F466468

General Info

Members Datasets Scaffolds Average Seq Length
585 310 562 431

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0465416|Ga0436364_0465416_745_2256
Length 503
Sequence MASISTTIALLPAKLYKARISLWLSELGTNAPRYGFLTVRTIDVERRLDLHFRAGSSNVQIPDATMPPKPQAPVKXAPLFPSRHMAPFVLITALFFLWGIPNNLNDVLIRQFMKSFAISRFEAGLVQSAFYIGYFLLAMPAAILMDRRGYKAGFVTGLVLFSLGTFMFWPAALVGRYGLFLFALFVIASGLSFLETASNPFITQLGDPASAERRLNFSQAFNPLGSISGVLIGTVFIFSGVALDSAQIGAMRSQHLYDAYLRSETLRVVKPYLGLGAIALFWALLIWRTKFPRIEGEHEAEGDRGHFRQLFRHPHFLLAVLAQFMYVGAQVGTWSYFIQYVQEFTRQGEKIAGYLLTGTLAAFGLGRFSSAYLMRFVAPSKLLGFYAIANVALVAFGVADPGWAGLWALFATSFFMSVMFPTIFALGLKGLGPNTKVGGSLLVMAIVGGAVLTPMMGLIAEVRHSIAPAYLVPFLAYLIVAGYAFAGARAGLPAVPATPFVSS

Samples

Sample ID Description Type Environment
1 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2643221640 Caulobacter sp. Root342 Isolate Unclassified
4 2643221642 Caulobacter sp. Root343 Isolate Unclassified
5 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
6 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
7 2738541278 Niastella sp. CF465 Isolate Unclassified
8 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
9 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
10 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
11 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
12 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
13 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
14 2849560528 Caulobacter zeae 410 Isolate Unclassified
15 2851153111 Caulobacter radicis 736 Isolate Unclassified
16 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
17 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
18 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
19 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
20 2937967321 Serratia sp. YC16 Isolate Unclassified
21 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
22 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
283 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
284 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
285 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
286 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
287 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
303 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
309 8004592986 Serratia sp. S119 Isolate Unclassified
310 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.04
Metatranscriptomes 1.03
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.4
Nodule 0
Rhizoplane 2.91
Rhizosphere 80.34
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000588 3300000546 Bacteria 6260
2 JGI24740J21852_10005850 3300001979 Bacteria 5157
3 JGI24740J21852_10028431 3300001979 Bacteria 1847
4 JGI24737J22298_10000764 3300001990 Bacteria 11363
5 JGI24737J22298_10009265 3300001990 Bacteria 3281
6 JGI24737J22298_10014815 3300001990 Bacteria 2528
7 JGI24738J21930_10006999 3300002075 Bacteria 2620
8 JGI25156J39149_1005352 3300002705 Bacteria 3722
9 JGI25157J39369_1000957 3300002741 Bacteria 13522
10 JGI25157J39369_1001843 3300002741 Bacteria 6634
11 JGI25153J46596_10000005 3300003215 Bacteria 492839
12 JGI25153J46596_10012703 3300003215 Bacteria 3609
13 rootH1_10060220 3300003316 Bacteria 5204
14 rootH2_10117872 3300003320 Bacteria 2770
15 Ga0006562J51391_1048246 3300003578 Bacteria 2230
16 Ga0006562J51391_1048247 3300003578 Bacteria 1700
17 Ga0055539_1000614 3300003752 Bacteria 9678
18 Ga0055533_1003355 3300003756 Bacteria 3248
19 Ga0055525_1000856 3300003759 Bacteria 8910
20 Ga0055527_1000271 3300003760 Bacteria 31313
21 Ga0055527_1000273 3300003760 Bacteria 30913
22 Ga0055535_1000567 3300003761 Bacteria 31313
23 Ga0055535_1000574 3300003761 Bacteria 30913
24 Ga0055542_1000591 3300003762 Bacteria 31313
25 Ga0055542_1000597 3300003762 Bacteria 30913
26 Ga0055529_1000556 3300003763 Bacteria 31313
27 Ga0055529_1000815 3300003763 Bacteria 18794
28 Ga0055536_1000029 3300003781 Bacteria 157375
29 Ga0055536_1000057 3300003781 Bacteria 104652
30 Ga0055530_10000628 3300003791 Bacteria 30471
31 Ga0055530_10002520 3300003791 Bacteria 11694
32 Ga0055531_10000053 3300003794 Bacteria 124623
33 Ga0055531_10001089 3300003794 Bacteria 21336
34 Ga0070658_10001662 3300005327 Bacteria 18762
35 Ga0070658_10084767 3300005327 Bacteria 2605
36 Ga0070658_10262184 3300005327 Bacteria 1468
37 Ga0070683_100044227 3300005329 Bacteria 4106
38 Ga0070683_100068736 3300005329 Bacteria 3301
39 Ga0070683_100159968 3300005329 Bacteria 2136
40 Ga0070670_100003591 3300005331 Bacteria 12905
41 Ga0070670_100022078 3300005331 Bacteria 5478
42 Ga0068869_100086366 3300005334 Bacteria 2351
43 Ga0070680_100020632 3300005336 Bacteria 5231
44 Ga0070680_100105787 3300005336 Bacteria 2339
45 Ga0070682_100021303 3300005337 Bacteria 3823
46 Ga0068868_100003302 3300005338 Bacteria 11223
47 Ga0068868_100022223 3300005338 Bacteria 4785
48 Ga0070660_100007846 3300005339 Bacteria 7443
49 Ga0070660_100014530 3300005339 Bacteria 5675
50 Ga0070689_100097225 3300005340 Bacteria 2328
51 Ga0070689_100179980 3300005340 Unclassified 1717
52 Ga0070661_100075564 3300005344 Bacteria 2482
53 Ga0070661_100113108 3300005344 Bacteria 2028
54 Ga0070692_10054368 3300005345 Bacteria 2090
55 Ga0070673_100020098 3300005364 Bacteria 4809
56 Ga0070688_100112957 3300005365 Bacteria 1809
57 Ga0070667_100162238 3300005367 Bacteria 1969
58 Ga0070709_10051072 3300005434 Unclassified 2594
59 Ga0070709_10097912 3300005434 Bacteria 1948
60 Ga0070711_100080899 3300005439 Bacteria 2314
61 Ga0070708_100096661 3300005445 Bacteria 2698
62 Ga0070663_100009554 3300005455 Bacteria 6009
63 Ga0070663_100011678 3300005455 Bacteria 5523
64 Ga0070663_100037095 3300005455 Bacteria 3391
65 Ga0070663_100051140 3300005455 Bacteria 2942
66 Ga0070663_100100837 3300005455 Bacteria 2154
67 Ga0070681_10003899 3300005458 Bacteria 14055
68 Ga0070681_10020352 3300005458 Bacteria 6651
69 Ga0070681_10021051 3300005458 Bacteria 6535
70 Ga0070681_10021875 3300005458 Bacteria 6414
71 Ga0070681_10076114 3300005458 Bacteria 3315
72 Ga0068867_100031244 3300005459 Bacteria 3843
73 Ga0070706_100007251 3300005467 Bacteria 10414
74 Ga0070706_100053056 3300005467 Bacteria 3742
75 Ga0070706_100068975 3300005467 Bacteria 3270
76 Ga0070707_100010484 3300005468 Bacteria 8632
77 Ga0070707_100114969 3300005468 Bacteria 2611
78 Ga0070698_100129362 3300005471 Unclassified 2481
79 Ga0070698_100129918 3300005471 Bacteria 2475
80 Ga0070699_100001924 3300005518 Bacteria 18737
81 Ga0070679_100017902 3300005530 Bacteria 6862
82 Ga0070679_100029757 3300005530 Bacteria 5388
83 Ga0070679_100036531 3300005530 Unclassified 4875
84 Ga0070684_100048725 3300005535 Bacteria 3676
85 Ga0070697_100000142 3300005536 Bacteria 57993
86 Ga0070697_100005294 3300005536 Bacteria 9909
87 Ga0068853_100069901 3300005539 Bacteria 3055
88 Ga0070695_100107325 3300005545 Bacteria 1889
89 Ga0070696_100051387 3300005546 Bacteria 2866
90 Ga0070693_100012351 3300005547 Bacteria 4319
91 Ga0070693_100113847 3300005547 Unclassified 1668
92 Ga0070665_100005312 3300005548 Bacteria 13304
93 Ga0070665_100024928 3300005548 Bacteria 6028
94 Ga0070665_100044843 3300005548 Bacteria 4439
95 Ga0068855_100007033 3300005563 Bacteria 13653
96 Ga0068855_100008387 3300005563 Bacteria 12494
97 Ga0068855_100008720 3300005563 Bacteria 12257
98 Ga0068855_100040367 3300005563 Bacteria 5540
99 Ga0068855_100054841 3300005563 Bacteria 4684
100 Ga0068855_100330963 3300005563 Bacteria 1681
101 Ga0070664_100004251 3300005564 Bacteria 11517
102 Ga0070664_100145906 3300005564 Bacteria 2087
103 Ga0068857_100002772 3300005577 Bacteria 14400
104 Ga0068857_100003979 3300005577 Bacteria 12446
105 Ga0068857_100019225 3300005577 Bacteria 5997
106 Ga0068857_100031650 3300005577 Bacteria 4675
107 Ga0068857_100202694 3300005577 Unclassified 1808
108 Ga0068854_100011344 3300005578 Bacteria 5796
109 Ga0068854_100052722 3300005578 Bacteria 2918
110 Ga0068856_100008204 3300005614 Bacteria 10185
111 Ga0068856_100008707 3300005614 Bacteria 9873
112 Ga0068856_100008836 3300005614 Bacteria 9803
113 Ga0068856_100010673 3300005614 Bacteria 8925
114 Ga0068856_100014695 3300005614 Bacteria 7556
115 Ga0068856_100014951 3300005614 Bacteria 7495
116 Ga0068856_100091595 3300005614 Unclassified 3024
117 Ga0068856_100092468 3300005614 Unclassified 3010
118 Ga0068852_100034382 3300005616 Unclassified 4216
119 Ga0068852_100192506 3300005616 Bacteria 1925
120 Ga0068859_100172793 3300005617 Bacteria 2242
121 Ga0068864_100068610 3300005618 Bacteria 3081
122 Ga0068866_10021163 3300005718 Bacteria 2992
123 Ga0068861_100039377 3300005719 Bacteria 3527
124 Ga0068870_10017678 3300005840 Bacteria 3429
125 Ga0068863_100002345 3300005841 Bacteria 18827
126 Ga0068863_100125243 3300005841 Bacteria 2451
127 Ga0068858_100005785 3300005842 Bacteria 12077
128 Ga0068858_100015121 3300005842 Bacteria 7258
129 Ga0068858_100030233 3300005842 Bacteria 5031
130 Ga0068860_100054613 3300005843 Unclassified 3797
131 Ga0068860_100164300 3300005843 Bacteria 2142
132 Ga0068862_100165779 3300005844 Bacteria 1975
133 Ga0070717_10012748 3300006028 Bacteria 6416
134 Ga0070715_10028765 3300006163 Bacteria 2233
135 Ga0070716_100004196 3300006173 Bacteria 6854
136 Ga0070716_100047982 3300006173 Unclassified 2411
137 Ga0070712_100002300 3300006175 Bacteria 11765
138 Ga0075367_10010419 3300006178 Bacteria 4885
139 Ga0097621_100001543 3300006237 Bacteria 15760
140 Ga0097621_100023969 3300006237 Bacteria 4758
141 Ga0068871_100001290 3300006358 Bacteria 16755
142 Ga0068871_100012514 3300006358 Bacteria 6260
143 Ga0068871_100017418 3300006358 Bacteria 5437
144 Ga0068871_100088748 3300006358 Bacteria 2573
145 Ga0075431_100121272 3300006847 Bacteria 2698
146 Ga0075433_10025539 3300006852 Bacteria 4994
147 Ga0075434_100001525 3300006871 Bacteria 19566
148 Ga0075434_100005128 3300006871 Bacteria 11897
149 Ga0075434_100147431 3300006871 Bacteria 2373
150 Ga0075434_100359442 3300006871 Bacteria 1477
151 Ga0068865_100017819 3300006881 Bacteria 4573
152 Ga0068865_100109584 3300006881 Bacteria 2035
153 Ga0097620_100172791 3300006931 Bacteria 2242
154 Ga0075435_100059576 3300007076 Bacteria 3095
155 Ga0099794_10000710 3300007265 Bacteria 11202
156 Ga0099794_10005808 3300007265 Bacteria 4975
157 Ga0099794_10006581 3300007265 Bacteria 4715
158 Ga0099794_10027794 3300007265 Unclassified 2625
159 Ga0099794_10053244 3300007265 Unclassified 1951
160 Ga0105240_10016106 3300009093 Bacteria 10130
161 Ga0105240_10027147 3300009093 Bacteria 7501
162 Ga0105240_10039699 3300009093 Bacteria 6025
163 Ga0105240_10084666 3300009093 Bacteria 3887
164 Ga0105240_10121260 3300009093 Bacteria 3148
165 Ga0105240_10297946 3300009093 Unclassified 1846
166 Ga0105245_10014579 3300009098 Bacteria 6844
167 Ga0105245_10079355 3300009098 Bacteria 2997
168 Ga0105245_10141088 3300009098 Bacteria 2269
169 Ga0105247_10014269 3300009101 Unclassified 4768
170 Ga0105247_10038987 3300009101 Bacteria 2902
171 Ga0105241_10002474 3300009174 Bacteria 13893
172 Ga0105241_10018019 3300009174 Bacteria 5191
173 Ga0105241_10070722 3300009174 Bacteria 2708
174 Ga0105241_10081761 3300009174 Bacteria 2531
175 Ga0105241_10259800 3300009174 Bacteria 1475
176 Ga0105242_10010726 3300009176 Bacteria 7035
177 Ga0105248_10015511 3300009177 Bacteria 8400
178 Ga0105248_10071946 3300009177 Bacteria 3886
179 Ga0105248_10114929 3300009177 Bacteria 3035
180 Ga0105248_10254048 3300009177 Bacteria 1978
181 Ga0105248_10258093 3300009177 Unclassified 1962
182 Ga0105248_10266910 3300009177 Unclassified 1927
183 Ga0105237_10000007 3300009545 Bacteria 367690
184 Ga0105237_10001579 3300009545 Bacteria 29663
185 Ga0105237_10065099 3300009545 Bacteria 3642
186 Ga0105237_10081957 3300009545 Bacteria 3217
187 Ga0105238_10000552 3300009551 Bacteria 39122
188 Ga0105238_10009425 3300009551 Bacteria 9774
189 Ga0105238_10032841 3300009551 Bacteria 5282
190 Ga0105238_10119512 3300009551 Bacteria 2615
191 Ga0105249_10404999 3300009553 Bacteria 1395
192 Ga0105239_10044423 3300010375 Bacteria 4871
193 Ga0105239_10067648 3300010375 Unclassified 3924
194 Ga0105239_10098951 3300010375 Bacteria 3224
195 Ga0157371_10006338 3300013102 Bacteria 9788
196 Ga0157370_10006501 3300013104 Bacteria 12876
197 Ga0157370_10015501 3300013104 Bacteria 7749
198 Ga0157370_10094330 3300013104 Bacteria 2808
199 Ga0157370_10211055 3300013104 Bacteria 1799
200 Ga0157369_10006362 3300013105 Bacteria 13705
201 Ga0157369_10011496 3300013105 Bacteria 10053
202 Ga0157369_10100081 3300013105 Bacteria 3090
203 Ga0157369_10117798 3300013105 Unclassified 2819
204 Ga0157369_10161718 3300013105 Bacteria 2363
205 Ga0157369_10165511 3300013105 Bacteria 2332
206 Ga0157369_10187985 3300013105 Bacteria 2171
207 Ga0157374_10001815 3300013296 Bacteria 17974
208 Ga0157374_10009359 3300013296 Bacteria 8406
209 Ga0157374_10009705 3300013296 Bacteria 8264
210 Ga0157374_10037505 3300013296 Bacteria 4449
211 Ga0157374_10101481 3300013296 Bacteria 2759
212 Ga0157374_10112297 3300013296 Bacteria 2622
213 Ga0157378_10000086 3300013297 Bacteria 86864
214 Ga0157378_10001360 3300013297 Bacteria 21961
215 Ga0157378_10005518 3300013297 Bacteria 11083
216 Ga0157378_10011038 3300013297 Bacteria 7906
217 Ga0157378_10049777 3300013297 Bacteria 3729
218 Ga0157378_10070402 3300013297 Unclassified 3141
219 Ga0157378_10136460 3300013297 Unclassified 2275
220 Ga0163162_10000643 3300013306 Bacteria 32332
221 Ga0157372_10000685 3300013307 Bacteria 37210
222 Ga0157372_10001623 3300013307 Bacteria 24392
223 Ga0157372_10005288 3300013307 Bacteria 13705
224 Ga0157372_10009321 3300013307 Bacteria 10442
225 Ga0157372_10049235 3300013307 Bacteria 4685
226 Ga0157372_10108835 3300013307 Unclassified 3173
227 Ga0157375_10008565 3300013308 Bacteria 8958
228 Ga0157375_10049713 3300013308 Bacteria 4110
229 Ga0157375_10209049 3300013308 Bacteria 2108
230 Ga0157375_10229205 3300013308 Bacteria 2016
231 Ga0163163_10017234 3300014325 Bacteria 6733
232 Ga0157379_10003000 3300014968 Bacteria 14240
233 Ga0157376_10000023 3300014969 Bacteria 223978
234 Ga0157376_10329691 3300014969 Bacteria 1454
235 Ga0182006_1011021 3300015261 Bacteria 3992
236 Ga0206349_1942608 3300020075 Bacteria 1570
237 Ga0213876_10002846 3300021384 Bacteria 10068
238 Ga0213876_10033728 3300021384 Bacteria 2699
239 Ga0224712_10001848 3300022467 Bacteria 5074
240 Ga0209674_100053 3300025226 Bacteria 323159
241 Ga0209672_100009 3300025228 Bacteria 883623
242 Ga0209672_100024 3300025228 Bacteria 367869
243 Ga0209147_100728 3300025229 Bacteria 16447
244 Ga0209563_100127 3300025230 Bacteria 109913
245 Ga0209258_100011 3300025242 Bacteria 867542
246 Ga0209258_100047 3300025242 Bacteria 367869
247 Ga0209646_1002921 3300025246 Bacteria 3561
248 Ga0209026_1000163 3300025250 Bacteria 102814
249 Ga0209026_1000391 3300025250 Bacteria 39130
250 Ga0209677_102437 3300025253 Bacteria 7000
251 Ga0209148_1000013 3300025254 Bacteria 956684
252 Ga0209148_1000054 3300025254 Bacteria 367869
253 Ga0209759_1000622 3300025256 Bacteria 33847
254 Ga0209455_1000012 3300025272 Bacteria 867234
255 Ga0209455_1000052 3300025272 Bacteria 367804
256 Ga0209455_1000357 3300025272 Bacteria 42718
257 Ga0209676_1000031 3300025292 Bacteria 478976
258 Ga0209676_1000057 3300025292 Bacteria 361061
259 Ga0209564_1022600 3300025295 Bacteria 2216
260 Ga0209758_1000001 3300025297 Bacteria 1981790
261 Ga0209758_1001007 3300025297 Bacteria 37395
262 Ga0209050_1000087 3300025298 Bacteria 261460
263 Ga0209050_1000096 3300025298 Bacteria 240109
264 Ga0209051_1003301 3300025303 Bacteria 10694
265 Ga0209257_1000050 3300025304 Bacteria 439325
266 Ga0209257_1003560 3300025304 Bacteria 13220
267 Ga0207656_10006675 3300025321 Bacteria 4167
268 Ga0207656_10067085 3300025321 Bacteria 1587
269 Ga0207647_10001584 3300025904 Bacteria 17460
270 Ga0207647_10007704 3300025904 Bacteria 7752
271 Ga0207647_10016475 3300025904 Bacteria 5045
272 Ga0207647_10034514 3300025904 Bacteria 3228
273 Ga0207647_10053198 3300025904 Bacteria 2496
274 Ga0207647_10059914 3300025904 Bacteria 2328
275 Ga0207699_10140856 3300025906 Unclassified 1585
276 Ga0207645_10008945 3300025907 Bacteria 6954
277 Ga0207705_10014727 3300025909 Bacteria 5623
278 Ga0207684_10000404 3300025910 Bacteria 57743
279 Ga0207684_10011107 3300025910 Bacteria 7885
280 Ga0207684_10030224 3300025910 Bacteria 4613
281 Ga0207684_10157014 3300025910 Bacteria 1958
282 Ga0207654_10026100 3300025911 Bacteria 3160
283 Ga0207654_10028353 3300025911 Bacteria 3052
284 Ga0207707_10001311 3300025912 Bacteria 23194
285 Ga0207707_10021978 3300025912 Bacteria 5576
286 Ga0207707_10037134 3300025912 Bacteria 4257
287 Ga0207707_10049037 3300025912 Bacteria 3680
288 Ga0207695_10001214 3300025913 Bacteria 44135
289 Ga0207695_10006440 3300025913 Bacteria 15246
290 Ga0207695_10006516 3300025913 Bacteria 15114
291 Ga0207695_10013830 3300025913 Bacteria 9600
292 Ga0207695_10034600 3300025913 Bacteria 5491
293 Ga0207695_10048759 3300025913 Unclassified 4471
294 Ga0207695_10071089 3300025913 Bacteria 3554
295 Ga0207671_10000074 3300025914 Bacteria 156482
296 Ga0207671_10001275 3300025914 Bacteria 29656
297 Ga0207693_10007380 3300025915 Bacteria 9041
298 Ga0207660_10037612 3300025917 Bacteria 3374
299 Ga0207657_10007124 3300025919 Bacteria 11481
300 Ga0207657_10018089 3300025919 Bacteria 6743
301 Ga0207657_10096443 3300025919 Bacteria 2460
302 Ga0207649_10075571 3300025920 Bacteria 2165
303 Ga0207652_10016368 3300025921 Bacteria 6054
304 Ga0207652_10035420 3300025921 Unclassified 4213
305 Ga0207646_10003451 3300025922 Bacteria 17850
306 Ga0207650_10006698 3300025925 Bacteria 7855
307 Ga0207687_10006388 3300025927 Bacteria 7790
308 Ga0207687_10021546 3300025927 Bacteria 4283
309 Ga0207687_10113743 3300025927 Bacteria 2013
310 Ga0207706_10000597 3300025933 Bacteria 38406
311 Ga0207706_10181775 3300025933 Bacteria 1847
312 Ga0207686_10008372 3300025934 Bacteria 5582
313 Ga0207704_10006293 3300025938 Bacteria 5526
314 Ga0207665_10002739 3300025939 Bacteria 11819
315 Ga0207665_10036769 3300025939 Bacteria 3258
316 Ga0207711_10007793 3300025941 Bacteria 8953
317 Ga0207711_10043469 3300025941 Bacteria 3833
318 Ga0207711_10284876 3300025941 Bacteria 1522
319 Ga0207689_10128542 3300025942 Unclassified 2084
320 Ga0207689_10165181 3300025942 Bacteria 1824
321 Ga0207661_10118200 3300025944 Bacteria 2253
322 Ga0207679_10013694 3300025945 Bacteria 5318
323 Ga0207679_10021273 3300025945 Bacteria 4395
324 Ga0207667_10000292 3300025949 Bacteria 69279
325 Ga0207667_10003522 3300025949 Bacteria 19354
326 Ga0207667_10008343 3300025949 Bacteria 12315
327 Ga0207667_10024835 3300025949 Bacteria 6571
328 Ga0207667_10122904 3300025949 Bacteria 2674
329 Ga0207668_10130021 3300025972 Bacteria 1921
330 Ga0207640_10000454 3300025981 Bacteria 24951
331 Ga0207640_10005798 3300025981 Bacteria 6735
332 Ga0207677_10001241 3300026023 Bacteria 13750
333 Ga0207677_10011739 3300026023 Bacteria 5005
334 Ga0207703_10036549 3300026035 Bacteria 3911
335 Ga0207703_10057396 3300026035 Unclassified 3174
336 Ga0207703_10093978 3300026035 Bacteria 2527
337 Ga0207639_10000757 3300026041 Bacteria 22024
338 Ga0207639_10048935 3300026041 Bacteria 3202
339 Ga0207639_10161340 3300026041 Bacteria 1889
340 Ga0207678_10002331 3300026067 Bacteria 17203
341 Ga0207678_10002963 3300026067 Bacteria 15378
342 Ga0207678_10010168 3300026067 Bacteria 8258
343 Ga0207678_10024920 3300026067 Bacteria 5223
344 Ga0207678_10049478 3300026067 Bacteria 3633
345 Ga0207678_10078972 3300026067 Bacteria 2818
346 Ga0207702_10000185 3300026078 Bacteria 74602
347 Ga0207702_10003499 3300026078 Bacteria 14313
348 Ga0207702_10006873 3300026078 Bacteria 9754
349 Ga0207702_10007110 3300026078 Bacteria 9576
350 Ga0207702_10013707 3300026078 Bacteria 6734
351 Ga0207702_10135686 3300026078 Bacteria 2220
352 Ga0207641_10006841 3300026088 Bacteria 9547
353 Ga0207648_10010985 3300026089 Bacteria 8553
354 Ga0207676_10023414 3300026095 Bacteria 4556
355 Ga0207674_10000057 3300026116 Bacteria 113117
356 Ga0207674_10003396 3300026116 Bacteria 19530
357 Ga0207674_10003522 3300026116 Bacteria 19105
358 Ga0207674_10005801 3300026116 Bacteria 14650
359 Ga0207674_10006199 3300026116 Bacteria 14092
360 Ga0207674_10030344 3300026116 Bacteria 5684
361 Ga0207674_10271707 3300026116 Bacteria 1643
362 Ga0207698_10023928 3300026142 Unclassified 4276
363 Ga0209588_1009575 3300027671 Bacteria 2899
364 Ga0265354_1000112 3300028016 Bacteria 14177
365 Ga0268266_10000276 3300028379 Bacteria 84981
366 Ga0268266_10017988 3300028379 Bacteria 6026
367 Ga0268266_10040573 3300028379 Unclassified 3967
368 Ga0268264_10037766 3300028381 Unclassified 3983
369 Ga0268264_10066921 3300028381 Bacteria 3031
370 Ga0268264_10262534 3300028381 Bacteria 1609
371 Ga0265336_10001467 3300028666 Bacteria 10711
372 Ga0265336_10022366 3300028666 Bacteria 2013
373 Ga0265338_10004358 3300028800 Bacteria 19152
374 Ga0265338_10011772 3300028800 Bacteria 10058
375 Ga0265338_10011969 3300028800 Bacteria 9939
376 Ga0265760_10000850 3300031090 Bacteria 8805
377 Ga0265760_10017221 3300031090 Bacteria 2075
378 Ga0265330_10000857 3300031235 Bacteria 18974
379 Ga0265330_10019477 3300031235 Bacteria 3109
380 Ga0265332_10019672 3300031238 Bacteria 2980
381 Ga0265328_10006650 3300031239 Bacteria 4869
382 Ga0265328_10016113 3300031239 Bacteria 2913
383 Ga0265320_10005172 3300031240 Bacteria 8418
384 Ga0265325_10000777 3300031241 Bacteria 23082
385 Ga0265325_10004129 3300031241 Bacteria 9237
386 Ga0265325_10011996 3300031241 Bacteria 4965
387 Ga0265325_10046730 3300031241 Bacteria 2244
388 Ga0265329_10023269 3300031242 Bacteria 2065
389 Ga0265339_10000166 3300031249 Bacteria 55317
390 Ga0265339_10006065 3300031249 Bacteria 7981
391 Ga0265339_10009203 3300031249 Bacteria 6230
392 Ga0265331_10002148 3300031250 Bacteria 13558
393 Ga0265316_10001544 3300031344 Bacteria 24695
394 Ga0265316_10002566 3300031344 Bacteria 18767
395 Ga0265316_10007409 3300031344 Bacteria 10340
396 Ga0265316_10029837 3300031344 Bacteria 4478
397 Ga0265316_10052104 3300031344 Bacteria 3211
398 Ga0265316_10096355 3300031344 Bacteria 2253
399 Ga0265316_10108852 3300031344 Unclassified 2100
400 Ga0307509_10071299 3300031507 Bacteria 3625
401 Ga0307408_100000536 3300031548 Bacteria 32722
402 Ga0307408_100001503 3300031548 Bacteria 17317
403 Ga0265313_10003479 3300031595 Bacteria 12705
404 Ga0265314_10006932 3300031711 Bacteria 9920
405 Ga0265342_10001566 3300031712 Bacteria 21128
406 Ga0265342_10009510 3300031712 Bacteria 6837
407 Ga0265342_10028058 3300031712 Bacteria 3511
408 Ga0307412_10017304 3300031911 Bacteria 4313
409 Ga0307416_100065690 3300032002 Bacteria 2983
410 Ga0307414_10000975 3300032004 Bacteria 14596
411 Ga0307414_10002075 3300032004 Bacteria 10412
412 Ga0373931_0015496 3300035691 Unclassified 3740
413 Ga0395899_0000195 3300037312 Bacteria 89015
414 Ga0395900_0000018 3300037418 Bacteria 363472
415 Ga0395900_0098271 3300037418 Unclassified 3008
416 Ga0395898_0000533 3300037466 Bacteria 72575
417 Ga0395905_0006060 3300037471 Bacteria 12240
418 Ga0395905_0026421 3300037471 Bacteria 5474
419 Ga0395905_0026922 3300037471 Bacteria 5423
420 Ga0436364_0035386 3300037853 Bacteria 3647
421 Ga0436364_0465416 3300037853 Bacteria 2474
422 Ga0395901_0107063 3300038443 Bacteria 2934
423 Ga0436365_0826620 3300039437 Bacteria 4262
424 Ga0436365_1307509 3300039437 Bacteria 21399
425 Ga0436365_1427729 3300039437 Bacteria 2689
426 Ga0436365_1518684 3300039437 Bacteria 3383
427 Ga0436360_0109202 3300039438 Bacteria 2270
428 Ga0436360_0345550 3300039438 Bacteria 7582
429 Ga0436361_0045513 3300039447 Bacteria 15977
430 Ga0436361_0877238 3300039447 Bacteria 37122
431 Ga0436363_1347570 3300039450 Bacteria 3447
432 Ga0439436_0004671 3300041404 Bacteria 4201
433 Ga0451847_0046663 3300041503 Bacteria 1318
434 Ga0439457_000119 3300042014 Bacteria 19152
435 Ga0466969_0001399 3300044656 Bacteria 13001
436 Ga0466969_0003759 3300044656 Bacteria 8068
437 Ga0466972_0000123 3300044658 Bacteria 65577
438 Ga0466966_0000420 3300044684 Bacteria 27294
439 Ga0466966_0024873 3300044684 Bacteria 3915
440 Ga0466961_0000604 3300044693 Bacteria 22628
441 Ga0466961_0010585 3300044693 Bacteria 5885
442 Ga0466961_0025001 3300044693 Bacteria 3843
443 Ga0466963_0034133 3300044694 Bacteria 3309
444 Ga0453684_0006535 3300044712 Bacteria 22076
445 Ga0466970_0004581 3300044765 Bacteria 6823
446 Ga0466957_0001397 3300044842 Bacteria 12589
447 Ga0466957_0002169 3300044842 Bacteria 10515
448 Ga0466957_0004881 3300044842 Bacteria 7506
449 Ga0466959_0000043 3300045049 Bacteria 92533
450 Ga0466959_0000138 3300045049 Bacteria 47575
451 Ga0466959_0017254 3300045049 Bacteria 5289
452 Ga0466958_0000090 3300045836 Bacteria 27924
453 Ga0466958_0022281 3300045836 Bacteria 3709
454 Ga0466958_0171283 3300045836 Unclassified 1375
455 Ga0495627_000843 3300046453 Bacteria 22003
456 Ga0495591_000010 3300046458 Bacteria 327794
457 Ga0495629_0033524 3300046459 Bacteria 3632
458 Ga0495580_0001960 3300046472 Bacteria 18074
459 Ga0495580_0031303 3300046472 Unclassified 3845
460 Ga0495582_0000232 3300046473 Bacteria 30900
461 Ga0495582_0042722 3300046473 Bacteria 2496
462 Ga0495585_0000021 3300046492 Bacteria 155715
463 Ga0495594_0004095 3300046499 Bacteria 7498
464 Ga0495610_0032659 3300046512 Bacteria 2701
465 Ga0495631_0000060 3300046518 Bacteria 68239
466 Ga0495632_0000049 3300046519 Bacteria 134597
467 Ga0495637_0001039 3300046520 Bacteria 17394
468 Ga0495637_0020152 3300046520 Bacteria 3072
469 Ga0495643_0000047 3300046522 Bacteria 217914
470 Ga0495643_0095616 3300046522 Bacteria 1528
471 Ga0495648_0000688 3300046524 Bacteria 36092
472 Ga0495648_0112043 3300046524 Bacteria 1483
473 Ga0495663_0000009 3300046525 Bacteria 256308
474 Ga0495666_0050742 3300046526 Bacteria 1994
475 Ga0495654_0000031 3300046530 Bacteria 206800
476 Ga0495640_0007988 3300046533 Bacteria 8316
477 Ga0495633_0000319 3300046558 Bacteria 54580
478 Ga0495633_0000434 3300046558 Bacteria 43286
479 Ga0495668_0009292 3300046616 Bacteria 6045
480 Ga0495668_0011446 3300046616 Bacteria 5311
481 Ga0495625_0003135 3300046660 Bacteria 16878
482 Ga0495625_0110842 3300046660 Bacteria 1875
483 Ga0495661_0000353 3300046665 Bacteria 50121
484 Ga0495661_0091113 3300046665 Bacteria 1734
485 Ga0495599_0196812 3300046678 Bacteria 1239
486 Ga0495647_0040406 3300046681 Bacteria 1772
487 Ga0495658_0029694 3300046683 Bacteria 2962
488 Ga0495671_0000038 3300046692 Bacteria 173693
489 Ga0495581_0007531 3300047315 Bacteria 6295
490 Ga0495674_0078386 3300047319 Bacteria 2838
491 Ga0495676_0058422 3300047321 Bacteria 3035
492 Ga0495686_0000018 3300047472 Bacteria 434962
493 Ga0495686_0001516 3300047472 Bacteria 24996
494 Ga0495686_0003748 3300047472 Bacteria 12935
495 Ga0495686_0045056 3300047472 Bacteria 2792
496 Ga0495686_0074904 3300047472 Bacteria 2076
497 Ga0495593_0028091 3300047673 Bacteria 3092
498 Ga0496100_0147106 3300048903 Bacteria 1677
499 Ga0496102_0002056 3300048905 Bacteria 17344
500 Ga0496102_0085173 3300048905 Bacteria 2918
501 Ga0496102_0163245 3300048905 Bacteria 2096
502 Ga0496103_0014990 3300048906 Unclassified 4608
503 Ga0496104_0000071 3300048907 Bacteria 106442
504 Ga0496104_0014536 3300048907 Bacteria 7110
505 Ga0496105_0085492 3300048908 Bacteria 2606
506 Ga0496106_0027892 3300048909 Unclassified 4204
507 Ga0496112_0034587 3300048915 Unclassified 4918
508 Ga0496112_0096293 3300048915 Bacteria 2930
509 Ga0496113_0021745 3300048916 Bacteria 4529
510 Ga0496114_0062298 3300048917 Bacteria 3122
511 Ga0496115_0013469 3300048918 Bacteria 6187
512 Ga0496115_0023958 3300048918 Bacteria 4741
513 Ga0496115_0051686 3300048918 Bacteria 3295
514 Ga0496124_0002081 3300048927 Bacteria 27042
515 Ga0496124_0014734 3300048927 Bacteria 7546
516 Ga0496125_0000453 3300048928 Bacteria 74032
517 Ga0496125_0051820 3300048928 Bacteria 3381
518 Ga0496126_0000095 3300048929 Bacteria 207654
519 Ga0496126_0001333 3300048929 Bacteria 39193
520 Ga0496126_0005343 3300048929 Bacteria 14691
521 Ga0495682_0000253 3300049460 Bacteria 42266
522 Ga0501034_0003168 3300049571 Bacteria 18914
523 Ga0501036_0173501 3300049572 Bacteria 1816
524 Ga0501047_0006703 3300049581 Bacteria 10826
525 Ga0501047_0231325 3300049581 Bacteria 1702
526 Ga0501069_0027641 3300049585 Bacteria 3109
527 Ga0501070_0010960 3300049586 Bacteria 7652
528 Ga0501070_0017543 3300049586 Bacteria 6009
529 Ga0501070_0148860 3300049586 Bacteria 1932
530 Ga0501074_0011233 3300049590 Bacteria 6508
531 Ga0501074_0026870 3300049590 Bacteria 4171
532 Ga0501223_000075 3300049663 Bacteria 30250
533 Ga0501224_000007 3300049664 Bacteria 127654
534 Ga0501233_000037 3300049668 Bacteria 17538
535 Ga0501235_000597 3300049669 Bacteria 7273
536 Ga0501225_0000113 3300049705 Bacteria 25146
537 Ga0501234_001186 3300049707 Bacteria 4110
538 Ga0501080_0024852 3300049742 Bacteria 5555
539 Ga0501035_0014043 3300049822 Bacteria 7389
540 Ga0501035_0025899 3300049822 Bacteria 5374
541 Ga0501044_0005139 3300049823 Bacteria 14596
542 Ga0501044_0008743 3300049823 Bacteria 11083
543 Ga0501044_0040131 3300049823 Bacteria 4880
544 Ga0501226_000061 3300049853 Bacteria 36545
545 nmdc:mga0k408_78107_c1 3300050493 Bacteria 1936
546 nmdc:mga0n895_1232_c1 3300050512 Bacteria 18867
547 nmdc:mga0n895_1944_c1 3300050512 Bacteria 15863
548 nmdc:mga0rr50_15239_c1 3300050513 Bacteria 5069
549 nmdc:mga0a205_10836_c1 3300050515 Bacteria 8387
550 Ga0495619_0023333 3300053085 Bacteria 3966
551 Ga0500578_0036455 3300053086 Bacteria 3159
552 Ga0500643_004400 3300053087 Bacteria 6390
553 Ga0500583_0000671 3300053092 Bacteria 10081
554 Ga0500641_0000501 3300053096 Bacteria 14088
555 Ga0500595_000250 3300053119 Bacteria 35820
556 Ga0500608_000004 3300053122 Bacteria 108109
557 Ga0500655_005238 3300053133 Bacteria 2340
558 Ga0500658_0002578 3300053134 Bacteria 7004
559 Ga0500589_005363 3300053147 Bacteria 4988
560 Ga0500622_0009463 3300053156 Bacteria 5391
561 Ga0500645_000125 3300053730 Bacteria 60408
562 Ga0466962_0001613 3300061719 Bacteria 10569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0107063 Ga0395901_0107063_1857_2924 326
2 3300046512 Ga0495610_0032659 Ga0495610_0032659_11_1108 330
3 3300048905 Ga0496102_0163245 Ga0496102_0163245_25_1098 332
4 3300048908 Ga0496105_0085492 Ga0496105_0085492_1512_2585 332
5 3300045836 Ga0466958_0171283 Ga0466958_0171283_37_1122 338
6 3300046678 Ga0495599_0196812 Ga0495599_0196812_50_1159 341
7 3300041503 Ga0451847_0046663 Ga0451847_0046663_58_1197 353
8 3300046520 Ga0495637_0020152 Ga0495637_0020152_1210_2490 358
9 3300046524 Ga0495648_0112043 Ga0495648_0112043_107_1387 358
10 3300046660 Ga0495625_0110842 Ga0495625_0110842_349_1629 358
11 3300053133 Ga0500655_005238 Ga0500655_005238_214_1494 358
12 3300001979 JGI24740J21852_10005850 JGI24740J21852_100058503 364
13 3300001990 JGI24737J22298_10014815 JGI24737J22298_100148152 364
14 3300003215 JGI25153J46596_10012703 JGI25153J46596_100127034 364
15 3300003578 Ga0006562J51391_1048246 Ga0006562J51391_10482461 364
16 3300003578 Ga0006562J51391_1048247 Ga0006562J51391_10482471 364
17 3300005455 Ga0070663_100051140 Ga0070663_1000511402 364
18 3300005563 Ga0068855_100054841 Ga0068855_1000548412 364
19 3300005577 Ga0068857_100031650 Ga0068857_1000316502 364
20 3300025297 Ga0209758_1001007 Ga0209758_10010075 364
21 3300025321 Ga0207656_10067085 Ga0207656_100670851 364
22 3300025904 Ga0207647_10016475 Ga0207647_100164752 364
23 3300025913 Ga0207695_10006440 Ga0207695_100064404 364
24 3300025914 Ga0207671_10001275 Ga0207671_100012755 364
25 3300025933 Ga0207706_10181775 Ga0207706_101817752 364
26 3300025949 Ga0207667_10000292 Ga0207667_1000029246 364
27 3300025981 Ga0207640_10000454 Ga0207640_1000045415 364
28 3300026067 Ga0207678_10024920 Ga0207678_100249203 364
29 3300026116 Ga0207674_10005801 Ga0207674_100058015 364
30 3300046519 Ga0495632_0000049 Ga0495632_0000049_65944_67122 364
31 3300046520 Ga0495637_0001039 Ga0495637_0001039_7522_8700 364
32 3300046522 Ga0495643_0000047 Ga0495643_0000047_44218_45396 364
33 3300046525 Ga0495663_0000009 Ga0495663_0000009_121584_122762 364
34 3300046558 Ga0495633_0000434 Ga0495633_0000434_5645_6823 364
35 3300046692 Ga0495671_0000038 Ga0495671_0000038_128298_129476 364
36 3300047472 Ga0495686_0074904 Ga0495686_0074904_394_1572 364
37 3300009545 Ga0105237_10001579 Ga0105237_1000157916 368
38 3300021384 Ga0213876_10002846 Ga0213876_100028462 368
39 3300025229 Ga0209147_100728 Ga0209147_10072812 368
40 3300039437 Ga0436365_1307509 Ga0436365_1307509_12250_13581 368
41 3300046453 Ga0495627_000843 Ga0495627_000843_15485_16723 368
42 3300037471 Ga0395905_0026421 Ga0395905_0026421_4063_5265 369
43 3300044656 Ga0466969_0001399 Ga0466969_0001399_10173_11441 370
44 3300044684 Ga0466966_0000420 Ga0466966_0000420_15434_16702 370
45 3300044693 Ga0466961_0025001 Ga0466961_0025001_1925_3193 370
46 3300044694 Ga0466963_0034133 Ga0466963_0034133_1091_2359 370
47 3300044842 Ga0466957_0002169 Ga0466957_0002169_2863_4131 370
48 3300045049 Ga0466959_0000138 Ga0466959_0000138_20474_21742 370
49 3300045836 Ga0466958_0000090 Ga0466958_0000090_15434_16702 370
50 3300061719 Ga0466962_0001613 Ga0466962_0001613_4765_6033 370
51 3300032004 Ga0307414_10000975 Ga0307414_1000097510 372
52 3300049581 Ga0501047_0006703 Ga0501047_0006703_3057_4352 372
53 3300049586 Ga0501070_0017543 Ga0501070_0017543_1285_2580 372
54 3300049590 Ga0501074_0011233 Ga0501074_0011233_4200_5495 372
55 3300049742 Ga0501080_0024852 Ga0501080_0024852_255_1550 372
56 3300049822 Ga0501035_0014043 Ga0501035_0014043_198_1493 372
57 3300049823 Ga0501044_0008743 Ga0501044_0008743_9657_10952 372
58 3300031548 Ga0307408_100000536 Ga0307408_1000005364 373
59 3300046558 Ga0495633_0000319 Ga0495633_0000319_10852_12090 374
60 3300009174 Ga0105241_10070722 Ga0105241_100707223 376
61 3300009545 Ga0105237_10065099 Ga0105237_100650992 376
62 3300013105 Ga0157369_10165511 Ga0157369_101655112 376
63 3300037471 Ga0395905_0026922 Ga0395905_0026922_3784_5055 376
64 3300009093 Ga0105240_10121260 Ga0105240_101212602 377
65 3300048928 Ga0496125_0000453 Ga0496125_0000453_2877_4181 377
66 3300002075 JGI24738J21930_10006999 JGI24738J21930_100069992 379
67 3300026116 Ga0207674_10271707 Ga0207674_102717071 379
68 3300031548 Ga0307408_100001503 Ga0307408_10000150310 379
69 3300047472 Ga0495686_0045056 Ga0495686_0045056_358_1611 379
70 3300005455 Ga0070663_100037095 Ga0070663_1000370953 380
71 3300005616 Ga0068852_100192506 Ga0068852_1001925062 380
72 3300026067 Ga0207678_10078972 Ga0207678_100789723 380
73 3300044658 Ga0466972_0000123 Ga0466972_0000123_35872_37155 380
74 3300009101 Ga0105247_10038987 Ga0105247_100389873 382
75 3300048917 Ga0496114_0062298 Ga0496114_0062298_24_1262 382
76 3300049572 Ga0501036_0173501 Ga0501036_0173501_332_1615 382
77 3300049585 Ga0501069_0027641 Ga0501069_0027641_912_2195 382
78 3300049590 Ga0501074_0026870 Ga0501074_0026870_427_1710 382
79 3300049823 Ga0501044_0040131 Ga0501044_0040131_1381_2664 382
80 3300039438 Ga0436360_0109202 Ga0436360_0109202_729_1964 383
81 3300046459 Ga0495629_0033524 Ga0495629_0033524_1331_2551 383
82 3300046473 Ga0495582_0042722 Ga0495582_0042722_1262_2482 383
83 3300046616 Ga0495668_0009292 Ga0495668_0009292_2271_3533 383
84 3300053122 Ga0500608_000004 Ga0500608_000004_53332_54594 383
85 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005353 385
86 3300025297 Ga0209758_1000001 Ga0209758_1000001356 385
87 3300046660 Ga0495625_0003135 Ga0495625_0003135_11640_12944 385
88 3300006852 Ga0075433_10025539 Ga0075433_100255395 386
89 3300006871 Ga0075434_100001525 Ga0075434_10000152513 386
90 3300050512 nmdc:mga0n895_1944_c1 nmdc:mga0n895_1944_c1_13328_14644 386
91 3300050515 nmdc:mga0a205_10836_c1 nmdc:mga0a205_10836_c1_5330_6646 386
92 3300053119 Ga0500595_000250 Ga0500595_000250_22755_23996 386
93 3300006847 Ga0075431_100121272 Ga0075431_1001212722 387
94 3300031911 Ga0307412_10017304 Ga0307412_100173043 387
95 3300032002 Ga0307416_100065690 Ga0307416_1000656903 387
96 3300032004 Ga0307414_10002075 Ga0307414_100020759 387
97 3300049571 Ga0501034_0003168 Ga0501034_0003168_2522_3829 387
98 3300049663 Ga0501223_000075 Ga0501223_000075_9043_10350 387
99 3300049664 Ga0501224_000007 Ga0501224_000007_108805_110112 387
100 3300049668 Ga0501233_000037 Ga0501233_000037_3799_5106 387
101 3300049669 Ga0501235_000597 Ga0501235_000597_5922_7229 387
102 3300049705 Ga0501225_0000113 Ga0501225_0000113_20015_21322 387
103 3300049707 Ga0501234_001186 Ga0501234_001186_97_1404 387
104 3300049853 Ga0501226_000061 Ga0501226_000061_17696_19003 387
105 iso_pu_bacteria 2738541276 2738716030 387
106 iso_pu_bacteria 2751185897 2753764511 387
107 iso_pu_bacteria 2848297114 2848297857 387
108 iso_pu_bacteria 2946787523 2946788151 387
109 iso_pu_bacteria 8055588893 8055589233 387
110 3300002741 JGI25157J39369_1001843 JGI25157J39369_10018434 388
111 3300005337 Ga0070682_100021303 Ga0070682_1000213032 388
112 3300005455 Ga0070663_100011678 Ga0070663_1000116783 388
113 3300005547 Ga0070693_100012351 Ga0070693_1000123513 388
114 3300025246 Ga0209646_1002921 Ga0209646_10029213 388
115 3300025250 Ga0209026_1000391 Ga0209026_100039112 388
116 3300025272 Ga0209455_1000357 Ga0209455_100035729 388
117 3300026067 Ga0207678_10002963 Ga0207678_1000296315 388
118 3300039450 Ga0436363_1347570 Ga0436363_1347570_54_1313 388
119 3300049586 Ga0501070_0010960 Ga0501070_0010960_3435_4745 388
120 3300049586 Ga0501070_0148860 Ga0501070_0148860_12_1322 388
121 3300053087 Ga0500643_004400 Ga0500643_004400_494_1777 388
122 3300053134 Ga0500658_0002578 Ga0500658_0002578_509_1792 388
123 iso_pu_bacteria 2599185354 2600202722 388
124 3300005329 Ga0070683_100068736 Ga0070683_1000687362 389
125 3300005458 Ga0070681_10021051 Ga0070681_100210514 389
126 3300005564 Ga0070664_100145906 Ga0070664_1001459062 389
127 3300009093 Ga0105240_10084666 Ga0105240_100846662 389
128 3300009551 Ga0105238_10009425 Ga0105238_100094259 389
129 3300010375 Ga0105239_10044423 Ga0105239_100444233 389
130 3300013105 Ga0157369_10100081 Ga0157369_101000812 389
131 3300015261 Ga0182006_1011021 Ga0182006_10110212 389
132 3300025913 Ga0207695_10006516 Ga0207695_100065166 389
133 3300025944 Ga0207661_10118200 Ga0207661_101182002 389
134 3300046522 Ga0495643_0095616 Ga0495643_0095616_104_1408 389
135 3300048927 Ga0496124_0002081 Ga0496124_0002081_24176_25507 389
136 3300053096 Ga0500641_0000501 Ga0500641_0000501_10940_12190 389
137 iso_pu_bacteria 2738541278 2738730216 389
138 iso_pu_bacteria 2747842501 2748017763 389
139 3300009174 Ga0105241_10002474 Ga0105241_100024748 390
140 3300009545 Ga0105237_10081957 Ga0105237_100819572 390
141 3300013104 Ga0157370_10094330 Ga0157370_100943303 390
142 3300031235 Ga0265330_10000857 Ga0265330_100008579 390
143 3300031241 Ga0265325_10000777 Ga0265325_1000077712 390
144 3300031249 Ga0265339_10006065 Ga0265339_100060655 390
145 3300031344 Ga0265316_10002566 Ga0265316_100025669 390
146 3300031595 Ga0265313_10003479 Ga0265313_100034794 390
147 3300031712 Ga0265342_10001566 Ga0265342_1000156611 390
148 3300001990 JGI24737J22298_10000764 JGI24737J22298_100007644 391
149 3300005331 Ga0070670_100022078 Ga0070670_1000220785 391
150 3300005546 Ga0070696_100051387 Ga0070696_1000513872 391
151 3300005577 Ga0068857_100002772 Ga0068857_1000027727 391
152 3300009093 Ga0105240_10016106 Ga0105240_100161069 391
153 3300009545 Ga0105237_10000007 Ga0105237_10000007182 391
154 3300013104 Ga0157370_10015501 Ga0157370_100155013 391
155 3300014325 Ga0163163_10017234 Ga0163163_100172342 391
156 3300025904 Ga0207647_10034514 Ga0207647_100345143 391
157 3300025904 Ga0207647_10053198 Ga0207647_100531982 391
158 3300025913 Ga0207695_10001214 Ga0207695_1000121413 391
159 3300025914 Ga0207671_10000074 Ga0207671_1000007477 391
160 3300025925 Ga0207650_10006698 Ga0207650_100066984 391
161 3300026078 Ga0207702_10000185 Ga0207702_1000018517 391
162 3300026116 Ga0207674_10000057 Ga0207674_1000005772 391
163 3300037312 Ga0395899_0000195 Ga0395899_0000195_87087_88370 391
164 3300037466 Ga0395898_0000533 Ga0395898_0000533_535_1818 391
165 3300037471 Ga0395905_0006060 Ga0395905_0006060_10135_11460 391
166 3300046492 Ga0495585_0000021 Ga0495585_0000021_123868_125163 391
167 3300046518 Ga0495631_0000060 Ga0495631_0000060_37437_38732 391
168 3300046524 Ga0495648_0000688 Ga0495648_0000688_4222_5517 391
169 3300046665 Ga0495661_0000353 Ga0495661_0000353_18241_19536 391
170 3300049460 Ga0495682_0000253 Ga0495682_0000253_16674_17969 391
171 3300050493 nmdc:mga0k408_78107_c1 nmdc:mga0k408_78107_c1_10_1404 391
172 3300053730 Ga0500645_000125 Ga0500645_000125_28618_29913 391
173 iso_pu_bacteria 2643221663 2644353807 391
174 iso_pu_bacteria 2791355048 2792463398 391
175 iso_pu_bacteria 2843744320 2843749003 391
176 iso_pu_bacteria 2888366609 2888367107 391
177 iso_pu_bacteria 2937967321 2937970904 391
178 iso_pu_bacteria 8004592986 8004596559 391
179 3300003759 Ga0055525_1000856 Ga0055525_10008567 392
180 3300003760 Ga0055527_1000273 Ga0055527_10002738 392
181 3300003761 Ga0055535_1000574 Ga0055535_10005748 392
182 3300003762 Ga0055542_1000597 Ga0055542_100059717 392
183 3300003763 Ga0055529_1000815 Ga0055529_100081510 392
184 3300005471 Ga0070698_100129362 Ga0070698_1001293622 392
185 3300048929 Ga0496126_0005343 Ga0496126_0005343_5518_6819 392
186 iso_pu_bacteria 2585428106 2587916304 392
187 iso_pu_bacteria 2643221640 2644226187 392
188 iso_pu_bacteria 2643221642 2644235675 392
189 iso_pu_bacteria 2849560528 2849562948 392
190 iso_pu_bacteria 2851153111 2851155564 392
191 iso_pu_bacteria 2857504554 2857508999 392
192 iso_pu_bacteria 2928531327 2928535044 392
193 3300001979 JGI24740J21852_10028431 JGI24740J21852_100284312 393
194 3300001990 JGI24737J22298_10009265 JGI24737J22298_100092653 393
195 3300003781 Ga0055536_1000029 Ga0055536_100002999 393
196 3300003781 Ga0055536_1000057 Ga0055536_100005768 393
197 3300003791 Ga0055530_10000628 Ga0055530_100006282 393
198 3300003791 Ga0055530_10002520 Ga0055530_1000252013 393
199 3300003794 Ga0055531_10000053 Ga0055531_1000005395 393
200 3300003794 Ga0055531_10001089 Ga0055531_100010893 393
201 3300005327 Ga0070658_10084767 Ga0070658_100847672 393
202 3300005455 Ga0070663_100009554 Ga0070663_1000095542 393
203 3300005539 Ga0068853_100069901 Ga0068853_1000699012 393
204 3300005563 Ga0068855_100040367 Ga0068855_1000403673 393
205 3300005614 Ga0068856_100014951 Ga0068856_1000149518 393
206 3300025292 Ga0209676_1000031 Ga0209676_1000031204 393
207 3300025292 Ga0209676_1000057 Ga0209676_1000057180 393
208 3300025295 Ga0209564_1022600 Ga0209564_10226001 393
209 3300025298 Ga0209050_1000087 Ga0209050_100008768 393
210 3300025298 Ga0209050_1000096 Ga0209050_100009677 393
211 3300025303 Ga0209051_1003301 Ga0209051_10033016 393
212 3300025304 Ga0209257_1000050 Ga0209257_1000050226 393
213 3300025304 Ga0209257_1003560 Ga0209257_10035602 393
214 3300025904 Ga0207647_10001584 Ga0207647_1000158411 393
215 3300025919 Ga0207657_10096443 Ga0207657_100964432 393
216 3300026041 Ga0207639_10000757 Ga0207639_100007573 393
217 3300026067 Ga0207678_10002331 Ga0207678_100023316 393
218 3300026078 Ga0207702_10007110 Ga0207702_100071104 393
219 3300026116 Ga0207674_10030344 Ga0207674_100303446 393
220 3300041404 Ga0439436_0004671 Ga0439436_0004671_1062_2327 393
221 3300042014 Ga0439457_000119 Ga0439457_000119_8443_9708 393
222 3300048927 Ga0496124_0014734 Ga0496124_0014734_4012_5313 393
223 3300048928 Ga0496125_0051820 Ga0496125_0051820_1823_3124 393
224 3300048929 Ga0496126_0001333 Ga0496126_0001333_37804_39105 393
225 3300053156 Ga0500622_0009463 Ga0500622_0009463_2133_3434 393
226 3300002705 JGI25156J39149_1005352 JGI25156J39149_10053523 394
227 3300002741 JGI25157J39369_1000957 JGI25157J39369_10009572 394
228 3300003752 Ga0055539_1000614 Ga0055539_10006143 394
229 3300003756 Ga0055533_1003355 Ga0055533_10033552 394
230 3300003760 Ga0055527_1000271 Ga0055527_100027118 394
231 3300003761 Ga0055535_1000567 Ga0055535_100056718 394
232 3300003762 Ga0055542_1000591 Ga0055542_10005918 394
233 3300003763 Ga0055529_1000556 Ga0055529_10005568 394
234 3300005614 Ga0068856_100014695 Ga0068856_1000146955 394
235 3300025226 Ga0209674_100053 Ga0209674_10005345 394
236 3300025228 Ga0209672_100009 Ga0209672_100009334 394
237 3300025228 Ga0209672_100024 Ga0209672_100024282 394
238 3300025230 Ga0209563_100127 Ga0209563_10012775 394
239 3300025242 Ga0209258_100011 Ga0209258_100011310 394
240 3300025242 Ga0209258_100047 Ga0209258_100047282 394
241 3300025250 Ga0209026_1000163 Ga0209026_100016323 394
242 3300025253 Ga0209677_102437 Ga0209677_1024373 394
243 3300025254 Ga0209148_1000013 Ga0209148_1000013310 394
244 3300025254 Ga0209148_1000054 Ga0209148_1000054282 394
245 3300025256 Ga0209759_1000622 Ga0209759_100062223 394
246 3300025272 Ga0209455_1000012 Ga0209455_1000012310 394
247 3300025272 Ga0209455_1000052 Ga0209455_1000052282 394
248 3300026078 Ga0207702_10013707 Ga0207702_100137073 394
249 3300031090 Ga0265760_10000850 Ga0265760_100008505 394
250 3300037418 Ga0395900_0000018 Ga0395900_0000018_292805_294121 394
251 3300044656 Ga0466969_0003759 Ga0466969_0003759_3170_4486 394
252 3300044684 Ga0466966_0024873 Ga0466966_0024873_2483_3796 394
253 3300044693 Ga0466961_0000604 Ga0466961_0000604_18771_20087 394
254 3300044693 Ga0466961_0010585 Ga0466961_0010585_4446_5759 394
255 3300044765 Ga0466970_0004581 Ga0466970_0004581_2498_3814 394
256 3300044842 Ga0466957_0004881 Ga0466957_0004881_1666_2982 394
257 3300045049 Ga0466959_0000043 Ga0466959_0000043_18617_19933 394
258 3300045049 Ga0466959_0017254 Ga0466959_0017254_3626_4939 394
259 3300006173 Ga0070716_100004196 Ga0070716_1000041967 395
260 3300025939 Ga0207665_10002739 Ga0207665_100027394 395
261 3300046458 Ga0495591_000010 Ga0495591_000010_320916_322247 395
262 3300046530 Ga0495654_0000031 Ga0495654_0000031_130926_132257 395
263 3300046616 Ga0495668_0011446 Ga0495668_0011446_3309_4640 395
264 3300003316 rootH1_10060220 rootH1_100602202 396
265 3300006871 Ga0075434_100147431 Ga0075434_1001474312 396
266 3300007265 Ga0099794_10000710 Ga0099794_100007104 396
267 3300031507 Ga0307509_10071299 Ga0307509_100712992 396
268 3300044842 Ga0466957_0001397 Ga0466957_0001397_3098_4384 396
269 3300045836 Ga0466958_0022281 Ga0466958_0022281_1364_2644 396
270 3300053086 Ga0500578_0036455 Ga0500578_0036455_184_1461 396
271 3300053092 Ga0500583_0000671 Ga0500583_0000671_183_1460 396
272 3300053147 Ga0500589_005363 Ga0500589_005363_2958_4235 396
273 3300005434 Ga0070709_10051072 Ga0070709_100510721 397
274 3300009093 Ga0105240_10039699 Ga0105240_100396995 397
275 3300025906 Ga0207699_10140856 Ga0207699_101408561 397
276 3300025913 Ga0207695_10034600 Ga0207695_100346004 397
277 3300031344 Ga0265316_10029837 Ga0265316_100298372 397
278 3300031344 Ga0265316_10108852 Ga0265316_101088522 397
279 iso_pu_bacteria 2830075706 2830077524 397
280 3300005434 Ga0070709_10097912 Ga0070709_100979121 398
281 3300005545 Ga0070695_100107325 Ga0070695_1001073251 398
282 3300005547 Ga0070693_100113847 Ga0070693_1001138472 398
283 3300005578 Ga0068854_100052722 Ga0068854_1000527223 398
284 3300006163 Ga0070715_10028765 Ga0070715_100287652 398
285 3300006237 Ga0097621_100001543 Ga0097621_1000015434 398
286 3300009098 Ga0105245_10014579 Ga0105245_100145794 398
287 3300009101 Ga0105247_10014269 Ga0105247_100142692 398
288 3300009174 Ga0105241_10018019 Ga0105241_100180194 398
289 3300009174 Ga0105241_10259800 Ga0105241_102598001 398
290 3300009176 Ga0105242_10010726 Ga0105242_100107262 398
291 3300009177 Ga0105248_10071946 Ga0105248_100719463 398
292 3300009177 Ga0105248_10258093 Ga0105248_102580931 398
293 3300013296 Ga0157374_10101481 Ga0157374_101014812 398
294 3300013297 Ga0157378_10000086 Ga0157378_1000008633 398
295 3300013297 Ga0157378_10136460 Ga0157378_101364603 398
296 3300014968 Ga0157379_10003000 Ga0157379_1000300010 398
297 3300025911 Ga0207654_10028353 Ga0207654_100283532 398
298 3300025934 Ga0207686_10008372 Ga0207686_100083724 398
299 3300025941 Ga0207711_10043469 Ga0207711_100434692 398
300 3300026023 Ga0207677_10011739 Ga0207677_100117393 398
301 3300031241 Ga0265325_10011996 Ga0265325_100119962 398
302 3300047472 Ga0495686_0003748 Ga0495686_0003748_6259_7596 398
303 3300048905 Ga0496102_0002056 Ga0496102_0002056_11371_12672 398
304 3300048906 Ga0496103_0014990 Ga0496103_0014990_648_1949 398
305 3300048907 Ga0496104_0014536 Ga0496104_0014536_2321_3622 398
306 3300048909 Ga0496106_0027892 Ga0496106_0027892_550_1851 398
307 3300005338 Ga0068868_100003302 Ga0068868_1000033022 399
308 3300005458 Ga0070681_10021875 Ga0070681_100218753 399
309 3300005530 Ga0070679_100036531 Ga0070679_1000365312 399
310 3300006028 Ga0070717_10012748 Ga0070717_100127486 399
311 3300006358 Ga0068871_100012514 Ga0068871_1000125142 399
312 3300009177 Ga0105248_10015511 Ga0105248_100155114 399
313 3300025912 Ga0207707_10037134 Ga0207707_100371343 399
314 3300025927 Ga0207687_10021546 Ga0207687_100215464 399
315 3300026035 Ga0207703_10036549 Ga0207703_100365491 399
316 3300028666 Ga0265336_10022366 Ga0265336_100223662 399
317 3300028800 Ga0265338_10011772 Ga0265338_100117726 399
318 3300031090 Ga0265760_10017221 Ga0265760_100172212 399
319 3300031238 Ga0265332_10019672 Ga0265332_100196723 399
320 3300031239 Ga0265328_10006650 Ga0265328_100066504 399
321 3300031240 Ga0265320_10005172 Ga0265320_100051726 399
322 3300031241 Ga0265325_10046730 Ga0265325_100467301 399
323 3300031242 Ga0265329_10023269 Ga0265329_100232692 399
324 3300031250 Ga0265331_10002148 Ga0265331_100021482 399
325 3300031344 Ga0265316_10007409 Ga0265316_100074097 399
326 3300039438 Ga0436360_0345550 Ga0436360_0345550_3245_4558 399
327 3300039447 Ga0436361_0045513 Ga0436361_0045513_1214_2527 399
328 3300047472 Ga0495686_0001516 Ga0495686_0001516_4263_5576 399
329 3300005334 Ga0068869_100086366 Ga0068869_1000863661 400
330 3300005339 Ga0070660_100014530 Ga0070660_1000145303 400
331 3300005340 Ga0070689_100179980 Ga0070689_1001799802 400
332 3300005344 Ga0070661_100113108 Ga0070661_1001131081 400
333 3300005367 Ga0070667_100162238 Ga0070667_1001622382 400
334 3300005439 Ga0070711_100080899 Ga0070711_1000808992 400
335 3300005459 Ga0068867_100031244 Ga0068867_1000312442 400
336 3300005468 Ga0070707_100114969 Ga0070707_1001149692 400
337 3300005548 Ga0070665_100024928 Ga0070665_1000249285 400
338 3300005563 Ga0068855_100330963 Ga0068855_1003309632 400
339 3300005577 Ga0068857_100202694 Ga0068857_1002026942 400
340 3300005614 Ga0068856_100092468 Ga0068856_1000924682 400
341 3300005616 Ga0068852_100034382 Ga0068852_1000343824 400
342 3300005719 Ga0068861_100039377 Ga0068861_1000393772 400
343 3300005842 Ga0068858_100015121 Ga0068858_1000151218 400
344 3300005844 Ga0068862_100165779 Ga0068862_1001657792 400
345 3300006175 Ga0070712_100002300 Ga0070712_1000023003 400
346 3300006358 Ga0068871_100017418 Ga0068871_1000174181 400
347 3300006881 Ga0068865_100109584 Ga0068865_1001095842 400
348 3300009177 Ga0105248_10254048 Ga0105248_102540481 400
349 3300009551 Ga0105238_10032841 Ga0105238_100328416 400
350 3300013102 Ga0157371_10006338 Ga0157371_100063384 400
351 3300013296 Ga0157374_10009705 Ga0157374_100097053 400
352 3300013296 Ga0157374_10112297 Ga0157374_101122973 400
353 3300013297 Ga0157378_10011038 Ga0157378_100110382 400
354 3300013308 Ga0157375_10229205 Ga0157375_102292051 400
355 3300014969 Ga0157376_10329691 Ga0157376_103296911 400
356 3300025321 Ga0207656_10006675 Ga0207656_100066753 400
357 3300025907 Ga0207645_10008945 Ga0207645_100089453 400
358 3300025911 Ga0207654_10026100 Ga0207654_100261002 400
359 3300025913 Ga0207695_10048759 Ga0207695_100487594 400
360 3300025915 Ga0207693_10007380 Ga0207693_100073805 400
361 3300025917 Ga0207660_10037612 Ga0207660_100376123 400
362 3300025919 Ga0207657_10007124 Ga0207657_100071247 400
363 3300025927 Ga0207687_10006388 Ga0207687_100063888 400
364 3300025933 Ga0207706_10000597 Ga0207706_1000059726 400
365 3300025941 Ga0207711_10007793 Ga0207711_100077936 400
366 3300025942 Ga0207689_10128542 Ga0207689_101285422 400
367 3300025945 Ga0207679_10013694 Ga0207679_100136942 400
368 3300025949 Ga0207667_10008343 Ga0207667_1000834313 400
369 3300025972 Ga0207668_10130021 Ga0207668_101300212 400
370 3300026041 Ga0207639_10161340 Ga0207639_101613402 400
371 3300026067 Ga0207678_10010168 Ga0207678_100101682 400
372 3300026067 Ga0207678_10049478 Ga0207678_100494783 400
373 3300026089 Ga0207648_10010985 Ga0207648_100109853 400
374 3300026116 Ga0207674_10006199 Ga0207674_1000619912 400
375 3300026142 Ga0207698_10023928 Ga0207698_100239281 400
376 3300028016 Ga0265354_1000112 Ga0265354_10001123 400
377 3300028379 Ga0268266_10017988 Ga0268266_100179882 400
378 3300028379 Ga0268266_10040573 Ga0268266_100405731 400
379 3300028381 Ga0268264_10037766 Ga0268264_100377663 400
380 3300031344 Ga0265316_10096355 Ga0265316_100963552 400
381 3300035691 Ga0373931_0015496 Ga0373931_0015496_2207_3520 400
382 3300039447 Ga0436361_0877238 Ga0436361_0877238_5746_7062 400
383 3300046472 Ga0495580_0001960 Ga0495580_0001960_8933_10249 400
384 3300046472 Ga0495580_0031303 Ga0495580_0031303_82_1395 400
385 3300046473 Ga0495582_0000232 Ga0495582_0000232_19972_21288 400
386 3300046499 Ga0495594_0004095 Ga0495594_0004095_1152_2465 400
387 3300046526 Ga0495666_0050742 Ga0495666_0050742_290_1603 400
388 3300046533 Ga0495640_0007988 Ga0495640_0007988_1991_3304 400
389 3300046681 Ga0495647_0040406 Ga0495647_0040406_409_1722 400
390 3300046683 Ga0495658_0029694 Ga0495658_0029694_264_1577 400
391 3300047315 Ga0495581_0007531 Ga0495581_0007531_1296_2609 400
392 3300047319 Ga0495674_0078386 Ga0495674_0078386_1263_2576 400
393 3300047321 Ga0495676_0058422 Ga0495676_0058422_1386_2699 400
394 3300047673 Ga0495593_0028091 Ga0495593_0028091_1738_3051 400
395 3300048903 Ga0496100_0147106 Ga0496100_0147106_73_1386 400
396 3300048907 Ga0496104_0000071 Ga0496104_0000071_50677_51996 400
397 3300048916 Ga0496113_0021745 Ga0496113_0021745_281_1594 400
398 3300048918 Ga0496115_0013469 Ga0496115_0013469_4667_5980 400
399 3300005329 Ga0070683_100159968 Ga0070683_1001599682 401
400 3300005467 Ga0070706_100053056 Ga0070706_1000530562 401
401 3300005614 Ga0068856_100091595 Ga0068856_1000915952 401
402 3300005841 Ga0068863_100002345 Ga0068863_1000023452 401
403 3300005842 Ga0068858_100030233 Ga0068858_1000302332 401
404 3300005843 Ga0068860_100054613 Ga0068860_1000546134 401
405 3300006173 Ga0070716_100047982 Ga0070716_1000479822 401
406 3300006871 Ga0075434_100005128 Ga0075434_1000051289 401
407 3300007076 Ga0075435_100059576 Ga0075435_1000595763 401
408 3300009093 Ga0105240_10027147 Ga0105240_100271475 401
409 3300009177 Ga0105248_10266910 Ga0105248_102669102 401
410 3300009551 Ga0105238_10119512 Ga0105238_101195122 401
411 3300009553 Ga0105249_10404999 Ga0105249_104049991 401
412 3300013297 Ga0157378_10049777 Ga0157378_100497773 401
413 3300013297 Ga0157378_10070402 Ga0157378_100704023 401
414 3300014969 Ga0157376_10000023 Ga0157376_10000023180 401
415 3300025910 Ga0207684_10030224 Ga0207684_100302242 401
416 3300025910 Ga0207684_10157014 Ga0207684_101570141 401
417 3300025912 Ga0207707_10021978 Ga0207707_100219785 401
418 3300025913 Ga0207695_10013830 Ga0207695_100138303 401
419 3300025939 Ga0207665_10036769 Ga0207665_100367692 401
420 3300026023 Ga0207677_10001241 Ga0207677_1000124115 401
421 3300026035 Ga0207703_10057396 Ga0207703_100573962 401
422 3300026088 Ga0207641_10006841 Ga0207641_100068412 401
423 3300028381 Ga0268264_10066921 Ga0268264_100669213 401
424 3300028381 Ga0268264_10262534 Ga0268264_102625341 401
425 3300028800 Ga0265338_10004358 Ga0265338_100043587 401
426 3300031249 Ga0265339_10009203 Ga0265339_100092034 401
427 3300039437 Ga0436365_1427729 Ga0436365_1427729_1052_2374 401
428 3300047472 Ga0495686_0000018 Ga0495686_0000018_396365_397687 401
429 3300048918 Ga0496115_0023958 Ga0496115_0023958_714_2054 401
430 3300050512 nmdc:mga0n895_1232_c1 nmdc:mga0n895_1232_c1_6175_7485 401
431 3300050513 nmdc:mga0rr50_15239_c1 nmdc:mga0rr50_15239_c1_3317_4627 401
432 iso_pu_bacteria 2883068021 2883072955 401
433 3300005336 Ga0070680_100020632 Ga0070680_1000206326 402
434 3300005345 Ga0070692_10054368 Ga0070692_100543681 402
435 3300005458 Ga0070681_10020352 Ga0070681_100203527 402
436 3300005530 Ga0070679_100017902 Ga0070679_1000179026 402
437 3300005548 Ga0070665_100005312 Ga0070665_10000531210 402
438 3300006178 Ga0075367_10010419 Ga0075367_100104195 402
439 3300007265 Ga0099794_10006581 Ga0099794_100065811 402
440 3300009098 Ga0105245_10141088 Ga0105245_101410882 402
441 3300013105 Ga0157369_10117798 Ga0157369_101177983 402
442 3300013105 Ga0157369_10161718 Ga0157369_101617182 402
443 3300013306 Ga0163162_10000643 Ga0163162_1000064316 402
444 3300013307 Ga0157372_10108835 Ga0157372_101088353 402
445 3300013308 Ga0157375_10209049 Ga0157375_102090491 402
446 3300020075 Ga0206349_1942608 Ga0206349_19426081 402
447 3300021384 Ga0213876_10033728 Ga0213876_100337282 402
448 3300022467 Ga0224712_10001848 Ga0224712_100018482 402
449 3300025921 Ga0207652_10035420 Ga0207652_100354207 402
450 3300025941 Ga0207711_10284876 Ga0207711_102848761 402
451 3300028379 Ga0268266_10000276 Ga0268266_100002769 402
452 3300028666 Ga0265336_10001467 Ga0265336_1000146710 402
453 3300037418 Ga0395900_0098271 Ga0395900_0098271_382_1713 402
454 3300044712 Ga0453684_0006535 Ga0453684_0006535_977_2269 402
455 3300049581 Ga0501047_0231325 Ga0501047_0231325_223_1563 402
456 3300053085 Ga0495619_0023333 Ga0495619_0023333_612_1964 402
457 3300005327 Ga0070658_10262184 Ga0070658_102621841 403
458 3300005329 Ga0070683_100044227 Ga0070683_1000442272 403
459 3300005331 Ga0070670_100003591 Ga0070670_1000035912 403
460 3300005336 Ga0070680_100105787 Ga0070680_1001057872 403
461 3300005338 Ga0068868_100022223 Ga0068868_1000222233 403
462 3300005340 Ga0070689_100097225 Ga0070689_1000972253 403
463 3300005344 Ga0070661_100075564 Ga0070661_1000755641 403
464 3300005364 Ga0070673_100020098 Ga0070673_1000200983 403
465 3300005365 Ga0070688_100112957 Ga0070688_1001129572 403
466 3300005458 Ga0070681_10003899 Ga0070681_100038993 403
467 3300005458 Ga0070681_10076114 Ga0070681_100761143 403
468 3300005530 Ga0070679_100029757 Ga0070679_1000297575 403
469 3300005535 Ga0070684_100048725 Ga0070684_1000487252 403
470 3300005563 Ga0068855_100007033 Ga0068855_1000070332 403
471 3300005563 Ga0068855_100008720 Ga0068855_1000087209 403
472 3300005564 Ga0070664_100004251 Ga0070664_1000042519 403
473 3300005577 Ga0068857_100003979 Ga0068857_1000039799 403
474 3300005577 Ga0068857_100019225 Ga0068857_1000192253 403
475 3300005578 Ga0068854_100011344 Ga0068854_1000113445 403
476 3300005614 Ga0068856_100008204 Ga0068856_1000082043 403
477 3300005614 Ga0068856_100008836 Ga0068856_1000088364 403
478 3300005614 Ga0068856_100010673 Ga0068856_1000106732 403
479 3300005617 Ga0068859_100172793 Ga0068859_1001727932 403
480 3300005618 Ga0068864_100068610 Ga0068864_1000686103 403
481 3300005718 Ga0068866_10021163 Ga0068866_100211632 403
482 3300005840 Ga0068870_10017678 Ga0068870_100176785 403
483 3300005841 Ga0068863_100125243 Ga0068863_1001252431 403
484 3300005842 Ga0068858_100005785 Ga0068858_1000057859 403
485 3300005843 Ga0068860_100164300 Ga0068860_1001643002 403
486 3300006237 Ga0097621_100023969 Ga0097621_1000239693 403
487 3300006358 Ga0068871_100001290 Ga0068871_10000129014 403
488 3300006358 Ga0068871_100088748 Ga0068871_1000887482 403
489 3300006871 Ga0075434_100359442 Ga0075434_1003594421 403
490 3300006881 Ga0068865_100017819 Ga0068865_1000178193 403
491 3300006931 Ga0097620_100172791 Ga0097620_1001727912 403
492 3300007265 Ga0099794_10005808 Ga0099794_100058084 403
493 3300007265 Ga0099794_10027794 Ga0099794_100277943 403
494 3300009093 Ga0105240_10297946 Ga0105240_102979462 403
495 3300009098 Ga0105245_10079355 Ga0105245_100793553 403
496 3300009174 Ga0105241_10081761 Ga0105241_100817612 403
497 3300009551 Ga0105238_10000552 Ga0105238_1000055233 403
498 3300010375 Ga0105239_10067648 Ga0105239_100676482 403
499 3300010375 Ga0105239_10098951 Ga0105239_100989512 403
500 3300013104 Ga0157370_10211055 Ga0157370_102110552 403
501 3300013105 Ga0157369_10006362 Ga0157369_100063629 403
502 3300013105 Ga0157369_10187985 Ga0157369_101879852 403
503 3300013296 Ga0157374_10001815 Ga0157374_1000181516 403
504 3300013296 Ga0157374_10009359 Ga0157374_100093597 403
505 3300013297 Ga0157378_10001360 Ga0157378_1000136019 403
506 3300013297 Ga0157378_10005518 Ga0157378_100055187 403
507 3300013307 Ga0157372_10000685 Ga0157372_1000068530 403
508 3300013307 Ga0157372_10005288 Ga0157372_100052889 403
509 3300013307 Ga0157372_10009321 Ga0157372_100093212 403
510 3300013308 Ga0157375_10008565 Ga0157375_100085658 403
511 3300013308 Ga0157375_10049713 Ga0157375_100497132 403
512 3300025904 Ga0207647_10059914 Ga0207647_100599142 403
513 3300025912 Ga0207707_10001311 Ga0207707_100013113 403
514 3300025912 Ga0207707_10049037 Ga0207707_100490372 403
515 3300025913 Ga0207695_10071089 Ga0207695_100710892 403
516 3300025920 Ga0207649_10075571 Ga0207649_100755711 403
517 3300025921 Ga0207652_10016368 Ga0207652_100163683 403
518 3300025927 Ga0207687_10113743 Ga0207687_101137432 403
519 3300025938 Ga0207704_10006293 Ga0207704_100062934 403
520 3300025942 Ga0207689_10165181 Ga0207689_101651812 403
521 3300025945 Ga0207679_10021273 Ga0207679_100212732 403
522 3300025949 Ga0207667_10024835 Ga0207667_100248355 403
523 3300025949 Ga0207667_10122904 Ga0207667_101229043 403
524 3300025981 Ga0207640_10005798 Ga0207640_100057985 403
525 3300026035 Ga0207703_10093978 Ga0207703_100939782 403
526 3300026041 Ga0207639_10048935 Ga0207639_100489351 403
527 3300026078 Ga0207702_10003499 Ga0207702_1000349911 403
528 3300026078 Ga0207702_10006873 Ga0207702_100068731 403
529 3300026095 Ga0207676_10023414 Ga0207676_100234143 403
530 3300026116 Ga0207674_10003396 Ga0207674_100033963 403
531 3300026116 Ga0207674_10003522 Ga0207674_1000352218 403
532 3300039437 Ga0436365_1518684 Ga0436365_1518684_1109_2488 403
533 3300048905 Ga0496102_0085173 Ga0496102_0085173_406_1710 403
534 3300048915 Ga0496112_0034587 Ga0496112_0034587_1209_2513 403
535 3300048915 Ga0496112_0096293 Ga0496112_0096293_1033_2340 403
536 3300049822 Ga0501035_0025899 Ga0501035_0025899_315_1661 403
537 3300049823 Ga0501044_0005139 Ga0501044_0005139_4568_5914 403
538 3300005445 Ga0070708_100096661 Ga0070708_1000966612 404
539 3300005467 Ga0070706_100007251 Ga0070706_1000072511 404
540 3300005467 Ga0070706_100068975 Ga0070706_1000689753 404
541 3300005468 Ga0070707_100010484 Ga0070707_1000104847 404
542 3300005471 Ga0070698_100129918 Ga0070698_1001299182 404
543 3300005518 Ga0070699_100001924 Ga0070699_10000192412 404
544 3300005536 Ga0070697_100000142 Ga0070697_10000014222 404
545 3300005536 Ga0070697_100005294 Ga0070697_1000052943 404
546 3300025910 Ga0207684_10000404 Ga0207684_1000040428 404
547 3300025910 Ga0207684_10011107 Ga0207684_100111072 404
548 3300025922 Ga0207646_10003451 Ga0207646_1000345113 404
549 3300046665 Ga0495661_0091113 Ga0495661_0091113_37_1338 404
550 3300013307 Ga0157372_10049235 Ga0157372_100492354 405
551 3300028800 Ga0265338_10011969 Ga0265338_100119695 405
552 3300031235 Ga0265330_10019477 Ga0265330_100194773 405
553 3300031239 Ga0265328_10016113 Ga0265328_100161132 405
554 3300031249 Ga0265339_10000166 Ga0265339_1000016615 405
555 3300031344 Ga0265316_10001544 Ga0265316_1000154411 405
556 3300031711 Ga0265314_10006932 Ga0265314_1000693210 405
557 3300031712 Ga0265342_10028058 Ga0265342_100280582 405
558 3300009177 Ga0105248_10114929 Ga0105248_101149291 406
559 3300031344 Ga0265316_10052104 Ga0265316_100521043 406
560 3300031712 Ga0265342_10009510 Ga0265342_100095103 406
561 3300037853 Ga0436364_0465416 Ga0436364_0465416_745_2256 406
562 3300005327 Ga0070658_10001662 Ga0070658_1000166212 407
563 3300005339 Ga0070660_100007846 Ga0070660_1000078461 407
564 3300005563 Ga0068855_100008387 Ga0068855_1000083874 407
565 3300005614 Ga0068856_100008707 Ga0068856_1000087076 407
566 3300013104 Ga0157370_10006501 Ga0157370_100065019 407
567 3300013105 Ga0157369_10011496 Ga0157369_100114962 407
568 3300013307 Ga0157372_10001623 Ga0157372_100016238 407
569 3300025909 Ga0207705_10014727 Ga0207705_100147272 407
570 3300025919 Ga0207657_10018089 Ga0207657_100180895 407
571 3300025949 Ga0207667_10003522 Ga0207667_100035229 407
572 3300026078 Ga0207702_10135686 Ga0207702_101356862 407
573 3300031241 Ga0265325_10004129 Ga0265325_100041294 407
574 3300037853 Ga0436364_0035386 Ga0436364_0035386_689_2044 407
575 3300039437 Ga0436365_0826620 Ga0436365_0826620_2815_4170 407
576 3300003320 rootH2_10117872 rootH2_101178722 409
577 3300007265 Ga0099794_10053244 Ga0099794_100532441 410
578 3300027671 Ga0209588_1009575 Ga0209588_10095752 410
579 3300048929 Ga0496126_0000095 Ga0496126_0000095_127304_128638 411
580 3300005455 Ga0070663_100100837 Ga0070663_1001008371 414
581 3300005548 Ga0070665_100044843 Ga0070665_1000448432 414
582 3300013296 Ga0157374_10037505 Ga0157374_100375051 414
583 3300025904 Ga0207647_10007704 Ga0207647_100077044 414
584 3300048918 Ga0496115_0051686 Ga0496115_0051686_100_1419 414
585 3300000546 LJNas_1000588 LJNas_10005885 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

86

454

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.7442 27 411
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.7319 27 411
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.7275 21 400
3o7q-assembly1.cif.gz_A crystal structure of a major facilitator superfamily (mfs) transporter, fucp, in the outward conformation 0.7206 23 404
6e8j-assembly1.cif.gz_A crystal structure of a bacterial homolog to human lysosomal transporter, spinster, in inward-facing and occupied conformation 0.7203 19 406
ID Description Score Start End Superfamily
af_Q4DW70_101_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8879 62 159 1.20.1250.20
af_Q66GI9_106_299_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8756 22 226 1.20.1250.20
af_A0A0R0F726_79_268_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8607 20 235 1.20.1250.20
3o7qA02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8557 245 404 1.20.1250.20
af_P11551_22_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8535 23 233 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2B7ZZB4-F1-model_v4 Glucose/galactose MFS transporter 0.9066 12 172 GO:0005886
GO:0022857
AF-A0A2B7ZZB4-F1-model_v4 Glucose/galactose MFS transporter 0.8759 12 172 GO:0005886
GO:0022857
AF-A0A0N1KFM2-F1-model_v4 deleted 0.8626 15 231
AF-A0A3C0QTN0-F1-model_v4 Glucose/galactose MFS transporter 0.8347 21 406 GO:0005886
GO:0022857
AF-A0A6I1JCH0-F1-model_v4 deleted 0.8195 4 177

Feature Viewer

pLDDT pTM Quality
82.78 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map