F465520
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 576 | 395 | 520 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10026182|Ga0307414_100261824 |
| Length | 330 |
| Sequence | LYLAGLGVCCHKAAESLIVSLCTCPGYAGVCFSELEKKVAQITASMVKELREKTDAPMMECKKALTEAEGDLARAEEILRVKLGNKASKAATRVTAEGLIGLYITPDNKRGTVVEVNCETDFVAKNDDFVGFINQVAELITDKNPADVAALAALSMGEGTVETTRSALVGKIGENISIRRFQRFETGDQLASYVHGGKIGVLVEFAGPEETGKDLAMHIAATKPRALDASGVSQADIAAERSVAEQKAAESGKPAEIVTKMVDGAVQKYLKEVTLLSQPFVKNDKQSIEQMLKEKGAKVTGFALYVVGEGIEKKSEDFAAEVAAAAAGTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 5 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 6 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 7 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 8 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 9 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 10 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 11 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 12 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 13 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 14 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 15 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 16 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 17 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 18 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 19 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 20 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 21 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 22 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 23 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 24 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 25 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 26 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 27 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 28 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 29 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 30 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 31 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 32 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 33 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 34 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 35 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 36 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 37 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 38 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 39 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 40 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 41 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 42 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 43 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 44 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 45 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 46 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 47 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 48 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 49 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 50 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 51 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 52 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 53 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 54 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 55 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 56 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 57 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 58 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 59 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 60 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 80 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 81 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 97 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 132 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 133 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 160 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 161 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 242 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 257 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 275 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 339 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 340 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 384 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 385 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 386 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 387 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 388 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 391 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 392 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 393 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 394 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 395 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.54 |
| Metatranscriptomes | 1.74 |
| Isolates | 9.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.24 |
| Nodule | 2.26 |
| Rhizoplane | 1.74 |
| Rhizosphere | 73.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000372 | 3300002704 | Bacteria | 13405 |
| 2 | Ga0006759J45824_1020768 | 3300003163 | Bacteria | 2548 |
| 3 | JGI25151J46595_10005266 | 3300003187 | Bacteria | 6702 |
| 4 | JGI25151J46595_10006164 | 3300003187 | Bacteria | 6073 |
| 5 | JGI25151J46595_10013369 | 3300003187 | Bacteria | 3695 |
| 6 | JGI25153J46596_10002002 | 3300003215 | Bacteria | 12045 |
| 7 | JGI25160J50197_1004394 | 3300003354 | Bacteria | 6104 |
| 8 | Ga0007417J51691_1011547 | 3300003544 | Bacteria | 2361 |
| 9 | Ga0007410J51695_1010058 | 3300003574 | Bacteria | 4462 |
| 10 | Ga0007409J51694_1006129 | 3300003575 | Bacteria | 4322 |
| 11 | Ga0007416J51690_1010384 | 3300003577 | Bacteria | 4494 |
| 12 | Ga0032354_1020514 | 3300003693 | Bacteria | 4368 |
| 13 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 14 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 15 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 16 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 17 | Ga0055529_1000977 | 3300003763 | Bacteria | 14289 |
| 18 | Ga0055526_1017220 | 3300003771 | Bacteria | 2775 |
| 19 | Ga0055537_1010233 | 3300003773 | Bacteria | 1993 |
| 20 | Ga0055524_1021989 | 3300003775 | Bacteria | 2096 |
| 21 | Ga0055536_1000211 | 3300003781 | Bacteria | 47611 |
| 22 | Ga0055534_1001154 | 3300003784 | Bacteria | 11154 |
| 23 | Ga0055528_1013339 | 3300003790 | Bacteria | 3117 |
| 24 | Ga0055530_10010065 | 3300003791 | Bacteria | 3549 |
| 25 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 26 | Ga0065704_10107675 | 3300005289 | Bacteria | 2049 |
| 27 | Ga0065704_10171474 | 3300005289 | Bacteria | 1289 |
| 28 | Ga0065707_10101473 | 3300005295 | Bacteria | 2862 |
| 29 | Ga0070676_10057426 | 3300005328 | Bacteria | 2303 |
| 30 | Ga0070690_100018947 | 3300005330 | Bacteria | 4167 |
| 31 | Ga0070670_100046142 | 3300005331 | Bacteria | 3746 |
| 32 | Ga0070670_100052950 | 3300005331 | Bacteria | 3486 |
| 33 | Ga0068869_100003267 | 3300005334 | Bacteria | 9903 |
| 34 | Ga0068869_100122415 | 3300005334 | Bacteria | 1991 |
| 35 | Ga0068869_100130306 | 3300005334 | Bacteria | 1932 |
| 36 | Ga0068868_100013526 | 3300005338 | Bacteria | 5985 |
| 37 | Ga0070660_100001298 | 3300005339 | Bacteria | 17020 |
| 38 | Ga0070689_100519148 | 3300005340 | Bacteria | 1023 |
| 39 | Ga0070675_100035020 | 3300005354 | Bacteria | 4077 |
| 40 | Ga0070675_100161662 | 3300005354 | Bacteria | 1926 |
| 41 | Ga0070671_100009222 | 3300005355 | Bacteria | 7926 |
| 42 | Ga0070671_100108894 | 3300005355 | Bacteria | 2326 |
| 43 | Ga0070674_100035299 | 3300005356 | Bacteria | 3348 |
| 44 | Ga0070674_100060608 | 3300005356 | Bacteria | 2638 |
| 45 | Ga0070674_100062878 | 3300005356 | Bacteria | 2596 |
| 46 | Ga0070673_100100428 | 3300005364 | Bacteria | 2382 |
| 47 | Ga0070673_100229297 | 3300005364 | Bacteria | 1611 |
| 48 | Ga0070659_100324752 | 3300005366 | Bacteria | 1287 |
| 49 | Ga0070667_100084285 | 3300005367 | Bacteria | 2724 |
| 50 | Ga0070667_100237088 | 3300005367 | Bacteria | 1628 |
| 51 | Ga0070667_100414150 | 3300005367 | Bacteria | 1228 |
| 52 | Ga0070694_100197072 | 3300005444 | Bacteria | 1499 |
| 53 | Ga0070694_100228004 | 3300005444 | Bacteria | 1400 |
| 54 | Ga0070694_100276990 | 3300005444 | Bacteria | 1278 |
| 55 | Ga0070678_100014278 | 3300005456 | Bacteria | 5005 |
| 56 | Ga0070678_100148987 | 3300005456 | Bacteria | 1883 |
| 57 | Ga0070681_10054614 | 3300005458 | Bacteria | 3981 |
| 58 | Ga0070681_10099387 | 3300005458 | Bacteria | 2856 |
| 59 | Ga0068867_100332156 | 3300005459 | Bacteria | 1263 |
| 60 | Ga0070699_100152459 | 3300005518 | Bacteria | 2045 |
| 61 | Ga0070684_100327803 | 3300005535 | Bacteria | 1407 |
| 62 | Ga0070697_100090031 | 3300005536 | Bacteria | 2536 |
| 63 | Ga0068853_100055595 | 3300005539 | Bacteria | 3412 |
| 64 | Ga0068853_100314356 | 3300005539 | Bacteria | 1451 |
| 65 | Ga0070672_100004310 | 3300005543 | Bacteria | 9307 |
| 66 | Ga0070695_100007395 | 3300005545 | Bacteria | 6515 |
| 67 | Ga0070665_100054543 | 3300005548 | Bacteria | 4009 |
| 68 | Ga0070665_100138102 | 3300005548 | Bacteria | 2440 |
| 69 | Ga0068855_100001340 | 3300005563 | Bacteria | 30486 |
| 70 | Ga0068855_100010957 | 3300005563 | Bacteria | 10939 |
| 71 | Ga0068855_100516689 | 3300005563 | Bacteria | 1296 |
| 72 | Ga0070664_100015472 | 3300005564 | Bacteria | 6240 |
| 73 | Ga0070664_100371872 | 3300005564 | Bacteria | 1303 |
| 74 | Ga0068857_100060442 | 3300005577 | Bacteria | 3366 |
| 75 | Ga0068854_100000993 | 3300005578 | Bacteria | 17083 |
| 76 | Ga0068856_100304393 | 3300005614 | Bacteria | 1612 |
| 77 | Ga0068852_100079188 | 3300005616 | Bacteria | 2910 |
| 78 | Ga0068859_100250726 | 3300005617 | Bacteria | 1861 |
| 79 | Ga0068864_100077826 | 3300005618 | Bacteria | 2901 |
| 80 | Ga0068864_100150849 | 3300005618 | Bacteria | 2105 |
| 81 | Ga0068861_100132738 | 3300005719 | Bacteria | 2023 |
| 82 | Ga0068861_100186196 | 3300005719 | Bacteria | 1731 |
| 83 | Ga0068851_10006259 | 3300005834 | Bacteria | 5431 |
| 84 | Ga0068851_10126062 | 3300005834 | Bacteria | 1381 |
| 85 | Ga0068863_100255161 | 3300005841 | Bacteria | 1695 |
| 86 | Ga0068858_100043999 | 3300005842 | Bacteria | 4140 |
| 87 | Ga0068858_100179395 | 3300005842 | Bacteria | 1999 |
| 88 | Ga0068860_100223993 | 3300005843 | Bacteria | 1826 |
| 89 | Ga0068862_100102333 | 3300005844 | Bacteria | 2507 |
| 90 | Ga0075368_10001014 | 3300006042 | Bacteria | 8786 |
| 91 | Ga0075363_100003480 | 3300006048 | Bacteria | 6700 |
| 92 | Ga0075364_10003579 | 3300006051 | Bacteria | 8847 |
| 93 | Ga0075364_10008637 | 3300006051 | Bacteria | 6093 |
| 94 | Ga0075364_10022675 | 3300006051 | Bacteria | 3968 |
| 95 | Ga0075362_10011738 | 3300006177 | Bacteria | 3457 |
| 96 | Ga0075367_10004716 | 3300006178 | Bacteria | 6700 |
| 97 | Ga0075369_10028077 | 3300006186 | Bacteria | 2356 |
| 98 | Ga0075366_10003213 | 3300006195 | Bacteria | 8577 |
| 99 | Ga0075366_10008907 | 3300006195 | Bacteria | 5591 |
| 100 | Ga0097621_100011505 | 3300006237 | Bacteria | 6519 |
| 101 | Ga0097621_100021575 | 3300006237 | Bacteria | 4985 |
| 102 | Ga0097621_100359059 | 3300006237 | Bacteria | 1297 |
| 103 | Ga0075370_10007136 | 3300006353 | Bacteria | 5672 |
| 104 | Ga0068871_100031771 | 3300006358 | Bacteria | 4166 |
| 105 | Ga0068871_100509762 | 3300006358 | Bacteria | 1085 |
| 106 | Ga0075428_100000245 | 3300006844 | Bacteria | 53219 |
| 107 | Ga0075430_100015261 | 3300006846 | Bacteria | 6540 |
| 108 | Ga0075430_100040292 | 3300006846 | Bacteria | 3955 |
| 109 | Ga0075431_100003069 | 3300006847 | Bacteria | 16172 |
| 110 | Ga0075431_100174842 | 3300006847 | Bacteria | 2206 |
| 111 | Ga0075431_100197206 | 3300006847 | Bacteria | 2061 |
| 112 | Ga0075429_100030290 | 3300006880 | Bacteria | 4700 |
| 113 | Ga0068865_100045835 | 3300006881 | Bacteria | 2998 |
| 114 | Ga0075436_100085530 | 3300006914 | Bacteria | 2190 |
| 115 | Ga0097620_100250739 | 3300006931 | Bacteria | 1861 |
| 116 | Ga0079104_1000025 | 3300006946 | Bacteria | 218785 |
| 117 | Ga0079104_1011224 | 3300006946 | Bacteria | 2893 |
| 118 | Ga0099826_10000012 | 3300006948 | Bacteria | 283499 |
| 119 | Ga0099794_10026857 | 3300007265 | Bacteria | 2665 |
| 120 | Ga0099794_10038181 | 3300007265 | Bacteria | 2275 |
| 121 | Ga0105251_10054280 | 3300009011 | Bacteria | 1903 |
| 122 | Ga0105240_10035080 | 3300009093 | Bacteria | 6468 |
| 123 | Ga0111539_10000383 | 3300009094 | Bacteria | 54556 |
| 124 | Ga0111539_10159164 | 3300009094 | Bacteria | 2641 |
| 125 | Ga0105245_10220811 | 3300009098 | Bacteria | 1829 |
| 126 | Ga0105247_10130261 | 3300009101 | Bacteria | 1639 |
| 127 | Ga0105243_10000729 | 3300009148 | Bacteria | 31488 |
| 128 | Ga0105243_10033164 | 3300009148 | Bacteria | 3992 |
| 129 | Ga0105243_10079014 | 3300009148 | Bacteria | 2680 |
| 130 | Ga0105241_10307760 | 3300009174 | Bacteria | 1362 |
| 131 | Ga0105242_10039525 | 3300009176 | Bacteria | 3798 |
| 132 | Ga0105242_10196791 | 3300009176 | Bacteria | 1788 |
| 133 | Ga0105248_10002249 | 3300009177 | Bacteria | 21375 |
| 134 | Ga0105248_10002407 | 3300009177 | Bacteria | 20777 |
| 135 | Ga0105248_10218927 | 3300009177 | Bacteria | 2144 |
| 136 | Ga0105237_10005766 | 3300009545 | Bacteria | 13911 |
| 137 | Ga0105237_10025618 | 3300009545 | Bacteria | 6028 |
| 138 | Ga0105238_10115807 | 3300009551 | Bacteria | 2660 |
| 139 | Ga0105239_10037494 | 3300010375 | Bacteria | 5312 |
| 140 | Ga0105239_10039314 | 3300010375 | Bacteria | 5183 |
| 141 | Ga0105246_10108932 | 3300011119 | Bacteria | 2031 |
| 142 | Ga0157373_10004456 | 3300013100 | Bacteria | 10537 |
| 143 | Ga0157370_10213618 | 3300013104 | Bacteria | 1787 |
| 144 | Ga0157369_10000979 | 3300013105 | Bacteria | 36209 |
| 145 | Ga0157369_10160429 | 3300013105 | Bacteria | 2374 |
| 146 | Ga0157374_10000107 | 3300013296 | Bacteria | 75925 |
| 147 | Ga0157374_10000145 | 3300013296 | Bacteria | 64560 |
| 148 | Ga0157374_10052521 | 3300013296 | Bacteria | 3797 |
| 149 | Ga0157374_10259174 | 3300013296 | Bacteria | 1712 |
| 150 | Ga0157378_10219365 | 3300013297 | Bacteria | 1807 |
| 151 | Ga0163162_10019867 | 3300013306 | Bacteria | 6597 |
| 152 | Ga0163162_10045102 | 3300013306 | Bacteria | 4417 |
| 153 | Ga0163162_10078206 | 3300013306 | Bacteria | 3373 |
| 154 | Ga0157372_10002854 | 3300013307 | Bacteria | 18675 |
| 155 | Ga0163163_10260928 | 3300014325 | Bacteria | 1783 |
| 156 | Ga0157380_10194863 | 3300014326 | Bacteria | 1792 |
| 157 | Ga0157379_10109018 | 3300014968 | Bacteria | 2486 |
| 158 | Ga0157379_10137413 | 3300014968 | Bacteria | 2202 |
| 159 | Ga0157376_10062291 | 3300014969 | Bacteria | 3138 |
| 160 | Ga0157376_10246115 | 3300014969 | Bacteria | 1668 |
| 161 | Ga0163161_10038025 | 3300017792 | Bacteria | 3450 |
| 162 | Ga0206355_1291451 | 3300020076 | Bacteria | 1214 |
| 163 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 164 | Ga0213872_10015634 | 3300021361 | Bacteria | 3527 |
| 165 | Ga0213872_10073098 | 3300021361 | Bacteria | 1544 |
| 166 | Ga0213872_10082680 | 3300021361 | Bacteria | 1441 |
| 167 | Ga0209436_100479 | 3300025208 | Bacteria | 17653 |
| 168 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 169 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 170 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 171 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 172 | Ga0209258_103478 | 3300025242 | Bacteria | 3374 |
| 173 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 174 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 175 | Ga0209759_1003925 | 3300025256 | Bacteria | 5732 |
| 176 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 177 | Ga0209565_1000021 | 3300025263 | Bacteria | 406281 |
| 178 | Ga0209565_1000983 | 3300025263 | Bacteria | 14647 |
| 179 | Ga0209565_1023911 | 3300025263 | Bacteria | 1250 |
| 180 | Ga0209455_1000515 | 3300025272 | Bacteria | 27385 |
| 181 | Ga0209673_1011367 | 3300025273 | Bacteria | 3676 |
| 182 | Ga0209130_1000990 | 3300025284 | Bacteria | 22166 |
| 183 | Ga0209130_1013661 | 3300025284 | Bacteria | 2071 |
| 184 | Ga0207673_1006146 | 3300025290 | Bacteria | 1480 |
| 185 | Ga0209675_1000149 | 3300025291 | Bacteria | 93109 |
| 186 | Ga0209675_1000250 | 3300025291 | Bacteria | 53412 |
| 187 | Ga0209675_1000722 | 3300025291 | Bacteria | 22494 |
| 188 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 189 | Ga0209676_1003098 | 3300025292 | Bacteria | 10694 |
| 190 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 191 | Ga0209025_1000115 | 3300025294 | Bacteria | 218871 |
| 192 | Ga0209025_1000522 | 3300025294 | Bacteria | 73140 |
| 193 | Ga0209025_1001089 | 3300025294 | Bacteria | 39299 |
| 194 | Ga0209025_1013887 | 3300025294 | Bacteria | 5016 |
| 195 | Ga0209564_1003403 | 3300025295 | Bacteria | 10940 |
| 196 | Ga0209564_1003556 | 3300025295 | Bacteria | 10461 |
| 197 | Ga0209564_1023976 | 3300025295 | Bacteria | 2099 |
| 198 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 199 | Ga0209758_1019907 | 3300025297 | Bacteria | 3207 |
| 200 | Ga0209050_1001037 | 3300025298 | Bacteria | 34453 |
| 201 | Ga0209050_1013802 | 3300025298 | Bacteria | 3549 |
| 202 | Ga0209256_1000280 | 3300025299 | Bacteria | 89706 |
| 203 | Ga0209256_1000625 | 3300025299 | Bacteria | 48667 |
| 204 | Ga0209256_1001989 | 3300025299 | Bacteria | 18379 |
| 205 | Ga0209256_1002500 | 3300025299 | Bacteria | 14836 |
| 206 | Ga0207426_1001293 | 3300025302 | Bacteria | 21613 |
| 207 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 208 | Ga0207697_10015856 | 3300025315 | Bacteria | 3108 |
| 209 | Ga0207697_10019635 | 3300025315 | Bacteria | 2769 |
| 210 | Ga0207688_10015702 | 3300025901 | Bacteria | 4108 |
| 211 | Ga0207645_10006952 | 3300025907 | Bacteria | 8057 |
| 212 | Ga0207643_10001107 | 3300025908 | Bacteria | 15985 |
| 213 | Ga0207654_10012463 | 3300025911 | Bacteria | 4356 |
| 214 | Ga0207707_10024191 | 3300025912 | Bacteria | 5313 |
| 215 | Ga0207695_10008662 | 3300025913 | Bacteria | 12692 |
| 216 | Ga0207695_10016694 | 3300025913 | Bacteria | 8579 |
| 217 | Ga0207695_10377419 | 3300025913 | Bacteria | 1303 |
| 218 | Ga0207671_10068927 | 3300025914 | Bacteria | 2636 |
| 219 | Ga0207671_10079071 | 3300025914 | Bacteria | 2464 |
| 220 | Ga0207660_10036839 | 3300025917 | Bacteria | 3403 |
| 221 | Ga0207657_10007584 | 3300025919 | Bacteria | 11119 |
| 222 | Ga0207681_10164130 | 3300025923 | Bacteria | 1677 |
| 223 | Ga0207694_10001629 | 3300025924 | Bacteria | 18867 |
| 224 | Ga0207694_10239374 | 3300025924 | Unclassified | 1483 |
| 225 | Ga0207650_10042006 | 3300025925 | Bacteria | 3353 |
| 226 | Ga0207650_10116033 | 3300025925 | Bacteria | 2079 |
| 227 | Ga0207659_10068983 | 3300025926 | Bacteria | 2573 |
| 228 | Ga0207659_10222924 | 3300025926 | Bacteria | 1517 |
| 229 | Ga0207644_10017444 | 3300025931 | Bacteria | 4847 |
| 230 | Ga0207644_10069053 | 3300025931 | Bacteria | 2579 |
| 231 | Ga0207644_10387375 | 3300025931 | Bacteria | 1141 |
| 232 | Ga0207706_10016696 | 3300025933 | Bacteria | 6625 |
| 233 | Ga0207686_10041023 | 3300025934 | Bacteria | 2819 |
| 234 | Ga0207709_10000170 | 3300025935 | Bacteria | 87011 |
| 235 | Ga0207709_10448542 | 3300025935 | Bacteria | 997 |
| 236 | Ga0207670_10072333 | 3300025936 | Bacteria | 2387 |
| 237 | Ga0207669_10041700 | 3300025937 | Bacteria | 2674 |
| 238 | Ga0207669_10084550 | 3300025937 | Bacteria | 2045 |
| 239 | Ga0207704_10114711 | 3300025938 | Bacteria | 1829 |
| 240 | Ga0207691_10017249 | 3300025940 | Bacteria | 6848 |
| 241 | Ga0207711_10002151 | 3300025941 | Bacteria | 17750 |
| 242 | Ga0207711_10020864 | 3300025941 | Bacteria | 5468 |
| 243 | Ga0207711_10174985 | 3300025941 | Bacteria | 1949 |
| 244 | Ga0207689_10000974 | 3300025942 | Bacteria | 27470 |
