F469461

General Info

Members Datasets Scaffolds Average Seq Length
615 296 1230 214

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0035085|Ga0451577_0035085_551_1303
Length 250
Sequence VKLNFKLSLPKFGKKAGGKQVVSVPKASLPKLPPIDFKEIAEQFKGLNPNDIGTWPLAPRLAVLAAIFVGIIVAGWFVLWSSQLDTLTAKGQEELKLKDEYVAKKGQAINLELYTQQLNQIDLTFGAQLKQLPNKSEVESLLIEINQAGLGRGLQFELFKPGSEAMKDFYAELPIQVKLVGSYHDFGAFAADIGKLSRIVTLSNVAISQGKDGGLLTLEAVAKTFRYLDDEEMAAVKKAARDAKKAGEKK

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
287 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
293 2547132512 Azospira oryzae 6a3 Isolate Unclassified
294 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
295 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
296 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0.49
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 98.21
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0035085 3300042876 Bacteria 4519
2 JGI24750J21931_1023972 3300002070 Bacteria 868
3 Ga0055530_10002193 3300003791 Bacteria 12916
4 Ga0058859_11725196 3300004798 Bacteria 1549
5 Ga0058860_12081681 3300004801 Bacteria 1216
6 Ga0065707_10109239 3300005295 Bacteria 2468
7 Ga0070676_10352229 3300005328 Bacteria 1012
8 Ga0070690_100001346 3300005330 Bacteria 12774
9 Ga0070690_100374212 3300005330 Bacteria 1040
10 Ga0070677_10360085 3300005333 Bacteria 756
11 Ga0068869_100000038 3300005334 Bacteria 54696
12 Ga0068869_100153113 3300005334 Bacteria 1790
13 Ga0068869_100456246 3300005334 Bacteria 1060
14 Ga0070680_100001895 3300005336 Bacteria 15343
15 Ga0070680_100052878 3300005336 Bacteria 3314
16 Ga0070680_100092643 3300005336 Bacteria 2502
17 Ga0070680_100389061 3300005336 Bacteria 1188
18 Ga0070682_100008909 3300005337 Bacteria 5667
19 Ga0068868_100000087 3300005338 Bacteria 56475
20 Ga0070689_100004169 3300005340 Bacteria 9742
21 Ga0070689_100038066 3300005340 Bacteria 3679
22 Ga0070689_100100840 3300005340 Bacteria 2285
23 Ga0070689_100285327 3300005340 Bacteria 1370
24 Ga0070691_10006255 3300005341 Bacteria 5438
25 Ga0070691_10272187 3300005341 Bacteria 916
26 Ga0070687_100000019 3300005343 Bacteria 53616
27 Ga0070687_100081312 3300005343 Bacteria 1768
28 Ga0070692_10005775 3300005345 Bacteria 5319
29 Ga0070692_10049631 3300005345 Bacteria 2177
30 Ga0070692_10148759 3300005345 Bacteria 1332
31 Ga0070692_10285348 3300005345 Bacteria 1002
32 Ga0070669_100006619 3300005353 Bacteria 8343
33 Ga0070675_100152826 3300005354 Bacteria 1980
34 Ga0070675_100456543 3300005354 Bacteria 1146
35 Ga0070671_100060823 3300005355 Bacteria 3145
36 Ga0070671_100667223 3300005355 Bacteria 901
37 Ga0070673_100104984 3300005364 Bacteria 2334
38 Ga0070688_100121479 3300005365 Bacteria 1750
39 Ga0070688_100178328 3300005365 Bacteria 1472
40 Ga0070667_100829065 3300005367 Bacteria 859
41 Ga0070710_10039476 3300005437 Bacteria 2598
42 Ga0070701_10000033 3300005438 Bacteria 34657
43 Ga0070705_100000060 3300005440 Bacteria 56895
44 Ga0070705_100001881 3300005440 Bacteria 10790
45 Ga0070705_100004175 3300005440 Bacteria 7056
46 Ga0070700_100000513 3300005441 Bacteria 19314
47 Ga0070700_100050632 3300005441 Bacteria 2582
48 Ga0070700_100123280 3300005441 Bacteria 1739
49 Ga0070700_100398830 3300005441 Bacteria 1034
50 Ga0070694_100000365 3300005444 Bacteria 24252
51 Ga0070694_100056007 3300005444 Bacteria 2676
52 Ga0070694_100128792 3300005444 Bacteria 1826
53 Ga0070694_100163816 3300005444 Bacteria 1634
54 Ga0070694_100590225 3300005444 Bacteria 893
55 Ga0070708_100206130 3300005445 Bacteria 1842
56 Ga0070681_10191104 3300005458 Bacteria 1967
57 Ga0068867_100000199 3300005459 Bacteria 39822
58 Ga0068867_100000810 3300005459 Bacteria 21084
59 Ga0068867_100394655 3300005459 Bacteria 1165
60 Ga0070706_100091151 3300005467 Bacteria 2827
61 Ga0070706_100290335 3300005467 Unclassified 1526
62 Ga0070707_100500614 3300005468 Bacteria 1177
63 Ga0070707_100708943 3300005468 Bacteria 969
64 Ga0070698_100021525 3300005471 Bacteria 6754
65 Ga0070699_100031013 3300005518 Bacteria 4616
66 Ga0070679_100019885 3300005530 Bacteria 6539
67 Ga0070679_100031192 3300005530 Bacteria 5265
68 Ga0070684_100137455 3300005535 Bacteria 2208
69 Ga0070697_100019191 3300005536 Bacteria 5399
70 Ga0070686_100000377 3300005544 Bacteria 28422
71 Ga0070686_100119176 3300005544 Bacteria 1810
72 Ga0070686_100327198 3300005544 Bacteria 1145
73 Ga0070695_100000012 3300005545 Bacteria 69784
74 Ga0070695_100009375 3300005545 Bacteria 5824
75 Ga0070695_100052424 3300005545 Bacteria 2621
76 Ga0070695_100280690 3300005545 Bacteria 1224
77 Ga0070696_100001489 3300005546 Bacteria 15344
78 Ga0070696_100004782 3300005546 Bacteria 9052
79 Ga0070696_100342665 3300005546 Bacteria 1155
80 Ga0070696_100741479 3300005546 Bacteria 804
81 Ga0070693_100000113 3300005547 Bacteria 35972
82 Ga0070693_100138588 3300005547 Bacteria 1529
83 Ga0070693_100302633 3300005547 Bacteria 1078
84 Ga0070704_100000059 3300005549 Bacteria 35749
85 Ga0070704_100010506 3300005549 Bacteria 5635
86 Ga0070704_100066093 3300005549 Bacteria 2606
87 Ga0070704_100292356 3300005549 Bacteria 1354
88 Ga0070704_100311799 3300005549 Unclassified 1315
89 Ga0068855_100003164 3300005563 Bacteria 20146
90 Ga0068857_100139618 3300005577 Bacteria 2190
91 Ga0068854_100004851 3300005578 Bacteria 8483
92 Ga0068856_100282055 3300005614 Bacteria 1678
93 Ga0070702_100000086 3300005615 Bacteria 27297
94 Ga0070702_100055076 3300005615 Bacteria 2291
95 Ga0070702_100161748 3300005615 Bacteria 1448
96 Ga0070702_100244351 3300005615 Bacteria 1213
97 Ga0068859_100026401 3300005617 Bacteria 5823
98 Ga0068859_100083689 3300005617 Bacteria 3234
99 Ga0068859_100208474 3300005617 Bacteria 2040
100 Ga0068859_100972758 3300005617 Bacteria 931
101 Ga0068866_10000122 3300005718 Bacteria 34190
102 Ga0068861_100000171 3300005719 Bacteria 34407
103 Ga0068861_100010431 3300005719 Bacteria 6450
104 Ga0068861_101297383 3300005719 Bacteria 708
105 Ga0068870_10006581 3300005840 Bacteria 5131
106 Ga0068870_10246113 3300005840 Bacteria 1106
107 Ga0068863_100298504 3300005841 Bacteria 1562
108 Ga0068858_100044159 3300005842 Bacteria 4132
109 Ga0068858_100145852 3300005842 Bacteria 2223
110 Ga0068860_100000832 3300005843 Bacteria 34498
111 Ga0068862_100000274 3300005844 Bacteria 57686
112 Ga0068862_100006228 3300005844 Bacteria 9934
113 Ga0068862_100540451 3300005844 Bacteria 1111
114 Ga0068862_100990536 3300005844 Bacteria 831
115 Ga0081538_10052476 3300005981 Bacteria 2436
116 Ga0070716_100002115 3300006173 Bacteria 9124
117 Ga0070712_100359953 3300006175 Bacteria 1193
118 Ga0075366_10017615 3300006195 Bacteria 4114
119 Ga0097621_100009696 3300006237 Bacteria 7003
120 Ga0068871_100000225 3300006358 Bacteria 39948
121 Ga0068871_100008238 3300006358 Bacteria 7492
122 Ga0068871_100939922 3300006358 Bacteria 803
123 Ga0075428_100008896 3300006844 Bacteria 11142
124 Ga0075428_100019799 3300006844 Bacteria 7448
125 Ga0075428_100145494 3300006844 Bacteria 2576
126 Ga0075428_100476114 3300006844 Bacteria 1336
127 Ga0075428_100755532 3300006844 Bacteria 1034
128 Ga0075430_100001649 3300006846 Bacteria 18210
129 Ga0075430_100037596 3300006846 Bacteria 4103
130 Ga0075430_100086127 3300006846 Bacteria 2630
131 Ga0075430_100491637 3300006846 Bacteria 1012
132 Ga0075430_100527470 3300006846 Bacteria 974
133 Ga0075431_100326793 3300006847 Bacteria 1546
134 Ga0075433_10000171 3300006852 Bacteria 35683
135 Ga0075433_10387228 3300006852 Bacteria 1234
136 Ga0075434_100000247 3300006871 Bacteria 37944
137 Ga0075434_100000662 3300006871 Bacteria 26707
138 Ga0075434_100013180 3300006871 Bacteria 7855
139 Ga0075434_100016075 3300006871 Bacteria 7191
140 Ga0075434_100433432 3300006871 Bacteria 1336
141 Ga0075429_100000404 3300006880 Bacteria 31949
142 Ga0075429_100741448 3300006880 Bacteria 860
143 Ga0068865_100000124 3300006881 Bacteria 39513
144 Ga0068865_100034828 3300006881 Bacteria 3381
145 Ga0075436_100000153 3300006914 Bacteria 42824
146 Ga0075436_100008039 3300006914 Bacteria 7221
147 Ga0075436_100026936 3300006914 Bacteria 3958
148 Ga0075436_100031040 3300006914 Bacteria 3677
149 Ga0075436_100033418 3300006914 Bacteria 3546
150 Ga0075436_100034633 3300006914 Bacteria 3482
151 Ga0075436_100156201 3300006914 Bacteria 1607
152 Ga0075436_100208401 3300006914 Bacteria 1385
153 Ga0097620_100026400 3300006931 Bacteria 5823
154 Ga0097620_100083683 3300006931 Bacteria 3234
155 Ga0097620_100208473 3300006931 Bacteria 2040
156 Ga0097620_100972762 3300006931 Bacteria 931
157 Ga0075435_100005954 3300007076 Bacteria 8578
158 Ga0075435_100007722 3300007076 Bacteria 7689
159 Ga0075435_100030335 3300007076 Bacteria 4250
160 Ga0075435_100169767 3300007076 Bacteria 1840
161 Ga0099794_10002375 3300007265 Bacteria 6930
162 Ga0099794_10010591 3300007265 Bacteria 3921
163 Ga0099794_10011534 3300007265 Bacteria 3785
164 Ga0099795_10015261 3300007788 Bacteria 2402
165 Ga0111539_10044126 3300009094 Bacteria 5342
166 Ga0111539_10062513 3300009094 Bacteria 4407
167 Ga0111539_10187971 3300009094 Bacteria 2411
168 Ga0105245_10007074 3300009098 Bacteria 9843
169 Ga0114129_10042355 3300009147 Bacteria 6412
170 Ga0114129_10109365 3300009147 Bacteria 3816
171 Ga0114129_10311065 3300009147 Bacteria 2097
172 Ga0114129_10893864 3300009147 Bacteria 1126
173 Ga0105243_10003692 3300009148 Bacteria 12305
174 Ga0105243_10004588 3300009148 Bacteria 10894
175 Ga0105243_10239325 3300009148 Bacteria 1614
176 Ga0105243_10480422 3300009148 Bacteria 1172
177 Ga0105241_10006274 3300009174 Bacteria 8767
178 Ga0105242_10000061 3300009176 Bacteria 75148
179 Ga0105242_10373322 3300009176 Bacteria 1323
180 Ga0105248_10161317 3300009177 Bacteria 2529
181 Ga0105248_10399064 3300009177 Bacteria 1548
182 Ga0105237_10377760 3300009545 Bacteria 1422
183 Ga0105249_10000940 3300009553 Bacteria 25776
184 Ga0105249_10002301 3300009553 Bacteria 16593
185 Ga0105249_10345727 3300009553 Bacteria 1505
186 Ga0099796_10237834 3300010159 Bacteria 752
187 Ga0105239_10090916 3300010375 Bacteria 3368
188 Ga0157378_10000911 3300013297 Bacteria 27218
189 Ga0163162_10334146 3300013306 Bacteria 1648
190 Ga0163162_10691601 3300013306 Bacteria 1142
191 Ga0157372_10463056 3300013307 Bacteria 1478
192 Ga0157380_10013393 3300014326 Bacteria 5977
193 Ga0157380_10050017 3300014326 Bacteria 3299
194 Ga0157380_10137932 3300014326 Bacteria 2091
195 Ga0157377_10012036 3300014745 Bacteria 4339
196 Ga0157376_10002096 3300014969 Bacteria 13416
197 Ga0207653_10002382 3300025885 Bacteria 5989
198 Ga0207642_10000452 3300025899 Bacteria 12489
199 Ga0207642_10048962 3300025899 Bacteria 1897
200 Ga0207688_10027378 3300025901 Bacteria 3136
201 Ga0207688_10029512 3300025901 Bacteria 3020
202 Ga0207645_10039499 3300025907 Bacteria 3024
203 Ga0207645_10125561 3300025907 Bacteria 1668
204 Ga0207643_10011092 3300025908 Bacteria 4864
205 Ga0207643_10018967 3300025908 Bacteria 3767
206 Ga0207684_10093523 3300025910 Bacteria 2564
207 Ga0207684_10493275 3300025910 Bacteria 1050
208 Ga0207654_10005492 3300025911 Bacteria 6414
209 Ga0207707_10007469 3300025912 Bacteria 9521
210 Ga0207707_10294252 3300025912 Bacteria 1404
211 Ga0207663_10080309 3300025916 Bacteria 2132
212 Ga0207660_10040871 3300025917 Bacteria 3248
213 Ga0207660_10090865 3300025917 Bacteria 2263
214 Ga0207660_10426875 3300025917 Bacteria 1070
215 Ga0207662_10000029 3300025918 Bacteria 65163
216 Ga0207662_10037936 3300025918 Bacteria 2823
217 Ga0207662_10242559 3300025918 Bacteria 1180
218 Ga0207652_10011390 3300025921 Bacteria 7167
219 Ga0207646_10202529 3300025922 Bacteria 1793
220 Ga0207681_10014597 3300025923 Bacteria 4887
221 Ga0207659_10019977 3300025926 Bacteria 4420
222 Ga0207687_10001385 3300025927 Bacteria 16545
223 Ga0207644_10067838 3300025931 Bacteria 2601
224 Ga0207686_10009694 3300025934 Bacteria 5232
225 Ga0207686_10136813 3300025934 Bacteria 1688
226 Ga0207709_10001813 3300025935 Bacteria 14261
227 Ga0207709_10080119 3300025935 Bacteria 2102
228 Ga0207709_10115418 3300025935 Bacteria 1803
229 Ga0207670_10000618 3300025936 Bacteria 19134
230 Ga0207670_10026590 3300025936 Bacteria 3648
231 Ga0207670_10162646 3300025936 Bacteria 1667
232 Ga0207670_10197160 3300025936 Bacteria 1527
233 Ga0207669_10591569 3300025937 Bacteria 901
234 Ga0207704_10001489 3300025938 Bacteria 10496
235 Ga0207704_10014112 3300025938 Bacteria 4025
236 Ga0207665_10001087 3300025939 Bacteria 18295
237 Ga0207665_10197944 3300025939 Bacteria 1463
238 Ga0207665_10332437 3300025939 Bacteria 1143
239 Ga0207691_10116575 3300025940 Bacteria 2370
240 Ga0207689_10084693 3300025942 Bacteria 2606
241 Ga0207689_10091704 3300025942 Bacteria 2496
242 Ga0207661_10217491 3300025944 Bacteria 1687
243 Ga0207667_10122152 3300025949 Bacteria 2684
244 Ga0207651_10426841 3300025960 Bacteria 1133
245 Ga0207651_10495526 3300025960 Bacteria 1055
246 Ga0207712_10027999 3300025961 Bacteria 3766
247 Ga0207712_10060570 3300025961 Bacteria 2684
248 Ga0207668_10130032 3300025972 Bacteria 1921
249 Ga0207640_10001918 3300025981 Bacteria 11181
250 Ga0207677_10009961 3300026023 Bacteria 5361
251 Ga0207703_10002228 3300026035 Bacteria 16982
252 Ga0207703_10049754 3300026035 Bacteria 3389
253 Ga0207708_10013647 3300026075 Bacteria 6069
254 Ga0207708_10058203 3300026075 Bacteria 2949
255 Ga0207708_10154028 3300026075 Bacteria 1812
256 Ga0207708_10307139 3300026075 Bacteria 1291
257 Ga0207708_10405059 3300026075 Bacteria 1129
258 Ga0207702_10329454 3300026078 Bacteria 1456
259 Ga0207641_10355087 3300026088 Bacteria 1398
260 Ga0207648_10000055 3300026089 Bacteria 106101
261 Ga0207648_10006440 3300026089 Bacteria 11667
262 Ga0207676_10063912 3300026095 Bacteria 2924
263 Ga0207674_10144119 3300026116 Bacteria 2341
264 Ga0207675_100000188 3300026118 Bacteria 56065
265 Ga0207675_100001245 3300026118 Bacteria 25404
266 Ga0207675_100219682 3300026118 Bacteria 1831
267 Ga0207683_10130714 3300026121 Bacteria 2258
268 Ga0209969_1003878 3300027360 Bacteria 2083
269 Ga0209967_1005701 3300027364 Bacteria 1679
270 Ga0209967_1006879 3300027364 Bacteria 1549
271 Ga0209981_1003604 3300027378 Bacteria 2010
272 Ga0209981_1008960 3300027378 Bacteria 1364
273 Ga0209996_1010498 3300027395 Bacteria 1230
274 Ga0210000_1010131 3300027462 Bacteria 1393
275 Ga0209999_1000579 3300027543 Bacteria 5778
276 Ga0210002_1007573 3300027617 Bacteria 1648
277 Ga0209588_1001855 3300027671 Bacteria 5637
278 Ga0209588_1004931 3300027671 Bacteria 3794
279 Ga0209588_1027185 3300027671 Bacteria 1820
280 Ga0209971_1001918 3300027682 Bacteria 5081
281 Ga0209971_1013633 3300027682 Bacteria 1925
282 Ga0209998_10046431 3300027717 Bacteria 997
283 Ga0209974_10011351 3300027876 Bacteria 2994
284 Ga0207428_10013066 3300027907 Bacteria 7272
285 Ga0268265_10001356 3300028380 Bacteria 20872
286 Ga0268265_10003023 3300028380 Bacteria 12271
287 Ga0268265_10444760 3300028380 Bacteria 1209
288 Ga0268264_10001502 3300028381 Bacteria 21740
289 Ga0265323_10005124 3300028653 Bacteria 5584
290 Ga0265332_10000077 3300031238 Bacteria 84198
291 Ga0265316_10094425 3300031344 Bacteria 2279
292 Ga0307509_10000018 3300031507 Bacteria 258998
293 Ga0307408_100523049 3300031548 Bacteria 1042
294 Ga0316575_10007587 3300031665 Bacteria 3928
295 Ga0316575_10186324 3300031665 Bacteria 862
296 Ga0316579_10000528 3300031691 Bacteria 12556
297 Ga0316578_10064409 3300031728 Bacteria 2163
298 Ga0307406_10090868 3300031901 Bacteria 2056
299 Ga0307407_10105547 3300031903 Bacteria 1758
300 Ga0307416_100298772 3300032002 Bacteria 1599
301 Ga0307416_100369129 3300032002 Bacteria 1460
302 Ga0307416_101149809 3300032002 Bacteria 881
303 Ga0307416_101501369 3300032002 Bacteria 779
304 Ga0307411_11127941 3300032005 Bacteria 708
305 Ga0316583_10000519 3300032133 Bacteria 11585
306 Ga0316593_10050888 3300032168 Bacteria 1399
307 Ga0373950_0022652 3300034818 Bacteria 1119
308 Ga0373934_0002280 3300035086 Bacteria 7060
309 Ga0373934_0047340 3300035086 Bacteria 1701
310 Ga0373934_0250047 3300035086 Bacteria 733
311 Ga0373923_0012805 3300035111 Bacteria 3113
312 Ga0373936_0000889 3300035113 Bacteria 10689
313 Ga0373936_0087976 3300035113 Bacteria 1299
314 Ga0373936_0128765 3300035113 Bacteria 1086
315 Ga0373945_0126943 3300035116 Bacteria 1019
316 Ga0373953_0284676 3300035117 Bacteria 720
317 Ga0373954_0001416 3300035118 Bacteria 9720
318 Ga0373954_0002079 3300035118 Bacteria 8308
319 Ga0373954_0010175 3300035118 Bacteria 4146
320 Ga0373956_0000124 3300035119 Bacteria 27145
321 Ga0373956_0008670 3300035119 Bacteria 4117
322 Ga0373956_0014877 3300035119 Bacteria 3253
323 Ga0373957_0000670 3300035120 Bacteria 8831
324 Ga0373957_0008547 3300035120 Bacteria 3321
325 Ga0373960_0008678 3300035121 Bacteria 2443
326 Ga0373960_0042895 3300035121 Bacteria 1315
327 Ga0373960_0126803 3300035121 Bacteria 852
328 Ga0373943_0009723 3300035170 Bacteria 4307
329 Ga0373943_0016637 3300035170 Bacteria 3356
330 Ga0373943_0066659 3300035170 Bacteria 1813
331 Ga0373946_0011804 3300035171 Bacteria 3266
332 Ga0373946_0013762 3300035171 Bacteria 3044
333 Ga0373955_0007891 3300035172 Bacteria 4914
334 Ga0373955_0008840 3300035172 Bacteria 4695
335 Ga0373955_0318449 3300035172 Unclassified 939
336 Ga0373961_0059231 3300035241 Bacteria 1157
337 Ga0316574_0044532 3300035398 Unclassified 2745
338 Ga0373924_0000737 3300035410 Bacteria 10200
339 Ga0373924_0206311 3300035410 Bacteria 867
340 Ga0373931_0013060 3300035691 Bacteria 4036
341 Ga0373935_0011893 3300035692 Bacteria 5229
342 Ga0373927_0023076 3300035695 Bacteria 4075
343 Ga0373927_0125496 3300035695 Bacteria 1675
344 Ga0373933_0000331 3300035724 Bacteria 30365
345 Ga0373933_0014198 3300035724 Bacteria 4424
346 Ga0373933_0040281 3300035724 Bacteria 2752
347 Ga0373933_0425440 3300035724 Bacteria 867
348 Ga0373947_0146664 3300035725 Bacteria 1517
349 Ga0373937_0001929 3300036401 Bacteria 17353
350 Ga0373937_0005477 3300036401 Bacteria 10872
351 Ga0373937_0016729 3300036401 Bacteria 6518
352 Ga0373937_0058335 3300036401 Bacteria 3546
353 Ga0373937_0432407 3300036401 Bacteria 1249
354 Ga0316582_0001940 3300036647 Bacteria 9444
355 Ga0373925_0178278 3300037068 Bacteria 1680
356 Ga0395900_0001750 3300037418 Bacteria 24987
357 Ga0316581_0001202 3300037588 Bacteria 5695
358 Ga0242420_037695 3300038996 Bacteria 916
359 Ga0439453_0001593 3300041408 Bacteria 2954
360 Ga0439461_0011683 3300041410 Bacteria 1633
361 Ga0439441_000063 3300042001 Bacteria 8229
362 Ga0439441_004892 3300042001 Bacteria 2053
363 Ga0439443_001286 3300042003 Bacteria 2703
364 Ga0439443_001576 3300042003 Bacteria 2555
365 Ga0439445_0131469 3300042004 Bacteria 723
366 Ga0439451_003435 3300042009 Bacteria 3212
367 Ga0439446_0013025 3300042156 Bacteria 2277
368 Ga0439434_0003355 3300042435 Bacteria 4696
369 Ga0439434_0008958 3300042435 Bacteria 2942
370 Ga0439435_0000255 3300042436 Bacteria 7747
371 Ga0439435_0000491 3300042436 Bacteria 6279
372 Ga0439435_0005225 3300042436 Bacteria 2845
373 Ga0439444_0000064 3300042437 Bacteria 7932
374 Ga0439444_0000255 3300042437 Bacteria 5297
375 Ga0439460_0000984 3300042461 Bacteria 6565
376 Ga0439460_0002319 3300042461 Bacteria 4574
377 Ga0451577_0000489 3300042876 Bacteria 67100
378 Ga0451577_0026082 3300042876 Bacteria 5295
379 Ga0451577_0056873 3300042876 Bacteria 3489
380 Ga0453684_0000014 3300044712 Bacteria 993311
381 Ga0453684_0000826 3300044712 Bacteria 104663
382 Ga0453684_0002735 3300044712 Bacteria 41744
383 Ga0453684_0006614 3300044712 Bacteria 21910
384 Ga0451576_0002078 3300045051 Bacteria 31306
385 Ga0451576_0018822 3300045051 Bacteria 7550
386 Ga0451576_0020161 3300045051 Bacteria 7264
387 Ga0451576_0049679 3300045051 Bacteria 4402
388 Ga0451576_0126320 3300045051 Bacteria 2665
389 Ga0451576_0180342 3300045051 Bacteria 2205
390 Ga0451576_0508522 3300045051 Bacteria 1265
391 Ga0451576_1212789 3300045051 Bacteria 788
392 Ga0466958_0050286 3300045836 Bacteria 2524
393 Ga0466967_0002142 3300045976 Bacteria 12111
394 Ga0495592_0000208 3300046454 Bacteria 50220
395 Ga0495592_0009535 3300046454 Bacteria 7304
396 Ga0495592_0012190 3300046454 Bacteria 6524
397 Ga0495592_0084287 3300046454 Bacteria 2294
398 Ga0495592_0448104 3300046454 Bacteria 809
399 Ga0495603_0030362 3300046455 Bacteria 3255
400 Ga0495603_0162556 3300046455 Bacteria 1295
401 Ga0495641_0000646 3300046461 Bacteria 29404
402 Ga0495651_0000570 3300046462 Bacteria 28594
403 Ga0495651_0001148 3300046462 Bacteria 20475
404 Ga0495651_0227737 3300046462 Unclassified 1286
405 Ga0495651_0384179 3300046462 Bacteria 920
406 Ga0495653_0016472 3300046463 Bacteria 6017
407 Ga0495580_0003937 3300046472 Bacteria 12529
408 Ga0495580_0026721 3300046472 Bacteria 4204
409 Ga0495582_0029451 3300046473 Bacteria 3014
410 Ga0495582_0148957 3300046473 Bacteria 1328
411 Ga0495639_0001056 3300046475 Bacteria 12422
412 Ga0495639_0362894 3300046475 Unclassified 728
413 Ga0495662_0001966 3300046476 Bacteria 10318
414 Ga0495664_0015795 3300046477 Bacteria 4296
415 Ga0495664_0293932 3300046477 Bacteria 981
416 Ga0495584_0021787 3300046491 Bacteria 3254
417 Ga0495608_0000215 3300046511 Bacteria 41692
418 Ga0495608_0009175 3300046511 Bacteria 6914
419 Ga0495618_0006570 3300046514 Bacteria 7052
420 Ga0495628_0000486 3300046516 Bacteria 36439
421 Ga0495628_0000828 3300046516 Bacteria 28693
422 Ga0495628_0001568 3300046516 Bacteria 20933
423 Ga0495628_0072128 3300046516 Bacteria 2691
424 Ga0495630_0003803 3300046517 Bacteria 10529
425 Ga0495630_0039944 3300046517 Bacteria 3507
426 Ga0495630_0306259 3300046517 Bacteria 1214
427 Ga0495666_0000205 3300046526 Bacteria 25319
428 Ga0495666_0008144 3300046526 Bacteria 5255
429 Ga0495642_0013720 3300046528 Bacteria 3138
430 Ga0495642_0015324 3300046528 Bacteria 2979
431 Ga0495652_0002564 3300046529 Bacteria 18609
432 Ga0495652_0068612 3300046529 Bacteria 2970
433 Ga0495665_0026152 3300046531 Bacteria 3135
434 Ga0495665_0061378 3300046531 Bacteria 1985
435 Ga0495640_0004866 3300046533 Bacteria 10684
436 Ga0495640_0006505 3300046533 Bacteria 9234
437 Ga0495586_0000295 3300046535 Bacteria 31568
438 Ga0495586_0001179 3300046535 Bacteria 14671
439 Ga0495586_0001556 3300046535 Bacteria 12652
440 Ga0495586_0060930 3300046535 Bacteria 2053
441 Ga0495587_0003401 3300046536 Bacteria 10619
442 Ga0495587_0116742 3300046536 Bacteria 1530
443 Ga0495598_0029061 3300046537 Bacteria 1538
444 Ga0495598_0053645 3300046537 Bacteria 1222
445 Ga0495598_0190228 3300046537 Bacteria 736
446 Ga0495621_0010170 3300046539 Bacteria 2871
447 Ga0495621_0036255 3300046539 Bacteria 1711
448 Ga0495645_0001457 3300046543 Bacteria 15986
449 Ga0495667_0008223 3300046559 Bacteria 7080
450 Ga0495667_0008352 3300046559 Bacteria 7024
451 Ga0495667_0196043 3300046559 Unclassified 1293
452 Ga0495634_0002521 3300046642 Bacteria 15179
453 Ga0495634_0023243 3300046642 Bacteria 4359
454 Ga0495635_0028458 3300046663 Bacteria 3885
455 Ga0495635_0101422 3300046663 Bacteria 1967
456 Ga0495588_0006590 3300046674 Bacteria 5240
457 Ga0495599_0000461 3300046678 Bacteria 23203
458 Ga0495599_0030342 3300046678 Bacteria 3392
459 Ga0495599_0091487 3300046678 Bacteria 1898
460 Ga0495599_0105799 3300046678 Bacteria 1753
461 Ga0495599_0178475 3300046678 Unclassified 1309
462 Ga0495647_0005117 3300046681 Bacteria 4295
463 Ga0495647_0006528 3300046681 Bacteria 3869
464 Ga0495658_0004199 3300046683 Bacteria 7091
465 Ga0495658_0012677 3300046683 Bacteria 4275
466 Ga0495658_0048168 3300046683 Bacteria 2402
467 Ga0495669_0002405 3300046684 Bacteria 7680
468 Ga0495669_0059785 3300046684 Bacteria 1722
469 Ga0495613_0001788 3300046689 Bacteria 16337
470 Ga0495613_0008282 3300046689 Bacteria 7717
471 Ga0495624_0006034 3300046690 Bacteria 8639
472 Ga0495600_0000301 3300046809 Bacteria 26459
473 Ga0495600_0094347 3300046809 Bacteria 1951
474 Ga0495581_0032296 3300047315 Bacteria 3032
475 Ga0495636_0019790 3300047318 Bacteria 2708
476 Ga0495674_0016084 3300047319 Bacteria 6982
477 Ga0495674_0139696 3300047319 Unclassified 2037
478 Ga0495676_0088195 3300047321 Bacteria 2328
479 Ga0495680_0000180 3300047322 Bacteria 66863
480 Ga0495680_0009365 3300047322 Bacteria 8816
481 Ga0495680_0033384 3300047322 Bacteria 4168
482 Ga0495675_0001943 3300047444 Bacteria 12328
483 Ga0501031_0166505 3300049568 Bacteria 1441
484 Ga0501033_0003723 3300049570 Bacteria 12406
485 Ga0501036_0025947 3300049572 Bacteria 4944
486 Ga0501036_0313032 3300049572 Bacteria 1312
487 Ga0501037_0431897 3300049573 Bacteria 900
488 Ga0501038_0006768 3300049574 Bacteria 10587
489 Ga0501039_0004197 3300049575 Bacteria 10848
490 Ga0501039_0014935 3300049575 Bacteria 5940
491 Ga0501039_0038881 3300049575 Bacteria 3674
492 Ga0501040_0000187 3300049576 Bacteria 35657
493 Ga0501040_0001882 3300049576 Bacteria 13460
494 Ga0501040_0058356 3300049576 Bacteria 2650
495 Ga0501040_0324674 3300049576 Bacteria 1101
496 Ga0501041_0000059 3300049577 Bacteria 40532
497 Ga0501041_0004822 3300049577 Bacteria 7839
498 Ga0501041_0040915 3300049577 Bacteria 2815
499 Ga0501042_0003933 3300049578 Bacteria 9401
500 Ga0501042_0006691 3300049578 Bacteria 7509
501 Ga0501042_0060477 3300049578 Bacteria 2706
502 Ga0501042_0298526 3300049578 Bacteria 1164
503 Ga0501043_0066107 3300049579 Bacteria 2839
504 Ga0501046_0000287 3300049580 Bacteria 51116
505 Ga0501048_0000626 3300049582 Bacteria 25223
506 Ga0501048_0051149 3300049582 Bacteria 2942
507 Ga0501067_0125530 3300049583 Bacteria 1428
508 Ga0501068_0034162 3300049584 Bacteria 3032
509 Ga0501068_0034963 3300049584 Bacteria 2999
510 Ga0501068_0065676 3300049584 Bacteria 2209
511 Ga0501069_0089844 3300049585 Bacteria 1737
512 Ga0501070_0018770 3300049586 Bacteria 5802
513 Ga0501070_0427865 3300049586 Bacteria 1069
514 Ga0501070_0491345 3300049586 Bacteria 987
515 Ga0501071_0004083 3300049587 Bacteria 9228
516 Ga0501071_0006846 3300049587 Bacteria 7428
517 Ga0501071_0119962 3300049587 Bacteria 1949
518 Ga0501071_0196283 3300049587 Bacteria 1515
519 Ga0501071_0359108 3300049587 Bacteria 1109
520 Ga0501072_0000300 3300049588 Bacteria 35018
521 Ga0501072_0016093 3300049588 Bacteria 5737
522 Ga0501072_0045043 3300049588 Bacteria 3468
523 Ga0501072_0149792 3300049588 Bacteria 1860
524 Ga0501073_0034116 3300049589 Bacteria 3623
525 Ga0501074_0014285 3300049590 Bacteria 5775
526 Ga0501074_0070866 3300049590 Bacteria 2506
527 Ga0501074_0176662 3300049590 Bacteria 1524
528 Ga0501074_0468342 3300049590 Bacteria 893
529 Ga0501075_0000120 3300049591 Bacteria 38065
530 Ga0501075_0004231 3300049591 Bacteria 9700
531 Ga0501076_0000968 3300049592 Bacteria 18820
532 Ga0501076_0003058 3300049592 Bacteria 11644
533 Ga0501076_0007792 3300049592 Bacteria 7806
534 Ga0501076_0301297 3300049592 Bacteria 1314
535 Ga0501077_0003794 3300049593 Bacteria 9097
536 Ga0501077_0062356 3300049593 Bacteria 2366
537 Ga0501077_0085798 3300049593 Bacteria 1996
538 Ga0501077_0284610 3300049593 Bacteria 1052
539 Ga0501079_0004081 3300049741 Bacteria 10816
540 Ga0501079_0034434 3300049741 Bacteria 3897
541 Ga0501079_0062273 3300049741 Bacteria 2878
542 Ga0501079_0089555 3300049741 Bacteria 2383
543 Ga0501080_0004298 3300049742 Bacteria 12649
544 Ga0501080_0005206 3300049742 Bacteria 11593
545 Ga0501080_0028960 3300049742 Bacteria 5156
546 Ga0501081_0000322 3300049743 Bacteria 25642
547 Ga0501081_0003363 3300049743 Bacteria 10174
548 Ga0501081_0094932 3300049743 Bacteria 2102
549 Ga0501081_0139133 3300049743 Bacteria 1739
550 Ga0501035_0241664 3300049822 Bacteria 1536
551 Ga0501044_0195046 3300049823 Bacteria 1986
552 Ga0501044_0957966 3300049823 Bacteria 729
553 Ga0501045_0000559 3300049824 Bacteria 23387
554 Ga0501045_0010098 3300049824 Bacteria 6607
555 nmdc:mga05p37_163935_c1 3300050507 Bacteria 2713
556 nmdc:mga05p37_1868_c1 3300050507 Bacteria 24533
557 nmdc:mga05p37_472587_c1 3300050507 Bacteria 1446
558 nmdc:mga05p37_622854_c1 3300050507 Bacteria 1214
559 nmdc:mga05p37_757682_c1 3300050507 Bacteria 1069
560 nmdc:mga09592_29170_c1 3300050508 Bacteria 4589
561 nmdc:mga0qj67_130889_c1 3300050509 Bacteria 2032
562 nmdc:mga0qj67_25037_c1 3300050509 Bacteria 4607
563 nmdc:mga0qj67_299186_c1 3300050509 Bacteria 1304
564 nmdc:mga0qj67_33084_c1 3300050509 Bacteria 4034
565 nmdc:mga0qj67_78095_c1 3300050509 Bacteria 2649
566 nmdc:mga0qj67_80445_c1 3300050509 Bacteria 2611
567 nmdc:mga06r32_100836_c1 3300050510 Bacteria 2833
568 nmdc:mga06r32_323200_c1 3300050510 Bacteria 1528
569 nmdc:mga06r32_366797_c1 3300050510 Bacteria 1424
570 nmdc:mga06r32_682401_c1 3300050510 Bacteria 994
571 nmdc:mga08y16_112143_c1 3300050511 Bacteria 2839
572 nmdc:mga08y16_36128_c1 3300050511 Bacteria 5189
573 nmdc:mga08y16_43900_c1 3300050511 Bacteria 4684
574 nmdc:mga0n895_1144_c1 3300050512 Bacteria 19418
575 nmdc:mga0n895_21322_c1 3300050512 Bacteria 6055
576 nmdc:mga0n895_58_c1 3300050512 Bacteria 65261
577 nmdc:mga0rr50_12295_c1 3300050513 Bacteria 5525
578 nmdc:mga0rr50_139848_c1 3300050513 Bacteria 1947
579 nmdc:mga0rr50_196729_c1 3300050513 Bacteria 1655
580 nmdc:mga0rr50_3065_c1 3300050513 Bacteria 7929
581 nmdc:mga0rr50_50779_c1 3300050513 Bacteria 3074
582 nmdc:mga08x19_109454_c1 3300050514 Bacteria 1842
583 nmdc:mga08x19_219_c1 3300050514 Bacteria 43753
584 nmdc:mga08x19_2281_c1 3300050514 Bacteria 11658
585 nmdc:mga08x19_28101_c1 3300050514 Bacteria 3521
586 nmdc:mga08x19_623361_c1 3300050514 Bacteria 765
587 nmdc:mga08x19_72572_c1 3300050514 Bacteria 2245
588 nmdc:mga08x19_73975_c1 3300050514 Bacteria 2226
589 nmdc:mga08x19_84764_c1 3300050514 Bacteria 2085
590 nmdc:mga0a205_40889_c1 3300050515 Bacteria 4465
591 nmdc:mga0a205_42561_c1 3300050515 Bacteria 4377
592 nmdc:mga0a205_633_c2 3300050515 Bacteria 10644
593 nmdc:mga0a205_708400_c1 3300050515 Bacteria 856
594 nmdc:mga0a205_713096_c1 3300050515 Bacteria 853
595 Ga0495601_0000559 3300053077 Bacteria 19741
596 Ga0495601_0086948 3300053077 Bacteria 2009
597 Ga0495612_0108127 3300053078 Bacteria 1188
598 Ga0495619_0053592 3300053085 Bacteria 2668
599 Ga0500593_001276 3300053117 Bacteria 9103
600 Ga0500608_134776 3300053122 Bacteria 1103
601 Ga0501084_0000977 3300054114 Bacteria 22188
602 Ga0501084_0495435 3300054114 Bacteria 1032
603 Ga0590074_031537 3300059423 Bacteria 937
604 Ga0501082_0001072 3300060353 Bacteria 24229
605 Ga0501082_0246996 3300060353 Bacteria 1553
606 Ga0501082_0278144 3300060353 Bacteria 1457
607 Ga0530510_0000349 3300061734 Bacteria 29813
608 Ga0530510_0001085 3300061734 Bacteria 18056
609 Ga0530510_0208227 3300061734 Bacteria 1453
610 Ga0530510_0373545 3300061734 Bacteria 1073
611 2526212509 2526164512 Bacteria 4025691
612 2548846504 2547132512 Bacteria 3416496
613 2574432323 2574179768 Bacteria 4907129
614 2891636540 2891633521 Bacteria 4602265
615 639788814 639633007 Bacteria 4376040
616 Ga0451577_0035085
617 JGI24750J21931_1023972
618 Ga0055530_10002193
619 Ga0058859_11725196
620 Ga0058860_12081681
621 Ga0065707_10109239
622 Ga0070676_10352229
623 Ga0070690_100001346
624 Ga0070690_100374212
625 Ga0070677_10360085
626 Ga0068869_100000038
627 Ga0068869_100153113
628 Ga0068869_100456246
629 Ga0070680_100001895
630 Ga0070680_100052878
631 Ga0070680_100092643
632 Ga0070680_100389061
633 Ga0070682_100008909
634 Ga0068868_100000087
635 Ga0070689_100004169
636 Ga0070689_100038066
637 Ga0070689_100100840
638 Ga0070689_100285327
639 Ga0070691_10006255
640 Ga0070691_10272187
641 Ga0070687_100000019
642 Ga0070687_100081312
643 Ga0070692_10005775
644 Ga0070692_10049631
645 Ga0070692_10148759
646 Ga0070692_10285348
647 Ga0070669_100006619
648 Ga0070675_100152826
649 Ga0070675_100456543
650 Ga0070671_100060823
651 Ga0070671_100667223
652 Ga0070673_100104984
653 Ga0070688_100121479
654 Ga0070688_100178328
655 Ga0070667_100829065
656 Ga0070710_10039476
657 Ga0070701_10000033
658 Ga0070705_100000060
659 Ga0070705_100001881
660 Ga0070705_100004175
661 Ga0070700_100000513
662 Ga0070700_100050632
663 Ga0070700_100123280
664 Ga0070700_100398830
665 Ga0070694_100000365
666 Ga0070694_100056007
667 Ga0070694_100128792
668 Ga0070694_100163816
669 Ga0070694_100590225
670 Ga0070708_100206130
671 Ga0070681_10191104
672 Ga0068867_100000199
673 Ga0068867_100000810
674 Ga0068867_100394655
675 Ga0070706_100091151
676 Ga0070706_100290335
677 Ga0070707_100500614
678 Ga0070707_100708943
679 Ga0070698_100021525
680 Ga0070699_100031013
681 Ga0070679_100019885
682 Ga0070679_100031192
683 Ga0070684_100137455
684 Ga0070697_100019191
685 Ga0070686_100000377
686 Ga0070686_100119176
687 Ga0070686_100327198
688 Ga0070695_100000012
689 Ga0070695_100009375
690 Ga0070695_100052424
691 Ga0070695_100280690
692 Ga0070696_100001489
693 Ga0070696_100004782
694 Ga0070696_100342665
695 Ga0070696_100741479
696 Ga0070693_100000113
697 Ga0070693_100138588
698 Ga0070693_100302633
699 Ga0070704_100000059
700 Ga0070704_100010506
701 Ga0070704_100066093
702 Ga0070704_100292356
703 Ga0070704_100311799
704 Ga0068855_100003164
705 Ga0068857_100139618
706 Ga0068854_100004851
707 Ga0068856_100282055
708 Ga0070702_100000086
709 Ga0070702_100055076
710 Ga0070702_100161748
711 Ga0070702_100244351
712 Ga0068859_100026401
713 Ga0068859_100083689
714 Ga0068859_100208474
715 Ga0068859_100972758
716 Ga0068866_10000122
717 Ga0068861_100000171
718 Ga0068861_100010431
719 Ga0068861_101297383
720 Ga0068870_10006581
721 Ga0068870_10246113
722 Ga0068863_100298504
723 Ga0068858_100044159
724 Ga0068858_100145852
725 Ga0068860_100000832
726 Ga0068862_100000274
727 Ga0068862_100006228
728 Ga0068862_100540451
729 Ga0068862_100990536
730 Ga0081538_10052476
731 Ga0070716_100002115
732 Ga0070712_100359953
733 Ga0075366_10017615
734 Ga0097621_100009696
735 Ga0068871_100000225
736 Ga0068871_100008238
737 Ga0068871_100939922
738 Ga0075428_100008896
739 Ga0075428_100019799
740 Ga0075428_100145494
741 Ga0075428_100476114
742 Ga0075428_100755532
743 Ga0075430_100001649
744 Ga0075430_100037596
745 Ga0075430_100086127
746 Ga0075430_100491637
747 Ga0075430_100527470
748 Ga0075431_100326793
749 Ga0075433_10000171
750 Ga0075433_10387228
751 Ga0075434_100000247
752 Ga0075434_100000662
753 Ga0075434_100013180
754 Ga0075434_100016075
755 Ga0075434_100433432
756 Ga0075429_100000404
757 Ga0075429_100741448
758 Ga0068865_100000124
759 Ga0068865_100034828
760 Ga0075436_100000153
761 Ga0075436_100008039
762 Ga0075436_100026936
763 Ga0075436_100031040
764 Ga0075436_100033418
765 Ga0075436_100034633
766 Ga0075436_100156201
767 Ga0075436_100208401
768 Ga0097620_100026400
769 Ga0097620_100083683
770 Ga0097620_100208473
771 Ga0097620_100972762
772 Ga0075435_100005954
773 Ga0075435_100007722
774 Ga0075435_100030335
775 Ga0075435_100169767
776 Ga0099794_10002375
777 Ga0099794_10010591
778 Ga0099794_10011534
779 Ga0099795_10015261
780 Ga0111539_10044126
781 Ga0111539_10062513
782 Ga0111539_10187971
783 Ga0105245_10007074
784 Ga0114129_10042355
785 Ga0114129_10109365
786 Ga0114129_10311065
787 Ga0114129_10893864
788 Ga0105243_10003692
789 Ga0105243_10004588
790 Ga0105243_10239325
791 Ga0105243_10480422
792 Ga0105241_10006274
793 Ga0105242_10000061
794 Ga0105242_10373322
795 Ga0105248_10161317
796 Ga0105248_10399064
797 Ga0105237_10377760
798 Ga0105249_10000940
799 Ga0105249_10002301
800 Ga0105249_10345727
801 Ga0099796_10237834
802 Ga0105239_10090916
803 Ga0157378_10000911
804 Ga0163162_10334146
805 Ga0163162_10691601
806 Ga0157372_10463056
807 Ga0157380_10013393
808 Ga0157380_10050017
809 Ga0157380_10137932
810 Ga0157377_10012036
811 Ga0157376_10002096
812 Ga0207653_10002382
813 Ga0207642_10000452
814 Ga0207642_10048962
815 Ga0207688_10027378
816 Ga0207688_10029512
817 Ga0207645_10039499
818 Ga0207645_10125561
819 Ga0207643_10011092
820 Ga0207643_10018967
821 Ga0207684_10093523
822 Ga0207684_10493275
823 Ga0207654_10005492
824 Ga0207707_10007469
825 Ga0207707_10294252
826 Ga0207663_10080309
827 Ga0207660_10040871
828 Ga0207660_10090865
829 Ga0207660_10426875
830 Ga0207662_10000029
831 Ga0207662_10037936
832 Ga0207662_10242559
833 Ga0207652_10011390
834 Ga0207646_10202529
835 Ga0207681_10014597
836 Ga0207659_10019977
837 Ga0207687_10001385
838 Ga0207644_10067838
839 Ga0207686_10009694
840 Ga0207686_10136813
841 Ga0207709_10001813
842 Ga0207709_10080119
843 Ga0207709_10115418
844 Ga0207670_10000618
845 Ga0207670_10026590
846 Ga0207670_10162646
847 Ga0207670_10197160
848 Ga0207669_10591569
849 Ga0207704_10001489
850 Ga0207704_10014112
851 Ga0207665_10001087
852 Ga0207665_10197944
853 Ga0207665_10332437
854 Ga0207691_10116575
855 Ga0207689_10084693
856 Ga0207689_10091704
857 Ga0207661_10217491
858 Ga0207667_10122152
859 Ga0207651_10426841
860 Ga0207651_10495526
861 Ga0207712_10027999
862 Ga0207712_10060570
863 Ga0207668_10130032
864 Ga0207640_10001918
865 Ga0207677_10009961
866 Ga0207703_10002228
867 Ga0207703_10049754
868 Ga0207708_10013647
869 Ga0207708_10058203
870 Ga0207708_10154028
871 Ga0207708_10307139
872 Ga0207708_10405059
873 Ga0207702_10329454
874 Ga0207641_10355087
875 Ga0207648_10000055
876 Ga0207648_10006440
877 Ga0207676_10063912
878 Ga0207674_10144119
879 Ga0207675_100000188
880 Ga0207675_100001245
881 Ga0207675_100219682
882 Ga0207683_10130714
883 Ga0209969_1003878
884 Ga0209967_1005701
885 Ga0209967_1006879
886 Ga0209981_1003604
887 Ga0209981_1008960
888 Ga0209996_1010498
889 Ga0210000_1010131
890 Ga0209999_1000579
891 Ga0210002_1007573
892 Ga0209588_1001855
893 Ga0209588_1004931
894 Ga0209588_1027185
895 Ga0209971_1001918
896 Ga0209971_1013633
897 Ga0209998_10046431
898 Ga0209974_10011351
899 Ga0207428_10013066
900 Ga0268265_10001356
901 Ga0268265_10003023
902 Ga0268265_10444760
903 Ga0268264_10001502
904 Ga0265323_10005124
905 Ga0265332_10000077
906 Ga0265316_10094425
907 Ga0307509_10000018
908 Ga0307408_100523049
909 Ga0316575_10007587
910 Ga0316575_10186324
911 Ga0316579_10000528
912 Ga0316578_10064409
913 Ga0307406_10090868
914 Ga0307407_10105547
915 Ga0307416_100298772
916 Ga0307416_100369129
917 Ga0307416_101149809
918 Ga0307416_101501369
919 Ga0307411_11127941
920 Ga0316583_10000519
921 Ga0316593_10050888
922 Ga0373950_0022652
923 Ga0373934_0002280
924 Ga0373934_0047340
925 Ga0373934_0250047
926 Ga0373923_0012805
927 Ga0373936_0000889
928 Ga0373936_0087976
929 Ga0373936_0128765
930 Ga0373945_0126943
931 Ga0373953_0284676
932 Ga0373954_0001416
933 Ga0373954_0002079
934 Ga0373954_0010175
935 Ga0373956_0000124
936 Ga0373956_0008670
937 Ga0373956_0014877
938 Ga0373957_0000670
939 Ga0373957_0008547
940 Ga0373960_0008678
941 Ga0373960_0042895
942 Ga0373960_0126803
943 Ga0373943_0009723
944 Ga0373943_0016637
945 Ga0373943_0066659
946 Ga0373946_0011804
947 Ga0373946_0013762
948 Ga0373955_0007891
949 Ga0373955_0008840
950 Ga0373955_0318449
951 Ga0373961_0059231
952 Ga0316574_0044532
953 Ga0373924_0000737
954 Ga0373924_0206311
955 Ga0373931_0013060
956 Ga0373935_0011893
957 Ga0373927_0023076
958 Ga0373927_0125496
959 Ga0373933_0000331
960 Ga0373933_0014198
961 Ga0373933_0040281
962 Ga0373933_0425440
963 Ga0373947_0146664
964 Ga0373937_0001929
965 Ga0373937_0005477
966 Ga0373937_0016729
967 Ga0373937_0058335
968 Ga0373937_0432407
969 Ga0316582_0001940
970 Ga0373925_0178278
971 Ga0395900_0001750
972 Ga0316581_0001202
973 Ga0242420_037695
974 Ga0439453_0001593
975 Ga0439461_0011683
976 Ga0439441_000063
977 Ga0439441_004892
978 Ga0439443_001286
979 Ga0439443_001576
980 Ga0439445_0131469
981 Ga0439451_003435
982 Ga0439446_0013025
983 Ga0439434_0003355
984 Ga0439434_0008958
985 Ga0439435_0000255
986 Ga0439435_0000491
987 Ga0439435_0005225
988 Ga0439444_0000064
989 Ga0439444_0000255
990 Ga0439460_0000984
991 Ga0439460_0002319
992 Ga0451577_0000489
993 Ga0451577_0026082
994 Ga0451577_0056873
995 Ga0453684_0000014
996 Ga0453684_0000826
997 Ga0453684_0002735
998 Ga0453684_0006614
999 Ga0451576_0002078
1000 Ga0451576_0018822
1001 Ga0451576_0020161
1002 Ga0451576_0049679
1003 Ga0451576_0126320
1004 Ga0451576_0180342
1005 Ga0451576_0508522
1006 Ga0451576_1212789
1007 Ga0466958_0050286
1008 Ga0466967_0002142
1009 Ga0495592_0000208
1010 Ga0495592_0009535
1011 Ga0495592_0012190
1012 Ga0495592_0084287
1013 Ga0495592_0448104
1014 Ga0495603_0030362
1015 Ga0495603_0162556
1016 Ga0495641_0000646
1017 Ga0495651_0000570
1018 Ga0495651_0001148
1019 Ga0495651_0227737
1020 Ga0495651_0384179
1021 Ga0495653_0016472
1022 Ga0495580_0003937
1023 Ga0495580_0026721
1024 Ga0495582_0029451
1025 Ga0495582_0148957
1026 Ga0495639_0001056
1027 Ga0495639_0362894
1028 Ga0495662_0001966
1029 Ga0495664_0015795
1030 Ga0495664_0293932
1031 Ga0495584_0021787
1032 Ga0495608_0000215
1033 Ga0495608_0009175
1034 Ga0495618_0006570
1035 Ga0495628_0000486
1036 Ga0495628_0000828
1037 Ga0495628_0001568
1038 Ga0495628_0072128
1039 Ga0495630_0003803
1040 Ga0495630_0039944
1041 Ga0495630_0306259
1042 Ga0495666_0000205
1043 Ga0495666_0008144
1044 Ga0495642_0013720
1045 Ga0495642_0015324
1046 Ga0495652_0002564
1047 Ga0495652_0068612
1048 Ga0495665_0026152
1049 Ga0495665_0061378
1050 Ga0495640_0004866
1051 Ga0495640_0006505
1052 Ga0495586_0000295
1053 Ga0495586_0001179
1054 Ga0495586_0001556
1055 Ga0495586_0060930
1056 Ga0495587_0003401
1057 Ga0495587_0116742
1058 Ga0495598_0029061
1059 Ga0495598_0053645
1060 Ga0495598_0190228
1061 Ga0495621_0010170
1062 Ga0495621_0036255
1063 Ga0495645_0001457
1064 Ga0495667_0008223
1065 Ga0495667_0008352
1066 Ga0495667_0196043
1067 Ga0495634_0002521
1068 Ga0495634_0023243
1069 Ga0495635_0028458
1070 Ga0495635_0101422
1071 Ga0495588_0006590
1072 Ga0495599_0000461
1073 Ga0495599_0030342
1074 Ga0495599_0091487
1075 Ga0495599_0105799
1076 Ga0495599_0178475
1077 Ga0495647_0005117
1078 Ga0495647_0006528
1079 Ga0495658_0004199
1080 Ga0495658_0012677
1081 Ga0495658_0048168
1082 Ga0495669_0002405
1083 Ga0495669_0059785
1084 Ga0495613_0001788
1085 Ga0495613_0008282
1086 Ga0495624_0006034
1087 Ga0495600_0000301
1088 Ga0495600_0094347
1089 Ga0495581_0032296
1090 Ga0495636_0019790
1091 Ga0495674_0016084
1092 Ga0495674_0139696
1093 Ga0495676_0088195
1094 Ga0495680_0000180
1095 Ga0495680_0009365
1096 Ga0495680_0033384
1097 Ga0495675_0001943
1098 Ga0501031_0166505
1099 Ga0501033_0003723
1100 Ga0501036_0025947
1101 Ga0501036_0313032
1102 Ga0501037_0431897
1103 Ga0501038_0006768
1104 Ga0501039_0004197
1105 Ga0501039_0014935
1106 Ga0501039_0038881
1107 Ga0501040_0000187
1108 Ga0501040_0001882
1109 Ga0501040_0058356
1110 Ga0501040_0324674
1111 Ga0501041_0000059
1112 Ga0501041_0004822
1113 Ga0501041_0040915
1114 Ga0501042_0003933
1115 Ga0501042_0006691
1116 Ga0501042_0060477
1117 Ga0501042_0298526
1118 Ga0501043_0066107
1119 Ga0501046_0000287
1120 Ga0501048_0000626
1121 Ga0501048_0051149
1122 Ga0501067_0125530
1123 Ga0501068_0034162
1124 Ga0501068_0034963
1125 Ga0501068_0065676
1126 Ga0501069_0089844
1127 Ga0501070_0018770
1128 Ga0501070_0427865
1129 Ga0501070_0491345
1130 Ga0501071_0004083
1131 Ga0501071_0006846
1132 Ga0501071_0119962
1133 Ga0501071_0196283
1134 Ga0501071_0359108
1135 Ga0501072_0000300
1136 Ga0501072_0016093
1137 Ga0501072_0045043
1138 Ga0501072_0149792
1139 Ga0501073_0034116
1140 Ga0501074_0014285
1141 Ga0501074_0070866
1142 Ga0501074_0176662
1143 Ga0501074_0468342
1144 Ga0501075_0000120
1145 Ga0501075_0004231
1146 Ga0501076_0000968
1147 Ga0501076_0003058
1148 Ga0501076_0007792
1149 Ga0501076_0301297
1150 Ga0501077_0003794
1151 Ga0501077_0062356
1152 Ga0501077_0085798
1153 Ga0501077_0284610
1154 Ga0501079_0004081
1155 Ga0501079_0034434
1156 Ga0501079_0062273
1157 Ga0501079_0089555
1158 Ga0501080_0004298
1159 Ga0501080_0005206
1160 Ga0501080_0028960
1161 Ga0501081_0000322
1162 Ga0501081_0003363
1163 Ga0501081_0094932
1164 Ga0501081_0139133
1165 Ga0501035_0241664
1166 Ga0501044_0195046
1167 Ga0501044_0957966
1168 Ga0501045_0000559
1169 Ga0501045_0010098
1170 nmdc:mga05p37_163935_c1
1171 nmdc:mga05p37_1868_c1
1172 nmdc:mga05p37_472587_c1
1173 nmdc:mga05p37_622854_c1
1174 nmdc:mga05p37_757682_c1
1175 nmdc:mga09592_29170_c1
1176 nmdc:mga0qj67_130889_c1
1177 nmdc:mga0qj67_25037_c1
1178 nmdc:mga0qj67_299186_c1
1179 nmdc:mga0qj67_33084_c1
1180 nmdc:mga0qj67_78095_c1
1181 nmdc:mga0qj67_80445_c1
1182 nmdc:mga06r32_100836_c1
1183 nmdc:mga06r32_323200_c1
1184 nmdc:mga06r32_366797_c1
1185 nmdc:mga06r32_682401_c1
1186 nmdc:mga08y16_112143_c1
1187 nmdc:mga08y16_36128_c1
1188 nmdc:mga08y16_43900_c1
1189 nmdc:mga0n895_1144_c1
1190 nmdc:mga0n895_21322_c1
1191 nmdc:mga0n895_58_c1
1192 nmdc:mga0rr50_12295_c1
1193 nmdc:mga0rr50_139848_c1
1194 nmdc:mga0rr50_196729_c1
1195 nmdc:mga0rr50_3065_c1
1196 nmdc:mga0rr50_50779_c1
1197 nmdc:mga08x19_109454_c1
1198 nmdc:mga08x19_219_c1
1199 nmdc:mga08x19_2281_c1
1200 nmdc:mga08x19_28101_c1
1201 nmdc:mga08x19_623361_c1
1202 nmdc:mga08x19_72572_c1
1203 nmdc:mga08x19_73975_c1
1204 nmdc:mga08x19_84764_c1
1205 nmdc:mga0a205_40889_c1
1206 nmdc:mga0a205_42561_c1
1207 nmdc:mga0a205_633_c2
1208 nmdc:mga0a205_708400_c1
1209 nmdc:mga0a205_713096_c1
1210 Ga0495601_0000559
1211 Ga0495601_0086948
1212 Ga0495612_0108127
1213 Ga0495619_0053592
1214 Ga0500593_001276
1215 Ga0500608_134776
1216 Ga0501084_0000977
1217 Ga0501084_0495435
1218 Ga0590074_031537
1219 Ga0501082_0001072
1220 Ga0501082_0246996
1221 Ga0501082_0278144
1222 Ga0530510_0000349
1223 Ga0530510_0001085
1224 Ga0530510_0208227
1225 Ga0530510_0373545
1226 2526212509
1227 2548846504
1228 2574432323
1229 2891636540
1230 639788814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04350

PilO

Pilus assembly protein, PilO

87

229

0.98

Map