 301 |
| 289 | 3300025901 | Ga0207688_10063844 | Ga0207688_100638442 | 301 |
| 290 | 3300025901 | Ga0207688_10096916 | Ga0207688_100969162 | 301 |
| 291 | 3300025904 | Ga0207647_10174612 | Ga0207647_101746122 | 301 |
| 292 | 3300025905 | Ga0207685_10003083 | Ga0207685_100030833 | 301 |
| 293 | 3300025907 | Ga0207645_10008417 | Ga0207645_100084173 | 301 |
| 294 | 3300025907 | Ga0207645_10012643 | Ga0207645_100126436 | 301 |
| 295 | 3300025907 | Ga0207645_10049304 | Ga0207645_100493042 | 301 |
| 296 | 3300025907 | Ga0207645_10088256 | Ga0207645_100882562 | 301 |
| 297 | 3300025908 | Ga0207643_10003472 | Ga0207643_100034725 | 301 |
| 298 | 3300025908 | Ga0207643_10007174 | Ga0207643_100071745 | 301 |
| 299 | 3300025908 | Ga0207643_10029841 | Ga0207643_100298412 | 301 |
| 300 | 3300025908 | Ga0207643_10069949 | Ga0207643_100699492 | 301 |
| 301 | 3300025914 | Ga0207671_10002832 | Ga0207671_1000283215 | 301 |
| 302 | 3300025914 | Ga0207671_10242215 | Ga0207671_102422152 | 301 |
| 303 | 3300025915 | Ga0207693_10003071 | Ga0207693_1000307110 | 301 |
| 304 | 3300025915 | Ga0207693_10003980 | Ga0207693_100039805 | 301 |
| 305 | 3300025916 | Ga0207663_10001512 | Ga0207663_1000151211 | 301 |
| 306 | 3300025917 | Ga0207660_10263302 | Ga0207660_102633021 | 301 |
| 307 | 3300025918 | Ga0207662_10152589 | Ga0207662_101525891 | 301 |
| 308 | 3300025918 | Ga0207662_10195283 | Ga0207662_101952831 | 301 |
| 309 | 3300025922 | Ga0207646_10113021 | Ga0207646_101130211 | 301 |
| 310 | 3300025923 | Ga0207681_10007252 | Ga0207681_100072524 | 301 |
| 311 | 3300025923 | Ga0207681_10162526 | Ga0207681_101625262 | 301 |
| 312 | 3300025924 | Ga0207694_10012688 | Ga0207694_100126881 | 301 |
| 313 | 3300025924 | Ga0207694_10022799 | Ga0207694_100227993 | 301 |
| 314 | 3300025924 | Ga0207694_10188764 | Ga0207694_101887642 | 301 |
| 315 | 3300025926 | Ga0207659_10017867 | Ga0207659_100178673 | 301 |
| 316 | 3300025926 | Ga0207659_10023808 | Ga0207659_100238082 | 301 |
| 317 | 3300025926 | Ga0207659_10028501 | Ga0207659_100285013 | 301 |
| 318 | 3300025926 | Ga0207659_10051984 | Ga0207659_100519842 | 301 |
| 319 | 3300025927 | Ga0207687_10149517 | Ga0207687_101495172 | 301 |
| 320 | 3300025929 | Ga0207664_10191918 | Ga0207664_101919182 | 301 |
| 321 | 3300025931 | Ga0207644_10015400 | Ga0207644_100154003 | 301 |
| 322 | 3300025931 | Ga0207644_10053989 | Ga0207644_100539892 | 301 |
| 323 | 3300025931 | Ga0207644_10310841 | Ga0207644_103108412 | 301 |
| 324 | 3300025933 | Ga0207706_10017818 | Ga0207706_100178184 | 301 |
| 325 | 3300025934 | Ga0207686_10004843 | Ga0207686_100048439 | 301 |
| 326 | 3300025935 | Ga0207709_10000172 | Ga0207709_1000017210 | 301 |
| 327 | 3300025935 | Ga0207709_10074108 | Ga0207709_100741082 | 301 |
| 328 | 3300025936 | Ga0207670_10074293 | Ga0207670_100742933 | 301 |
| 329 | 3300025937 | Ga0207669_10001682 | Ga0207669_100016825 | 301 |
| 330 | 3300025937 | Ga0207669_10010408 | Ga0207669_100104085 | 301 |
| 331 | 3300025938 | Ga0207704_10011309 | Ga0207704_100113092 | 301 |
| 332 | 3300025939 | Ga0207665_10008158 | Ga0207665_100081583 | 301 |
| 333 | 3300025940 | Ga0207691_10028712 | Ga0207691_100287125 | 301 |
| 334 | 3300025940 | Ga0207691_10038014 | Ga0207691_100380144 | 301 |
| 335 | 3300025940 | Ga0207691_10063199 | Ga0207691_100631992 | 301 |
| 336 | 3300025941 | Ga0207711_10278895 | Ga0207711_102788952 | 301 |
| 337 | 3300025942 | Ga0207689_10006281 | Ga0207689_100062813 | 301 |
| 338 | 3300025942 | Ga0207689_10032696 | Ga0207689_100326962 | 301 |
| 339 | 3300025942 | Ga0207689_10061790 | Ga0207689_100617903 | 301 |
| 340 | 3300025942 | Ga0207689_10167957 | Ga0207689_101679572 | 301 |
| 341 | 3300025944 | Ga0207661_10183457 | Ga0207661_101834571 | 301 |
| 342 | 3300025945 | Ga0207679_10022786 | Ga0207679_100227864 | 301 |
| 343 | 3300025945 | Ga0207679_10057924 | Ga0207679_100579243 | 301 |
| 344 | 3300025949 | Ga0207667_10058805 | Ga0207667_100588053 | 301 |
| 345 | 3300025949 | Ga0207667_10068267 | Ga0207667_100682673 | 301 |
| 346 | 3300025960 | Ga0207651_10015114 | Ga0207651_100151143 | 301 |
| 347 | 3300025960 | Ga0207651_10018013 | Ga0207651_100180132 | 301 |
| 348 | 3300025961 | Ga0207712_10088688 | Ga0207712_100886882 | 301 |
| 349 | 3300025972 | Ga0207668_10052464 | Ga0207668_100524642 | 301 |
| 350 | 3300025972 | Ga0207668_10078772 | Ga0207668_100787722 | 301 |
| 351 | 3300026023 | Ga0207677_10077706 | Ga0207677_100777063 | 301 |
| 352 | 3300026023 | Ga0207677_10103657 | Ga0207677_101036572 | 301 |
| 353 | 3300026035 | Ga0207703_10039908 | Ga0207703_100399082 | 301 |
| 354 | 3300026075 | Ga0207708_10012429 | Ga0207708_100124296 | 301 |
| 355 | 3300026075 | Ga0207708_10018035 | Ga0207708_100180353 | 301 |
| 356 | 3300026075 | Ga0207708_10311893 | Ga0207708_103118932 | 301 |
| 357 | 3300026078 | Ga0207702_10021218 | Ga0207702_100212185 | 301 |
| 358 | 3300026089 | Ga0207648_10000429 | Ga0207648_1000042936 | 301 |
| 359 | 3300026089 | Ga0207648_10023693 | Ga0207648_100236935 | 301 |
| 360 | 3300026089 | Ga0207648_10123942 | Ga0207648_101239423 | 301 |
| 361 | 3300026095 | Ga0207676_10075540 | Ga0207676_100755402 | 301 |
| 362 | 3300026095 | Ga0207676_10133597 | Ga0207676_101335972 | 301 |
| 363 | 3300026116 | Ga0207674_10067184 | Ga0207674_100671844 | 301 |
| 364 | 3300026118 | Ga0207675_100022127 | Ga0207675_1000221273 | 301 |
| 365 | 3300026118 | Ga0207675_100142047 | Ga0207675_1001420472 | 301 |
| 366 | 3300026118 | Ga0207675_100158338 | Ga0207675_1001583382 | 301 |
| 367 | 3300026118 | Ga0207675_100296051 | Ga0207675_1002960512 | 301 |
| 368 | 3300026121 | Ga0207683_10009916 | Ga0207683_100099166 | 301 |
| 369 | 3300026121 | Ga0207683_10029975 | Ga0207683_100299752 | 301 |
| 370 | 3300026121 | Ga0207683_10030376 | Ga0207683_100303763 | 301 |
| 371 | 3300026121 | Ga0207683_10035523 | Ga0207683_100355233 | 301 |
| 372 | 3300026121 | Ga0207683_10049653 | Ga0207683_100496531 | 301 |
| 373 | 3300026121 | Ga0207683_10102494 | Ga0207683_101024943 | 301 |
| 374 | 3300026121 | Ga0207683_10340193 | Ga0207683_103401931 | 301 |
| 375 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020498 | 301 |
| 376 | 3300027512 | Ga0209179_1007240 | Ga0209179_10072402 | 301 |
| 377 | 3300027671 | Ga0209588_1041323 | Ga0209588_10413232 | 301 |
| 378 | 3300027682 | Ga0209971_1003504 | Ga0209971_10035043 | 301 |
| 379 | 3300027876 | Ga0209974_10010132 | Ga0209974_100101322 | 301 |
| 380 | 3300027876 | Ga0209974_10032498 | Ga0209974_100324982 | 301 |
| 381 | 3300027907 | Ga0207428_10002055 | Ga0207428_100020559 | 301 |
| 382 | 3300027907 | Ga0207428_10007334 | Ga0207428_100073342 | 301 |
| 383 | 3300027907 | Ga0207428_10010695 | Ga0207428_100106956 | 301 |
| 384 | 3300027907 | Ga0207428_10015486 | Ga0207428_100154866 | 301 |
| 385 | 3300027907 | Ga0207428_10052578 | Ga0207428_100525782 | 301 |
| 386 | 3300027907 | Ga0207428_10186520 | Ga0207428_101865202 | 301 |
| 387 | 3300028379 | Ga0268266_10148552 | Ga0268266_101485522 | 301 |
| 388 | 3300028379 | Ga0268266_10316136 | Ga0268266_103161362 | 301 |
| 389 | 3300028380 | Ga0268265_10008126 | Ga0268265_100081261 | 301 |
| 390 | 3300028380 | Ga0268265_10405751 | Ga0268265_104057511 | 301 |
| 391 | 3300028380 | Ga0268265_10486324 | Ga0268265_104863241 | 301 |
| 392 | 3300028381 | Ga0268264_10024489 | Ga0268264_100244893 | 301 |
| 393 | 3300028556 | Ga0265337_1001439 | Ga0265337_10014397 | 301 |
| 394 | 3300028558 | Ga0265326_10001380 | Ga0265326_100013806 | 301 |
| 395 | 3300028563 | Ga0265319_1002798 | Ga0265319_10027986 | 301 |
| 396 | 3300028573 | Ga0265334_10005260 | Ga0265334_100052602 | 301 |
| 397 | 3300028577 | Ga0265318_10003474 | Ga0265318_100034744 | 301 |
| 398 | 3300028653 | Ga0265323_10000992 | Ga0265323_100009926 | 301 |
| 399 | 3300028666 | Ga0265336_10000063 | Ga0265336_1000006380 | 301 |
| 400 | 3300028794 | Ga0307515_10000292 | Ga0307515_100002926 | 301 |
| 401 | 3300028794 | Ga0307515_10000494 | Ga0307515_1000049442 | 301 |
| 402 | 3300028794 | Ga0307515_10039959 | Ga0307515_100399594 | 301 |
| 403 | 3300028800 | Ga0265338_10000154 | Ga0265338_1000015414 | 301 |
| 404 | 3300029957 | Ga0265324_10001590 | Ga0265324_100015908 | 301 |
| 405 | 3300030522 | Ga0307512_10037887 | Ga0307512_100378873 | 301 |
| 406 | 3300031240 | Ga0265320_10010219 | Ga0265320_100102191 | 301 |
| 407 | 3300031247 | Ga0265340_10005895 | Ga0265340_100058955 | 301 |
| 408 | 3300031249 | Ga0265339_10001335 | Ga0265339_100013355 | 301 |
| 409 | 3300031251 | Ga0265327_10005550 | Ga0265327_100055504 | 301 |
| 410 | 3300031456 | Ga0307513_10012018 | Ga0307513_100120182 | 301 |
| 411 | 3300031456 | Ga0307513_10012594 | Ga0307513_100125942 | 301 |
| 412 | 3300031456 | Ga0307513_10062057 | Ga0307513_100620573 | 301 |
| 413 | 3300031507 | Ga0307509_10024290 | Ga0307509_100242905 | 301 |
| 414 | 3300031507 | Ga0307509_10329973 | Ga0307509_103299732 | 301 |
| 415 | 3300031548 | Ga0307408_100000029 | Ga0307408_10000002984 | 301 |
| 416 | 3300031548 | Ga0307408_100015068 | Ga0307408_1000150683 | 301 |
| 417 | 3300031548 | Ga0307408_100086750 | Ga0307408_1000867502 | 301 |
| 418 | 3300031595 | Ga0265313_10004883 | Ga0265313_100048838 | 301 |
| 419 | 3300031616 | Ga0307508_10000096 | Ga0307508_1000009618 | 301 |
| 420 | 3300031616 | Ga0307508_10113029 | Ga0307508_101130293 | 301 |
| 421 | 3300031649 | Ga0307514_10001887 | Ga0307514_1000188719 | 301 |
| 422 | 3300031711 | Ga0265314_10027734 | Ga0265314_100277344 | 301 |
| 423 | 3300031711 | Ga0265314_10034777 | Ga0265314_100347775 | 301 |
| 424 | 3300031712 | Ga0265342_10023837 | Ga0265342_100238373 | 301 |
| 425 | 3300031712 | Ga0265342_10144661 | Ga0265342_101446612 | 301 |
| 426 | 3300031730 | Ga0307516_10001367 | Ga0307516_100013677 | 301 |
| 427 | 3300031730 | Ga0307516_10003526 | Ga0307516_1000352611 | 301 |
| 428 | 3300031730 | Ga0307516_10053532 | Ga0307516_100535323 | 301 |
| 429 | 3300031730 | Ga0307516_10140117 | Ga0307516_101401172 | 301 |
| 430 | 3300031731 | Ga0307405_10001234 | Ga0307405_100012348 | 301 |
| 431 | 3300031824 | Ga0307413_10002493 | Ga0307413_100024933 | 301 |
| 432 | 3300031824 | Ga0307413_10124258 | Ga0307413_101242582 | 301 |
| 433 | 3300031852 | Ga0307410_10010279 | Ga0307410_100102791 | 301 |
| 434 | 3300031901 | Ga0307406_10012325 | Ga0307406_100123254 | 301 |
| 435 | 3300031911 | Ga0307412_10004520 | Ga0307412_100045206 | 301 |
| 436 | 3300031911 | Ga0307412_10379705 | Ga0307412_103797051 | 301 |
| 437 | 3300031995 | Ga0307409_100005343 | Ga0307409_1000053432 | 301 |
| 438 | 3300032002 | Ga0307416_100005644 | Ga0307416_1000056442 | 301 |
| 439 | 3300032002 | Ga0307416_100475880 | Ga0307416_1004758801 | 301 |
| 440 | 3300032005 | Ga0307411_10003401 | Ga0307411_100034015 | 301 |
| 441 | 3300035083 | Ga0373926_0027932 | Ga0373926_0027932_715_1626 | 301 |
| 442 | 3300035089 | Ga0373944_0047809 | Ga0373944_0047809_67_981 | 301 |
| 443 | 3300035113 | Ga0373936_0001944 | Ga0373936_0001944_1167_2081 | 301 |
| 444 | 3300035117 | Ga0373953_0006315 | Ga0373953_0006315_2729_3655 | 301 |
| 445 | 3300035118 | Ga0373954_0075076 | Ga0373954_0075076_147_1073 | 301 |
| 446 | 3300035119 | Ga0373956_0171409 | Ga0373956_0171409_75_989 | 301 |
| 447 | 3300035171 | Ga0373946_0043886 | Ga0373946_0043886_332_1246 | 301 |
| 448 | 3300035241 | Ga0373961_0024428 | Ga0373961_0024428_268_1173 | 301 |
| 449 | 3300035695 | Ga0373927_0001069 | Ga0373927_0001069_14028_14942 | 301 |
| 450 | 3300035695 | Ga0373927_0010672 | Ga0373927_0010672_1288_2226 | 301 |
| 451 | 3300035725 | Ga0373947_0007770 | Ga0373947_0007770_4515_5429 | 301 |
| 452 | 3300036401 | Ga0373937_0037618 | Ga0373937_0037618_3260_4174 | 301 |
| 453 | 3300036401 | Ga0373937_0044534 | Ga0373937_0044534_998_1912 | 301 |
| 454 | 3300037068 | Ga0373925_0003237 | Ga0373925_0003237_2412_3326 | 301 |
| 455 | 3300037312 | Ga0395899_0219652 | Ga0395899_0219652_148_1071 | 301 |
| 456 | 3300037418 | Ga0395900_0016357 | Ga0395900_0016357_2665_3606 | 301 |
| 457 | 3300037466 | Ga0395898_0243873 | Ga0395898_0243873_356_1297 | 301 |
| 458 | 3300037471 | Ga0395905_0002341 | Ga0395905_0002341_859_1791 | 301 |
| 459 | 3300037471 | Ga0395905_0010810 | Ga0395905_0010810_6550_7491 | 301 |
| 460 | 3300037471 | Ga0395905_0034060 | Ga0395905_0034060_2922_3863 | 301 |
| 461 | 3300037471 | Ga0395905_0045282 | Ga0395905_0045282_2492_3439 | 301 |
| 462 | 3300037471 | Ga0395905_0060217 | Ga0395905_0060217_749_1663 | 301 |
| 463 | 3300038443 | Ga0395901_0118960 | Ga0395901_0118960_524_1447 | 301 |
| 464 | 3300038726 | Ga0400490_35285 | Ga0400490_35285_4269_5186 | 301 |
| 465 | 3300038727 | Ga0400491_04233 | Ga0400491_04233_696_1613 | 301 |
| 466 | 3300038741 | Ga0400488_34208 | Ga0400488_34208_1540_2454 | 301 |
| 467 | 3300039062 | Ga0400483_215880 | Ga0400483_215880_3254_4168 | 301 |
| 468 | 3300039110 | Ga0400487_20550 | Ga0400487_20550_572_1486 | 301 |
| 469 | 3300039110 | Ga0400487_34028 | Ga0400487_34028_15185_16099 | 301 |
| 470 | 3300039437 | Ga0436365_0151425 | Ga0436365_0151425_221_1135 | 301 |
| 471 | 3300039437 | Ga0436365_0476641 | Ga0436365_0476641_385_1308 | 301 |
| 472 | 3300039438 | Ga0436360_0109312 | Ga0436360_0109312_214_1152 | 301 |
| 473 | 3300039438 | Ga0436360_1087288 | Ga0436360_1087288_1281_2228 | 301 |
| 474 | 3300039438 | Ga0436360_1192691 | Ga0436360_1192691_1911_2849 | 301 |
| 475 | 3300039447 | Ga0436361_0193139 | Ga0436361_0193139_2898_3830 | 301 |
| 476 | 3300039447 | Ga0436361_0455065 | Ga0436361_0455065_13311_14243 | 301 |
| 477 | 3300039450 | Ga0436363_1505079 | Ga0436363_1505079_425_1369 | 301 |
| 478 | 3300039453 | Ga0436362_1236534 | Ga0436362_1236534_596_1534 | 301 |
| 479 | 3300041999 | Ga0439433_0018131 | Ga0439433_0018131_73_1011 | 301 |
| 480 | 3300042007 | Ga0439449_0005387 | Ga0439449_0005387_1925_2863 | 301 |
| 481 | 3300042008 | Ga0439450_009025 | Ga0439450_009025_101_1006 | 301 |
| 482 | 3300042115 | Ga0450911_001989 | Ga0450911_001989_1927_2859 | 301 |
| 483 | 3300042435 | Ga0439434_0060106 | Ga0439434_0060106_115_1035 | 301 |
| 484 | 3300042436 | Ga0439435_0024205 | Ga0439435_0024205_648_1556 | 301 |
| 485 | 3300042531 | Ga0450918_000016 | Ga0450918_000016_30160_31098 | 301 |
| 486 | 3300042532 | Ga0450893_0004350 | Ga0450893_0004350_1081_1995 | 301 |
| 487 | 3300042876 | Ga0451577_0000235 | Ga0451577_0000235_67639_68565 | 301 |
| 488 | 3300042876 | Ga0451577_0288313 | Ga0451577_0288313_500_1426 | 301 |
| 489 | 3300044656 | Ga0466969_0118683 | Ga0466969_0118683_38_955 | 301 |
| 490 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_14178_15110 | 301 |
| 491 | 3300044712 | Ga0453684_0000906 | Ga0453684_0000906_56764_57690 | 301 |
| 492 | 3300044712 | Ga0453684_0069104 | Ga0453684_0069104_1267_2181 | 301 |
| 493 | 3300044712 | Ga0453684_0422095 | Ga0453684_0422095_502_1428 | 301 |
| 494 | 3300045051 | Ga0451576_0015435 | Ga0451576_0015435_6397_7311 | 301 |
| 495 | 3300045051 | Ga0451576_0124675 | Ga0451576_0124675_859_1785 | 301 |
| 496 | 3300046454 | Ga0495592_0019534 | Ga0495592_0019534_3531_4445 | 301 |
| 497 | 3300046455 | Ga0495603_0000064 | Ga0495603_0000064_39583_40497 | 301 |
| 498 | 3300046455 | Ga0495603_0155368 | Ga0495603_0155368_23_955 | 301 |
| 499 | 3300046459 | Ga0495629_0001770 | Ga0495629_0001770_10148_11062 | 301 |
| 500 | 3300046459 | Ga0495629_0105467 | Ga0495629_0105467_927_1853 | 301 |
| 501 | 3300046460 | Ga0495638_0000710 | Ga0495638_0000710_1419_2360 | 301 |
| 502 | 3300046461 | Ga0495641_0004409 | Ga0495641_0004409_2215_3129 | 301 |
| 503 | 3300046462 | Ga0495651_0029648 | Ga0495651_0029648_1454_2380 | 301 |
| 504 | 3300046471 | Ga0495650_0001530 | Ga0495650_0001530_10140_11057 | 301 |
| 505 | 3300046472 | Ga0495580_0002618 | Ga0495580_0002618_10085_10999 | 301 |
| 506 | 3300046473 | Ga0495582_0000197 | Ga0495582_0000197_9673_10587 | 301 |
| 507 | 3300046475 | Ga0495639_0001620 | Ga0495639_0001620_5077_5991 | 301 |
| 508 | 3300046475 | Ga0495639_0035744 | Ga0495639_0035744_882_1799 | 301 |
| 509 | 3300046476 | Ga0495662_0012317 | Ga0495662_0012317_2322_3236 | 301 |
| 510 | 3300046477 | Ga0495664_0011941 | Ga0495664_0011941_1243_2157 | 301 |
| 511 | 3300046477 | Ga0495664_0036973 | Ga0495664_0036973_1923_2849 | 301 |
| 512 | 3300046491 | Ga0495584_0031775 | Ga0495584_0031775_1242_2210 | 301 |
| 513 | 3300046499 | Ga0495594_0004585 | Ga0495594_0004585_288_1202 | 301 |
| 514 | 3300046500 | Ga0495596_0000604 | Ga0495596_0000604_13892_14833 | 301 |
| 515 | 3300046500 | Ga0495596_0010570 | Ga0495596_0010570_1379_2347 | 301 |
| 516 | 3300046501 | Ga0495607_0041240 | Ga0495607_0041240_667_1608 | 301 |
| 517 | 3300046512 | Ga0495610_0044439 | Ga0495610_0044439_1031_1963 | 301 |
| 518 | 3300046514 | Ga0495618_0023879 | Ga0495618_0023879_2438_3352 | 301 |
| 519 | 3300046516 | Ga0495628_0049588 | Ga0495628_0049588_732_1658 | 301 |
| 520 | 3300046517 | Ga0495630_0005383 | Ga0495630_0005383_5209_6123 | 301 |
| 521 | 3300046519 | Ga0495632_0017507 | Ga0495632_0017507_2883_3824 | 301 |
| 522 | 3300046519 | Ga0495632_0024422 | Ga0495632_0024422_452_1384 | 301 |
| 523 | 3300046522 | Ga0495643_0003067 | Ga0495643_0003067_5787_6692 | 301 |
| 524 | 3300046522 | Ga0495643_0029686 | Ga0495643_0029686_1641_2582 | 301 |
| 525 | 3300046523 | Ga0495644_0017097 | Ga0495644_0017097_839_1780 | 301 |
| 526 | 3300046524 | Ga0495648_0000070 | Ga0495648_0000070_69147_70061 | 301 |
| 527 | 3300046528 | Ga0495642_0030338 | Ga0495642_0030338_931_1872 | 301 |
| 528 | 3300046529 | Ga0495652_0040068 | Ga0495652_0040068_1155_2069 | 301 |
| 529 | 3300046529 | Ga0495652_0061314 | Ga0495652_0061314_1667_2593 | 301 |
| 530 | 3300046531 | Ga0495665_0000902 | Ga0495665_0000902_6855_7769 | 301 |
| 531 | 3300046533 | Ga0495640_0001505 | Ga0495640_0001505_8038_8952 | 301 |
| 532 | 3300046538 | Ga0495609_0028193 | Ga0495609_0028193_1468_2409 | 301 |
| 533 | 3300046539 | Ga0495621_0096422 | Ga0495621_0096422_26_949 | 301 |
| 534 | 3300046542 | Ga0495597_0003270 | Ga0495597_0003270_496_1437 | 301 |
| 535 | 3300046557 | Ga0495622_0001436 | Ga0495622_0001436_2085_2999 | 301 |
| 536 | 3300046615 | Ga0495656_0015604 | Ga0495656_0015604_965_1933 | 301 |
| 537 | 3300046615 | Ga0495656_0173623 | Ga0495656_0173623_67_972 | 301 |
| 538 | 3300046616 | Ga0495668_0000018 | Ga0495668_0000018_173289_174227 | 301 |
| 539 | 3300046616 | Ga0495668_0001435 | Ga0495668_0001435_5930_6844 | 301 |
| 540 | 3300046648 | Ga0495611_0006888 | Ga0495611_0006888_2086_3027 | 301 |
| 541 | 3300046660 | Ga0495625_0042913 | Ga0495625_0042913_1569_2510 | 301 |
| 542 | 3300046663 | Ga0495635_0000356 | Ga0495635_0000356_8467_9381 | 301 |
| 543 | 3300046665 | Ga0495661_0053208 | Ga0495661_0053208_444_1385 | 301 |
| 544 | 3300046674 | Ga0495588_0000619 | Ga0495588_0000619_10567_11481 | 301 |
| 545 | 3300046678 | Ga0495599_0015026 | Ga0495599_0015026_2049_2975 | 301 |
| 546 | 3300046679 | Ga0495623_0089260 | Ga0495623_0089260_38_970 | 301 |
| 547 | 3300046681 | Ga0495647_0022565 | Ga0495647_0022565_494_1408 | 301 |
| 548 | 3300046683 | Ga0495658_0003461 | Ga0495658_0003461_5173_6087 | 301 |
| 549 | 3300046689 | Ga0495613_0004786 | Ga0495613_0004786_3228_4142 | 301 |
| 550 | 3300046689 | Ga0495613_0050119 | Ga0495613_0050119_1136_2062 | 301 |
| 551 | 3300046690 | Ga0495624_0001264 | Ga0495624_0001264_6501_7415 | 301 |
| 552 | 3300046691 | Ga0495670_0012551 | Ga0495670_0012551_789_1745 | 301 |
| 553 | 3300046691 | Ga0495670_0056496 | Ga0495670_0056496_426_1340 | 301 |
| 554 | 3300046794 | Ga0495589_0037901 | Ga0495589_0037901_404_1345 | 301 |
| 555 | 3300046810 | Ga0495660_0025343 | Ga0495660_0025343_250_1164 | 301 |
| 556 | 3300047315 | Ga0495581_0002800 | Ga0495581_0002800_6482_7396 | 301 |
| 557 | 3300047317 | Ga0495604_0091766 | Ga0495604_0091766_84_1010 | 301 |
| 558 | 3300047319 | Ga0495674_0069526 | Ga0495674_0069526_1888_2814 | 301 |
| 559 | 3300047322 | Ga0495680_0016989 | Ga0495680_0016989_5078_6004 | 301 |
| 560 | 3300047447 | Ga0495685_022972 | Ga0495685_022972_270_1211 | 301 |
| 561 | 3300047673 | Ga0495593_0000053 | Ga0495593_0000053_39453_40367 | 301 |
| 562 | 3300048088 | Ga0495602_0171272 | Ga0495602_0171272_309_1241 | 301 |
| 563 | 3300048088 | Ga0495602_0195990 | Ga0495602_0195990_432_1427 | 301 |
| 564 | 3300048089 | Ga0495614_0035545 | Ga0495614_0035545_555_1469 | 301 |
| 565 | 3300048091 | Ga0495626_0000868 | Ga0495626_0000868_20158_21078 | 301 |
| 566 | 3300048091 | Ga0495626_0020961 | Ga0495626_0020961_1401_2342 | 301 |
| 567 | 3300048904 | Ga0496101_0004586 | Ga0496101_0004586_4548_5474 | 301 |
| 568 | 3300048905 | Ga0496102_0007305 | Ga0496102_0007305_6889_7815 | 301 |
| 569 | 3300048907 | Ga0496104_0163229 | Ga0496104_0163229_12_950 | 301 |
| 570 | 3300048907 | Ga0496104_0167719 | Ga0496104_0167719_532_1449 | 301 |
| 571 | 3300048907 | Ga0496104_0184256 | Ga0496104_0184256_710_1672 | 301 |
| 572 | 3300048908 | Ga0496105_0000572 | Ga0496105_0000572_8050_8988 | 301 |
| 573 | 3300048908 | Ga0496105_0022207 | Ga0496105_0022207_4054_4980 | 301 |
| 574 | 3300048908 | Ga0496105_0066814 | Ga0496105_0066814_1396_2313 | 301 |
| 575 | 3300048909 | Ga0496106_0420367 | Ga0496106_0420367_37_954 | 301 |
| 576 | 3300048910 | Ga0496107_0000808 | Ga0496107_0000808_4535_5461 | 301 |
| 577 | 3300048910 | Ga0496107_0211643 | Ga0496107_0211643_283_1200 | 301 |
| 578 | 3300048918 | Ga0496115_0059959 | Ga0496115_0059959_1980_2942 | 301 |
| 579 | 3300048924 | Ga0496121_0057214 | Ga0496121_0057214_779_1702 | 301 |
| 580 | 3300048927 | Ga0496124_0106707 | Ga0496124_0106707_160_1074 | 301 |
| 581 | 3300048928 | Ga0496125_0038093 | Ga0496125_0038093_1817_2749 | 301 |
| 582 | 3300048928 | Ga0496125_0087591 | Ga0496125_0087591_858_1775 | 301 |
| 583 | 3300048929 | Ga0496126_0284820 | Ga0496126_0284820_397_1311 | 301 |
| 584 | 3300048929 | Ga0496126_0310800 | Ga0496126_0310800_189_1103 | 301 |
| 585 | 3300049459 | Ga0495678_003261 | Ga0495678_003261_8673_9587 | 301 |
| 586 | 3300049460 | Ga0495682_0019068 | Ga0495682_0019068_1040_1981 | 301 |
| 587 | 3300049568 | Ga0501031_0001824 | Ga0501031_0001824_5272_6189 | 301 |
| 588 | 3300049571 | Ga0501034_0186886 | Ga0501034_0186886_1025_1942 | 301 |
| 589 | 3300049583 | Ga0501067_0023296 | Ga0501067_0023296_740_1672 | 301 |
| 590 | 3300049583 | Ga0501067_0028047 | Ga0501067_0028047_346_1263 | 301 |
| 591 | 3300049649 | Ga0501198_000037 | Ga0501198_000037_50165_51097 | 301 |
| 592 | 3300049662 | Ga0501222_000032 | Ga0501222_000032_12936_13868 | 301 |
| 593 | 3300049688 | Ga0501259_017361 | Ga0501259_017361_138_1043 | 301 |
| 594 | 3300050493 | nmdc:mga0k408_23715_c1 | nmdc:mga0k408_23715_c1_65_973 | 301 |
| 595 | 3300050496 | nmdc:mga07m45_5721_c1 | nmdc:mga07m45_5721_c1_3441_4358 | 301 |
| 596 | 3300050507 | nmdc:mga05p37_180532_c1 | nmdc:mga05p37_180532_c1_469_1374 | 301 |
| 597 | 3300050507 | nmdc:mga05p37_19865_c1 | nmdc:mga05p37_19865_c1_124_1029 | 301 |
| 598 | 3300050507 | nmdc:mga05p37_208757_c1 | nmdc:mga05p37_208757_c1_141_1046 | 301 |
| 599 | 3300050507 | nmdc:mga05p37_52613_c1 | nmdc:mga05p37_52613_c1_2352_3266 | 301 |
| 600 | 3300050508 | nmdc:mga09592_11616_c1 | nmdc:mga09592_11616_c1_6059_6967 | 301 |
| 601 | 3300050508 | nmdc:mga09592_190386_c1 | nmdc:mga09592_190386_c1_462_1367 | 301 |
| 602 | 3300050508 | nmdc:mga09592_23749_c1 | nmdc:mga09592_23749_c1_1808_2716 | 301 |
| 603 | 3300050509 | nmdc:mga0qj67_1010_c1 | nmdc:mga0qj67_1010_c1_16093_17001 | 301 |
| 604 | 3300050509 | nmdc:mga0qj67_112735_c1 | nmdc:mga0qj67_112735_c1_240_1145 | 301 |
| 605 | 3300050510 | nmdc:mga06r32_3055_c1 | nmdc:mga06r32_3055_c1_11550_12458 | 301 |
| 606 | 3300050510 | nmdc:mga06r32_36396_c1 | nmdc:mga06r32_36396_c1_3327_4235 | 301 |
| 607 | 3300050510 | nmdc:mga06r32_78341_c1 | nmdc:mga06r32_78341_c1_461_1366 | 301 |
| 608 | 3300050511 | nmdc:mga08y16_148858_c1 | nmdc:mga08y16_148858_c1_519_1424 | 301 |
| 609 | 3300050511 | nmdc:mga08y16_1998_c1 | nmdc:mga08y16_1998_c1_5131_6039 | 301 |
| 610 | 3300050511 | nmdc:mga08y16_23677_c1 | nmdc:mga08y16_23677_c1_3651_4556 | 301 |
| 611 | 3300050511 | nmdc:mga08y16_5088_c1 | nmdc:mga08y16_5088_c1_5355_6263 | 301 |
| 612 | 3300050511 | nmdc:mga08y16_51502_c1 | nmdc:mga08y16_51502_c1_1876_2781 | 301 |
| 613 | 3300050511 | nmdc:mga08y16_547333_c1 | nmdc:mga08y16_547333_c1_70_975 | 301 |
| 614 | 3300050511 | nmdc:mga08y16_5509_c1 | nmdc:mga08y16_5509_c1_2467_3372 | 301 |
| 615 | 3300050511 | nmdc:mga08y16_596848_c1 | nmdc:mga08y16_596848_c1_196_1101 | 301 |
| 616 | 3300050512 | nmdc:mga0n895_2763_c1 | nmdc:mga0n895_2763_c1_1684_2589 | 301 |
| 617 | 3300050512 | nmdc:mga0n895_3027_c1 | nmdc:mga0n895_3027_c1_625_1530 | 301 |
| 618 | 3300050512 | nmdc:mga0n895_38591_c1 | nmdc:mga0n895_38591_c1_3693_4598 | 301 |
| 619 | 3300050512 | nmdc:mga0n895_412338_c1 | nmdc:mga0n895_412338_c1_131_1045 | 301 |
| 620 | 3300050512 | nmdc:mga0n895_67403_c1 | nmdc:mga0n895_67403_c1_1052_1987 | 301 |
| 621 | 3300050513 | nmdc:mga0rr50_142109_c1 | nmdc:mga0rr50_142109_c1_376_1290 | 301 |
| 622 | 3300050513 | nmdc:mga0rr50_231643_c1 | nmdc:mga0rr50_231643_c1_123_1040 | 301 |
| 623 | 3300050513 | nmdc:mga0rr50_43386_c1 | nmdc:mga0rr50_43386_c1_1767_2672 | 301 |
| 624 | 3300050515 | nmdc:mga0a205_1255_c1 | nmdc:mga0a205_1255_c1_16913_17818 | 301 |
| 625 | 3300050515 | nmdc:mga0a205_3105_c1 | nmdc:mga0a205_3105_c1_1303_2208 | 301 |
| 626 | 3300050515 | nmdc:mga0a205_447_c1 | nmdc:mga0a205_447_c1_29351_30256 | 301 |
| 627 | 3300050515 | nmdc:mga0a205_85247_c1 | nmdc:mga0a205_85247_c1_1591_2505 | 301 |
| 628 | 3300053083 | Ga0495655_0004612 | Ga0495655_0004612_1258_2172 | 301 |
| 629 | 3300053117 | Ga0500593_000250 | Ga0500593_000250_12307_13224 | 301 |
| 630 | 3300054114 | Ga0501084_0291317 | Ga0501084_0291317_161_1066 | 301 |
| 631 | 3300059423 | Ga0590074_015400 | Ga0590074_015400_329_1270 | 301 |
| 632 | iso_pu_bacteria | 2842718218 | 2842719400 | 301 |
| 633 | iso_pu_bacteria | 2904690495 | 2904695482 | 301 |
| 634 | iso_pu_bacteria | 2908756301 | 2908757472 | 301 |
| 635 | iso_pu_bacteria | 2919704043 | 2919705025 | 301 |
| 636 | iso_pu_bacteria | 2928115317 | 2928117047 | 301 |
| 637 | iso_pu_bacteria | 8006926726 | 8006930744 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dia-assembly1.cif.gz_A | crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 | 0.9654 | 9 | 298 |
| 4di9-assembly1.cif.gz_A | crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 | 0.961 | 5 | 298 |
| 4d8l-assembly1.cif.gz_A | crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis | 0.9604 | 10 | 298 |
| 4di9-assembly1.cif.gz_A | crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 | 0.929 | 5 | 298 |
| 4dia-assembly1.cif.gz_A | crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 | 0.929 | 9 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4d95A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9613 | 5 | 298 | 3.20.20.140 |
| 4d95A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9261 | 5 | 298 | 3.20.20.140 |
| 4mupC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.857 | 18 | 299 | 3.20.20.140 |
| 4mupC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8455 | 18 | 299 | 3.20.20.140 |
| 2ffiA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8454 | 23 | 298 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833FUB3-F1-model_v4 | Amidohydrolase family protein | 0.9974 | 115 | 298 |
GO:0016787
|
| AF-A0A4Q3N7X8-F1-model_v4 | deleted | 0.9968 | 140 | 298 |
|
| AF-A0A2R7NPL9-F1-model_v4 | 2-pyrone-4,6-dicarboxylate hydrolase | 0.9964 | 78 | 298 |
GO:0016787
|
| AF-Q13CG7-F1-model_v4 | Amidohydrolase 2 | 0.9961 | 1 | 298 |
GO:0016787
|
| AF-A0A519I5F2-F1-model_v4 | 2-pyrone-4,6-dicarboxylate hydrolase | 0.995 | 193 | 298 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar