F471400

General Info

Members Datasets Scaffolds Average Seq Length
637 374 621 304

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10085284|rootH1_100852842
Length 273
Sequence MTAFAKTPGWLDWCGQPSKPRFELPPHAVDAHCHVFGPGHQFPYAPERKYTPCDASKAQLFALRDHLGFARNVIVQATCHGADNRAMVDACRESGGRARGVATVKRAVTDAEAARVFAFGWHVVLYFEAQDLPELWDTMAALPNIVVIDHLGRPDVSQPVDGPAFSLFLRLLREHPNVWTKVSCPERLSVSGPPAIDGERAPYQDVVPFARLVVESFPDRVLWGTDWPHPNLKGHMPDDGLLVDFIPHLAPTPELQQKLLVANPRRLYWPEET

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
6 2721755523 Delftia sp. HK171 Isolate Unclassified
7 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
8 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
9 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
10 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
11 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
12 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
13 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
14 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
15 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
190 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
254 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
255 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
256 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
257 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
264 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
265 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
266 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
267 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
268 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
269 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
270 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
271 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
355 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
356 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
357 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
358 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
369 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
370 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 0
Isolates 2.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0.78
Rhizoplane 2.04
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1005088 3300002076 Bacteria 1844
2 JGI25406J46586_10000721 3300003203 Bacteria 15439
3 JGI25406J46586_10004727 3300003203 Bacteria 6337
4 JGI25406J46586_10019628 3300003203 Bacteria 2749
5 JGI25406J46586_10020738 3300003203 Bacteria 2651
6 rootH2_10247225 3300003320 Bacteria 2227
7 rootL2_10017603 3300003322 Bacteria 18297
8 rootH1_10085284 3300003323 Bacteria 2993
9 Ga0055531_10008251 3300003794 Bacteria 5538
10 Ga0065712_10078880 3300005290 Bacteria 3287
11 Ga0065707_10092192 3300005295 Bacteria 3810
12 Ga0070676_10003564 3300005328 Bacteria 8141
13 Ga0070676_10008828 3300005328 Bacteria 5442
14 Ga0070676_10050389 3300005328 Bacteria 2441
15 Ga0070690_100001736 3300005330 Bacteria 11511
16 Ga0070690_100023070 3300005330 Bacteria 3813
17 Ga0070670_100072240 3300005331 Bacteria 2963
18 Ga0070670_100106230 3300005331 Bacteria 2419
19 Ga0070677_10001442 3300005333 Bacteria 7540
20 Ga0070677_10015588 3300005333 Bacteria 2693
21 Ga0068869_100001494 3300005334 Bacteria 13854
22 Ga0068869_100023320 3300005334 Bacteria 4272
23 Ga0068869_100111702 3300005334 Bacteria 2080
24 Ga0068869_100153986 3300005334 Bacteria 1785
25 Ga0070666_10198159 3300005335 Bacteria 1412
26 Ga0070680_100079923 3300005336 Bacteria 2696
27 Ga0070682_100000252 3300005337 Bacteria 38842
28 Ga0068868_100082908 3300005338 Bacteria 2573
29 Ga0070689_100055212 3300005340 Bacteria 3077
30 Ga0070668_100037286 3300005347 Bacteria 3712
31 Ga0070668_100114143 3300005347 Bacteria 2152
32 Ga0070669_100014516 3300005353 Bacteria 5603
33 Ga0070669_100029077 3300005353 Bacteria 3982
34 Ga0070669_100069805 3300005353 Bacteria 2595
35 Ga0070669_100311232 3300005353 Bacteria 1269
36 Ga0070675_100006367 3300005354 Bacteria 9066
37 Ga0070675_100022719 3300005354 Bacteria 5011
38 Ga0070675_100028795 3300005354 Bacteria 4474
39 Ga0070675_100032453 3300005354 Bacteria 4227
40 Ga0070675_100102569 3300005354 Bacteria 2411
41 Ga0070675_100232826 3300005354 Bacteria 1607
42 Ga0070671_100003098 3300005355 Bacteria 12944
43 Ga0070671_100058005 3300005355 Bacteria 3223
44 Ga0070671_100285572 3300005355 Bacteria 1404
45 Ga0070674_100002446 3300005356 Bacteria 10278
46 Ga0070674_100419066 3300005356 Bacteria 1098
47 Ga0070673_100013595 3300005364 Bacteria 5639
48 Ga0070673_100047176 3300005364 Bacteria 3350
49 Ga0070673_100064065 3300005364 Bacteria 2927
50 Ga0070673_100216214 3300005364 Bacteria 1657
51 Ga0070688_100401963 3300005365 Bacteria 1014
52 Ga0070659_100115927 3300005366 Bacteria 2165
53 Ga0070667_100022678 3300005367 Bacteria 5205
54 Ga0070667_100384703 3300005367 Bacteria 1275
55 Ga0070709_10002985 3300005434 Bacteria 9106
56 Ga0070714_100013754 3300005435 Bacteria 6490
57 Ga0070714_100143267 3300005435 Bacteria 2147
58 Ga0070710_10005127 3300005437 Bacteria 6199
59 Ga0070701_10163816 3300005438 Bacteria 1290
60 Ga0070711_100008828 3300005439 Bacteria 6185
61 Ga0070700_100001670 3300005441 Bacteria 11111
62 Ga0070700_100316577 3300005441 Bacteria 1145
63 Ga0070663_100292284 3300005455 Bacteria 1302
64 Ga0070678_100005422 3300005456 Bacteria 7367
65 Ga0070678_100093766 3300005456 Bacteria 2309
66 Ga0070678_100229592 3300005456 Bacteria 1546
67 Ga0070662_100008793 3300005457 Bacteria 6587
68 Ga0068867_100006363 3300005459 Bacteria 8348
69 Ga0068867_100011208 3300005459 Bacteria 6324
70 Ga0068867_100060453 3300005459 Bacteria 2811
71 Ga0068867_100072962 3300005459 Bacteria 2570
72 Ga0068867_100142478 3300005459 Bacteria 1875
73 Ga0070685_10074933 3300005466 Bacteria 2015
74 Ga0070706_100139518 3300005467 Bacteria 2263
75 Ga0070706_100315058 3300005467 Bacteria 1459
76 Ga0070707_100108691 3300005468 Bacteria 2690
77 Ga0070698_100248102 3300005471 Bacteria 1713
78 Ga0070699_100011663 3300005518 Bacteria 7587
79 Ga0068853_100387645 3300005539 Bacteria 1306
80 Ga0070672_100026250 3300005543 Bacteria 4331
81 Ga0070672_100041640 3300005543 Bacteria 3532
82 Ga0070672_100055765 3300005543 Bacteria 3096
83 Ga0070672_100094115 3300005543 Bacteria 2422
84 Ga0070672_100133926 3300005543 Bacteria 2039
85 Ga0070686_100020402 3300005544 Bacteria 3920
86 Ga0070665_100050187 3300005548 Bacteria 4187
87 Ga0070665_100074498 3300005548 Bacteria 3401
88 Ga0070704_100036796 3300005549 Bacteria 3338
89 Ga0070704_100041535 3300005549 Bacteria 3175
90 Ga0068855_100101520 3300005563 Bacteria 3312
91 Ga0070664_100028196 3300005564 Bacteria 4670
92 Ga0070664_100088159 3300005564 Bacteria 2683
93 Ga0068857_100143182 3300005577 Bacteria 2162
94 Ga0068856_100156024 3300005614 Bacteria 2293
95 Ga0068852_100007943 3300005616 Bacteria 7776
96 Ga0068859_100032369 3300005617 Bacteria 5253
97 Ga0068864_100044342 3300005618 Bacteria 3811
98 Ga0068864_100376880 3300005618 Bacteria 1344
99 Ga0068861_100024692 3300005719 Bacteria 4349
100 Ga0068861_100215269 3300005719 Bacteria 1621
101 Ga0068851_10081246 3300005834 Bacteria 1693
102 Ga0068870_10007969 3300005840 Bacteria 4743
103 Ga0068870_10164894 3300005840 Bacteria 1317
104 Ga0068863_100011364 3300005841 Bacteria 8621
105 Ga0068863_100491331 3300005841 Bacteria 1208
106 Ga0068858_100201132 3300005842 Bacteria 1884
107 Ga0068858_100260154 3300005842 Bacteria 1649
108 Ga0068860_100046850 3300005843 Bacteria 4121
109 Ga0068862_100004814 3300005844 Bacteria 11365
110 Ga0068862_100022389 3300005844 Bacteria 5286
111 Ga0068862_100261277 3300005844 Bacteria 1580
112 Ga0081455_10008730 3300005937 Bacteria 10495
113 Ga0081455_10012116 3300005937 Bacteria 8619
114 Ga0081455_10027965 3300005937 Bacteria 5158
115 Ga0081455_10182845 3300005937 Bacteria 1585
116 Ga0081540_1003649 3300005983 Bacteria 12076
117 Ga0081540_1008233 3300005983 Bacteria 7307
118 Ga0081540_1030795 3300005983 Bacteria 2965
119 Ga0081540_1057475 3300005983 Bacteria 1881
120 Ga0081539_10000133 3300005985 Bacteria 173855
121 Ga0081539_10000220 3300005985 Bacteria 133834
122 Ga0081539_10000329 3300005985 Bacteria 105307
123 Ga0081539_10000748 3300005985 Bacteria 64594
124 Ga0081539_10076850 3300005985 Bacteria 1768
125 Ga0070717_10016495 3300006028 Bacteria 5727
126 Ga0070715_10001596 3300006163 Bacteria 6680
127 Ga0070716_100003246 3300006173 Bacteria 7637
128 Ga0070712_100012263 3300006175 Bacteria 5448
129 Ga0075362_10009885 3300006177 Bacteria 3705
130 Ga0075366_10002436 3300006195 Bacteria 9534
131 Ga0075366_10045747 3300006195 Bacteria 2593
132 Ga0075370_10033291 3300006353 Bacteria 2885
133 Ga0068871_100029013 3300006358 Bacteria 4343
134 Ga0068871_100255259 3300006358 Bacteria 1528
135 Ga0068871_100263221 3300006358 Bacteria 1505
136 Ga0075428_100010461 3300006844 Bacteria 10306
137 Ga0075428_100035390 3300006844 Bacteria 5505
138 Ga0075428_100042766 3300006844 Bacteria 4981
139 Ga0075428_100188845 3300006844 Bacteria 2229
140 Ga0075430_100001888 3300006846 Bacteria 17166
141 Ga0075430_100011647 3300006846 Bacteria 7482
142 Ga0075430_100057775 3300006846 Bacteria 3262
143 Ga0075431_100005130 3300006847 Bacteria 12882
144 Ga0075431_100006116 3300006847 Bacteria 11940
145 Ga0075431_100009127 3300006847 Bacteria 9944
146 Ga0075433_10000801 3300006852 Bacteria 21822
147 Ga0075433_10011067 3300006852 Bacteria 7255
148 Ga0075433_10032292 3300006852 Bacteria 4484
149 Ga0075433_10045435 3300006852 Bacteria 3818
150 Ga0075434_100046860 3300006871 Bacteria 4289
151 Ga0075434_100050560 3300006871 Bacteria 4130
152 Ga0075434_100087405 3300006871 Bacteria 3118
153 Ga0075434_100424156 3300006871 Bacteria 1351
154 Ga0075429_100022932 3300006880 Bacteria 5412
155 Ga0075429_100027210 3300006880 Bacteria 4963
156 Ga0075429_100086913 3300006880 Bacteria 2725
157 Ga0068865_100015587 3300006881 Bacteria 4849
158 Ga0068865_100030497 3300006881 Bacteria 3587
159 Ga0075436_100206257 3300006914 Bacteria 1393
160 Ga0097620_100032371 3300006931 Bacteria 5253
161 Ga0097620_100166569 3300006931 Bacteria 2284
162 Ga0099823_1000138 3300006944 Bacteria 37983
163 Ga0079104_1000724 3300006946 Bacteria 29488
164 Ga0075435_100018531 3300007076 Bacteria 5298
165 Ga0075435_100022855 3300007076 Bacteria 4828
166 Ga0075435_100037441 3300007076 Bacteria 3863
167 Ga0099794_10017152 3300007265 Bacteria 3223
168 Ga0099795_10077249 3300007788 Bacteria 1268
169 Ga0105250_10000186 3300009092 Bacteria 53643
170 Ga0105240_10147690 3300009093 Bacteria 2803
171 Ga0105240_10373678 3300009093 Bacteria 1611
172 Ga0111539_10002454 3300009094 Bacteria 24635
173 Ga0111539_10007541 3300009094 Bacteria 13914
174 Ga0111539_10025554 3300009094 Bacteria 7240
175 Ga0111539_10049394 3300009094 Bacteria 5017
176 Ga0111539_10072504 3300009094 Bacteria 4061
177 Ga0111539_10099831 3300009094 Bacteria 3408
178 Ga0111539_10100666 3300009094 Bacteria 3393
179 Ga0111539_10357549 3300009094 Bacteria 1699
180 Ga0105245_10118739 3300009098 Bacteria 2468
181 Ga0105247_10022846 3300009101 Bacteria 3768
182 Ga0114129_10008622 3300009147 Bacteria 14537
183 Ga0114129_10031159 3300009147 Bacteria 7542
184 Ga0114129_10129102 3300009147 Bacteria 3474
185 Ga0105243_10004635 3300009148 Bacteria 10832
186 Ga0105243_10043540 3300009148 Bacteria 3518
187 Ga0105241_10380060 3300009174 Bacteria 1234
188 Ga0105242_10004078 3300009176 Bacteria 11354
189 Ga0105248_10037611 3300009177 Bacteria 5415
190 Ga0105237_10011248 3300009545 Bacteria 9471
191 Ga0105238_10022610 3300009551 Bacteria 6408
192 Ga0105238_10082606 3300009551 Bacteria 3202
193 Ga0105239_10010532 3300010375 Bacteria 10337
194 Ga0105246_10011917 3300011119 Bacteria 5410
195 Ga0157371_10000013 3300013102 Bacteria 352631
196 Ga0157374_10140135 3300013296 Bacteria 2347
197 Ga0163162_10051286 3300013306 Bacteria 4140
198 Ga0157372_10228433 3300013307 Bacteria 2157
199 Ga0157375_10134975 3300013308 Bacteria 2590
200 Ga0163163_10139391 3300014325 Bacteria 2467
201 Ga0157380_10059007 3300014326 Bacteria 3061
202 Ga0157377_10012486 3300014745 Bacteria 4273
203 Ga0157379_10000207 3300014968 Bacteria 45489
204 Ga0157379_10035730 3300014968 Bacteria 4430
205 Ga0157376_10039405 3300014969 Bacteria 3853
206 Ga0182006_1013759 3300015261 Bacteria 3500
207 Ga0182007_10000236 3300015262 Bacteria 37233
208 Ga0182005_1000110 3300015265 Bacteria 58820
209 Ga0183362_10002 3300015683 Bacteria 1432711
210 Ga0163161_10023578 3300017792 Bacteria 4342
211 Ga0163161_10052190 3300017792 Bacteria 2964
212 Ga0213872_10000001 3300021361 Bacteria 662532
213 Ga0213872_10000134 3300021361 Bacteria 67449
214 Ga0213876_10067866 3300021384 Bacteria 1884
215 Ga0209258_103215 3300025242 Bacteria 3649
216 Ga0209677_100280 3300025253 Bacteria 34034
217 Ga0209455_1001166 3300025272 Bacteria 12650
218 Ga0209455_1009352 3300025272 Bacteria 2583
219 Ga0209050_1005408 3300025298 Bacteria 8053
220 Ga0209256_1000840 3300025299 Bacteria 38531
221 Ga0209051_1004454 3300025303 Bacteria 8621
222 Ga0209257_1004031 3300025304 Bacteria 11813
223 Ga0207697_10002977 3300025315 Bacteria 8550
224 Ga0207656_10040913 3300025321 Bacteria 1967
225 Ga0207696_1000072 3300025711 Bacteria 224214
226 Ga0207682_10007560 3300025893 Bacteria 4326
227 Ga0207682_10015707 3300025893 Bacteria 2949
228 Ga0207692_10000318 3300025898 Bacteria 16715
229 Ga0207642_10002274 3300025899 Bacteria 5979
230 Ga0207710_10011222 3300025900 Bacteria 3773
231 Ga0207688_10006362 3300025901 Bacteria 6431
232 Ga0207688_10009797 3300025901 Bacteria 5215
233 Ga0207688_10063844 3300025901 Bacteria 2077
234 Ga0207688_10096916 3300025901 Bacteria 1699
235 Ga0207647_10174612 3300025904 Bacteria 1250
236 Ga0207685_10003083 3300025905 Bacteria 3977
237 Ga0207645_10008417 3300025907 Bacteria 7196
238 Ga0207645_10012643 3300025907 Bacteria 5721
239 Ga0207645_10049304 3300025907 Bacteria 2689
240 Ga0207645_10088256 3300025907 Bacteria 1993
241 Ga0207643_10003472 3300025908 Bacteria 8482
242 Ga0207643_10007174 3300025908 Bacteria 5981
243 Ga0207643_10029841 3300025908 Bacteria 3033
244 Ga0207643_10069949 3300025908 Bacteria 2018
245 Ga0207671_10002832 3300025914 Bacteria 18036
246 Ga0207671_10242215 3300025914 Bacteria 1417
247 Ga0207693_10003071 3300025915 Bacteria 14397
248 Ga0207693_10003980 3300025915 Bacteria 12554
249 Ga0207663_10001512 3300025916 Bacteria 10861
250 Ga0207660_10263302 3300025917 Bacteria 1364
251 Ga0207662_10152589 3300025918 Bacteria 1470
252 Ga0207662_10195283 3300025918 Bacteria 1307
253 Ga0207646_10113021 3300025922 Bacteria 2438
254 Ga0207681_10007252 3300025923 Bacteria 6796
255 Ga0207681_10162526 3300025923 Bacteria 1685
256 Ga0207694_10012688 3300025924 Bacteria 6348
257 Ga0207694_10022799 3300025924 Bacteria 4749
258 Ga0207694_10188764 3300025924 Bacteria 1673
259 Ga0207659_10017867 3300025926 Bacteria 4641
260 Ga0207659_10018075 3300025926 Bacteria 4616
261 Ga0207659_10023808 3300025926 Bacteria 4093
262 Ga0207659_10028501 3300025926 Bacteria 3796
263 Ga0207659_10051984 3300025926 Bacteria 2917
264 Ga0207687_10149517 3300025927 Bacteria 1780
265 Ga0207664_10191918 3300025929 Bacteria 1759
266 Ga0207644_10015400 3300025931 Bacteria 5131
267 Ga0207644_10053989 3300025931 Bacteria 2893
268 Ga0207644_10166434 3300025931 Bacteria 1718
269 Ga0207644_10310841 3300025931 Bacteria 1272
270 Ga0207706_10000606 3300025933 Bacteria 38141
271 Ga0207706_10017818 3300025933 Bacteria 6398
272 Ga0207686_10004843 3300025934 Bacteria 7234
273 Ga0207709_10000172 3300025935 Bacteria 86654
274 Ga0207709_10074108 3300025935 Bacteria 2171
275 Ga0207670_10074293 3300025936 Bacteria 2359
276 Ga0207669_10001682 3300025937 Bacteria 9406
277 Ga0207669_10010408 3300025937 Bacteria 4477
278 Ga0207704_10011309 3300025938 Bacteria 4388
279 Ga0207665_10008158 3300025939 Bacteria 6912
280 Ga0207691_10002506 3300025940 Bacteria 17971
281 Ga0207691_10028712 3300025940 Bacteria 5206
282 Ga0207691_10038014 3300025940 Bacteria 4454
283 Ga0207691_10063199 3300025940 Bacteria 3358
284 Ga0207711_10236470 3300025941 Bacteria 1674
285 Ga0207711_10278895 3300025941 Bacteria 1539
286 Ga0207689_10006281 3300025942 Bacteria 10527
287 Ga0207689_10032696 3300025942 Bacteria 4325
288 Ga0207689_10061790 3300025942 Bacteria 3081
289 Ga0207689_10167957 3300025942 Bacteria 1807
290 Ga0207661_10183457 3300025944 Bacteria 1830
291 Ga0207679_10022786 3300025945 Bacteria 4270
292 Ga0207679_10057924 3300025945 Bacteria 2868
293 Ga0207667_10058805 3300025949 Bacteria 4030
294 Ga0207667_10068267 3300025949 Bacteria 3702
295 Ga0207651_10015114 3300025960 Bacteria 4476
296 Ga0207651_10018013 3300025960 Bacteria 4190
297 Ga0207712_10088688 3300025961 Bacteria 2272
298 Ga0207712_10156377 3300025961 Bacteria 1766
299 Ga0207668_10052464 3300025972 Bacteria 2821
300 Ga0207668_10078772 3300025972 Bacteria 2381
301 Ga0207677_10077706 3300026023 Bacteria 2368
302 Ga0207677_10103657 3300026023 Bacteria 2101
303 Ga0207703_10039908 3300026035 Bacteria 3754
304 Ga0207708_10012429 3300026075 Bacteria 6347
305 Ga0207708_10018035 3300026075 Bacteria 5311
306 Ga0207708_10094077 3300026075 Bacteria 2313
307 Ga0207708_10311893 3300026075 Bacteria 1282
308 Ga0207702_10021218 3300026078 Bacteria 5376
309 Ga0207648_10000429 3300026089 Bacteria 46380
310 Ga0207648_10002321 3300026089 Bacteria 20531
311 Ga0207648_10023693 3300026089 Bacteria 5494
312 Ga0207648_10123942 3300026089 Bacteria 2273
313 Ga0207676_10075540 3300026095 Bacteria 2719
314 Ga0207676_10133597 3300026095 Bacteria 2114
315 Ga0207674_10067184 3300026116 Bacteria 3610
316 Ga0207675_100015598 3300026118 Bacteria 7087
317 Ga0207675_100022127 3300026118 Bacteria 5918
318 Ga0207675_100142047 3300026118 Bacteria 2281
319 Ga0207675_100158338 3300026118 Bacteria 2159
320 Ga0207675_100296051 3300026118 Bacteria 1575
321 Ga0207683_10009916 3300026121 Bacteria 8123
322 Ga0207683_10029975 3300026121 Bacteria 4713
323 Ga0207683_10030376 3300026121 Bacteria 4682
324 Ga0207683_10035523 3300026121 Bacteria 4335
325 Ga0207683_10049653 3300026121 Bacteria 3674
326 Ga0207683_10102494 3300026121 Bacteria 2556
327 Ga0207683_10340193 3300026121 Bacteria 1376
328 Ga0209281_1000020 3300027111 Bacteria 575972
329 Ga0209179_1007240 3300027512 Bacteria 1825
330 Ga0209983_1004273 3300027665 Bacteria 3011
331 Ga0209588_1041323 3300027671 Bacteria 1489
332 Ga0209971_1003504 3300027682 Bacteria 3717
333 Ga0209974_10010132 3300027876 Bacteria 3185
334 Ga0209974_10032498 3300027876 Bacteria 1729
335 Ga0207428_10002055 3300027907 Bacteria 20307
336 Ga0207428_10007334 3300027907 Bacteria 10065
337 Ga0207428_10010695 3300027907 Bacteria 8184
338 Ga0207428_10015486 3300027907 Bacteria 6596
339 Ga0207428_10052578 3300027907 Bacteria 3252
340 Ga0207428_10186520 3300027907 Bacteria 1565
341 Ga0268266_10148552 3300028379 Bacteria 2110
342 Ga0268266_10316136 3300028379 Bacteria 1460
343 Ga0268265_10008126 3300028380 Bacteria 7091
344 Ga0268265_10405751 3300028380 Bacteria 1261
345 Ga0268265_10486324 3300028380 Bacteria 1160
346 Ga0268264_10024489 3300028381 Bacteria 4928
347 Ga0265337_1001439 3300028556 Bacteria 11715
348 Ga0265326_10001380 3300028558 Bacteria 8553
349 Ga0265319_1002798 3300028563 Bacteria 9365
350 Ga0265334_10005260 3300028573 Bacteria 5665
351 Ga0265318_10000962 3300028577 Bacteria 18486
352 Ga0265318_10003474 3300028577 Bacteria 7906
353 Ga0265323_10000992 3300028653 Bacteria 14760
354 Ga0265336_10000063 3300028666 Bacteria 98413
355 Ga0307515_10000292 3300028794 Bacteria 123160
356 Ga0307515_10000494 3300028794 Bacteria 94354
357 Ga0307515_10033589 3300028794 Bacteria 8436
358 Ga0307515_10039959 3300028794 Bacteria 7435
359 Ga0265338_10000154 3300028800 Bacteria 125708
360 Ga0265324_10001590 3300029957 Bacteria 12642
361 Ga0307512_10037887 3300030522 Bacteria 4066
362 Ga0265332_10003324 3300031238 Bacteria 7803
363 Ga0265320_10010219 3300031240 Bacteria 5603
364 Ga0265325_10017195 3300031241 Bacteria 4022
365 Ga0265340_10005895 3300031247 Bacteria 6775
366 Ga0265339_10001335 3300031249 Bacteria 18436
367 Ga0265327_10005550 3300031251 Bacteria 10474
368 Ga0265316_10131364 3300031344 Bacteria 1886
369 Ga0307513_10012018 3300031456 Bacteria 10714
370 Ga0307513_10012594 3300031456 Bacteria 10427
371 Ga0307513_10062057 3300031456 Bacteria 3952
372 Ga0307509_10024290 3300031507 Bacteria 6789
373 Ga0307509_10329973 3300031507 Bacteria 1258
374 Ga0307408_100000029 3300031548 Bacteria 227806
375 Ga0307408_100015068 3300031548 Bacteria 5144
376 Ga0307408_100086750 3300031548 Bacteria 2353
377 Ga0265313_10000779 3300031595 Bacteria 32214
378 Ga0265313_10001164 3300031595 Bacteria 25145
379 Ga0265313_10004883 3300031595 Bacteria 10056
380 Ga0307508_10000096 3300031616 Bacteria 103730
381 Ga0307508_10113029 3300031616 Bacteria 2315
382 Ga0307514_10001887 3300031649 Bacteria 23094
383 Ga0265314_10015177 3300031711 Bacteria 6122
384 Ga0265314_10027734 3300031711 Bacteria 4237
385 Ga0265314_10034777 3300031711 Bacteria 3677
386 Ga0265314_10109375 3300031711 Bacteria 1759
387 Ga0265342_10023837 3300031712 Bacteria 3867
388 Ga0265342_10144661 3300031712 Bacteria 1324
389 Ga0307516_10001367 3300031730 Bacteria 33805
390 Ga0307516_10003526 3300031730 Bacteria 20030
391 Ga0307516_10053532 3300031730 Bacteria 3945
392 Ga0307516_10140117 3300031730 Bacteria 2189
393 Ga0307405_10001234 3300031731 Bacteria 10638
394 Ga0307413_10002493 3300031824 Bacteria 7503
395 Ga0307413_10124258 3300031824 Bacteria 1754
396 Ga0307410_10010279 3300031852 Bacteria 5291
397 Ga0307406_10012325 3300031901 Bacteria 4875
398 Ga0307412_10004520 3300031911 Bacteria 7750
399 Ga0307412_10379705 3300031911 Bacteria 1144
400 Ga0307409_100005343 3300031995 Bacteria 7374
401 Ga0307416_100005644 3300032002 Bacteria 7724
402 Ga0307416_100447918 3300032002 Bacteria 1343
403 Ga0307416_100475880 3300032002 Bacteria 1308
404 Ga0307411_10003401 3300032005 Bacteria 7374
405 Ga0316583_10026639 3300032133 Bacteria 2064
406 Ga0373926_0027932 3300035083 Bacteria 1979
407 Ga0373944_0047809 3300035089 Bacteria 1341
408 Ga0373936_0001944 3300035113 Bacteria 7639
409 Ga0373936_0116030 3300035113 Bacteria 1140
410 Ga0373953_0006315 3300035117 Bacteria 3899
411 Ga0373954_0075076 3300035118 Bacteria 1609
412 Ga0373956_0171409 3300035119 Bacteria 1024
413 Ga0373946_0043886 3300035171 Bacteria 1844
414 Ga0373961_0024428 3300035241 Bacteria 1635
415 Ga0373935_0014829 3300035692 Bacteria 4705
416 Ga0373927_0001069 3300035695 Bacteria 20955
417 Ga0373927_0010672 3300035695 Bacteria 6119
418 Ga0373947_0007770 3300035725 Bacteria 6196
419 Ga0373937_0037618 3300036401 Bacteria 4410
420 Ga0373937_0044534 3300036401 Bacteria 4054
421 Ga0373925_0003237 3300037068 Bacteria 12714
422 Ga0373925_0206479 3300037068 Bacteria 1564
423 Ga0373925_0554371 3300037068 Bacteria 945
424 Ga0395899_0219652 3300037312 Bacteria 1317
425 Ga0395900_0016357 3300037418 Bacteria 7561
426 Ga0395898_0123687 3300037466 Bacteria 2479
427 Ga0395898_0243873 3300037466 Bacteria 1714
428 Ga0395905_0002341 3300037471 Bacteria 21134
429 Ga0395905_0010810 3300037471 Bacteria 8844
430 Ga0395905_0034060 3300037471 Bacteria 4782
431 Ga0395905_0045282 3300037471 Bacteria 4126
432 Ga0395905_0060217 3300037471 Bacteria 3550
433 Ga0395905_0347746 3300037471 Bacteria 1374
434 Ga0395901_0118960 3300038443 Bacteria 2776
435 Ga0400490_35285 3300038726 Bacteria 7917
436 Ga0400491_04233 3300038727 Bacteria 1718
437 Ga0400488_34208 3300038741 Bacteria 12154
438 Ga0400483_215880 3300039062 Bacteria 4205
439 Ga0400487_20550 3300039110 Bacteria 1889
440 Ga0400487_34028 3300039110 Bacteria 26819
441 Ga0436365_0151425 3300039437 Bacteria 1709
442 Ga0436365_0476641 3300039437 Bacteria 1840
443 Ga0436360_0109312 3300039438 Bacteria 1729
444 Ga0436360_1087288 3300039438 Bacteria 2846
445 Ga0436360_1192691 3300039438 Bacteria 3786
446 Ga0436361_0028664 3300039447 Bacteria 69721
447 Ga0436361_0193139 3300039447 Bacteria 16854
448 Ga0436361_0455065 3300039447 Bacteria 73475
449 Ga0436363_1505079 3300039450 Bacteria 1391
450 Ga0436362_1236534 3300039453 Bacteria 1812
451 Ga0439433_0018131 3300041999 Bacteria 1565
452 Ga0439449_0005387 3300042007 Bacteria 4903
453 Ga0439450_009025 3300042008 Bacteria 1880
454 Ga0450911_001989 3300042115 Bacteria 4252
455 Ga0439434_0060106 3300042435 Bacteria 1187
456 Ga0439435_0024205 3300042436 Bacteria 1600
457 Ga0439460_0118575 3300042461 Bacteria 864
458 Ga0450918_000016 3300042531 Bacteria 34446
459 Ga0450893_0004350 3300042532 Bacteria 2256
460 Ga0451577_0000235 3300042876 Bacteria 109693
461 Ga0451577_0288313 3300042876 Bacteria 1487
462 Ga0466969_0118683 3300044656 Bacteria 1233
463 Ga0466972_0000079 3300044658 Bacteria 90348
464 Ga0453684_0000906 3300044712 Bacteria 98768
465 Ga0453684_0069104 3300044712 Bacteria 4482
466 Ga0453684_0422095 3300044712 Bacteria 1489
467 Ga0451576_0015435 3300045051 Bacteria 8461
468 Ga0451576_0124675 3300045051 Bacteria 2683
469 Ga0495592_0019534 3300046454 Bacteria 5154
470 Ga0495603_0000064 3300046455 Bacteria 46716
471 Ga0495603_0155368 3300046455 Bacteria 1328
472 Ga0495629_0001770 3300046459 Bacteria 16944
473 Ga0495629_0105467 3300046459 Bacteria 1966
474 Ga0495638_0000710 3300046460 Bacteria 35874
475 Ga0495641_0004409 3300046461 Bacteria 9961
476 Ga0495651_0029648 3300046462 Bacteria 4266
477 Ga0495650_0001530 3300046471 Bacteria 21964
478 Ga0495580_0002618 3300046472 Bacteria 15620
479 Ga0495582_0000197 3300046473 Bacteria 33437
480 Ga0495639_0001620 3300046475 Bacteria 10038
481 Ga0495639_0035744 3300046475 Bacteria 2223
482 Ga0495662_0012317 3300046476 Bacteria 4174
483 Ga0495664_0011941 3300046477 Bacteria 4907
484 Ga0495664_0036973 3300046477 Bacteria 2880
485 Ga0495584_0031775 3300046491 Bacteria 2672
486 Ga0495594_0004585 3300046499 Bacteria 7112
487 Ga0495596_0000604 3300046500 Bacteria 22532
488 Ga0495596_0010570 3300046500 Bacteria 4013
489 Ga0495607_0041240 3300046501 Bacteria 2743
490 Ga0495610_0044439 3300046512 Bacteria 2205
491 Ga0495618_0023879 3300046514 Bacteria 3786
492 Ga0495628_0049588 3300046516 Bacteria 3324
493 Ga0495630_0005383 3300046517 Bacteria 9031
494 Ga0495632_0017507 3300046519 Bacteria 3953
495 Ga0495632_0024422 3300046519 Bacteria 3210
496 Ga0495632_0051562 3300046519 Bacteria 2025
497 Ga0495643_0003067 3300046522 Bacteria 12559
498 Ga0495643_0029686 3300046522 Bacteria 3058
499 Ga0495644_0017097 3300046523 Bacteria 2775
500 Ga0495648_0000070 3300046524 Bacteria 136680
501 Ga0495642_0030338 3300046528 Bacteria 2162
502 Ga0495652_0040068 3300046529 Bacteria 4049
503 Ga0495652_0061314 3300046529 Bacteria 3175
504 Ga0495665_0000902 3300046531 Bacteria 15623
505 Ga0495640_0001505 3300046533 Bacteria 18356
506 Ga0495609_0028193 3300046538 Bacteria 2563
507 Ga0495621_0096422 3300046539 Bacteria 1121
508 Ga0495597_0003270 3300046542 Bacteria 9606
509 Ga0495622_0001436 3300046557 Bacteria 12023
510 Ga0495656_0015604 3300046615 Bacteria 2871
511 Ga0495656_0173623 3300046615 Bacteria 1055
512 Ga0495668_0000018 3300046616 Bacteria 417480
513 Ga0495668_0001435 3300046616 Bacteria 23071
514 Ga0495611_0006888 3300046648 Bacteria 4831
515 Ga0495625_0042913 3300046660 Bacteria 3283
516 Ga0495635_0000356 3300046663 Bacteria 29094
517 Ga0495661_0053208 3300046665 Bacteria 2435
518 Ga0495588_0000619 3300046674 Bacteria 16696
519 Ga0495599_0015026 3300046678 Bacteria 4799
520 Ga0495623_0089260 3300046679 Bacteria 1895
521 Ga0495647_0022565 3300046681 Bacteria 2274
522 Ga0495658_0003461 3300046683 Bacteria 7799
523 Ga0495669_0228473 3300046684 Bacteria 893
524 Ga0495613_0004786 3300046689 Bacteria 10156
525 Ga0495613_0050119 3300046689 Bacteria 3080
526 Ga0495624_0001264 3300046690 Bacteria 19934
527 Ga0495670_0012551 3300046691 Bacteria 4167
528 Ga0495670_0056496 3300046691 Bacteria 1969
529 Ga0495589_0037901 3300046794 Bacteria 2414
530 Ga0495660_0025343 3300046810 Bacteria 3369
531 Ga0495581_0002800 3300047315 Bacteria 9952
532 Ga0495604_0091766 3300047317 Bacteria 2251
533 Ga0495674_0069526 3300047319 Bacteria 3044
534 Ga0495672_0086533 3300047320 Bacteria 1733
535 Ga0495672_0087269 3300047320 Bacteria 1723
536 Ga0495680_0016989 3300047322 Bacteria 6230
537 Ga0495685_022972 3300047447 Bacteria 2146
538 Ga0495593_0000053 3300047673 Bacteria 47697
539 Ga0495602_0171272 3300048088 Bacteria 1685
540 Ga0495602_0195990 3300048088 Bacteria 1545
541 Ga0495614_0035545 3300048089 Bacteria 2141
542 Ga0495626_0000868 3300048091 Bacteria 26883
543 Ga0495626_0020961 3300048091 Bacteria 3250
544 Ga0496101_0004586 3300048904 Bacteria 8729
545 Ga0496102_0007305 3300048905 Bacteria 9429
546 Ga0496104_0163229 3300048907 Bacteria 2136
547 Ga0496104_0167719 3300048907 Bacteria 2105
548 Ga0496104_0184256 3300048907 Bacteria 1998
549 Ga0496105_0000572 3300048908 Bacteria 24357
550 Ga0496105_0022207 3300048908 Bacteria 5139
551 Ga0496105_0066814 3300048908 Bacteria 2969
552 Ga0496106_0420367 3300048909 Bacteria 1074
553 Ga0496107_0000808 3300048910 Bacteria 18176
554 Ga0496107_0211643 3300048910 Bacteria 1442
555 Ga0496111_0045887 3300048914 Bacteria 3145
556 Ga0496115_0059959 3300048918 Bacteria 3065
557 Ga0496116_0057566 3300048919 Bacteria 2540
558 Ga0496121_0057214 3300048924 Bacteria 3233
559 Ga0496121_0178566 3300048924 Bacteria 1535
560 Ga0496124_0007054 3300048927 Bacteria 12039
561 Ga0496124_0106707 3300048927 Bacteria 2261
562 Ga0496125_0038093 3300048928 Bacteria 4168
563 Ga0496125_0040603 3300048928 Bacteria 3989
564 Ga0496125_0056205 3300048928 Bacteria 3198
565 Ga0496125_0087591 3300048928 Bacteria 2351
566 Ga0496126_0284820 3300048929 Bacteria 1368
567 Ga0496126_0310800 3300048929 Bacteria 1297
568 Ga0495678_003261 3300049459 Bacteria 10144
569 Ga0495682_0019068 3300049460 Bacteria 2582
570 Ga0501031_0001824 3300049568 Bacteria 13399
571 Ga0501034_0186886 3300049571 Bacteria 2035
572 Ga0501067_0023296 3300049583 Bacteria 3431
573 Ga0501067_0028047 3300049583 Bacteria 3120
574 Ga0501198_000037 3300049649 Bacteria 52054
575 Ga0501222_000032 3300049662 Bacteria 55723
576 Ga0501259_017361 3300049688 Bacteria 1247
577 Ga0501225_0055146 3300049705 Bacteria 1112
578 nmdc:mga0k408_23715_c1 3300050493 Bacteria 3464
579 nmdc:mga07m45_5721_c1 3300050496 Bacteria 6218
580 nmdc:mga05p37_180532_c1 3300050507 Bacteria 2568
581 nmdc:mga05p37_19865_c1 3300050507 Bacteria 8128
582 nmdc:mga05p37_208757_c1 3300050507 Bacteria 2362
583 nmdc:mga05p37_52613_c1 3300050507 Bacteria 5006
584 nmdc:mga09592_11616_c1 3300050508 Bacteria 7161
585 nmdc:mga09592_190386_c1 3300050508 Bacteria 1776
586 nmdc:mga09592_23749_c1 3300050508 Bacteria 5065
587 nmdc:mga09592_76368_c1 3300050508 Bacteria 2849
588 nmdc:mga0qj67_1010_c1 3300050509 Bacteria 19413
589 nmdc:mga0qj67_112735_c1 3300050509 Bacteria 2196
590 nmdc:mga0qj67_199451_c1 3300050509 Bacteria 1626
591 nmdc:mga06r32_3055_c1 3300050510 Bacteria 14984
592 nmdc:mga06r32_36396_c1 3300050510 Bacteria 4650
593 nmdc:mga06r32_39835_c1 3300050510 Bacteria 4460
594 nmdc:mga06r32_78341_c1 3300050510 Bacteria 3213
595 nmdc:mga08y16_148858_c1 3300050511 Bacteria 2433
596 nmdc:mga08y16_1998_c1 3300050511 Bacteria 20844
597 nmdc:mga08y16_23677_c1 3300050511 Bacteria 6484
598 nmdc:mga08y16_5088_c1 3300050511 Bacteria 13743
599 nmdc:mga08y16_51502_c1 3300050511 Bacteria 4307
600 nmdc:mga08y16_547333_c1 3300050511 Bacteria 1172
601 nmdc:mga08y16_5509_c1 3300050511 Bacteria 13243
602 nmdc:mga08y16_596848_c1 3300050511 Bacteria 1113
603 nmdc:mga0n895_2763_c1 3300050512 Bacteria 13867
604 nmdc:mga0n895_3027_c1 3300050512 Bacteria 13368
605 nmdc:mga0n895_38591_c1 3300050512 Bacteria 4629
606 nmdc:mga0n895_412338_c1 3300050512 Bacteria 1366
607 nmdc:mga0n895_67403_c1 3300050512 Bacteria 3545
608 nmdc:mga0rr50_142109_c1 3300050513 Bacteria 1932
609 nmdc:mga0rr50_231643_c1 3300050513 Bacteria 1528
610 nmdc:mga0rr50_43386_c1 3300050513 Bacteria 3291
611 nmdc:mga0a205_108192_c1 3300050515 Bacteria 2678
612 nmdc:mga0a205_1255_c1 3300050515 Bacteria 21291
613 nmdc:mga0a205_3105_c1 3300050515 Bacteria 14729
614 nmdc:mga0a205_447_c1 3300050515 Bacteria 31860
615 nmdc:mga0a205_85247_c1 3300050515 Bacteria 3051
616 Ga0495655_0004612 3300053083 Bacteria 2371
617 Ga0500650_0088102 3300053098 Bacteria 1453
618 Ga0500593_000250 3300053117 Bacteria 22072
619 Ga0501084_0291317 3300054114 Bacteria 1379
620 Ga0590074_015400 3300059423 Bacteria 1299
621 Ga0501082_0294796 3300060353 Bacteria 1412

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007788 Ga0099795_10077249 Ga0099795_100772492 266
2 3300046519 Ga0495632_0051562 Ga0495632_0051562_41_859 267
3 3300037068 Ga0373925_0554371 Ga0373925_0554371_97_912 268
4 3300037471 Ga0395905_0347746 Ga0395905_0347746_524_1345 268
5 3300042461 Ga0439460_0118575 Ga0439460_0118575_19_825 268
6 3300046684 Ga0495669_0228473 Ga0495669_0228473_55_861 268
7 3300003323 rootH1_10085284 rootH1_100852842 269
8 3300035113 Ga0373936_0116030 Ga0373936_0116030_41_874 274
9 3300035692 Ga0373935_0014829 Ga0373935_0014829_3835_4668 274
10 3300037466 Ga0395898_0123687 Ga0395898_0123687_19_861 274
11 3300060353 Ga0501082_0294796 Ga0501082_0294796_162_995 274
12 3300025941 Ga0207711_10236470 Ga0207711_102364702 282
13 3300014325 Ga0163163_10139391 Ga0163163_101393913 289
14 3300028794 Ga0307515_10033589 Ga0307515_100335894 289
15 3300037068 Ga0373925_0206479 Ga0373925_0206479_244_1140 292
16 3300050515 nmdc:mga0a205_108192_c1 nmdc:mga0a205_108192_c1_1624_2529 292
17 3300031238 Ga0265332_10003324 Ga0265332_100033244 293
18 3300005459 Ga0068867_100011208 Ga0068867_1000112085 294
19 3300005844 Ga0068862_100022389 Ga0068862_1000223892 294
20 3300015262 Ga0182007_10000236 Ga0182007_1000023629 294
21 3300015265 Ga0182005_1000110 Ga0182005_100011051 294
22 3300025933 Ga0207706_10000606 Ga0207706_1000060621 294
23 3300025940 Ga0207691_10002506 Ga0207691_1000250613 294
24 3300025961 Ga0207712_10156377 Ga0207712_101563772 294
25 3300026075 Ga0207708_10094077 Ga0207708_100940772 294
26 3300026089 Ga0207648_10002321 Ga0207648_100023216 294
27 3300026118 Ga0207675_100015598 Ga0207675_1000155984 294
28 3300027665 Ga0209983_1004273 Ga0209983_10042732 294
29 3300028577 Ga0265318_10000962 Ga0265318_100009622 294
30 3300031241 Ga0265325_10017195 Ga0265325_100171952 294
31 3300031344 Ga0265316_10131364 Ga0265316_101313642 294
32 3300031595 Ga0265313_10000779 Ga0265313_1000077928 294
33 3300031595 Ga0265313_10001164 Ga0265313_100011648 294
34 3300031711 Ga0265314_10015177 Ga0265314_100151772 294
35 3300032133 Ga0316583_10026639 Ga0316583_100266393 294
36 3300047320 Ga0495672_0087269 Ga0495672_0087269_777_1667 294
37 3300048914 Ga0496111_0045887 Ga0496111_0045887_778_1668 294
38 3300048919 Ga0496116_0057566 Ga0496116_0057566_719_1609 294
39 3300048924 Ga0496121_0178566 Ga0496121_0178566_521_1411 294
40 3300048927 Ga0496124_0007054 Ga0496124_0007054_3044_3934 294
41 3300048928 Ga0496125_0040603 Ga0496125_0040603_2936_3826 294
42 3300050508 nmdc:mga09592_76368_c1 nmdc:mga09592_76368_c1_1765_2724 294
43 3300005295 Ga0065707_10092192 Ga0065707_100921921 297
44 3300009092 Ga0105250_10000186 Ga0105250_100001867 297
45 3300025711 Ga0207696_1000072 Ga0207696_1000072199 297
46 3300031711 Ga0265314_10109375 Ga0265314_101093751 297
47 3300050509 nmdc:mga0qj67_199451_c1 nmdc:mga0qj67_199451_c1_479_1372 297
48 3300050510 nmdc:mga06r32_39835_c1 nmdc:mga06r32_39835_c1_2631_3524 297
49 iso_pu_bacteria 2574179768 2574433012 297
50 iso_pu_bacteria 2585428062 2587756656 297
51 iso_pu_bacteria 2643221644 2644247498 297
52 iso_pu_bacteria 2721755763 2723879019 297
53 iso_pu_bacteria 2904479285 2904482829 297
54 iso_pu_bacteria 2643221609 2644058346 298
55 iso_pu_bacteria 2643221611 2644073398 298
56 iso_pu_bacteria 2721755523 2722883082 298
57 iso_pu_bacteria 2839138175 2839141439 298
58 iso_pu_bacteria 2932422444 2932422646 298
59 3300005539 Ga0068853_100387645 Ga0068853_1003876451 299
60 3300048928 Ga0496125_0056205 Ga0496125_0056205_679_1596 299
61 3300049705 Ga0501225_0055146 Ga0501225_0055146_147_1067 299
62 3300005354 Ga0070675_100032453 Ga0070675_1000324532 300
63 3300005355 Ga0070671_100058005 Ga0070671_1000580052 300
64 3300005841 Ga0068863_100491331 Ga0068863_1004913312 300
65 3300006358 Ga0068871_100255259 Ga0068871_1002552592 300
66 3300006844 Ga0075428_100042766 Ga0075428_1000427663 300
67 3300021361 Ga0213872_10000001 Ga0213872_10000001215 300
68 3300025926 Ga0207659_10018075 Ga0207659_100180752 300
69 3300025931 Ga0207644_10166434 Ga0207644_101664342 300
70 3300032002 Ga0307416_100447918 Ga0307416_1004479182 300
71 3300039447 Ga0436361_0028664 Ga0436361_0028664_58572_59510 300
72 3300047320 Ga0495672_0086533 Ga0495672_0086533_467_1375 300
73 3300053098 Ga0500650_0088102 Ga0500650_0088102_106_1041 300
74 3300002076 JGI24749J21850_1005088 JGI24749J21850_10050881 301
75 3300003203 JGI25406J46586_10000721 JGI25406J46586_100007217 301
76 3300003203 JGI25406J46586_10004727 JGI25406J46586_100047274 301
77 3300003203 JGI25406J46586_10019628 JGI25406J46586_100196282 301
78 3300003203 JGI25406J46586_10020738 JGI25406J46586_100207382 301
79 3300003320 rootH2_10247225 rootH2_102472253 301
80 3300003322 rootL2_10017603 rootL2_1001760312 301
81 3300003794 Ga0055531_10008251 Ga0055531_100082517 301
82 3300005290 Ga0065712_10078880 Ga0065712_100788803 301
83 3300005328 Ga0070676_10003564 Ga0070676_100035644 301
84 3300005328 Ga0070676_10008828 Ga0070676_100088285 301
85 3300005328 Ga0070676_10050389 Ga0070676_100503892 301
86 3300005330 Ga0070690_100001736 Ga0070690_1000017367 301
87 3300005330 Ga0070690_100023070 Ga0070690_1000230701 301
88 3300005331 Ga0070670_100072240 Ga0070670_1000722402 301
89 3300005331 Ga0070670_100106230 Ga0070670_1001062302 301
90 3300005333 Ga0070677_10001442 Ga0070677_100014422 301
91 3300005333 Ga0070677_10015588 Ga0070677_100155883 301
92 3300005334 Ga0068869_100001494 Ga0068869_10000149411 301
93 3300005334 Ga0068869_100023320 Ga0068869_1000233204 301
94 3300005334 Ga0068869_100111702 Ga0068869_1001117022 301
95 3300005334 Ga0068869_100153986 Ga0068869_1001539862 301
96 3300005335 Ga0070666_10198159 Ga0070666_101981591 301
97 3300005336 Ga0070680_100079923 Ga0070680_1000799233 301
98 3300005337 Ga0070682_100000252 Ga0070682_10000025214 301
99 3300005338 Ga0068868_100082908 Ga0068868_1000829082 301
100 3300005340 Ga0070689_100055212 Ga0070689_1000552121 301
101 3300005347 Ga0070668_100037286 Ga0070668_1000372864 301
102 3300005347 Ga0070668_100114143 Ga0070668_1001141432 301
103 3300005353 Ga0070669_100014516 Ga0070669_1000145163 301
104 3300005353 Ga0070669_100029077 Ga0070669_1000290772 301
105 3300005353 Ga0070669_100069805 Ga0070669_1000698052 301
106 3300005353 Ga0070669_100311232 Ga0070669_1003112322 301
107 3300005354 Ga0070675_100006367 Ga0070675_1000063678 301
108 3300005354 Ga0070675_100022719 Ga0070675_1000227194 301
109 3300005354 Ga0070675_100028795 Ga0070675_1000287953 301
110 3300005354 Ga0070675_100102569 Ga0070675_1001025693 301
111 3300005354 Ga0070675_100232826 Ga0070675_1002328262 301
112 3300005355 Ga0070671_100003098 Ga0070671_1000030983 301
113 3300005355 Ga0070671_100285572 Ga0070671_1002855722 301
114 3300005356 Ga0070674_100002446 Ga0070674_1000024462 301
115 3300005356 Ga0070674_100419066 Ga0070674_1004190661 301
116 3300005364 Ga0070673_100013595 Ga0070673_1000135954 301
117 3300005364 Ga0070673_100047176 Ga0070673_1000471764 301
118 3300005364 Ga0070673_100064065 Ga0070673_1000640653 301
119 3300005364 Ga0070673_100216214 Ga0070673_1002162142 301
120 3300005365 Ga0070688_100401963 Ga0070688_1004019631 301
121 3300005366 Ga0070659_100115927 Ga0070659_1001159272 301
122 3300005367 Ga0070667_100022678 Ga0070667_1000226784 301
123 3300005367 Ga0070667_100384703 Ga0070667_1003847031 301
124 3300005434 Ga0070709_10002985 Ga0070709_100029855 301
125 3300005435 Ga0070714_100013754 Ga0070714_1000137542 301
126 3300005435 Ga0070714_100143267 Ga0070714_1001432673 301
127 3300005437 Ga0070710_10005127 Ga0070710_100051275 301
128 3300005438 Ga0070701_10163816 Ga0070701_101638162 301
129 3300005439 Ga0070711_100008828 Ga0070711_1000088282 301
130 3300005441 Ga0070700_100001670 Ga0070700_1000016703 301
131 3300005441 Ga0070700_100316577 Ga0070700_1003165771 301
132 3300005455 Ga0070663_100292284 Ga0070663_1002922842 301
133 3300005456 Ga0070678_100005422 Ga0070678_1000054225 301
134 3300005456 Ga0070678_100093766 Ga0070678_1000937661 301
135 3300005456 Ga0070678_100229592 Ga0070678_1002295922 301
136 3300005457 Ga0070662_100008793 Ga0070662_1000087934 301
137 3300005459 Ga0068867_100006363 Ga0068867_1000063636 301
138 3300005459 Ga0068867_100060453 Ga0068867_1000604533 301
139 3300005459 Ga0068867_100072962 Ga0068867_1000729622 301
140 3300005459 Ga0068867_100142478 Ga0068867_1001424782 301
141 3300005466 Ga0070685_10074933 Ga0070685_100749331 301
142 3300005467 Ga0070706_100139518 Ga0070706_1001395183 301
143 3300005467 Ga0070706_100315058 Ga0070706_1003150582 301
144 3300005468 Ga0070707_100108691 Ga0070707_1001086912 301
145 3300005471 Ga0070698_100248102 Ga0070698_1002481022 301
146 3300005518 Ga0070699_100011663 Ga0070699_1000116636 301
147 3300005543 Ga0070672_100026250 Ga0070672_1000262504 301
148 3300005543 Ga0070672_100041640 Ga0070672_1000416402 301
149 3300005543 Ga0070672_100055765 Ga0070672_1000557653 301
150 3300005543 Ga0070672_100094115 Ga0070672_1000941152 301
151 3300005543 Ga0070672_100133926 Ga0070672_1001339263 301
152 3300005544 Ga0070686_100020402 Ga0070686_1000204021 301
153 3300005548 Ga0070665_100050187 Ga0070665_1000501871 301
154 3300005548 Ga0070665_100074498 Ga0070665_1000744983 301
155 3300005549 Ga0070704_100036796 Ga0070704_1000367962 301
156 3300005549 Ga0070704_100041535 Ga0070704_1000415354 301
157 3300005563 Ga0068855_100101520 Ga0068855_1001015202 301
158 3300005564 Ga0070664_100028196 Ga0070664_1000281964 301
159 3300005564 Ga0070664_100088159 Ga0070664_1000881591 301
160 3300005577 Ga0068857_100143182 Ga0068857_1001431821 301
161 3300005614 Ga0068856_100156024 Ga0068856_1001560242 301
162 3300005616 Ga0068852_100007943 Ga0068852_10000794312 301
163 3300005617 Ga0068859_100032369 Ga0068859_1000323693 301
164 3300005618 Ga0068864_100044342 Ga0068864_1000443423 301
165 3300005618 Ga0068864_100376880 Ga0068864_1003768802 301
166 3300005719 Ga0068861_100024692 Ga0068861_1000246922 301
167 3300005719 Ga0068861_100215269 Ga0068861_1002152692 301
168 3300005834 Ga0068851_10081246 Ga0068851_100812462 301
169 3300005840 Ga0068870_10007969 Ga0068870_100079693 301
170 3300005840 Ga0068870_10164894 Ga0068870_101648942 301
171 3300005841 Ga0068863_100011364 Ga0068863_1000113646 301
172 3300005842 Ga0068858_100201132 Ga0068858_1002011322 301
173 3300005842 Ga0068858_100260154 Ga0068858_1002601542 301
174 3300005843 Ga0068860_100046850 Ga0068860_1000468504 301
175 3300005844 Ga0068862_100004814 Ga0068862_1000048143 301
176 3300005844 Ga0068862_100261277 Ga0068862_1002612771 301
177 3300005937 Ga0081455_10008730 Ga0081455_100087301 301
178 3300005937 Ga0081455_10012116 Ga0081455_1001211611 301
179 3300005937 Ga0081455_10027965 Ga0081455_100279656 301
180 3300005937 Ga0081455_10182845 Ga0081455_101828452 301
181 3300005983 Ga0081540_1003649 Ga0081540_10036496 301
182 3300005983 Ga0081540_1008233 Ga0081540_10082334 301
183 3300005983 Ga0081540_1030795 Ga0081540_10307954 301
184 3300005983 Ga0081540_1057475 Ga0081540_10574752 301
185 3300005985 Ga0081539_10000133 Ga0081539_1000013369 301
186 3300005985 Ga0081539_10000220 Ga0081539_1000022011 301
187 3300005985 Ga0081539_10000329 Ga0081539_1000032986 301
188 3300005985 Ga0081539_10000748 Ga0081539_1000074855 301
189 3300005985 Ga0081539_10076850 Ga0081539_100768502 301
190 3300006028 Ga0070717_10016495 Ga0070717_100164954 301
191 3300006163 Ga0070715_10001596 Ga0070715_100015964 301
192 3300006173 Ga0070716_100003246 Ga0070716_1000032465 301
193 3300006175 Ga0070712_100012263 Ga0070712_1000122632 301
194 3300006177 Ga0075362_10009885 Ga0075362_100098852 301
195 3300006195 Ga0075366_10002436 Ga0075366_100024366 301
196 3300006195 Ga0075366_10045747 Ga0075366_100457473 301
197 3300006353 Ga0075370_10033291 Ga0075370_100332912 301
198 3300006358 Ga0068871_100029013 Ga0068871_1000290133 301
199 3300006358 Ga0068871_100263221 Ga0068871_1002632211 301
200 3300006844 Ga0075428_100010461 Ga0075428_1000104616 301
201 3300006844 Ga0075428_100035390 Ga0075428_1000353904 301
202 3300006844 Ga0075428_100188845 Ga0075428_1001888452 301
203 3300006846 Ga0075430_100001888 Ga0075430_1000018889 301
204 3300006846 Ga0075430_100011647 Ga0075430_1000116474 301
205 3300006846 Ga0075430_100057775 Ga0075430_1000577753 301
206 3300006847 Ga0075431_100005130 Ga0075431_10000513011 301
207 3300006847 Ga0075431_100006116 Ga0075431_1000061166 301
208 3300006847 Ga0075431_100009127 Ga0075431_1000091275 301
209 3300006852 Ga0075433_10000801 Ga0075433_1000080112 301
210 3300006852 Ga0075433_10011067 Ga0075433_100110676 301
211 3300006852 Ga0075433_10032292 Ga0075433_100322922 301
212 3300006852 Ga0075433_10045435 Ga0075433_100454354 301
213 3300006871 Ga0075434_100046860 Ga0075434_1000468602 301
214 3300006871 Ga0075434_100050560 Ga0075434_1000505604 301
215 3300006871 Ga0075434_100087405 Ga0075434_1000874052 301
216 3300006871 Ga0075434_100424156 Ga0075434_1004241562 301
217 3300006880 Ga0075429_100022932 Ga0075429_1000229323 301
218 3300006880 Ga0075429_100027210 Ga0075429_1000272103 301
219 3300006880 Ga0075429_100086913 Ga0075429_1000869131 301
220 3300006881 Ga0068865_100015587 Ga0068865_1000155871 301
221 3300006881 Ga0068865_100030497 Ga0068865_1000304972 301
222 3300006914 Ga0075436_100206257 Ga0075436_1002062572 301
223 3300006931 Ga0097620_100032371 Ga0097620_1000323714 301
224 3300006931 Ga0097620_100166569 Ga0097620_1001665692 301
225 3300006944 Ga0099823_1000138 Ga0099823_100013832 301
226 3300006946 Ga0079104_1000724 Ga0079104_10007243 301
227 3300007076 Ga0075435_100018531 Ga0075435_1000185316 301
228 3300007076 Ga0075435_100022855 Ga0075435_1000228552 301
229 3300007076 Ga0075435_100037441 Ga0075435_1000374412 301
230 3300007265 Ga0099794_10017152 Ga0099794_100171523 301
231 3300009093 Ga0105240_10147690 Ga0105240_101476904 301
232 3300009093 Ga0105240_10373678 Ga0105240_103736782 301
233 3300009094 Ga0111539_10002454 Ga0111539_1000245416 301
234 3300009094 Ga0111539_10007541 Ga0111539_100075418 301
235 3300009094 Ga0111539_10025554 Ga0111539_100255542 301
236 3300009094 Ga0111539_10049394 Ga0111539_100493943 301
237 3300009094 Ga0111539_10072504 Ga0111539_100725043 301
238 3300009094 Ga0111539_10099831 Ga0111539_100998312 301
239 3300009094 Ga0111539_10100666 Ga0111539_101006662 301
240 3300009094 Ga0111539_10357549 Ga0111539_103575492 301
241 3300009098 Ga0105245_10118739 Ga0105245_101187393 301
242 3300009101 Ga0105247_10022846 Ga0105247_100228462 301
243 3300009147 Ga0114129_10008622 Ga0114129_1000862211 301
244 3300009147 Ga0114129_10031159 Ga0114129_100311593 301
245 3300009147 Ga0114129_10129102 Ga0114129_101291024 301
246 3300009148 Ga0105243_10004635 Ga0105243_1000463510 301
247 3300009148 Ga0105243_10043540 Ga0105243_100435402 301
248 3300009174 Ga0105241_10380060 Ga0105241_103800601 301
249 3300009176 Ga0105242_10004078 Ga0105242_100040787 301
250 3300009177 Ga0105248_10037611 Ga0105248_100376113 301
251 3300009545 Ga0105237_10011248 Ga0105237_100112489 301
252 3300009551 Ga0105238_10022610 Ga0105238_100226102 301
253 3300009551 Ga0105238_10082606 Ga0105238_100826063 301
254 3300010375 Ga0105239_10010532 Ga0105239_100105326 301
255 3300011119 Ga0105246_10011917 Ga0105246_100119173 301
256 3300013102 Ga0157371_10000013 Ga0157371_10000013317 301
257 3300013296 Ga0157374_10140135 Ga0157374_101401352 301
258 3300013306 Ga0163162_10051286 Ga0163162_100512862 301
259 3300013307 Ga0157372_10228433 Ga0157372_102284332 301
260 3300013308 Ga0157375_10134975 Ga0157375_101349752 301
261 3300014326 Ga0157380_10059007 Ga0157380_100590072 301
262 3300014745 Ga0157377_10012486 Ga0157377_100124862 301
263 3300014968 Ga0157379_10000207 Ga0157379_1000020739 301
264 3300014968 Ga0157379_10035730 Ga0157379_100357302 301
265 3300014969 Ga0157376_10039405 Ga0157376_100394054 301
266 3300015261 Ga0182006_1013759 Ga0182006_10137594 301
267 3300015683 Ga0183362_10002 Ga0183362_10002610 301
268 3300017792 Ga0163161_10023578 Ga0163161_100235783 301
269 3300017792 Ga0163161_10052190 Ga0163161_100521903 301
270 3300021361 Ga0213872_10000134 Ga0213872_100001349 301
271 3300021384 Ga0213876_10067866 Ga0213876_100678663 301
272 3300025242 Ga0209258_103215 Ga0209258_1032153 301
273 3300025253 Ga0209677_100280 Ga0209677_1002809 301
274 3300025272 Ga0209455_1001166 Ga0209455_10011668 301
275 3300025272 Ga0209455_1009352 Ga0209455_10093522 301
276 3300025298 Ga0209050_1005408 Ga0209050_10054088 301
277 3300025299 Ga0209256_1000840 Ga0209256_100084026 301
278 3300025303 Ga0209051_1004454 Ga0209051_10044547 301
279 3300025304 Ga0209257_1004031 Ga0209257_10040318 301
280 3300025315 Ga0207697_10002977 Ga0207697_100029773 301
281 3300025321 Ga0207656_10040913 Ga0207656_100409133 301
282 3300025893 Ga0207682_10007560 Ga0207682_100075604 301
283 3300025893 Ga0207682_10015707 Ga0207682_100157072 301
284 3300025898 Ga0207692_10000318 Ga0207692_100003183 301
285 3300025899 Ga0207642_10002274 Ga0207642_100022744 301
286 3300025900 Ga0207710_10011222 Ga0207710_100112224 301
287 3300025901 Ga0207688_10006362 Ga0207688_100063625 301
288 3300025901 Ga0207688_10009797 Ga0207688_100097974 301
289 3300025901 Ga0207688_10063844 Ga0207688_100638442 301
290 3300025901 Ga0207688_10096916 Ga0207688_100969162 301
291 3300025904 Ga0207647_10174612 Ga0207647_101746122 301
292 3300025905 Ga0207685_10003083 Ga0207685_100030833 301
293 3300025907 Ga0207645_10008417 Ga0207645_100084173 301
294 3300025907 Ga0207645_10012643 Ga0207645_100126436 301
295 3300025907 Ga0207645_10049304 Ga0207645_100493042 301
296 3300025907 Ga0207645_10088256 Ga0207645_100882562 301
297 3300025908 Ga0207643_10003472 Ga0207643_100034725 301
298 3300025908 Ga0207643_10007174 Ga0207643_100071745 301
299 3300025908 Ga0207643_10029841 Ga0207643_100298412 301
300 3300025908 Ga0207643_10069949 Ga0207643_100699492 301
301 3300025914 Ga0207671_10002832 Ga0207671_1000283215 301
302 3300025914 Ga0207671_10242215 Ga0207671_102422152 301
303 3300025915 Ga0207693_10003071 Ga0207693_1000307110 301
304 3300025915 Ga0207693_10003980 Ga0207693_100039805 301
305 3300025916 Ga0207663_10001512 Ga0207663_1000151211 301
306 3300025917 Ga0207660_10263302 Ga0207660_102633021 301
307 3300025918 Ga0207662_10152589 Ga0207662_101525891 301
308 3300025918 Ga0207662_10195283 Ga0207662_101952831 301
309 3300025922 Ga0207646_10113021 Ga0207646_101130211 301
310 3300025923 Ga0207681_10007252 Ga0207681_100072524 301
311 3300025923 Ga0207681_10162526 Ga0207681_101625262 301
312 3300025924 Ga0207694_10012688 Ga0207694_100126881 301
313 3300025924 Ga0207694_10022799 Ga0207694_100227993 301
314 3300025924 Ga0207694_10188764 Ga0207694_101887642 301
315 3300025926 Ga0207659_10017867 Ga0207659_100178673 301
316 3300025926 Ga0207659_10023808 Ga0207659_100238082 301
317 3300025926 Ga0207659_10028501 Ga0207659_100285013 301
318 3300025926 Ga0207659_10051984 Ga0207659_100519842 301
319 3300025927 Ga0207687_10149517 Ga0207687_101495172 301
320 3300025929 Ga0207664_10191918 Ga0207664_101919182 301
321 3300025931 Ga0207644_10015400 Ga0207644_100154003 301
322 3300025931 Ga0207644_10053989 Ga0207644_100539892 301
323 3300025931 Ga0207644_10310841 Ga0207644_103108412 301
324 3300025933 Ga0207706_10017818 Ga0207706_100178184 301
325 3300025934 Ga0207686_10004843 Ga0207686_100048439 301
326 3300025935 Ga0207709_10000172 Ga0207709_1000017210 301
327 3300025935 Ga0207709_10074108 Ga0207709_100741082 301
328 3300025936 Ga0207670_10074293 Ga0207670_100742933 301
329 3300025937 Ga0207669_10001682 Ga0207669_100016825 301
330 3300025937 Ga0207669_10010408 Ga0207669_100104085 301
331 3300025938 Ga0207704_10011309 Ga0207704_100113092 301
332 3300025939 Ga0207665_10008158 Ga0207665_100081583 301
333 3300025940 Ga0207691_10028712 Ga0207691_100287125 301
334 3300025940 Ga0207691_10038014 Ga0207691_100380144 301
335 3300025940 Ga0207691_10063199 Ga0207691_100631992 301
336 3300025941 Ga0207711_10278895 Ga0207711_102788952 301
337 3300025942 Ga0207689_10006281 Ga0207689_100062813 301
338 3300025942 Ga0207689_10032696 Ga0207689_100326962 301
339 3300025942 Ga0207689_10061790 Ga0207689_100617903 301
340 3300025942 Ga0207689_10167957 Ga0207689_101679572 301
341 3300025944 Ga0207661_10183457 Ga0207661_101834571 301
342 3300025945 Ga0207679_10022786 Ga0207679_100227864 301
343 3300025945 Ga0207679_10057924 Ga0207679_100579243 301
344 3300025949 Ga0207667_10058805 Ga0207667_100588053 301
345 3300025949 Ga0207667_10068267 Ga0207667_100682673 301
346 3300025960 Ga0207651_10015114 Ga0207651_100151143 301
347 3300025960 Ga0207651_10018013 Ga0207651_100180132 301
348 3300025961 Ga0207712_10088688 Ga0207712_100886882 301
349 3300025972 Ga0207668_10052464 Ga0207668_100524642 301
350 3300025972 Ga0207668_10078772 Ga0207668_100787722 301
351 3300026023 Ga0207677_10077706 Ga0207677_100777063 301
352 3300026023 Ga0207677_10103657 Ga0207677_101036572 301
353 3300026035 Ga0207703_10039908 Ga0207703_100399082 301
354 3300026075 Ga0207708_10012429 Ga0207708_100124296 301
355 3300026075 Ga0207708_10018035 Ga0207708_100180353 301
356 3300026075 Ga0207708_10311893 Ga0207708_103118932 301
357 3300026078 Ga0207702_10021218 Ga0207702_100212185 301
358 3300026089 Ga0207648_10000429 Ga0207648_1000042936 301
359 3300026089 Ga0207648_10023693 Ga0207648_100236935 301
360 3300026089 Ga0207648_10123942 Ga0207648_101239423 301
361 3300026095 Ga0207676_10075540 Ga0207676_100755402 301
362 3300026095 Ga0207676_10133597 Ga0207676_101335972 301
363 3300026116 Ga0207674_10067184 Ga0207674_100671844 301
364 3300026118 Ga0207675_100022127 Ga0207675_1000221273 301
365 3300026118 Ga0207675_100142047 Ga0207675_1001420472 301
366 3300026118 Ga0207675_100158338 Ga0207675_1001583382 301
367 3300026118 Ga0207675_100296051 Ga0207675_1002960512 301
368 3300026121 Ga0207683_10009916 Ga0207683_100099166 301
369 3300026121 Ga0207683_10029975 Ga0207683_100299752 301
370 3300026121 Ga0207683_10030376 Ga0207683_100303763 301
371 3300026121 Ga0207683_10035523 Ga0207683_100355233 301
372 3300026121 Ga0207683_10049653 Ga0207683_100496531 301
373 3300026121 Ga0207683_10102494 Ga0207683_101024943 301
374 3300026121 Ga0207683_10340193 Ga0207683_103401931 301
375 3300027111 Ga0209281_1000020 Ga0209281_1000020498 301
376 3300027512 Ga0209179_1007240 Ga0209179_10072402 301
377 3300027671 Ga0209588_1041323 Ga0209588_10413232 301
378 3300027682 Ga0209971_1003504 Ga0209971_10035043 301
379 3300027876 Ga0209974_10010132 Ga0209974_100101322 301
380 3300027876 Ga0209974_10032498 Ga0209974_100324982 301
381 3300027907 Ga0207428_10002055 Ga0207428_100020559 301
382 3300027907 Ga0207428_10007334 Ga0207428_100073342 301
383 3300027907 Ga0207428_10010695 Ga0207428_100106956 301
384 3300027907 Ga0207428_10015486 Ga0207428_100154866 301
385 3300027907 Ga0207428_10052578 Ga0207428_100525782 301
386 3300027907 Ga0207428_10186520 Ga0207428_101865202 301
387 3300028379 Ga0268266_10148552 Ga0268266_101485522 301
388 3300028379 Ga0268266_10316136 Ga0268266_103161362 301
389 3300028380 Ga0268265_10008126 Ga0268265_100081261 301
390 3300028380 Ga0268265_10405751 Ga0268265_104057511 301
391 3300028380 Ga0268265_10486324 Ga0268265_104863241 301
392 3300028381 Ga0268264_10024489 Ga0268264_100244893 301
393 3300028556 Ga0265337_1001439 Ga0265337_10014397 301
394 3300028558 Ga0265326_10001380 Ga0265326_100013806 301
395 3300028563 Ga0265319_1002798 Ga0265319_10027986 301
396 3300028573 Ga0265334_10005260 Ga0265334_100052602 301
397 3300028577 Ga0265318_10003474 Ga0265318_100034744 301
398 3300028653 Ga0265323_10000992 Ga0265323_100009926 301
399 3300028666 Ga0265336_10000063 Ga0265336_1000006380 301
400 3300028794 Ga0307515_10000292 Ga0307515_100002926 301
401 3300028794 Ga0307515_10000494 Ga0307515_1000049442 301
402 3300028794 Ga0307515_10039959 Ga0307515_100399594 301
403 3300028800 Ga0265338_10000154 Ga0265338_1000015414 301
404 3300029957 Ga0265324_10001590 Ga0265324_100015908 301
405 3300030522 Ga0307512_10037887 Ga0307512_100378873 301
406 3300031240 Ga0265320_10010219 Ga0265320_100102191 301
407 3300031247 Ga0265340_10005895 Ga0265340_100058955 301
408 3300031249 Ga0265339_10001335 Ga0265339_100013355 301
409 3300031251 Ga0265327_10005550 Ga0265327_100055504 301
410 3300031456 Ga0307513_10012018 Ga0307513_100120182 301
411 3300031456 Ga0307513_10012594 Ga0307513_100125942 301
412 3300031456 Ga0307513_10062057 Ga0307513_100620573 301
413 3300031507 Ga0307509_10024290 Ga0307509_100242905 301
414 3300031507 Ga0307509_10329973 Ga0307509_103299732 301
415 3300031548 Ga0307408_100000029 Ga0307408_10000002984 301
416 3300031548 Ga0307408_100015068 Ga0307408_1000150683 301
417 3300031548 Ga0307408_100086750 Ga0307408_1000867502 301
418 3300031595 Ga0265313_10004883 Ga0265313_100048838 301
419 3300031616 Ga0307508_10000096 Ga0307508_1000009618 301
420 3300031616 Ga0307508_10113029 Ga0307508_101130293 301
421 3300031649 Ga0307514_10001887 Ga0307514_1000188719 301
422 3300031711 Ga0265314_10027734 Ga0265314_100277344 301
423 3300031711 Ga0265314_10034777 Ga0265314_100347775 301
424 3300031712 Ga0265342_10023837 Ga0265342_100238373 301
425 3300031712 Ga0265342_10144661 Ga0265342_101446612 301
426 3300031730 Ga0307516_10001367 Ga0307516_100013677 301
427 3300031730 Ga0307516_10003526 Ga0307516_1000352611 301
428 3300031730 Ga0307516_10053532 Ga0307516_100535323 301
429 3300031730 Ga0307516_10140117 Ga0307516_101401172 301
430 3300031731 Ga0307405_10001234 Ga0307405_100012348 301
431 3300031824 Ga0307413_10002493 Ga0307413_100024933 301
432 3300031824 Ga0307413_10124258 Ga0307413_101242582 301
433 3300031852 Ga0307410_10010279 Ga0307410_100102791 301
434 3300031901 Ga0307406_10012325 Ga0307406_100123254 301
435 3300031911 Ga0307412_10004520 Ga0307412_100045206 301
436 3300031911 Ga0307412_10379705 Ga0307412_103797051 301
437 3300031995 Ga0307409_100005343 Ga0307409_1000053432 301
438 3300032002 Ga0307416_100005644 Ga0307416_1000056442 301
439 3300032002 Ga0307416_100475880 Ga0307416_1004758801 301
440 3300032005 Ga0307411_10003401 Ga0307411_100034015 301
441 3300035083 Ga0373926_0027932 Ga0373926_0027932_715_1626 301
442 3300035089 Ga0373944_0047809 Ga0373944_0047809_67_981 301
443 3300035113 Ga0373936_0001944 Ga0373936_0001944_1167_2081 301
444 3300035117 Ga0373953_0006315 Ga0373953_0006315_2729_3655 301
445 3300035118 Ga0373954_0075076 Ga0373954_0075076_147_1073 301
446 3300035119 Ga0373956_0171409 Ga0373956_0171409_75_989 301
447 3300035171 Ga0373946_0043886 Ga0373946_0043886_332_1246 301
448 3300035241 Ga0373961_0024428 Ga0373961_0024428_268_1173 301
449 3300035695 Ga0373927_0001069 Ga0373927_0001069_14028_14942 301
450 3300035695 Ga0373927_0010672 Ga0373927_0010672_1288_2226 301
451 3300035725 Ga0373947_0007770 Ga0373947_0007770_4515_5429 301
452 3300036401 Ga0373937_0037618 Ga0373937_0037618_3260_4174 301
453 3300036401 Ga0373937_0044534 Ga0373937_0044534_998_1912 301
454 3300037068 Ga0373925_0003237 Ga0373925_0003237_2412_3326 301
455 3300037312 Ga0395899_0219652 Ga0395899_0219652_148_1071 301
456 3300037418 Ga0395900_0016357 Ga0395900_0016357_2665_3606 301
457 3300037466 Ga0395898_0243873 Ga0395898_0243873_356_1297 301
458 3300037471 Ga0395905_0002341 Ga0395905_0002341_859_1791 301
459 3300037471 Ga0395905_0010810 Ga0395905_0010810_6550_7491 301
460 3300037471 Ga0395905_0034060 Ga0395905_0034060_2922_3863 301
461 3300037471 Ga0395905_0045282 Ga0395905_0045282_2492_3439 301
462 3300037471 Ga0395905_0060217 Ga0395905_0060217_749_1663 301
463 3300038443 Ga0395901_0118960 Ga0395901_0118960_524_1447 301
464 3300038726 Ga0400490_35285 Ga0400490_35285_4269_5186 301
465 3300038727 Ga0400491_04233 Ga0400491_04233_696_1613 301
466 3300038741 Ga0400488_34208 Ga0400488_34208_1540_2454 301
467 3300039062 Ga0400483_215880 Ga0400483_215880_3254_4168 301
468 3300039110 Ga0400487_20550 Ga0400487_20550_572_1486 301
469 3300039110 Ga0400487_34028 Ga0400487_34028_15185_16099 301
470 3300039437 Ga0436365_0151425 Ga0436365_0151425_221_1135 301
471 3300039437 Ga0436365_0476641 Ga0436365_0476641_385_1308 301
472 3300039438 Ga0436360_0109312 Ga0436360_0109312_214_1152 301
473 3300039438 Ga0436360_1087288 Ga0436360_1087288_1281_2228 301
474 3300039438 Ga0436360_1192691 Ga0436360_1192691_1911_2849 301
475 3300039447 Ga0436361_0193139 Ga0436361_0193139_2898_3830 301
476 3300039447 Ga0436361_0455065 Ga0436361_0455065_13311_14243 301
477 3300039450 Ga0436363_1505079 Ga0436363_1505079_425_1369 301
478 3300039453 Ga0436362_1236534 Ga0436362_1236534_596_1534 301
479 3300041999 Ga0439433_0018131 Ga0439433_0018131_73_1011 301
480 3300042007 Ga0439449_0005387 Ga0439449_0005387_1925_2863 301
481 3300042008 Ga0439450_009025 Ga0439450_009025_101_1006 301
482 3300042115 Ga0450911_001989 Ga0450911_001989_1927_2859 301
483 3300042435 Ga0439434_0060106 Ga0439434_0060106_115_1035 301
484 3300042436 Ga0439435_0024205 Ga0439435_0024205_648_1556 301
485 3300042531 Ga0450918_000016 Ga0450918_000016_30160_31098 301
486 3300042532 Ga0450893_0004350 Ga0450893_0004350_1081_1995 301
487 3300042876 Ga0451577_0000235 Ga0451577_0000235_67639_68565 301
488 3300042876 Ga0451577_0288313 Ga0451577_0288313_500_1426 301
489 3300044656 Ga0466969_0118683 Ga0466969_0118683_38_955 301
490 3300044658 Ga0466972_0000079 Ga0466972_0000079_14178_15110 301
491 3300044712 Ga0453684_0000906 Ga0453684_0000906_56764_57690 301
492 3300044712 Ga0453684_0069104 Ga0453684_0069104_1267_2181 301
493 3300044712 Ga0453684_0422095 Ga0453684_0422095_502_1428 301
494 3300045051 Ga0451576_0015435 Ga0451576_0015435_6397_7311 301
495 3300045051 Ga0451576_0124675 Ga0451576_0124675_859_1785 301
496 3300046454 Ga0495592_0019534 Ga0495592_0019534_3531_4445 301
497 3300046455 Ga0495603_0000064 Ga0495603_0000064_39583_40497 301
498 3300046455 Ga0495603_0155368 Ga0495603_0155368_23_955 301
499 3300046459 Ga0495629_0001770 Ga0495629_0001770_10148_11062 301
500 3300046459 Ga0495629_0105467 Ga0495629_0105467_927_1853 301
501 3300046460 Ga0495638_0000710 Ga0495638_0000710_1419_2360 301
502 3300046461 Ga0495641_0004409 Ga0495641_0004409_2215_3129 301
503 3300046462 Ga0495651_0029648 Ga0495651_0029648_1454_2380 301
504 3300046471 Ga0495650_0001530 Ga0495650_0001530_10140_11057 301
505 3300046472 Ga0495580_0002618 Ga0495580_0002618_10085_10999 301
506 3300046473 Ga0495582_0000197 Ga0495582_0000197_9673_10587 301
507 3300046475 Ga0495639_0001620 Ga0495639_0001620_5077_5991 301
508 3300046475 Ga0495639_0035744 Ga0495639_0035744_882_1799 301
509 3300046476 Ga0495662_0012317 Ga0495662_0012317_2322_3236 301
510 3300046477 Ga0495664_0011941 Ga0495664_0011941_1243_2157 301
511 3300046477 Ga0495664_0036973 Ga0495664_0036973_1923_2849 301
512 3300046491 Ga0495584_0031775 Ga0495584_0031775_1242_2210 301
513 3300046499 Ga0495594_0004585 Ga0495594_0004585_288_1202 301
514 3300046500 Ga0495596_0000604 Ga0495596_0000604_13892_14833 301
515 3300046500 Ga0495596_0010570 Ga0495596_0010570_1379_2347 301
516 3300046501 Ga0495607_0041240 Ga0495607_0041240_667_1608 301
517 3300046512 Ga0495610_0044439 Ga0495610_0044439_1031_1963 301
518 3300046514 Ga0495618_0023879 Ga0495618_0023879_2438_3352 301
519 3300046516 Ga0495628_0049588 Ga0495628_0049588_732_1658 301
520 3300046517 Ga0495630_0005383 Ga0495630_0005383_5209_6123 301
521 3300046519 Ga0495632_0017507 Ga0495632_0017507_2883_3824 301
522 3300046519 Ga0495632_0024422 Ga0495632_0024422_452_1384 301
523 3300046522 Ga0495643_0003067 Ga0495643_0003067_5787_6692 301
524 3300046522 Ga0495643_0029686 Ga0495643_0029686_1641_2582 301
525 3300046523 Ga0495644_0017097 Ga0495644_0017097_839_1780 301
526 3300046524 Ga0495648_0000070 Ga0495648_0000070_69147_70061 301
527 3300046528 Ga0495642_0030338 Ga0495642_0030338_931_1872 301
528 3300046529 Ga0495652_0040068 Ga0495652_0040068_1155_2069 301
529 3300046529 Ga0495652_0061314 Ga0495652_0061314_1667_2593 301
530 3300046531 Ga0495665_0000902 Ga0495665_0000902_6855_7769 301
531 3300046533 Ga0495640_0001505 Ga0495640_0001505_8038_8952 301
532 3300046538 Ga0495609_0028193 Ga0495609_0028193_1468_2409 301
533 3300046539 Ga0495621_0096422 Ga0495621_0096422_26_949 301
534 3300046542 Ga0495597_0003270 Ga0495597_0003270_496_1437 301
535 3300046557 Ga0495622_0001436 Ga0495622_0001436_2085_2999 301
536 3300046615 Ga0495656_0015604 Ga0495656_0015604_965_1933 301
537 3300046615 Ga0495656_0173623 Ga0495656_0173623_67_972 301
538 3300046616 Ga0495668_0000018 Ga0495668_0000018_173289_174227 301
539 3300046616 Ga0495668_0001435 Ga0495668_0001435_5930_6844 301
540 3300046648 Ga0495611_0006888 Ga0495611_0006888_2086_3027 301
541 3300046660 Ga0495625_0042913 Ga0495625_0042913_1569_2510 301
542 3300046663 Ga0495635_0000356 Ga0495635_0000356_8467_9381 301
543 3300046665 Ga0495661_0053208 Ga0495661_0053208_444_1385 301
544 3300046674 Ga0495588_0000619 Ga0495588_0000619_10567_11481 301
545 3300046678 Ga0495599_0015026 Ga0495599_0015026_2049_2975 301
546 3300046679 Ga0495623_0089260 Ga0495623_0089260_38_970 301
547 3300046681 Ga0495647_0022565 Ga0495647_0022565_494_1408 301
548 3300046683 Ga0495658_0003461 Ga0495658_0003461_5173_6087 301
549 3300046689 Ga0495613_0004786 Ga0495613_0004786_3228_4142 301
550 3300046689 Ga0495613_0050119 Ga0495613_0050119_1136_2062 301
551 3300046690 Ga0495624_0001264 Ga0495624_0001264_6501_7415 301
552 3300046691 Ga0495670_0012551 Ga0495670_0012551_789_1745 301
553 3300046691 Ga0495670_0056496 Ga0495670_0056496_426_1340 301
554 3300046794 Ga0495589_0037901 Ga0495589_0037901_404_1345 301
555 3300046810 Ga0495660_0025343 Ga0495660_0025343_250_1164 301
556 3300047315 Ga0495581_0002800 Ga0495581_0002800_6482_7396 301
557 3300047317 Ga0495604_0091766 Ga0495604_0091766_84_1010 301
558 3300047319 Ga0495674_0069526 Ga0495674_0069526_1888_2814 301
559 3300047322 Ga0495680_0016989 Ga0495680_0016989_5078_6004 301
560 3300047447 Ga0495685_022972 Ga0495685_022972_270_1211 301
561 3300047673 Ga0495593_0000053 Ga0495593_0000053_39453_40367 301
562 3300048088 Ga0495602_0171272 Ga0495602_0171272_309_1241 301
563 3300048088 Ga0495602_0195990 Ga0495602_0195990_432_1427 301
564 3300048089 Ga0495614_0035545 Ga0495614_0035545_555_1469 301
565 3300048091 Ga0495626_0000868 Ga0495626_0000868_20158_21078 301
566 3300048091 Ga0495626_0020961 Ga0495626_0020961_1401_2342 301
567 3300048904 Ga0496101_0004586 Ga0496101_0004586_4548_5474 301
568 3300048905 Ga0496102_0007305 Ga0496102_0007305_6889_7815 301
569 3300048907 Ga0496104_0163229 Ga0496104_0163229_12_950 301
570 3300048907 Ga0496104_0167719 Ga0496104_0167719_532_1449 301
571 3300048907 Ga0496104_0184256 Ga0496104_0184256_710_1672 301
572 3300048908 Ga0496105_0000572 Ga0496105_0000572_8050_8988 301
573 3300048908 Ga0496105_0022207 Ga0496105_0022207_4054_4980 301
574 3300048908 Ga0496105_0066814 Ga0496105_0066814_1396_2313 301
575 3300048909 Ga0496106_0420367 Ga0496106_0420367_37_954 301
576 3300048910 Ga0496107_0000808 Ga0496107_0000808_4535_5461 301
577 3300048910 Ga0496107_0211643 Ga0496107_0211643_283_1200 301
578 3300048918 Ga0496115_0059959 Ga0496115_0059959_1980_2942 301
579 3300048924 Ga0496121_0057214 Ga0496121_0057214_779_1702 301
580 3300048927 Ga0496124_0106707 Ga0496124_0106707_160_1074 301
581 3300048928 Ga0496125_0038093 Ga0496125_0038093_1817_2749 301
582 3300048928 Ga0496125_0087591 Ga0496125_0087591_858_1775 301
583 3300048929 Ga0496126_0284820 Ga0496126_0284820_397_1311 301
584 3300048929 Ga0496126_0310800 Ga0496126_0310800_189_1103 301
585 3300049459 Ga0495678_003261 Ga0495678_003261_8673_9587 301
586 3300049460 Ga0495682_0019068 Ga0495682_0019068_1040_1981 301
587 3300049568 Ga0501031_0001824 Ga0501031_0001824_5272_6189 301
588 3300049571 Ga0501034_0186886 Ga0501034_0186886_1025_1942 301
589 3300049583 Ga0501067_0023296 Ga0501067_0023296_740_1672 301
590 3300049583 Ga0501067_0028047 Ga0501067_0028047_346_1263 301
591 3300049649 Ga0501198_000037 Ga0501198_000037_50165_51097 301
592 3300049662 Ga0501222_000032 Ga0501222_000032_12936_13868 301
593 3300049688 Ga0501259_017361 Ga0501259_017361_138_1043 301
594 3300050493 nmdc:mga0k408_23715_c1 nmdc:mga0k408_23715_c1_65_973 301
595 3300050496 nmdc:mga07m45_5721_c1 nmdc:mga07m45_5721_c1_3441_4358 301
596 3300050507 nmdc:mga05p37_180532_c1 nmdc:mga05p37_180532_c1_469_1374 301
597 3300050507 nmdc:mga05p37_19865_c1 nmdc:mga05p37_19865_c1_124_1029 301
598 3300050507 nmdc:mga05p37_208757_c1 nmdc:mga05p37_208757_c1_141_1046 301
599 3300050507 nmdc:mga05p37_52613_c1 nmdc:mga05p37_52613_c1_2352_3266 301
600 3300050508 nmdc:mga09592_11616_c1 nmdc:mga09592_11616_c1_6059_6967 301
601 3300050508 nmdc:mga09592_190386_c1 nmdc:mga09592_190386_c1_462_1367 301
602 3300050508 nmdc:mga09592_23749_c1 nmdc:mga09592_23749_c1_1808_2716 301
603 3300050509 nmdc:mga0qj67_1010_c1 nmdc:mga0qj67_1010_c1_16093_17001 301
604 3300050509 nmdc:mga0qj67_112735_c1 nmdc:mga0qj67_112735_c1_240_1145 301
605 3300050510 nmdc:mga06r32_3055_c1 nmdc:mga06r32_3055_c1_11550_12458 301
606 3300050510 nmdc:mga06r32_36396_c1 nmdc:mga06r32_36396_c1_3327_4235 301
607 3300050510 nmdc:mga06r32_78341_c1 nmdc:mga06r32_78341_c1_461_1366 301
608 3300050511 nmdc:mga08y16_148858_c1 nmdc:mga08y16_148858_c1_519_1424 301
609 3300050511 nmdc:mga08y16_1998_c1 nmdc:mga08y16_1998_c1_5131_6039 301
610 3300050511 nmdc:mga08y16_23677_c1 nmdc:mga08y16_23677_c1_3651_4556 301
611 3300050511 nmdc:mga08y16_5088_c1 nmdc:mga08y16_5088_c1_5355_6263 301
612 3300050511 nmdc:mga08y16_51502_c1 nmdc:mga08y16_51502_c1_1876_2781 301
613 3300050511 nmdc:mga08y16_547333_c1 nmdc:mga08y16_547333_c1_70_975 301
614 3300050511 nmdc:mga08y16_5509_c1 nmdc:mga08y16_5509_c1_2467_3372 301
615 3300050511 nmdc:mga08y16_596848_c1 nmdc:mga08y16_596848_c1_196_1101 301
616 3300050512 nmdc:mga0n895_2763_c1 nmdc:mga0n895_2763_c1_1684_2589 301
617 3300050512 nmdc:mga0n895_3027_c1 nmdc:mga0n895_3027_c1_625_1530 301
618 3300050512 nmdc:mga0n895_38591_c1 nmdc:mga0n895_38591_c1_3693_4598 301
619 3300050512 nmdc:mga0n895_412338_c1 nmdc:mga0n895_412338_c1_131_1045 301
620 3300050512 nmdc:mga0n895_67403_c1 nmdc:mga0n895_67403_c1_1052_1987 301
621 3300050513 nmdc:mga0rr50_142109_c1 nmdc:mga0rr50_142109_c1_376_1290 301
622 3300050513 nmdc:mga0rr50_231643_c1 nmdc:mga0rr50_231643_c1_123_1040 301
623 3300050513 nmdc:mga0rr50_43386_c1 nmdc:mga0rr50_43386_c1_1767_2672 301
624 3300050515 nmdc:mga0a205_1255_c1 nmdc:mga0a205_1255_c1_16913_17818 301
625 3300050515 nmdc:mga0a205_3105_c1 nmdc:mga0a205_3105_c1_1303_2208 301
626 3300050515 nmdc:mga0a205_447_c1 nmdc:mga0a205_447_c1_29351_30256 301
627 3300050515 nmdc:mga0a205_85247_c1 nmdc:mga0a205_85247_c1_1591_2505 301
628 3300053083 Ga0495655_0004612 Ga0495655_0004612_1258_2172 301
629 3300053117 Ga0500593_000250 Ga0500593_000250_12307_13224 301
630 3300054114 Ga0501084_0291317 Ga0501084_0291317_161_1066 301
631 3300059423 Ga0590074_015400 Ga0590074_015400_329_1270 301
632 iso_pu_bacteria 2842718218 2842719400 301
633 iso_pu_bacteria 2904690495 2904695482 301
634 iso_pu_bacteria 2908756301 2908757472 301
635 iso_pu_bacteria 2919704043 2919705025 301
636 iso_pu_bacteria 2928115317 2928117047 301
637 iso_pu_bacteria 8006926726 8006930744 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

29

118

0.94

PF04909

Amidohydro_2

Amidohydrolase

113

269

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.9654 9 298
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.961 5 298
4d8l-assembly1.cif.gz_A crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis 0.9604 10 298
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.929 5 298
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.929 9 298
ID Description Score Start End Superfamily
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9613 5 298 3.20.20.140
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9261 5 298 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.857 18 299 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8455 18 299 3.20.20.140
2ffiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8454 23 298 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A833FUB3-F1-model_v4 Amidohydrolase family protein 0.9974 115 298 GO:0016787
AF-A0A4Q3N7X8-F1-model_v4 deleted 0.9968 140 298
AF-A0A2R7NPL9-F1-model_v4 2-pyrone-4,6-dicarboxylate hydrolase 0.9964 78 298 GO:0016787
AF-Q13CG7-F1-model_v4 Amidohydrolase 2 0.9961 1 298 GO:0016787
AF-A0A519I5F2-F1-model_v4 2-pyrone-4,6-dicarboxylate hydrolase 0.995 193 298 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map