| 245 | Ga0207689_10011213 | 3300025942 | Bacteria | 7691 |
| 246 | Ga0207689_10142650 | 3300025942 | Bacteria | 1973 |
| 247 | Ga0207679_10099505 | 3300025945 | Bacteria | 2271 |
| 248 | Ga0207679_10171176 | 3300025945 | Bacteria | 1788 |
| 249 | Ga0207667_10000036 | 3300025949 | Bacteria | 297966 |
| 250 | Ga0207667_10003025 | 3300025949 | Bacteria | 20864 |
| 251 | Ga0207667_10349225 | 3300025949 | Bacteria | 1509 |
| 252 | Ga0207667_10431595 | 3300025949 | Bacteria | 1340 |
| 253 | Ga0207667_10433986 | 3300025949 | Bacteria | 1336 |
| 254 | Ga0207651_10122637 | 3300025960 | Bacteria | 1974 |
| 255 | Ga0207651_10248247 | 3300025960 | Bacteria | 1454 |
| 256 | Ga0207668_10123300 | 3300025972 | Bacteria | 1966 |
| 257 | Ga0207640_10056548 | 3300025981 | Bacteria | 2576 |
| 258 | Ga0207640_10081723 | 3300025981 | Bacteria | 2210 |
| 259 | Ga0207658_10157464 | 3300025986 | Bacteria | 1858 |
| 260 | Ga0207677_10026341 | 3300026023 | Bacteria | 3645 |
| 261 | Ga0207703_10200367 | 3300026035 | Bacteria | 1774 |
| 262 | Ga0207639_10032487 | 3300026041 | Bacteria | 3842 |
| 263 | Ga0207708_10002945 | 3300026075 | Bacteria | 12557 |
| 264 | Ga0207702_10256429 | 3300026078 | Bacteria | 1645 |
| 265 | Ga0207641_10230822 | 3300026088 | Bacteria | 1720 |
| 266 | Ga0207648_10016310 | 3300026089 | Bacteria | 6791 |
| 267 | Ga0207648_10307103 | 3300026089 | Bacteria | 1423 |
| 268 | Ga0207676_10029810 | 3300026095 | Bacteria | 4089 |
| 269 | Ga0207674_10075367 | 3300026116 | Bacteria | 3384 |
| 270 | Ga0207674_10078367 | 3300026116 | Bacteria | 3309 |
| 271 | Ga0207674_10080680 | 3300026116 | Bacteria | 3256 |
| 272 | Ga0207675_100036828 | 3300026118 | Bacteria | 4563 |
| 273 | Ga0207675_100062827 | 3300026118 | Bacteria | 3469 |
| 274 | Ga0207683_10003576 | 3300026121 | Bacteria | 13558 |
| 275 | Ga0207683_10019454 | 3300026121 | Bacteria | 5798 |
| 276 | Ga0207698_10212559 | 3300026142 | Bacteria | 1741 |
| 277 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 278 | Ga0209969_1000556 | 3300027360 | Bacteria | 5017 |
| 279 | Ga0210000_1011120 | 3300027462 | Bacteria | 1332 |
| 280 | Ga0209995_1003898 | 3300027471 | Bacteria | 2381 |
| 281 | Ga0209282_1000028 | 3300027666 | Bacteria | 159466 |
| 282 | Ga0209588_1004797 | 3300027671 | Bacteria | 3837 |
| 283 | Ga0209588_1011598 | 3300027671 | Bacteria | 2664 |
| 284 | Ga0209813_10005486 | 3300027866 | Bacteria | 3083 |
| 285 | Ga0209974_10002299 | 3300027876 | Bacteria | 6942 |
| 286 | Ga0207428_10009367 | 3300027907 | Bacteria | 8784 |
| 287 | Ga0268266_10072113 | 3300028379 | Bacteria | 2994 |
| 288 | Ga0268266_10290333 | 3300028379 | Bacteria | 1523 |
| 289 | Ga0268266_10424949 | 3300028379 | Bacteria | 1260 |
| 290 | Ga0268265_10025659 | 3300028380 | Bacteria | 4187 |
| 291 | Ga0268265_10193069 | 3300028380 | Bacteria | 1760 |
| 292 | Ga0265318_10016824 | 3300028577 | Bacteria | 3013 |
| 293 | Ga0265330_10007917 | 3300031235 | Bacteria | 5149 |
| 294 | Ga0265332_10000024 | 3300031238 | Bacteria | 209663 |
| 295 | Ga0265332_10005145 | 3300031238 | Bacteria | 6057 |
| 296 | Ga0265328_10000042 | 3300031239 | Bacteria | 89241 |
| 297 | Ga0265328_10000626 | 3300031239 | Bacteria | 16367 |
| 298 | Ga0265328_10033455 | 3300031239 | Bacteria | 1906 |
| 299 | Ga0265328_10086353 | 3300031239 | Bacteria | 1158 |
| 300 | Ga0265320_10112576 | 3300031240 | Bacteria | 1246 |
| 301 | Ga0265329_10007591 | 3300031242 | Bacteria | 4182 |
| 302 | Ga0265331_10000115 | 3300031250 | Bacteria | 105212 |
| 303 | Ga0265331_10015706 | 3300031250 | Bacteria | 3991 |
| 304 | Ga0265327_10000045 | 3300031251 | Bacteria | 282880 |
| 305 | Ga0265327_10000471 | 3300031251 | Bacteria | 71254 |
| 306 | Ga0265327_10001889 | 3300031251 | Bacteria | 24237 |
| 307 | Ga0265327_10003449 | 3300031251 | Bacteria | 15063 |
| 308 | Ga0265327_10009656 | 3300031251 | Bacteria | 6922 |
| 309 | Ga0265316_10029365 | 3300031344 | Bacteria | 4523 |
| 310 | Ga0265316_10116944 | 3300031344 | Bacteria | 2016 |
| 311 | Ga0307408_100006211 | 3300031548 | Bacteria | 7935 |
| 312 | Ga0307408_100299448 | 3300031548 | Bacteria | 1346 |
| 313 | Ga0265314_10008502 | 3300031711 | Bacteria | 8776 |
| 314 | Ga0265314_10009621 | 3300031711 | Bacteria | 8142 |
| 315 | Ga0265342_10088468 | 3300031712 | Bacteria | 1778 |
| 316 | Ga0265342_10093434 | 3300031712 | Bacteria | 1722 |
| 317 | Ga0307516_10096592 | 3300031730 | Bacteria | 2775 |
| 318 | Ga0307412_10028620 | 3300031911 | Bacteria | 3488 |
| 319 | Ga0307412_10062734 | 3300031911 | Bacteria | 2504 |
| 320 | Ga0307412_10338543 | 3300031911 | Bacteria | 1203 |
| 321 | Ga0307409_100186417 | 3300031995 | Bacteria | 1842 |
| 322 | Ga0307416_100053451 | 3300032002 | Bacteria | 3240 |
| 323 | Ga0307416_100250158 | 3300032002 | Bacteria | 1724 |
| 324 | Ga0307414_10026182 | 3300032004 | Bacteria | 3750 |
| 325 | Ga0307414_10349215 | 3300032004 | Bacteria | 1269 |
| 326 | Ga0307411_10034295 | 3300032005 | Bacteria | 3157 |
| 327 | Ga0316583_10001168 | 3300032133 | Bacteria | 8592 |
| 328 | Ga0373950_0032454 | 3300034818 | Bacteria | 972 |
| 329 | Ga0373934_0000570 | 3300035086 | Bacteria | 12966 |
| 330 | Ga0373934_0000979 | 3300035086 | Bacteria | 10357 |
| 331 | Ga0373923_0041834 | 3300035111 | Bacteria | 1890 |
| 332 | Ga0373953_0019485 | 3300035117 | Bacteria | 2524 |
| 333 | Ga0373954_0048064 | 3300035118 | Bacteria | 1998 |
| 334 | Ga0373954_0049526 | 3300035118 | Bacteria | 1969 |
| 335 | Ga0373956_0000668 | 3300035119 | Bacteria | 14111 |
| 336 | Ga0373956_0018855 | 3300035119 | Bacteria | 2923 |
| 337 | Ga0373946_0084791 | 3300035171 | Bacteria | 1394 |
| 338 | Ga0373955_0065946 | 3300035172 | Bacteria | 2011 |
| 339 | Ga0373955_0077317 | 3300035172 | Bacteria | 1874 |
| 340 | Ga0373955_0215845 | 3300035172 | Bacteria | 1145 |
| 341 | Ga0373924_0029925 | 3300035410 | Bacteria | 2179 |
| 342 | Ga0373935_0036800 | 3300035692 | Bacteria | 3061 |
| 343 | Ga0373927_0024467 | 3300035695 | Bacteria | 3950 |
| 344 | Ga0373933_0000312 | 3300035724 | Bacteria | 31477 |
| 345 | Ga0373947_0116830 | 3300035725 | Bacteria | 1692 |
| 346 | Ga0373937_0000096 | 3300036401 | Bacteria | 81963 |
| 347 | Ga0373937_0063375 | 3300036401 | Bacteria | 3399 |
| 348 | Ga0373937_0074010 | 3300036401 | Bacteria | 3143 |
| 349 | Ga0373937_0125903 | 3300036401 | Bacteria | 2390 |
| 350 | Ga0373925_0321237 | 3300037068 | Bacteria | 1253 |
| 351 | Ga0395899_0003631 | 3300037312 | Bacteria | 12212 |
| 352 | Ga0395900_0006730 | 3300037418 | Bacteria | 11931 |
| 353 | Ga0395900_0011176 | 3300037418 | Bacteria | 9179 |
| 354 | Ga0395900_0224553 | 3300037418 | Bacteria | 1891 |
| 355 | Ga0395898_0012245 | 3300037466 | Bacteria | 8867 |
| 356 | Ga0395898_0593602 | 3300037466 | Bacteria | 1050 |
| 357 | Ga0395905_0015722 | 3300037471 | Bacteria | 7189 |
| 358 | Ga0395901_0004717 | 3300038443 | Bacteria | 13763 |
| 359 | Ga0395901_0257640 | 3300038443 | Bacteria | 1816 |
| 360 | Ga0395901_0603104 | 3300038443 | Bacteria | 1107 |
| 361 | Ga0400483_273072 | 3300039062 | Bacteria | 1764 |
| 362 | Ga0436361_0075458 | 3300039447 | Bacteria | 23492 |
| 363 | Ga0436361_0130398 | 3300039447 | Bacteria | 1614 |
| 364 | Ga0436361_0161338 | 3300039447 | Bacteria | 23900 |
| 365 | Ga0436361_0498219 | 3300039447 | Bacteria | 1527 |
| 366 | Ga0439448_0000613 | 3300042005 | Bacteria | 8389 |
| 367 | Ga0451577_0006152 | 3300042876 | Bacteria | 12056 |
| 368 | Ga0451577_0056941 | 3300042876 | Bacteria | 3486 |
| 369 | Ga0451577_0069235 | 3300042876 | Bacteria | 3147 |
| 370 | Ga0451577_0303443 | 3300042876 | Bacteria | 1447 |
| 371 | Ga0466972_0100988 | 3300044658 | Bacteria | 1365 |
| 372 | Ga0453683_0036914 | 3300044673 | Bacteria | 3075 |
| 373 | Ga0466961_0024750 | 3300044693 | Bacteria | 3862 |
| 374 | Ga0453684_0000512 | 3300044712 | Bacteria | 150627 |
| 375 | Ga0466970_0053063 | 3300044765 | Bacteria | 2165 |
| 376 | Ga0451576_0000461 | 3300045051 | Bacteria | 92083 |
| 377 | Ga0451576_0001379 | 3300045051 | Bacteria | 41763 |
| 378 | Ga0451576_0154932 | 3300045051 | Bacteria | 2390 |
| 379 | Ga0451576_0316028 | 3300045051 | Bacteria | 1634 |
| 380 | Ga0495627_000059 | 3300046453 | Bacteria | 142466 |
| 381 | Ga0495592_0010946 | 3300046454 | Bacteria | 6845 |
| 382 | Ga0495629_0129323 | 3300046459 | Bacteria | 1759 |
| 383 | Ga0495641_0007072 | 3300046461 | Bacteria | 7104 |
| 384 | Ga0495651_0000085 | 3300046462 | Bacteria | 68214 |
| 385 | Ga0495651_0003739 | 3300046462 | Bacteria | 11646 |
| 386 | Ga0495653_0004139 | 3300046463 | Bacteria | 11734 |
| 387 | Ga0495580_0071895 | 3300046472 | Bacteria | 2416 |
| 388 | Ga0495605_0020153 | 3300046474 | Bacteria | 3547 |
| 389 | Ga0495639_0079477 | 3300046475 | Bacteria | 1525 |
| 390 | Ga0495664_0015172 | 3300046477 | Bacteria | 4377 |
| 391 | Ga0495594_0035137 | 3300046499 | Bacteria | 2729 |
| 392 | Ga0495596_0003212 | 3300046500 | Bacteria | 8398 |
| 393 | Ga0495606_0021265 | 3300046507 | Bacteria | 4755 |
| 394 | Ga0495610_0006379 | 3300046512 | Bacteria | 8135 |
| 395 | Ga0495616_0003605 | 3300046513 | Bacteria | 9894 |
| 396 | Ga0495628_0010478 | 3300046516 | Bacteria | 7873 |
| 397 | Ga0495628_0107704 | 3300046516 | Bacteria | 2145 |
| 398 | Ga0495628_0121673 | 3300046516 | Bacteria | 2001 |
| 399 | Ga0495630_0170219 | 3300046517 | Bacteria | 1659 |
| 400 | Ga0495666_0060025 | 3300046526 | Bacteria | 1818 |
| 401 | Ga0495642_0021059 | 3300046528 | Bacteria | 2563 |
| 402 | Ga0495652_0011388 | 3300046529 | Bacteria | 8044 |
| 403 | Ga0495652_0109930 | 3300046529 | Bacteria | 2218 |
| 404 | Ga0495586_0135999 | 3300046535 | Bacteria | 1377 |
| 405 | Ga0495587_0047226 | 3300046536 | Bacteria | 2553 |
| 406 | Ga0495609_0039759 | 3300046538 | Bacteria | 2117 |
| 407 | Ga0495645_0004672 | 3300046543 | Bacteria | 9347 |
| 408 | Ga0495667_0038807 | 3300046559 | Bacteria | 3171 |
| 409 | Ga0495634_0025817 | 3300046642 | Bacteria | 4103 |
| 410 | Ga0495588_0036981 | 3300046674 | Bacteria | 2479 |
| 411 | Ga0495657_0003454 | 3300046675 | Bacteria | 12887 |
| 412 | Ga0495599_0019078 | 3300046678 | Bacteria | 4275 |
| 413 | Ga0495599_0053278 | 3300046678 | Bacteria | 2534 |
| 414 | Ga0495647_0007574 | 3300046681 | Bacteria | 3643 |
| 415 | Ga0495658_0036657 | 3300046683 | Bacteria | 2707 |
| 416 | Ga0495613_0021414 | 3300046689 | Bacteria | 4819 |
| 417 | Ga0495624_0048321 | 3300046690 | Bacteria | 2701 |
| 418 | Ga0495671_0004725 | 3300046692 | Bacteria | 8049 |
| 419 | Ga0495600_0001200 | 3300046809 | Bacteria | 14187 |
| 420 | Ga0495636_0002422 | 3300047318 | Bacteria | 7152 |
| 421 | Ga0495680_0105899 | 3300047322 | Bacteria | 2090 |
| 422 | Ga0495680_0254305 | 3300047322 | Bacteria | 1244 |
| 423 | Ga0495681_0087311 | 3300047470 | Bacteria | 1383 |
| 424 | Ga0495684_0008067 | 3300047471 | Bacteria | 8144 |
| 425 | Ga0495615_0037335 | 3300048090 | Bacteria | 1196 |
| 426 | Ga0496100_0136578 | 3300048903 | Bacteria | 1733 |
| 427 | Ga0496106_0175447 | 3300048909 | Bacteria | 1700 |
| 428 | Ga0496108_0065401 | 3300048911 | Bacteria | 3065 |
| 429 | Ga0496108_0070161 | 3300048911 | Bacteria | 2957 |
| 430 | Ga0496110_0466300 | 3300048913 | Bacteria | 1151 |
| 431 | Ga0496112_0007864 | 3300048915 | Bacteria | 9494 |
| 432 | Ga0496112_0197214 | 3300048915 | Bacteria | 1974 |
| 433 | Ga0496114_0084585 | 3300048917 | Bacteria | 2686 |
| 434 | Ga0496114_0358863 | 3300048917 | Bacteria | 1289 |
| 435 | Ga0496116_0005400 | 3300048919 | Bacteria | 11889 |
| 436 | Ga0496116_0039578 | 3300048919 | Bacteria | 3258 |
| 437 | Ga0496118_0013169 | 3300048921 | Bacteria | 7848 |
| 438 | Ga0496118_0100931 | 3300048921 | Bacteria | 1950 |
| 439 | Ga0496119_0009171 | 3300048922 | Bacteria | 8547 |
| 440 | Ga0496120_0010157 | 3300048923 | Bacteria | 6592 |
| 441 | Ga0496121_0000124 | 3300048924 | Bacteria | 170427 |
| 442 | Ga0496121_0062567 | 3300048924 | Bacteria | 3047 |
| 443 | Ga0496121_0176489 | 3300048924 | Bacteria | 1546 |
| 444 | Ga0496122_0000316 | 3300048925 | Bacteria | 106100 |
| 445 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 446 | Ga0496124_0010343 | 3300048927 | Bacteria | 9465 |
| 447 | Ga0496124_0020950 | 3300048927 | Bacteria | 6030 |
| 448 | Ga0496125_0000570 | 3300048928 | Bacteria | 63252 |
| 449 | Ga0496125_0180128 | 3300048928 | Bacteria | 1409 |
| 450 | Ga0496126_0037857 | 3300048929 | Bacteria | 4494 |
| 451 | Ga0501307_002280 | 3300049162 | Bacteria | 1767 |
| 452 | Ga0501311_001681 | 3300049527 | Bacteria | 1988 |
| 453 | Ga0501033_0127826 | 3300049570 | Bacteria | 1842 |
| 454 | Ga0501034_0013068 | 3300049571 | Bacteria | 8557 |
| 455 | Ga0501034_0241305 | 3300049571 | Bacteria | 1753 |
| 456 | Ga0501037_0140735 | 3300049573 | Bacteria | 1727 |
| 457 | Ga0501037_0177104 | 3300049573 | Bacteria | 1514 |
| 458 | Ga0501038_0301457 | 3300049574 | Bacteria | 1258 |
| 459 | Ga0501039_0018419 | 3300049575 | Bacteria | 5359 |
| 460 | Ga0501040_0176206 | 3300049576 | Bacteria | 1515 |
| 461 | Ga0501041_0006003 | 3300049577 | Bacteria | 7105 |
| 462 | Ga0501043_0000855 | 3300049579 | Bacteria | 26972 |
| 463 | Ga0501043_0269615 | 3300049579 | Bacteria | 1307 |
| 464 | Ga0501046_0000007 | 3300049580 | Bacteria | 356002 |
| 465 | Ga0501046_0085944 | 3300049580 | Bacteria | 2425 |
| 466 | Ga0501047_0013419 | 3300049581 | Bacteria | 7766 |
| 467 | Ga0501047_0024128 | 3300049581 | Bacteria | 5842 |
| 468 | Ga0501048_0004461 | 3300049582 | Bacteria | 10652 |
| 469 | Ga0501048_0177371 | 3300049582 | Bacteria | 1510 |
| 470 | Ga0501071_0079465 | 3300049587 | Bacteria | 2398 |
| 471 | Ga0501072_0044808 | 3300049588 | Bacteria | 3478 |
| 472 | Ga0501075_0006985 | 3300049591 | Bacteria | 7800 |
| 473 | Ga0501076_0064907 | 3300049592 | Bacteria | 2910 |
| 474 | Ga0501076_0268235 | 3300049592 | Bacteria | 1398 |
| 475 | Ga0501077_0148819 | 3300049593 | Bacteria | 1485 |
| 476 | Ga0501079_0006588 | 3300049741 | Bacteria | 8737 |
| 477 | Ga0501079_0213302 | 3300049741 | Bacteria | 1508 |
| 478 | Ga0501080_0027052 | 3300049742 | Bacteria | 5333 |
| 479 | Ga0501081_0002716 | 3300049743 | Bacteria | 11200 |
| 480 | Ga0501081_0113410 | 3300049743 | Bacteria | 1925 |
| 481 | Ga0501083_0000046 | 3300049744 | Bacteria | 88934 |
| 482 | Ga0501035_0008381 | 3300049822 | Bacteria | 9624 |
| 483 | Ga0501035_0029021 | 3300049822 | Bacteria | 5046 |
| 484 | Ga0501035_0066145 | 3300049822 | Bacteria | 3208 |
| 485 | Ga0501044_0001867 | 3300049823 | Bacteria | 24425 |
| 486 | Ga0501044_0004875 | 3300049823 | Bacteria | 14994 |
| 487 | Ga0501044_0007692 | 3300049823 | Bacteria | 11850 |
| 488 | Ga0501044_0062432 | 3300049823 | Bacteria | 3808 |
| 489 | Ga0501045_0071570 | 3300049824 | Bacteria | 2552 |
| 490 | Ga0501045_0107811 | 3300049824 | Bacteria | 2064 |
| 491 | nmdc:mga03683_43400_c1 | 3300050489 | Bacteria | 1855 |
| 492 | nmdc:mga03n38_12945_c1 | 3300050490 | Bacteria | 3156 |
| 493 | nmdc:mga00v17_1526_c1 | 3300050491 | Bacteria | 12076 |
| 494 | nmdc:mga00v17_191673_c1 | 3300050491 | Bacteria | 1320 |
| 495 | nmdc:mga00v17_37490_c1 | 3300050491 | Bacteria | 2896 |
| 496 | nmdc:mga0yw44_728_c1 | 3300050492 | Bacteria | 12120 |
| 497 | nmdc:mga0k408_8277_c1 | 3300050493 | Bacteria | 5580 |
| 498 | nmdc:mga06z11_46252_c1 | 3300050494 | Bacteria | 2205 |
| 499 | nmdc:mga04h51_524_c1 | 3300050495 | Bacteria | 9100 |
| 500 | nmdc:mga07m45_12364_c1 | 3300050496 | Bacteria | 4510 |
| 501 | nmdc:mga09592_1274_c1 | 3300050508 | Bacteria | 13551 |
| 502 | nmdc:mga09592_184331_c1 | 3300050508 | Bacteria | 1806 |
| 503 | nmdc:mga0qj67_14999_c1 | 3300050509 | Bacteria | 5862 |
| 504 | nmdc:mga0qj67_399746_c1 | 3300050509 | Bacteria | 1109 |
| 505 | nmdc:mga06r32_113877_c1 | 3300050510 | Bacteria | 2663 |
| 506 | nmdc:mga08y16_417295_c1 | 3300050511 | Bacteria | 1372 |
| 507 | nmdc:mga08y16_551_c1 | 3300050511 | Bacteria | 34725 |
| 508 | nmdc:mga08x19_13687_c1 | 3300050514 | Bacteria | 4909 |
| 509 | Ga0495601_0002619 | 3300053077 | Bacteria | 10205 |
| 510 | Ga0495601_0056928 | 3300053077 | Bacteria | 2476 |
| 511 | Ga0495595_0012537 | 3300053084 | Bacteria | 3565 |
| 512 | Ga0495619_0003254 | 3300053085 | Bacteria | 10513 |
| 513 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 514 | Ga0500634_0016885 | 3300053161 | Bacteria | 3901 |
| 515 | Ga0500637_0182814 | 3300053178 | Bacteria | 1201 |
| 516 | Ga0590074_018351 | 3300059423 | Bacteria | 1196 |
| 517 | Ga0590077_014556 | 3300059426 | Bacteria | 1639 |
| 518 | Ga0587066_030398 | 3300059490 | Bacteria | 959 |
| 519 | Ga0501082_0001560 | 3300060353 | Bacteria | 20176 |
| 520 | Ga0530510_0098723 | 3300061734 | Bacteria | 2135 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049579 | Ga0501043_0000855 | Ga0501043_0000855_7634_8506 | 247 |
| 2 | 3300049580 | Ga0501046_0000007 | Ga0501046_0000007_144465_145337 | 247 |
| 3 | 3300049581 | Ga0501047_0013419 | Ga0501047_0013419_4726_5598 | 247 |
| 4 | 3300049582 | Ga0501048_0004461 | Ga0501048_0004461_3861_4733 | 247 |
| 5 | 3300049744 | Ga0501083_0000046 | Ga0501083_0000046_62728_63600 | 247 |
| 6 | 3300049822 | Ga0501035_0008381 | Ga0501035_0008381_885_1757 | 247 |
| 7 | 3300049823 | Ga0501044_0062432 | Ga0501044_0062432_2355_3227 | 247 |
| 8 | 3300049824 | Ga0501045_0107811 | Ga0501045_0107811_711_1583 | 247 |
| 9 | 3300017792 | Ga0163161_10038025 | Ga0163161_100380253 | 249 |
| 10 | 3300049573 | Ga0501037_0140735 | Ga0501037_0140735_181_1038 | 261 |
| 11 | 3300049823 | Ga0501044_0004875 | Ga0501044_0004875_9090_9947 | 261 |
| 12 | 3300031711 | Ga0265314_10009621 | Ga0265314_100096212 | 263 |
| 13 | 3300031712 | Ga0265342_10093434 | Ga0265342_100934342 | 263 |
| 14 | 3300048927 | Ga0496124_0010343 | Ga0496124_0010343_5781_6656 | 268 |
| 15 | 3300031239 | Ga0265328_10000042 | Ga0265328_1000004274 | 269 |
| 16 | 3300031344 | Ga0265316_10116944 | Ga0265316_101169442 | 269 |
| 17 | 3300031239 | Ga0265328_10000626 | Ga0265328_100006267 | 272 |
| 18 | 3300031250 | Ga0265331_10000115 | Ga0265331_1000011526 | 272 |
| 19 | 3300031251 | Ga0265327_10000045 | Ga0265327_1000004578 | 272 |
| 20 | 3300044658 | Ga0466972_0100988 | Ga0466972_0100988_392_1273 | 272 |
| 21 | 3300031911 | Ga0307412_10338543 | Ga0307412_103385432 | 274 |
| 22 | 3300031995 | Ga0307409_100186417 | Ga0307409_1001864172 | 274 |
| 23 | 3300032002 | Ga0307416_100250158 | Ga0307416_1002501582 | 274 |
| 24 | 3300006844 | Ga0075428_100000245 | Ga0075428_10000024515 | 275 |
| 25 | 3300006847 | Ga0075431_100197206 | Ga0075431_1001972062 | 275 |
| 26 | 3300006880 | Ga0075429_100030290 | Ga0075429_1000302902 | 275 |
| 27 | 3300009094 | Ga0111539_10000383 | Ga0111539_100003833 | 275 |
| 28 | 3300009094 | Ga0111539_10159164 | Ga0111539_101591641 | 275 |
| 29 | 3300013306 | Ga0163162_10045102 | Ga0163162_100451025 | 275 |
| 30 | 3300027907 | Ga0207428_10009367 | Ga0207428_100093676 | 275 |
| 31 | 3300048924 | Ga0496121_0176489 | Ga0496121_0176489_641_1525 | 275 |
| 32 | 3300050508 | nmdc:mga09592_1274_c1 | nmdc:mga09592_1274_c1_3441_4280 | 275 |
| 33 | 3300050511 | nmdc:mga08y16_551_c1 | nmdc:mga08y16_551_c1_4913_5752 | 275 |
| 34 | 3300035725 | Ga0373947_0116830 | Ga0373947_0116830_65_928 | 276 |
| 35 | 3300005444 | Ga0070694_100197072 | Ga0070694_1001970722 | 278 |
| 36 | 3300005545 | Ga0070695_100007395 | Ga0070695_1000073952 | 278 |
| 37 | 3300025263 | Ga0209565_1023911 | Ga0209565_10239111 | 278 |
| 38 | 3300050511 | nmdc:mga08y16_417295_c1 | nmdc:mga08y16_417295_c1_446_1294 | 278 |
| 39 | iso_pu_bacteria | 2887375801 | 2887379434 | 278 |
| 40 | 3300003354 | JGI25160J50197_1004394 | JGI25160J50197_10043942 | 279 |
| 41 | 3300003771 | Ga0055526_1017220 | Ga0055526_10172202 | 279 |
| 42 | 3300003775 | Ga0055524_1021989 | Ga0055524_10219891 | 279 |
| 43 | 3300003790 | Ga0055528_1013339 | Ga0055528_10133394 | 279 |
| 44 | 3300003791 | Ga0055530_10010065 | Ga0055530_100100654 | 279 |
| 45 | 3300014325 | Ga0163163_10260928 | Ga0163163_102609282 | 279 |
| 46 | 3300025208 | Ga0209436_100479 | Ga0209436_1004792 | 279 |
| 47 | 3300025263 | Ga0209565_1000983 | Ga0209565_100098316 | 279 |
| 48 | 3300025284 | Ga0209130_1000990 | Ga0209130_10009908 | 279 |
| 49 | 3300025284 | Ga0209130_1013661 | Ga0209130_10136612 | 279 |
| 50 | 3300025291 | Ga0209675_1000250 | Ga0209675_10002508 | 279 |
| 51 | 3300025295 | Ga0209564_1003556 | Ga0209564_10035562 | 279 |
| 52 | 3300025298 | Ga0209050_1013802 | Ga0209050_10138022 | 279 |
| 53 | 3300025299 | Ga0209256_1002500 | Ga0209256_10025008 | 279 |
| 54 | 3300025302 | Ga0207426_1001293 | Ga0207426_100129322 | 279 |
| 55 | 3300025304 | Ga0209257_1000003 | Ga0209257_1000003287 | 279 |
| 56 | 3300031548 | Ga0307408_100006211 | Ga0307408_1000062118 | 279 |
| 57 | 3300031548 | Ga0307408_100299448 | Ga0307408_1002994482 | 279 |
| 58 | 3300032002 | Ga0307416_100053451 | Ga0307416_1000534512 | 279 |
| 59 | 3300036401 | Ga0373937_0125903 | Ga0373937_0125903_774_1631 | 279 |
| 60 | 3300046517 | Ga0495630_0170219 | Ga0495630_0170219_759_1616 | 279 |
| 61 | 3300046559 | Ga0495667_0038807 | Ga0495667_0038807_464_1321 | 279 |
| 62 | 3300047322 | Ga0495680_0105899 | Ga0495680_0105899_483_1340 | 279 |
| 63 | 3300049162 | Ga0501307_002280 | Ga0501307_002280_15_929 | 279 |
| 64 | 3300049527 | Ga0501311_001681 | Ga0501311_001681_1060_1974 | 279 |
| 65 | 3300007265 | Ga0099794_10026857 | Ga0099794_100268573 | 280 |
| 66 | 3300007265 | Ga0099794_10038181 | Ga0099794_100381812 | 280 |
| 67 | 3300027671 | Ga0209588_1004797 | Ga0209588_10047973 | 280 |
| 68 | 3300027671 | Ga0209588_1011598 | Ga0209588_10115982 | 280 |
| 69 | 3300028379 | Ga0268266_10424949 | Ga0268266_104249492 | 280 |
| 70 | 3300021361 | Ga0213872_10082680 | Ga0213872_100826802 | 281 |
| 71 | 3300039447 | Ga0436361_0130398 | Ga0436361_0130398_228_1139 | 281 |
| 72 | 3300005339 | Ga0070660_100001298 | Ga0070660_1000012985 | 282 |
| 73 | 3300005563 | Ga0068855_100010957 | Ga0068855_1000109574 | 282 |
| 74 | 3300009545 | Ga0105237_10005766 | Ga0105237_100057664 | 282 |
| 75 | 3300010375 | Ga0105239_10037494 | Ga0105239_100374942 | 282 |
| 76 | 3300013100 | Ga0157373_10004456 | Ga0157373_100044562 | 282 |
| 77 | 3300013105 | Ga0157369_10000979 | Ga0157369_1000097915 | 282 |
| 78 | 3300013296 | Ga0157374_10000107 | Ga0157374_1000010718 | 282 |
| 79 | 3300013307 | Ga0157372_10002854 | Ga0157372_100028548 | 282 |
| 80 | 3300020076 | Ga0206355_1291451 | Ga0206355_12914511 | 282 |
| 81 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001288 | 282 |
| 82 | 3300021361 | Ga0213872_10015634 | Ga0213872_100156341 | 282 |
| 83 | 3300021361 | Ga0213872_10073098 | Ga0213872_100730982 | 282 |
| 84 | 3300025256 | Ga0209759_1003925 | Ga0209759_10039252 | 282 |
| 85 | 3300025913 | Ga0207695_10016694 | Ga0207695_100166943 | 282 |
| 86 | 3300025914 | Ga0207671_10068927 | Ga0207671_100689271 | 282 |
| 87 | 3300025919 | Ga0207657_10007584 | Ga0207657_100075845 | 282 |
| 88 | 3300025949 | Ga0207667_10003025 | Ga0207667_100030254 | 282 |
| 89 | 3300039447 | Ga0436361_0075458 | Ga0436361_0075458_15489_16403 | 282 |
| 90 | 3300039447 | Ga0436361_0498219 | Ga0436361_0498219_577_1488 | 282 |
| 91 | 3300042005 | Ga0439448_0000613 | Ga0439448_0000613_4496_5404 | 282 |
| 92 | 3300005289 | Ga0065704_10171474 | Ga0065704_101714741 | 283 |
| 93 | 3300031251 | Ga0265327_10000471 | Ga0265327_100004719 | 283 |
| 94 | 3300006946 | Ga0079104_1000025 | Ga0079104_10000257 | 284 |
| 95 | 3300009148 | Ga0105243_10000729 | Ga0105243_1000072917 | 284 |
| 96 | 3300034818 | Ga0373950_0032454 | Ga0373950_0032454_20_886 | 284 |
| 97 | 3300035172 | Ga0373955_0215845 | Ga0373955_0215845_157_1053 | 284 |
| 98 | 3300037068 | Ga0373925_0321237 | Ga0373925_0321237_316_1212 | 284 |
| 99 | 3300045051 | Ga0451576_0154932 | Ga0451576_0154932_1483_2370 | 284 |
| 100 | 3300050490 | nmdc:mga03n38_12945_c1 | nmdc:mga03n38_12945_c1_1751_2626 | 284 |
| 101 | 3300050491 | nmdc:mga00v17_37490_c1 | nmdc:mga00v17_37490_c1_847_1722 | 284 |
| 102 | 3300050492 | nmdc:mga0yw44_728_c1 | nmdc:mga0yw44_728_c1_4187_5062 | 284 |
| 103 | 3300050494 | nmdc:mga06z11_46252_c1 | nmdc:mga06z11_46252_c1_1018_1893 | 284 |
| 104 | 3300050495 | nmdc:mga04h51_524_c1 | nmdc:mga04h51_524_c1_391_1266 | 284 |
| 105 | 3300050496 | nmdc:mga07m45_12364_c1 | nmdc:mga07m45_12364_c1_491_1366 | 284 |
| 106 | iso_pu_bacteria | 2895511927 | 2895517532 | 284 |
| 107 | 3300003215 | JGI25153J46596_10002002 | JGI25153J46596_100020027 | 285 |
| 108 | 3300025245 | Ga0207425_1000001 | Ga0207425_1000001823 | 285 |
| 109 | 3300025258 | Ga0209129_1000003 | Ga0209129_1000003823 | 285 |
| 110 | 3300025297 | Ga0209758_1000020 | Ga0209758_1000020453 | 285 |
| 111 | 3300025299 | Ga0209256_1001989 | Ga0209256_100198919 | 285 |
| 112 | 3300025935 | Ga0207709_10000170 | Ga0207709_1000017072 | 285 |
| 113 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007213 | 285 |
| 114 | iso_pu_bacteria | 2599185292 | 2599907033 | 285 |
| 115 | iso_pu_bacteria | 2643221569 | 2643863237 | 285 |
| 116 | iso_pu_bacteria | 2643221594 | 2643978643 | 285 |
| 117 | iso_pu_bacteria | 2643221621 | 2644121789 | 285 |
| 118 | iso_pu_bacteria | 2739367655 | 2739612664 | 285 |
| 119 | iso_pu_bacteria | 2808606395 | 2809036600 | 285 |
| 120 | iso_pu_bacteria | 2855730933 | 2855731459 | 285 |
| 121 | iso_pu_bacteria | 2855767633 | 2855768165 | 285 |
| 122 | iso_pu_bacteria | 2857537821 | 2857541213 | 285 |
| 123 | iso_pu_bacteria | 2857542790 | 2857545905 | 285 |
| 124 | iso_pu_bacteria | 2858950400 | 2858953882 | 285 |
| 125 | iso_pu_bacteria | 2881412998 | 2881413665 | 285 |
| 126 | iso_pu_bacteria | 2881927736 | 2881928339 | 285 |
| 127 | iso_pu_bacteria | 2941479691 | 2941481086 | 285 |
| 128 | iso_pu_bacteria | 8002392321 | 8002394453 | 285 |
| 129 | iso_pu_bacteria | 8055225921 | 8055228148 | 285 |
| 130 | 3300006195 | Ga0075366_10008907 | Ga0075366_100089076 | 286 |
| 131 | 3300006846 | Ga0075430_100015261 | Ga0075430_1000152614 | 286 |
| 132 | 3300006847 | Ga0075431_100003069 | Ga0075431_10000306916 | 286 |
| 133 | 3300048917 | Ga0496114_0084585 | Ga0496114_0084585_1221_2114 | 286 |
| 134 | 3300050508 | nmdc:mga09592_184331_c1 | nmdc:mga09592_184331_c1_539_1441 | 286 |
| 135 | 3300050509 | nmdc:mga0qj67_14999_c1 | nmdc:mga0qj67_14999_c1_3350_4252 | 286 |
| 136 | 3300050510 | nmdc:mga06r32_113877_c1 | nmdc:mga06r32_113877_c1_176_1078 | 286 |
| 137 | iso_pu_bacteria | 2526164512 | 2526213515 | 286 |
| 138 | iso_pu_bacteria | 2547132512 | 2548846818 | 286 |
| 139 | iso_pu_bacteria | 2891633521 | 2891634579 | 286 |
| 140 | iso_pu_bacteria | 2894023352 | 2894026480 | 286 |
| 141 | iso_pu_bacteria | 639633007 | 639787056 | 286 |
| 142 | 3300049592 | Ga0501076_0268235 | Ga0501076_0268235_126_1040 | 287 |
| 143 | 3300049743 | Ga0501081_0113410 | Ga0501081_0113410_631_1545 | 287 |
| 144 | iso_pu_bacteria | 2513237150 | 2513955198 | 287 |
| 145 | iso_pu_bacteria | 2513237165 | 2514043660 | 287 |
| 146 | iso_pu_bacteria | 2643221660 | 2644337636 | 287 |
| 147 | iso_pu_bacteria | 2721755523 | 2722882556 | 287 |
| 148 | iso_pu_bacteria | 2831864461 | 2831866367 | 287 |
| 149 | iso_pu_bacteria | 2834641062 | 2834642737 | 287 |
| 150 | iso_pu_bacteria | 2839138175 | 2839141182 | 287 |
| 151 | iso_pu_bacteria | 2858688981 | 2858693951 | 287 |
| 152 | iso_pu_bacteria | 2901300506 | 2901311273 | 287 |
| 153 | iso_pu_bacteria | 644736347 | 644747996 | 287 |
| 154 | iso_pu_bacteria | 8003400568 | 8003401514 | 287 |
| 155 | 3300005518 | Ga0070699_100152459 | Ga0070699_1001524591 | 288 |
| 156 | 3300013296 | Ga0157374_10000145 | Ga0157374_1000014513 | 288 |
| 157 | 3300031239 | Ga0265328_10086353 | Ga0265328_100863531 | 288 |
| 158 | 3300031240 | Ga0265320_10112576 | Ga0265320_101125762 | 288 |
| 159 | 3300031251 | Ga0265327_10001889 | Ga0265327_1000188912 | 288 |
| 160 | 3300031251 | Ga0265327_10003449 | Ga0265327_1000344910 | 288 |
| 161 | 3300031251 | Ga0265327_10009656 | Ga0265327_100096568 | 288 |
| 162 | 3300031730 | Ga0307516_10096592 | Ga0307516_100965923 | 288 |
| 163 | 3300032004 | Ga0307414_10349215 | Ga0307414_103492151 | 288 |
| 164 | 3300035086 | Ga0373934_0000979 | Ga0373934_0000979_5234_6154 | 288 |
| 165 | 3300035119 | Ga0373956_0000668 | Ga0373956_0000668_739_1659 | 288 |
| 166 | 3300035172 | Ga0373955_0065946 | Ga0373955_0065946_354_1274 | 288 |
| 167 | 3300035724 | Ga0373933_0000312 | Ga0373933_0000312_2492_3412 | 288 |
| 168 | 3300036401 | Ga0373937_0000096 | Ga0373937_0000096_29613_30533 | 288 |
| 169 | 3300039062 | Ga0400483_273072 | Ga0400483_273072_853_1728 | 288 |
| 170 | 3300046462 | Ga0495651_0000085 | Ga0495651_0000085_53542_54462 | 288 |
| 171 | 3300046674 | Ga0495588_0036981 | Ga0495588_0036981_423_1298 | 288 |
| 172 | 3300047322 | Ga0495680_0254305 | Ga0495680_0254305_68_988 | 288 |
| 173 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_289891_290766 | 288 |
| 174 | iso_pu_bacteria | 2643221603 | 2644027274 | 288 |
| 175 | iso_pu_bacteria | 2842718218 | 2842721014 | 288 |
| 176 | iso_pu_bacteria | 2974320154 | 2974323927 | 288 |
| 177 | 3300005328 | Ga0070676_10057426 | Ga0070676_100574262 | 289 |
| 178 | 3300005330 | Ga0070690_100018947 | Ga0070690_1000189473 | 289 |
| 179 | 3300005331 | Ga0070670_100046142 | Ga0070670_1000461423 | 289 |
| 180 | 3300005334 | Ga0068869_100003267 | Ga0068869_1000032674 | 289 |
| 181 | 3300005334 | Ga0068869_100122415 | Ga0068869_1001224152 | 289 |
| 182 | 3300005334 | Ga0068869_100130306 | Ga0068869_1001303062 | 289 |
| 183 | 3300005338 | Ga0068868_100013526 | Ga0068868_1000135265 | 289 |
| 184 | 3300005340 | Ga0070689_100519148 | Ga0070689_1005191481 | 289 |
| 185 | 3300005354 | Ga0070675_100035020 | Ga0070675_1000350204 | 289 |
| 186 | 3300005354 | Ga0070675_100161662 | Ga0070675_1001616622 | 289 |
| 187 | 3300005355 | Ga0070671_100108894 | Ga0070671_1001088942 | 289 |
| 188 | 3300005356 | Ga0070674_100035299 | Ga0070674_1000352993 | 289 |
| 189 | 3300005356 | Ga0070674_100060608 | Ga0070674_1000606083 | 289 |
| 190 | 3300005364 | Ga0070673_100100428 | Ga0070673_1001004283 | 289 |
| 191 | 3300005364 | Ga0070673_100229297 | Ga0070673_1002292972 | 289 |
| 192 | 3300005366 | Ga0070659_100324752 | Ga0070659_1003247521 | 289 |
| 193 | 3300005367 | Ga0070667_100084285 | Ga0070667_1000842851 | 289 |
| 194 | 3300005367 | Ga0070667_100237088 | Ga0070667_1002370882 | 289 |
| 195 | 3300005456 | Ga0070678_100014278 | Ga0070678_1000142785 | 289 |
| 196 | 3300005456 | Ga0070678_100148987 | Ga0070678_1001489871 | 289 |
| 197 | 3300005458 | Ga0070681_10054614 | Ga0070681_100546142 | 289 |
| 198 | 3300005458 | Ga0070681_10099387 | Ga0070681_100993873 | 289 |
| 199 | 3300005459 | Ga0068867_100332156 | Ga0068867_1003321562 | 289 |
| 200 | 3300005535 | Ga0070684_100327803 | Ga0070684_1003278032 | 289 |
| 201 | 3300005539 | Ga0068853_100055595 | Ga0068853_1000555953 | 289 |
| 202 | 3300005539 | Ga0068853_100314356 | Ga0068853_1003143562 | 289 |
| 203 | 3300005548 | Ga0070665_100054543 | Ga0070665_1000545432 | 289 |
| 204 | 3300005548 | Ga0070665_100138102 | Ga0070665_1001381023 | 289 |
| 205 | 3300005564 | Ga0070664_100015472 | Ga0070664_1000154724 | 289 |
| 206 | 3300005577 | Ga0068857_100060442 | Ga0068857_1000604423 | 289 |
| 207 | 3300005614 | Ga0068856_100304393 | Ga0068856_1003043932 | 289 |
| 208 | 3300005616 | Ga0068852_100079188 | Ga0068852_1000791883 | 289 |
| 209 | 3300005617 | Ga0068859_100250726 | Ga0068859_1002507262 | 289 |
| 210 | 3300005618 | Ga0068864_100077826 | Ga0068864_1000778264 | 289 |
| 211 | 3300005618 | Ga0068864_100150849 | Ga0068864_1001508493 | 289 |
| 212 | 3300005719 | Ga0068861_100132738 | Ga0068861_1001327381 | 289 |
| 213 | 3300005719 | Ga0068861_100186196 | Ga0068861_1001861962 | 289 |
| 214 | 3300005834 | Ga0068851_10006259 | Ga0068851_100062595 | 289 |
| 215 | 3300005841 | Ga0068863_100255161 | Ga0068863_1002551611 | 289 |
| 216 | 3300005842 | Ga0068858_100043999 | Ga0068858_1000439992 | 289 |
| 217 | 3300005843 | Ga0068860_100223993 | Ga0068860_1002239932 | 289 |
| 218 | 3300005844 | Ga0068862_100102333 | Ga0068862_1001023332 | 289 |
| 219 | 3300006051 | Ga0075364_10003579 | Ga0075364_100035798 | 289 |
| 220 | 3300006051 | Ga0075364_10022675 | Ga0075364_100226751 | 289 |
| 221 | 3300006237 | Ga0097621_100011505 | Ga0097621_1000115054 | 289 |
| 222 | 3300006237 | Ga0097621_100021575 | Ga0097621_1000215753 | 289 |
| 223 | 3300006237 | Ga0097621_100359059 | Ga0097621_1003590592 | 289 |
| 224 | 3300006358 | Ga0068871_100031771 | Ga0068871_1000317713 | 289 |
| 225 | 3300006358 | Ga0068871_100509762 | Ga0068871_1005097621 | 289 |
| 226 | 3300006847 | Ga0075431_100174842 | Ga0075431_1001748421 | 289 |
| 227 | 3300006881 | Ga0068865_100045835 | Ga0068865_1000458352 | 289 |
| 228 | 3300006931 | Ga0097620_100250739 | Ga0097620_1002507392 | 289 |
| 229 | 3300009098 | Ga0105245_10220811 | Ga0105245_102208111 | 289 |
| 230 | 3300009101 | Ga0105247_10130261 | Ga0105247_101302612 | 289 |
| 231 | 3300009148 | Ga0105243_10033164 | Ga0105243_100331644 | 289 |
| 232 | 3300009148 | Ga0105243_10079014 | Ga0105243_100790143 | 289 |
| 233 | 3300009174 | Ga0105241_10307760 | Ga0105241_103077602 | 289 |
| 234 | 3300009176 | Ga0105242_10039525 | Ga0105242_100395252 | 289 |
| 235 | 3300009176 | Ga0105242_10196791 | Ga0105242_101967912 | 289 |
| 236 | 3300009177 | Ga0105248_10002407 | Ga0105248_100024078 | 289 |
| 237 | 3300009177 | Ga0105248_10218927 | Ga0105248_102189272 | 289 |
| 238 | 3300009545 | Ga0105237_10025618 | Ga0105237_100256186 | 289 |
| 239 | 3300010375 | Ga0105239_10039314 | Ga0105239_100393145 | 289 |
| 240 | 3300011119 | Ga0105246_10108932 | Ga0105246_101089321 | 289 |
| 241 | 3300013104 | Ga0157370_10213618 | Ga0157370_102136182 | 289 |
| 242 | 3300013105 | Ga0157369_10160429 | Ga0157369_101604293 | 289 |
| 243 | 3300013296 | Ga0157374_10052521 | Ga0157374_100525214 | 289 |
| 244 | 3300013296 | Ga0157374_10259174 | Ga0157374_102591742 | 289 |
| 245 | 3300013297 | Ga0157378_10219365 | Ga0157378_102193653 | 289 |
| 246 | 3300013306 | Ga0163162_10019867 | Ga0163162_100198674 | 289 |
| 247 | 3300013306 | Ga0163162_10078206 | Ga0163162_100782064 | 289 |
| 248 | 3300014326 | Ga0157380_10194863 | Ga0157380_101948632 | 289 |
| 249 | 3300014968 | Ga0157379_10109018 | Ga0157379_101090182 | 289 |
| 250 | 3300014969 | Ga0157376_10062291 | Ga0157376_100622913 | 289 |
| 251 | 3300014969 | Ga0157376_10246115 | Ga0157376_102461152 | 289 |
| 252 | 3300025290 | Ga0207673_1006146 | Ga0207673_10061462 | 289 |
| 253 | 3300025292 | Ga0209676_1003098 | Ga0209676_100309810 | 289 |
| 254 | 3300025294 | Ga0209025_1000018 | Ga0209025_1000018492 | 289 |
| 255 | 3300025298 | Ga0209050_1001037 | Ga0209050_100103730 | 289 |
| 256 | 3300025315 | Ga0207697_10015856 | Ga0207697_100158564 | 289 |
| 257 | 3300025315 | Ga0207697_10019635 | Ga0207697_100196352 | 289 |
| 258 | 3300025901 | Ga0207688_10015702 | Ga0207688_100157023 | 289 |
| 259 | 3300025907 | Ga0207645_10006952 | Ga0207645_100069525 | 289 |
| 260 | 3300025908 | Ga0207643_10001107 | Ga0207643_1000110715 | 289 |
| 261 | 3300025911 | Ga0207654_10012463 | Ga0207654_100124635 | 289 |
| 262 | 3300025912 | Ga0207707_10024191 | Ga0207707_100241916 | 289 |
| 263 | 3300025913 | Ga0207695_10377419 | Ga0207695_103774192 | 289 |
| 264 | 3300025917 | Ga0207660_10036839 | Ga0207660_100368394 | 289 |
| 265 | 3300025923 | Ga0207681_10164130 | Ga0207681_101641302 | 289 |
| 266 | 3300025925 | Ga0207650_10042006 | Ga0207650_100420062 | 289 |
| 267 | 3300025926 | Ga0207659_10068983 | Ga0207659_100689832 | 289 |
| 268 | 3300025926 | Ga0207659_10222924 | Ga0207659_102229242 | 289 |
| 269 | 3300025931 | Ga0207644_10017444 | Ga0207644_100174442 | 289 |
| 270 | 3300025931 | Ga0207644_10387375 | Ga0207644_103873752 | 289 |
| 271 | 3300025933 | Ga0207706_10016696 | Ga0207706_100166965 | 289 |
| 272 | 3300025934 | Ga0207686_10041023 | Ga0207686_100410233 | 289 |
| 273 | 3300025935 | Ga0207709_10448542 | Ga0207709_104485421 | 289 |
| 274 | 3300025936 | Ga0207670_10072333 | Ga0207670_100723332 | 289 |
| 275 | 3300025937 | Ga0207669_10041700 | Ga0207669_100417002 | 289 |
| 276 | 3300025938 | Ga0207704_10114711 | Ga0207704_101147112 | 289 |
| 277 | 3300025941 | Ga0207711_10020864 | Ga0207711_100208642 | 289 |
| 278 | 3300025941 | Ga0207711_10174985 | Ga0207711_101749852 | 289 |
| 279 | 3300025942 | Ga0207689_10000974 | Ga0207689_1000097416 | 289 |
| 280 | 3300025942 | Ga0207689_10011213 | Ga0207689_100112134 | 289 |
| 281 | 3300025942 | Ga0207689_10142650 | Ga0207689_101426502 | 289 |
| 282 | 3300025945 | Ga0207679_10099505 | Ga0207679_100995052 | 289 |
| 283 | 3300025945 | Ga0207679_10171176 | Ga0207679_101711761 | 289 |
| 284 | 3300025960 | Ga0207651_10122637 | Ga0207651_101226373 | 289 |
| 285 | 3300025960 | Ga0207651_10248247 | Ga0207651_102482472 | 289 |
| 286 | 3300025972 | Ga0207668_10123300 | Ga0207668_101233003 | 289 |
| 287 | 3300025981 | Ga0207640_10056548 | Ga0207640_100565481 | 289 |
| 288 | 3300025986 | Ga0207658_10157464 | Ga0207658_101574642 | 289 |
| 289 | 3300026023 | Ga0207677_10026341 | Ga0207677_100263413 | 289 |
| 290 | 3300026035 | Ga0207703_10200367 | Ga0207703_102003672 | 289 |
| 291 | 3300026041 | Ga0207639_10032487 | Ga0207639_100324873 | 289 |
| 292 | 3300026075 | Ga0207708_10002945 | Ga0207708_100029454 | 289 |
| 293 | 3300026078 | Ga0207702_10256429 | Ga0207702_102564292 | 289 |
| 294 | 3300026088 | Ga0207641_10230822 | Ga0207641_102308222 | 289 |
| 295 | 3300026089 | Ga0207648_10016310 | Ga0207648_100163104 | 289 |
| 296 | 3300026089 | Ga0207648_10307103 | Ga0207648_103071031 | 289 |
| 297 | 3300026095 | Ga0207676_10029810 | Ga0207676_100298101 | 289 |
| 298 | 3300026116 | Ga0207674_10075367 | Ga0207674_100753672 | 289 |
| 299 | 3300026116 | Ga0207674_10078367 | Ga0207674_100783673 | 289 |
| 300 | 3300026118 | Ga0207675_100036828 | Ga0207675_1000368282 | 289 |
| 301 | 3300026118 | Ga0207675_100062827 | Ga0207675_1000628272 | 289 |
| 302 | 3300026121 | Ga0207683_10003576 | Ga0207683_100035763 | 289 |
| 303 | 3300026121 | Ga0207683_10019454 | Ga0207683_100194544 | 289 |
| 304 | 3300026142 | Ga0207698_10212559 | Ga0207698_102125592 | 289 |
| 305 | 3300028379 | Ga0268266_10072113 | Ga0268266_100721134 | 289 |
| 306 | 3300028379 | Ga0268266_10290333 | Ga0268266_102903331 | 289 |
| 307 | 3300028380 | Ga0268265_10025659 | Ga0268265_100256592 | 289 |
| 308 | 3300028380 | Ga0268265_10193069 | Ga0268265_101930691 | 289 |
| 309 | 3300028577 | Ga0265318_10016824 | Ga0265318_100168241 | 289 |
| 310 | 3300031235 | Ga0265330_10007917 | Ga0265330_100079172 | 289 |
| 311 | 3300031238 | Ga0265332_10005145 | Ga0265332_100051454 | 289 |
| 312 | 3300031239 | Ga0265328_10033455 | Ga0265328_100334552 | 289 |
| 313 | 3300031242 | Ga0265329_10007591 | Ga0265329_100075912 | 289 |
| 314 | 3300031250 | Ga0265331_10015706 | Ga0265331_100157064 | 289 |
| 315 | 3300031344 | Ga0265316_10029365 | Ga0265316_100293654 | 289 |
| 316 | 3300031711 | Ga0265314_10008502 | Ga0265314_100085027 | 289 |
| 317 | 3300031712 | Ga0265342_10088468 | Ga0265342_100884681 | 289 |
| 318 | 3300031911 | Ga0307412_10028620 | Ga0307412_100286202 | 289 |
| 319 | 3300032004 | Ga0307414_10026182 | Ga0307414_100261824 | 289 |
| 320 | 3300032005 | Ga0307411_10034295 | Ga0307411_100342954 | 289 |
| 321 | 3300035172 | Ga0373955_0077317 | Ga0373955_0077317_12_896 | 289 |
| 322 | 3300036401 | Ga0373937_0074010 | Ga0373937_0074010_1174_2058 | 289 |
| 323 | 3300037418 | Ga0395900_0011176 | Ga0395900_0011176_312_1202 | 289 |
| 324 | 3300038443 | Ga0395901_0603104 | Ga0395901_0603104_87_977 | 289 |
| 325 | 3300044765 | Ga0466970_0053063 | Ga0466970_0053063_34_912 | 289 |
| 326 | 3300046528 | Ga0495642_0021059 | Ga0495642_0021059_1497_2399 | 289 |
| 327 | 3300046683 | Ga0495658_0036657 | Ga0495658_0036657_1620_2522 | 289 |
| 328 | 3300047470 | Ga0495681_0087311 | Ga0495681_0087311_73_975 | 289 |
| 329 | 3300048903 | Ga0496100_0136578 | Ga0496100_0136578_34_936 | 289 |
| 330 | 3300048909 | Ga0496106_0175447 | Ga0496106_0175447_32_934 | 289 |
| 331 | 3300048911 | Ga0496108_0070161 | Ga0496108_0070161_1633_2535 | 289 |
| 332 | 3300048913 | Ga0496110_0466300 | Ga0496110_0466300_94_996 | 289 |
| 333 | 3300048915 | Ga0496112_0197214 | Ga0496112_0197214_400_1299 | 289 |
| 334 | 3300048917 | Ga0496114_0358863 | Ga0496114_0358863_370_1272 | 289 |
| 335 | 3300048919 | Ga0496116_0039578 | Ga0496116_0039578_1963_2841 | 289 |
| 336 | 3300048921 | Ga0496118_0013169 | Ga0496118_0013169_6302_7180 | 289 |
| 337 | 3300048921 | Ga0496118_0100931 | Ga0496118_0100931_757_1635 | 289 |
| 338 | 3300048922 | Ga0496119_0009171 | Ga0496119_0009171_3725_4603 | 289 |
| 339 | 3300048923 | Ga0496120_0010157 | Ga0496120_0010157_4818_5696 | 289 |
| 340 | 3300048924 | Ga0496121_0000124 | Ga0496121_0000124_97100_97978 | 289 |
| 341 | 3300048924 | Ga0496121_0062567 | Ga0496121_0062567_18_896 | 289 |
| 342 | 3300048925 | Ga0496122_0000316 | Ga0496122_0000316_96455_97333 | 289 |
| 343 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_385749_386627 | 289 |
| 344 | 3300048927 | Ga0496124_0020950 | Ga0496124_0020950_2486_3364 | 289 |
| 345 | 3300048928 | Ga0496125_0000570 | Ga0496125_0000570_20472_21350 | 289 |
| 346 | 3300048928 | Ga0496125_0180128 | Ga0496125_0180128_182_1060 | 289 |
| 347 | 3300048929 | Ga0496126_0037857 | Ga0496126_0037857_3546_4424 | 289 |
| 348 | 3300049570 | Ga0501033_0127826 | Ga0501033_0127826_74_952 | 289 |
| 349 | 3300049571 | Ga0501034_0241305 | Ga0501034_0241305_421_1299 | 289 |
| 350 | 3300049574 | Ga0501038_0301457 | Ga0501038_0301457_71_949 | 289 |
| 351 | 3300049579 | Ga0501043_0269615 | Ga0501043_0269615_104_982 | 289 |
| 352 | 3300049581 | Ga0501047_0024128 | Ga0501047_0024128_308_1186 | 289 |
| 353 | 3300049822 | Ga0501035_0029021 | Ga0501035_0029021_1647_2525 | 289 |
| 354 | 3300049822 | Ga0501035_0066145 | Ga0501035_0066145_794_1672 | 289 |
| 355 | 3300049823 | Ga0501044_0001867 | Ga0501044_0001867_1521_2399 | 289 |
| 356 | 3300049823 | Ga0501044_0007692 | Ga0501044_0007692_4544_5422 | 289 |
| 357 | 3300050491 | nmdc:mga00v17_1526_c1 | nmdc:mga00v17_1526_c1_1738_2616 | 289 |
| 358 | 3300050491 | nmdc:mga00v17_191673_c1 | nmdc:mga00v17_191673_c1_408_1286 | 289 |
| 359 | 3300003763 | Ga0055529_1000977 | Ga0055529_10009776 | 290 |
| 360 | 3300005289 | Ga0065704_10107675 | Ga0065704_101076752 | 290 |
| 361 | 3300005444 | Ga0070694_100228004 | Ga0070694_1002280042 | 290 |
| 362 | 3300005444 | Ga0070694_100276990 | Ga0070694_1002769901 | 290 |
| 363 | 3300005842 | Ga0068858_100179395 | Ga0068858_1001793952 | 290 |
| 364 | 3300006846 | Ga0075430_100040292 | Ga0075430_1000402924 | 290 |
| 365 | 3300009551 | Ga0105238_10115807 | Ga0105238_101158072 | 290 |
| 366 | 3300014968 | Ga0157379_10137413 | Ga0157379_101374132 | 290 |
| 367 | 3300025242 | Ga0209258_103478 | Ga0209258_1034783 | 290 |
| 368 | 3300025272 | Ga0209455_1000515 | Ga0209455_100051513 | 290 |
| 369 | 3300025924 | Ga0207694_10239374 | Ga0207694_102393741 | 290 |
| 370 | 3300031238 | Ga0265332_10000024 | Ga0265332_1000002495 | 290 |
| 371 | 3300031911 | Ga0307412_10062734 | Ga0307412_100627342 | 290 |
| 372 | 3300032133 | Ga0316583_10001168 | Ga0316583_100011682 | 290 |
| 373 | 3300042876 | Ga0451577_0006152 | Ga0451577_0006152_4320_5213 | 290 |
| 374 | 3300042876 | Ga0451577_0056941 | Ga0451577_0056941_2494_3387 | 290 |
| 375 | 3300042876 | Ga0451577_0069235 | Ga0451577_0069235_896_1783 | 290 |
| 376 | 3300044673 | Ga0453683_0036914 | Ga0453683_0036914_823_1716 | 290 |
| 377 | 3300044712 | Ga0453684_0000512 | Ga0453684_0000512_5327_6220 | 290 |
| 378 | 3300045051 | Ga0451576_0000461 | Ga0451576_0000461_68558_69451 | 290 |
| 379 | 3300045051 | Ga0451576_0001379 | Ga0451576_0001379_3222_4115 | 290 |
| 380 | 3300045051 | Ga0451576_0316028 | Ga0451576_0316028_530_1420 | 290 |
| 381 | 3300049573 | Ga0501037_0177104 | Ga0501037_0177104_371_1261 | 290 |
| 382 | 3300049575 | Ga0501039_0018419 | Ga0501039_0018419_3869_4759 | 290 |
| 383 | 3300049576 | Ga0501040_0176206 | Ga0501040_0176206_395_1285 | 290 |
| 384 | 3300049577 | Ga0501041_0006003 | Ga0501041_0006003_1532_2422 | 290 |
| 385 | 3300049580 | Ga0501046_0085944 | Ga0501046_0085944_739_1629 | 290 |
| 386 | 3300049582 | Ga0501048_0177371 | Ga0501048_0177371_514_1404 | 290 |
| 387 | 3300049587 | Ga0501071_0079465 | Ga0501071_0079465_923_1813 | 290 |
| 388 | 3300049588 | Ga0501072_0044808 | Ga0501072_0044808_1095_1985 | 290 |
| 389 | 3300049591 | Ga0501075_0006985 | Ga0501075_0006985_6095_6985 | 290 |
| 390 | 3300049592 | Ga0501076_0064907 | Ga0501076_0064907_616_1506 | 290 |
| 391 | 3300049593 | Ga0501077_0148819 | Ga0501077_0148819_151_1041 | 290 |
| 392 | 3300049741 | Ga0501079_0006588 | Ga0501079_0006588_5825_6715 | 290 |
| 393 | 3300049741 | Ga0501079_0213302 | Ga0501079_0213302_502_1386 | 290 |
| 394 | 3300049742 | Ga0501080_0027052 | Ga0501080_0027052_4123_5013 | 290 |
| 395 | 3300049743 | Ga0501081_0002716 | Ga0501081_0002716_5621_6511 | 290 |
| 396 | 3300049824 | Ga0501045_0071570 | Ga0501045_0071570_354_1244 | 290 |
| 397 | 3300050509 | nmdc:mga0qj67_399746_c1 | nmdc:mga0qj67_399746_c1_107_997 | 290 |
| 398 | 3300053161 | Ga0500634_0016885 | Ga0500634_0016885_732_1613 | 290 |
| 399 | 3300059423 | Ga0590074_018351 | Ga0590074_018351_97_1011 | 290 |
| 400 | 3300059426 | Ga0590077_014556 | Ga0590077_014556_277_1161 | 290 |
| 401 | 3300060353 | Ga0501082_0001560 | Ga0501082_0001560_14759_15649 | 290 |
| 402 | 3300061734 | Ga0530510_0098723 | Ga0530510_0098723_1030_1920 | 290 |
| 403 | iso_pu_bacteria | 2511231026 | 2511386667 | 290 |
| 404 | iso_pu_bacteria | 2521172590 | 2521558137 | 290 |
| 405 | iso_pu_bacteria | 2551306416 | 2553003262 | 290 |
| 406 | iso_pu_bacteria | 2765235838 | 2765569270 | 290 |
| 407 | iso_pu_bacteria | 2808606386 | 2808983865 | 290 |
| 408 | iso_pu_bacteria | 2808606415 | 2809130925 | 290 |
| 409 | iso_pu_bacteria | 2808606419 | 2809150740 | 290 |
| 410 | iso_pu_bacteria | 2818991449 | 2819614720 | 290 |
| 411 | iso_pu_bacteria | 2839094727 | 2839095844 | 290 |
| 412 | iso_pu_bacteria | 2852618963 | 2852622258 | 290 |
| 413 | iso_pu_bacteria | 2904439833 | 2904441089 | 290 |
| 414 | iso_pu_bacteria | 2904530477 | 2904531968 | 290 |
| 415 | iso_pu_bacteria | 2904584206 | 2904587806 | 290 |
| 416 | iso_pu_bacteria | 2904589729 | 2904590034 | 290 |
| 417 | iso_pu_bacteria | 2904601388 | 2904602578 | 290 |
| 418 | iso_pu_bacteria | 2919046199 | 2919046600 | 290 |
| 419 | iso_pu_bacteria | 2919079590 | 2919079916 | 290 |
| 420 | iso_pu_bacteria | 2923510766 | 2923511385 | 290 |
| 421 | iso_pu_bacteria | 2928130867 | 2928131316 | 290 |
| 422 | 3300003187 | JGI25151J46595_10005266 | JGI25151J46595_100052667 | 291 |
| 423 | 3300003187 | JGI25151J46595_10006164 | JGI25151J46595_100061641 | 291 |
| 424 | 3300003187 | JGI25151J46595_10013369 | JGI25151J46595_100133693 | 291 |
| 425 | 3300003773 | Ga0055537_1010233 | Ga0055537_10102331 | 291 |
| 426 | 3300003781 | Ga0055536_1000211 | Ga0055536_100021142 | 291 |
| 427 | 3300003784 | Ga0055534_1001154 | Ga0055534_10011541 | 291 |
| 428 | 3300005331 | Ga0070670_100052950 | Ga0070670_1000529504 | 291 |
| 429 | 3300005355 | Ga0070671_100009222 | Ga0070671_1000092228 | 291 |
| 430 | 3300005356 | Ga0070674_100062878 | Ga0070674_1000628783 | 291 |
| 431 | 3300005367 | Ga0070667_100414150 | Ga0070667_1004141502 | 291 |
| 432 | 3300005543 | Ga0070672_100004310 | Ga0070672_1000043108 | 291 |
| 433 | 3300005563 | Ga0068855_100516689 | Ga0068855_1005166891 | 291 |
| 434 | 3300006042 | Ga0075368_10001014 | Ga0075368_100010142 | 291 |
| 435 | 3300006048 | Ga0075363_100003480 | Ga0075363_1000034806 | 291 |
| 436 | 3300006051 | Ga0075364_10008637 | Ga0075364_100086376 | 291 |
| 437 | 3300006177 | Ga0075362_10011738 | Ga0075362_100117383 | 291 |
| 438 | 3300006178 | Ga0075367_10004716 | Ga0075367_100047166 | 291 |
| 439 | 3300006186 | Ga0075369_10028077 | Ga0075369_100280771 | 291 |
| 440 | 3300006195 | Ga0075366_10003213 | Ga0075366_100032134 | 291 |
| 441 | 3300006353 | Ga0075370_10007136 | Ga0075370_100071362 | 291 |
| 442 | 3300006948 | Ga0099826_10000012 | Ga0099826_10000012131 | 291 |
| 443 | 3300009011 | Ga0105251_10054280 | Ga0105251_100542802 | 291 |
| 444 | 3300009177 | Ga0105248_10002249 | Ga0105248_1000224919 | 291 |
| 445 | 3300025263 | Ga0209565_1000021 | Ga0209565_1000021247 | 291 |
| 446 | 3300025273 | Ga0209673_1011367 | Ga0209673_10113672 | 291 |
| 447 | 3300025291 | Ga0209675_1000149 | Ga0209675_100014938 | 291 |
| 448 | 3300025291 | Ga0209675_1000722 | Ga0209675_10007228 | 291 |
| 449 | 3300025292 | Ga0209676_1000014 | Ga0209676_1000014691 | 291 |
| 450 | 3300025294 | Ga0209025_1000115 | Ga0209025_100011528 | 291 |
| 451 | 3300025294 | Ga0209025_1000522 | Ga0209025_100052213 | 291 |
| 452 | 3300025294 | Ga0209025_1001089 | Ga0209025_10010892 | 291 |
| 453 | 3300025294 | Ga0209025_1013887 | Ga0209025_10138872 | 291 |
| 454 | 3300025295 | Ga0209564_1003403 | Ga0209564_100340310 | 291 |
| 455 | 3300025295 | Ga0209564_1023976 | Ga0209564_10239761 | 291 |
| 456 | 3300025297 | Ga0209758_1019907 | Ga0209758_10199072 | 291 |
| 457 | 3300025299 | Ga0209256_1000280 | Ga0209256_10002809 | 291 |
| 458 | 3300025299 | Ga0209256_1000625 | Ga0209256_100062530 | 291 |
| 459 | 3300025925 | Ga0207650_10116033 | Ga0207650_101160332 | 291 |
| 460 | 3300025931 | Ga0207644_10069053 | Ga0207644_100690533 | 291 |
| 461 | 3300025937 | Ga0207669_10084550 | Ga0207669_100845502 | 291 |
| 462 | 3300025940 | Ga0207691_10017249 | Ga0207691_100172493 | 291 |
| 463 | 3300025941 | Ga0207711_10002151 | Ga0207711_1000215116 | 291 |
| 464 | 3300025949 | Ga0207667_10433986 | Ga0207667_104339861 | 291 |
| 465 | 3300027360 | Ga0209969_1000556 | Ga0209969_10005563 | 291 |
| 466 | 3300027462 | Ga0210000_1011120 | Ga0210000_10111201 | 291 |
| 467 | 3300027471 | Ga0209995_1003898 | Ga0209995_10038983 | 291 |
| 468 | 3300027666 | Ga0209282_1000028 | Ga0209282_1000028103 | 291 |
| 469 | 3300027866 | Ga0209813_10005486 | Ga0209813_100054862 | 291 |
| 470 | 3300027876 | Ga0209974_10002299 | Ga0209974_100022992 | 291 |
| 471 | 3300042876 | Ga0451577_0303443 | Ga0451577_0303443_185_1084 | 291 |
| 472 | 3300046474 | Ga0495605_0020153 | Ga0495605_0020153_2072_2950 | 291 |
| 473 | 3300046500 | Ga0495596_0003212 | Ga0495596_0003212_6945_7823 | 291 |
| 474 | 3300046512 | Ga0495610_0006379 | Ga0495610_0006379_6673_7551 | 291 |
| 475 | 3300046513 | Ga0495616_0003605 | Ga0495616_0003605_570_1448 | 291 |
| 476 | 3300046538 | Ga0495609_0039759 | Ga0495609_0039759_651_1529 | 291 |
| 477 | 3300046692 | Ga0495671_0004725 | Ga0495671_0004725_598_1476 | 291 |
| 478 | 3300048911 | Ga0496108_0065401 | Ga0496108_0065401_1881_2759 | 291 |
| 479 | 3300048915 | Ga0496112_0007864 | Ga0496112_0007864_4151_5029 | 291 |
| 480 | 3300048919 | Ga0496116_0005400 | Ga0496116_0005400_10412_11290 | 291 |
| 481 | 3300049571 | Ga0501034_0013068 | Ga0501034_0013068_704_1582 | 291 |
| 482 | 3300050489 | nmdc:mga03683_43400_c1 | nmdc:mga03683_43400_c1_847_1743 | 291 |
| 483 | 3300050493 | nmdc:mga0k408_8277_c1 | nmdc:mga0k408_8277_c1_847_1743 | 291 |
| 484 | 3300053178 | Ga0500637_0182814 | Ga0500637_0182814_228_1124 | 291 |
| 485 | 3300003163 | Ga0006759J45824_1020768 | Ga0006759J45824_10207682 | 292 |
| 486 | 3300003544 | Ga0007417J51691_1011547 | Ga0007417J51691_10115472 | 292 |
| 487 | 3300003574 | Ga0007410J51695_1010058 | Ga0007410J51695_10100582 | 292 |
| 488 | 3300003575 | Ga0007409J51694_1006129 | Ga0007409J51694_10061292 | 292 |
| 489 | 3300003577 | Ga0007416J51690_1010384 | Ga0007416J51690_10103842 | 292 |
| 490 | 3300003693 | Ga0032354_1020514 | Ga0032354_10205142 | 292 |
| 491 | 3300005536 | Ga0070697_100090031 | Ga0070697_1000900313 | 292 |
| 492 | 3300006914 | Ga0075436_100085530 | Ga0075436_1000855303 | 292 |
| 493 | 3300025949 | Ga0207667_10349225 | Ga0207667_103492252 | 292 |
| 494 | 3300035118 | Ga0373954_0048064 | Ga0373954_0048064_83_994 | 292 |
| 495 | 3300037312 | Ga0395899_0003631 | Ga0395899_0003631_8792_9673 | 292 |
| 496 | 3300037418 | Ga0395900_0006730 | Ga0395900_0006730_6422_7303 | 292 |
| 497 | 3300037418 | Ga0395900_0224553 | Ga0395900_0224553_497_1378 | 292 |
| 498 | 3300037466 | Ga0395898_0012245 | Ga0395898_0012245_6740_7621 | 292 |
| 499 | 3300037466 | Ga0395898_0593602 | Ga0395898_0593602_84_965 | 292 |
| 500 | 3300037471 | Ga0395905_0015722 | Ga0395905_0015722_468_1349 | 292 |
| 501 | 3300038443 | Ga0395901_0004717 | Ga0395901_0004717_12752_13633 | 292 |
| 502 | 3300038443 | Ga0395901_0257640 | Ga0395901_0257640_77_958 | 292 |
| 503 | 3300046453 | Ga0495627_000059 | Ga0495627_000059_93535_94488 | 292 |
| 504 | 3300046507 | Ga0495606_0021265 | Ga0495606_0021265_529_1410 | 292 |
| 505 | 3300046516 | Ga0495628_0010478 | Ga0495628_0010478_3681_4592 | 292 |
| 506 | 3300046529 | Ga0495652_0011388 | Ga0495652_0011388_4109_5020 | 292 |
| 507 | 3300046543 | Ga0495645_0004672 | Ga0495645_0004672_6058_6969 | 292 |
| 508 | 3300047318 | Ga0495636_0002422 | Ga0495636_0002422_2533_3444 | 292 |
| 509 | 3300048090 | Ga0495615_0037335 | Ga0495615_0037335_244_1125 | 292 |
| 510 | 3300050514 | nmdc:mga08x19_13687_c1 | nmdc:mga08x19_13687_c1_2695_3606 | 292 |
| 511 | 3300053077 | Ga0495601_0056928 | Ga0495601_0056928_1047_1958 | 292 |
| 512 | 3300059490 | Ga0587066_030398 | Ga0587066_030398_25_906 | 292 |
| 513 | 3300005295 | Ga0065707_10101473 | Ga0065707_101014732 | 293 |
| 514 | 3300005564 | Ga0070664_100371872 | Ga0070664_1003718721 | 293 |
| 515 | 3300035086 | Ga0373934_0000570 | Ga0373934_0000570_734_1648 | 293 |
| 516 | 3300035111 | Ga0373923_0041834 | Ga0373923_0041834_739_1653 | 293 |
| 517 | 3300035117 | Ga0373953_0019485 | Ga0373953_0019485_1535_2449 | 293 |
| 518 | 3300035118 | Ga0373954_0049526 | Ga0373954_0049526_920_1834 | 293 |
| 519 | 3300035119 | Ga0373956_0018855 | Ga0373956_0018855_95_1009 | 293 |
| 520 | 3300035171 | Ga0373946_0084791 | Ga0373946_0084791_437_1351 | 293 |
| 521 | 3300035410 | Ga0373924_0029925 | Ga0373924_0029925_534_1448 | 293 |
| 522 | 3300035692 | Ga0373935_0036800 | Ga0373935_0036800_841_1755 | 293 |
| 523 | 3300035695 | Ga0373927_0024467 | Ga0373927_0024467_2128_3042 | 293 |
| 524 | 3300036401 | Ga0373937_0063375 | Ga0373937_0063375_1765_2679 | 293 |
| 525 | 3300046454 | Ga0495592_0010946 | Ga0495592_0010946_5382_6296 | 293 |
| 526 | 3300046459 | Ga0495629_0129323 | Ga0495629_0129323_295_1209 | 293 |
| 527 | 3300046461 | Ga0495641_0007072 | Ga0495641_0007072_4701_5615 | 293 |
| 528 | 3300046462 | Ga0495651_0003739 | Ga0495651_0003739_1968_2882 | 293 |
| 529 | 3300046463 | Ga0495653_0004139 | Ga0495653_0004139_2024_2938 | 293 |
| 530 | 3300046472 | Ga0495580_0071895 | Ga0495580_0071895_1457_2371 | 293 |
| 531 | 3300046475 | Ga0495639_0079477 | Ga0495639_0079477_239_1153 | 293 |
| 532 | 3300046477 | Ga0495664_0015172 | Ga0495664_0015172_2550_3464 | 293 |
| 533 | 3300046499 | Ga0495594_0035137 | Ga0495594_0035137_1082_1996 | 293 |
| 534 | 3300046516 | Ga0495628_0107704 | Ga0495628_0107704_686_1600 | 293 |
| 535 | 3300046516 | Ga0495628_0121673 | Ga0495628_0121673_622_1536 | 293 |
| 536 | 3300046526 | Ga0495666_0060025 | Ga0495666_0060025_485_1399 | 293 |
| 537 | 3300046529 | Ga0495652_0109930 | Ga0495652_0109930_482_1396 | 293 |
| 538 | 3300046535 | Ga0495586_0135999 | Ga0495586_0135999_427_1341 | 293 |
| 539 | 3300046536 | Ga0495587_0047226 | Ga0495587_0047226_757_1671 | 293 |
| 540 | 3300046642 | Ga0495634_0025817 | Ga0495634_0025817_2291_3205 | 293 |
| 541 | 3300046675 | Ga0495657_0003454 | Ga0495657_0003454_10764_11678 | 293 |
| 542 | 3300046678 | Ga0495599_0019078 | Ga0495599_0019078_1750_2664 | 293 |
| 543 | 3300046678 | Ga0495599_0053278 | Ga0495599_0053278_36_950 | 293 |
| 544 | 3300046681 | Ga0495647_0007574 | Ga0495647_0007574_1996_2910 | 293 |
| 545 | 3300046689 | Ga0495613_0021414 | Ga0495613_0021414_3184_4098 | 293 |
| 546 | 3300046690 | Ga0495624_0048321 | Ga0495624_0048321_723_1637 | 293 |
| 547 | 3300046809 | Ga0495600_0001200 | Ga0495600_0001200_8626_9540 | 293 |
| 548 | 3300047471 | Ga0495684_0008067 | Ga0495684_0008067_5220_6134 | 293 |
| 549 | 3300053077 | Ga0495601_0002619 | Ga0495601_0002619_3631_4545 | 293 |
| 550 | 3300053084 | Ga0495595_0012537 | Ga0495595_0012537_2034_2948 | 293 |
| 551 | 3300053085 | Ga0495619_0003254 | Ga0495619_0003254_7894_8808 | 293 |
| 552 | 3300002704 | JGI25155J39150_1000372 | JGI25155J39150_100037213 | 294 |
| 553 | 3300003751 | Ga0055538_1000002 | Ga0055538_1000002515 | 294 |
| 554 | 3300003752 | Ga0055539_1000002 | Ga0055539_1000002515 | 294 |
| 555 | 3300003756 | Ga0055533_1000004 | Ga0055533_1000004515 | 294 |
| 556 | 3300003759 | Ga0055525_1000002 | Ga0055525_1000002515 | 294 |
| 557 | 3300003841 | Ga0055541_1000002 | Ga0055541_1000002328 | 294 |
| 558 | 3300005563 | Ga0068855_100001340 | Ga0068855_1000013402 | 294 |
| 559 | 3300005578 | Ga0068854_100000993 | Ga0068854_10000099313 | 294 |
| 560 | 3300005834 | Ga0068851_10126062 | Ga0068851_101260621 | 294 |
| 561 | 3300006946 | Ga0079104_1011224 | Ga0079104_10112243 | 294 |
| 562 | 3300009093 | Ga0105240_10035080 | Ga0105240_100350803 | 294 |
| 563 | 3300025224 | Ga0209784_100002 | Ga0209784_100002743 | 294 |
| 564 | 3300025225 | Ga0209566_100003 | Ga0209566_100003743 | 294 |
| 565 | 3300025226 | Ga0209674_100004 | Ga0209674_100004743 | 294 |
| 566 | 3300025230 | Ga0209563_100006 | Ga0209563_100006743 | 294 |
| 567 | 3300025253 | Ga0209677_100003 | Ga0209677_100003743 | 294 |
| 568 | 3300025913 | Ga0207695_10008662 | Ga0207695_100086628 | 294 |
| 569 | 3300025914 | Ga0207671_10079071 | Ga0207671_100790711 | 294 |
| 570 | 3300025924 | Ga0207694_10001629 | Ga0207694_100016298 | 294 |
| 571 | 3300025949 | Ga0207667_10000036 | Ga0207667_1000003649 | 294 |
| 572 | 3300025949 | Ga0207667_10431595 | Ga0207667_104315952 | 294 |
| 573 | 3300025981 | Ga0207640_10081723 | Ga0207640_100817231 | 294 |
| 574 | 3300026116 | Ga0207674_10080680 | Ga0207674_100806802 | 294 |
| 575 | 3300039447 | Ga0436361_0161338 | Ga0436361_0161338_17686_18573 | 294 |
| 576 | 3300044693 | Ga0466961_0024750 | Ga0466961_0024750_963_1862 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2do6-assembly1.cif.gz_A | solution structure of rsgi ruh-065, a uba domain from human cdna | 0.9224 | 7 | 46 |
| 1tfe-assembly1.cif.gz_A-2 | dimerization domain of ef-ts from t. thermophilus | 0.9027 | 148 | 269 |
| 2ooa-assembly2.cif.gz_B | crystal structure of the uba domain from cbl-b ubiquitin ligase | 0.8968 | 5 | 43 |
| 1z96-assembly1.cif.gz_A | crystal structure of the mud1 uba domain | 0.8901 | 7 | 41 |
| 2oob-assembly1.cif.gz_A | crystal structure of the uba domain from cbl-b ubiquitin ligase in complex with ubiquitin | 0.8893 | 4 | 43 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1efuD03 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Elongation factor Ts, dimerisation domain | 0.9715 | 150 | 268 | 3.30.479.20 |
| af_Q2FZ23_57_146_3.30.479.20 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Elongation factor Ts, dimerisation domain | 0.9598 | 58 | 143 | 3.30.479.20 |
| af_Q80X50_30_89_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.937 | 7 | 41 | 1.10.8.10 |
| 1efuD03 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Elongation factor Ts, dimerisation domain | 0.9336 | 150 | 268 | 3.30.479.20 |
| 3k9oA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.9269 | 7 | 43 | 1.10.8.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T2V3Z7-F1-model_v4 | Elongation factor Ts | 0.9481 | 74 | 270 |
GO:0003746
GO:0005737 |
| AF-A0A519T5C5-F1-model_v4 | deleted | 0.9478 | 171 | 264 |
|
| AF-A0A661B9J7-F1-model_v4 | Elongation factor Ts (EF-Ts) | 0.9452 | 74 | 269 |
GO:0003746
GO:0005737 |
| AF-A0A0R2QW62-F1-model_v4 | Elongation factor Ts | 0.942 | 60 | 270 |
GO:0003746
GO:0005737 |
| AF-A0A6L7JRV2-F1-model_v4 | Elongation factor Ts | 0.9402 | 50 | 270 |
GO:0003746
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar