F465520

General Info

Members Datasets Scaffolds Average Seq Length
576 395 520 295

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10026182|Ga0307414_100261824
Length 330
Sequence LYLAGLGVCCHKAAESLIVSLCTCPGYAGVCFSELEKKVAQITASMVKELREKTDAPMMECKKALTEAEGDLARAEEILRVKLGNKASKAATRVTAEGLIGLYITPDNKRGTVVEVNCETDFVAKNDDFVGFINQVAELITDKNPADVAALAALSMGEGTVETTRSALVGKIGENISIRRFQRFETGDQLASYVHGGKIGVLVEFAGPEETGKDLAMHIAATKPRALDASGVSQADIAAERSVAEQKAAESGKPAEIVTKMVDGAVQKYLKEVTLLSQPFVKNDKQSIEQMLKEKGAKVTGFALYVVGEGIEKKSEDFAAEVAAAAAGTA

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
6 2547132512 Azospira oryzae 6a3 Isolate Unclassified
7 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
8 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
9 2643221569 Achromobacter sp. Root565 Isolate Unclassified
10 2643221594 Achromobacter sp. Root170 Isolate Unclassified
11 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
12 2643221621 Achromobacter sp. Root83 Isolate Unclassified
13 2643221660 Methylibium sp. Root1272 Isolate Unclassified
14 2721755523 Delftia sp. HK171 Isolate Unclassified
15 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
16 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
17 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
18 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
19 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
20 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
21 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
22 2831864461 Roseateles noduli HZ7 Isolate Nodule
23 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
24 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
25 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
26 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
27 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
28 2855730933 Achromobacter sp. HZ28 Isolate Nodule
29 2855767633 Achromobacter sp. HZ34 Isolate Nodule
30 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
31 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
32 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
33 2858950400 Achromobacter sp. K91 Isolate Unclassified
34 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
35 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
36 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
37 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
38 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
39 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
40 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
41 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
42 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
43 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
44 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
45 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
46 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
47 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
48 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
49 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
50 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
51 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
52 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
57 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
59 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
60 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
62 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
63 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
64 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
71 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
74 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
75 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
76 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
98 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
132 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
133 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
160 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
161 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
228 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
232 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
240 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
241 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
242 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
243 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
244 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
257 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
258 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
259 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
363 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
367 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
368 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
384 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
385 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
386 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
387 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
388 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
391 639633007 Azoarcus olearius BH72 Isolate Unclassified
392 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
393 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
394 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
395 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.54
Metatranscriptomes 1.74
Isolates 9.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.24
Nodule 2.26
Rhizoplane 1.74
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 8.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000372 3300002704 Bacteria 13405
2 Ga0006759J45824_1020768 3300003163 Bacteria 2548
3 JGI25151J46595_10005266 3300003187 Bacteria 6702
4 JGI25151J46595_10006164 3300003187 Bacteria 6073
5 JGI25151J46595_10013369 3300003187 Bacteria 3695
6 JGI25153J46596_10002002 3300003215 Bacteria 12045
7 JGI25160J50197_1004394 3300003354 Bacteria 6104
8 Ga0007417J51691_1011547 3300003544 Bacteria 2361
9 Ga0007410J51695_1010058 3300003574 Bacteria 4462
10 Ga0007409J51694_1006129 3300003575 Bacteria 4322
11 Ga0007416J51690_1010384 3300003577 Bacteria 4494
12 Ga0032354_1020514 3300003693 Bacteria 4368
13 Ga0055538_1000002 3300003751 Bacteria 999437
14 Ga0055539_1000002 3300003752 Bacteria 999437
15 Ga0055533_1000004 3300003756 Bacteria 999437
16 Ga0055525_1000002 3300003759 Bacteria 999437
17 Ga0055529_1000977 3300003763 Bacteria 14289
18 Ga0055526_1017220 3300003771 Bacteria 2775
19 Ga0055537_1010233 3300003773 Bacteria 1993
20 Ga0055524_1021989 3300003775 Bacteria 2096
21 Ga0055536_1000211 3300003781 Bacteria 47611
22 Ga0055534_1001154 3300003784 Bacteria 11154
23 Ga0055528_1013339 3300003790 Bacteria 3117
24 Ga0055530_10010065 3300003791 Bacteria 3549
25 Ga0055541_1000002 3300003841 Bacteria 896405
26 Ga0065704_10107675 3300005289 Bacteria 2049
27 Ga0065704_10171474 3300005289 Bacteria 1289
28 Ga0065707_10101473 3300005295 Bacteria 2862
29 Ga0070676_10057426 3300005328 Bacteria 2303
30 Ga0070690_100018947 3300005330 Bacteria 4167
31 Ga0070670_100046142 3300005331 Bacteria 3746
32 Ga0070670_100052950 3300005331 Bacteria 3486
33 Ga0068869_100003267 3300005334 Bacteria 9903
34 Ga0068869_100122415 3300005334 Bacteria 1991
35 Ga0068869_100130306 3300005334 Bacteria 1932
36 Ga0068868_100013526 3300005338 Bacteria 5985
37 Ga0070660_100001298 3300005339 Bacteria 17020
38 Ga0070689_100519148 3300005340 Bacteria 1023
39 Ga0070675_100035020 3300005354 Bacteria 4077
40 Ga0070675_100161662 3300005354 Bacteria 1926
41 Ga0070671_100009222 3300005355 Bacteria 7926
42 Ga0070671_100108894 3300005355 Bacteria 2326
43 Ga0070674_100035299 3300005356 Bacteria 3348
44 Ga0070674_100060608 3300005356 Bacteria 2638
45 Ga0070674_100062878 3300005356 Bacteria 2596
46 Ga0070673_100100428 3300005364 Bacteria 2382
47 Ga0070673_100229297 3300005364 Bacteria 1611
48 Ga0070659_100324752 3300005366 Bacteria 1287
49 Ga0070667_100084285 3300005367 Bacteria 2724
50 Ga0070667_100237088 3300005367 Bacteria 1628
51 Ga0070667_100414150 3300005367 Bacteria 1228
52 Ga0070694_100197072 3300005444 Bacteria 1499
53 Ga0070694_100228004 3300005444 Bacteria 1400
54 Ga0070694_100276990 3300005444 Bacteria 1278
55 Ga0070678_100014278 3300005456 Bacteria 5005
56 Ga0070678_100148987 3300005456 Bacteria 1883
57 Ga0070681_10054614 3300005458 Bacteria 3981
58 Ga0070681_10099387 3300005458 Bacteria 2856
59 Ga0068867_100332156 3300005459 Bacteria 1263
60 Ga0070699_100152459 3300005518 Bacteria 2045
61 Ga0070684_100327803 3300005535 Bacteria 1407
62 Ga0070697_100090031 3300005536 Bacteria 2536
63 Ga0068853_100055595 3300005539 Bacteria 3412
64 Ga0068853_100314356 3300005539 Bacteria 1451
65 Ga0070672_100004310 3300005543 Bacteria 9307
66 Ga0070695_100007395 3300005545 Bacteria 6515
67 Ga0070665_100054543 3300005548 Bacteria 4009
68 Ga0070665_100138102 3300005548 Bacteria 2440
69 Ga0068855_100001340 3300005563 Bacteria 30486
70 Ga0068855_100010957 3300005563 Bacteria 10939
71 Ga0068855_100516689 3300005563 Bacteria 1296
72 Ga0070664_100015472 3300005564 Bacteria 6240
73 Ga0070664_100371872 3300005564 Bacteria 1303
74 Ga0068857_100060442 3300005577 Bacteria 3366
75 Ga0068854_100000993 3300005578 Bacteria 17083
76 Ga0068856_100304393 3300005614 Bacteria 1612
77 Ga0068852_100079188 3300005616 Bacteria 2910
78 Ga0068859_100250726 3300005617 Bacteria 1861
79 Ga0068864_100077826 3300005618 Bacteria 2901
80 Ga0068864_100150849 3300005618 Bacteria 2105
81 Ga0068861_100132738 3300005719 Bacteria 2023
82 Ga0068861_100186196 3300005719 Bacteria 1731
83 Ga0068851_10006259 3300005834 Bacteria 5431
84 Ga0068851_10126062 3300005834 Bacteria 1381
85 Ga0068863_100255161 3300005841 Bacteria 1695
86 Ga0068858_100043999 3300005842 Bacteria 4140
87 Ga0068858_100179395 3300005842 Bacteria 1999
88 Ga0068860_100223993 3300005843 Bacteria 1826
89 Ga0068862_100102333 3300005844 Bacteria 2507
90 Ga0075368_10001014 3300006042 Bacteria 8786
91 Ga0075363_100003480 3300006048 Bacteria 6700
92 Ga0075364_10003579 3300006051 Bacteria 8847
93 Ga0075364_10008637 3300006051 Bacteria 6093
94 Ga0075364_10022675 3300006051 Bacteria 3968
95 Ga0075362_10011738 3300006177 Bacteria 3457
96 Ga0075367_10004716 3300006178 Bacteria 6700
97 Ga0075369_10028077 3300006186 Bacteria 2356
98 Ga0075366_10003213 3300006195 Bacteria 8577
99 Ga0075366_10008907 3300006195 Bacteria 5591
100 Ga0097621_100011505 3300006237 Bacteria 6519
101 Ga0097621_100021575 3300006237 Bacteria 4985
102 Ga0097621_100359059 3300006237 Bacteria 1297
103 Ga0075370_10007136 3300006353 Bacteria 5672
104 Ga0068871_100031771 3300006358 Bacteria 4166
105 Ga0068871_100509762 3300006358 Bacteria 1085
106 Ga0075428_100000245 3300006844 Bacteria 53219
107 Ga0075430_100015261 3300006846 Bacteria 6540
108 Ga0075430_100040292 3300006846 Bacteria 3955
109 Ga0075431_100003069 3300006847 Bacteria 16172
110 Ga0075431_100174842 3300006847 Bacteria 2206
111 Ga0075431_100197206 3300006847 Bacteria 2061
112 Ga0075429_100030290 3300006880 Bacteria 4700
113 Ga0068865_100045835 3300006881 Bacteria 2998
114 Ga0075436_100085530 3300006914 Bacteria 2190
115 Ga0097620_100250739 3300006931 Bacteria 1861
116 Ga0079104_1000025 3300006946 Bacteria 218785
117 Ga0079104_1011224 3300006946 Bacteria 2893
118 Ga0099826_10000012 3300006948 Bacteria 283499
119 Ga0099794_10026857 3300007265 Bacteria 2665
120 Ga0099794_10038181 3300007265 Bacteria 2275
121 Ga0105251_10054280 3300009011 Bacteria 1903
122 Ga0105240_10035080 3300009093 Bacteria 6468
123 Ga0111539_10000383 3300009094 Bacteria 54556
124 Ga0111539_10159164 3300009094 Bacteria 2641
125 Ga0105245_10220811 3300009098 Bacteria 1829
126 Ga0105247_10130261 3300009101 Bacteria 1639
127 Ga0105243_10000729 3300009148 Bacteria 31488
128 Ga0105243_10033164 3300009148 Bacteria 3992
129 Ga0105243_10079014 3300009148 Bacteria 2680
130 Ga0105241_10307760 3300009174 Bacteria 1362
131 Ga0105242_10039525 3300009176 Bacteria 3798
132 Ga0105242_10196791 3300009176 Bacteria 1788
133 Ga0105248_10002249 3300009177 Bacteria 21375
134 Ga0105248_10002407 3300009177 Bacteria 20777
135 Ga0105248_10218927 3300009177 Bacteria 2144
136 Ga0105237_10005766 3300009545 Bacteria 13911
137 Ga0105237_10025618 3300009545 Bacteria 6028
138 Ga0105238_10115807 3300009551 Bacteria 2660
139 Ga0105239_10037494 3300010375 Bacteria 5312
140 Ga0105239_10039314 3300010375 Bacteria 5183
141 Ga0105246_10108932 3300011119 Bacteria 2031
142 Ga0157373_10004456 3300013100 Bacteria 10537
143 Ga0157370_10213618 3300013104 Bacteria 1787
144 Ga0157369_10000979 3300013105 Bacteria 36209
145 Ga0157369_10160429 3300013105 Bacteria 2374
146 Ga0157374_10000107 3300013296 Bacteria 75925
147 Ga0157374_10000145 3300013296 Bacteria 64560
148 Ga0157374_10052521 3300013296 Bacteria 3797
149 Ga0157374_10259174 3300013296 Bacteria 1712
150 Ga0157378_10219365 3300013297 Bacteria 1807
151 Ga0163162_10019867 3300013306 Bacteria 6597
152 Ga0163162_10045102 3300013306 Bacteria 4417
153 Ga0163162_10078206 3300013306 Bacteria 3373
154 Ga0157372_10002854 3300013307 Bacteria 18675
155 Ga0163163_10260928 3300014325 Bacteria 1783
156 Ga0157380_10194863 3300014326 Bacteria 1792
157 Ga0157379_10109018 3300014968 Bacteria 2486
158 Ga0157379_10137413 3300014968 Bacteria 2202
159 Ga0157376_10062291 3300014969 Bacteria 3138
160 Ga0157376_10246115 3300014969 Bacteria 1668
161 Ga0163161_10038025 3300017792 Bacteria 3450
162 Ga0206355_1291451 3300020076 Bacteria 1214
163 Ga0213872_10000001 3300021361 Bacteria 662532
164 Ga0213872_10015634 3300021361 Bacteria 3527
165 Ga0213872_10073098 3300021361 Bacteria 1544
166 Ga0213872_10082680 3300021361 Bacteria 1441
167 Ga0209436_100479 3300025208 Bacteria 17653
168 Ga0209784_100002 3300025224 Bacteria 1753105
169 Ga0209566_100003 3300025225 Bacteria 1753105
170 Ga0209674_100004 3300025226 Bacteria 1753105
171 Ga0209563_100006 3300025230 Bacteria 1753105
172 Ga0209258_103478 3300025242 Bacteria 3374
173 Ga0207425_1000001 3300025245 Bacteria 2525432
174 Ga0209677_100003 3300025253 Bacteria 1753105
175 Ga0209759_1003925 3300025256 Bacteria 5732
176 Ga0209129_1000003 3300025258 Bacteria 903689
177 Ga0209565_1000021 3300025263 Bacteria 406281
178 Ga0209565_1000983 3300025263 Bacteria 14647
179 Ga0209565_1023911 3300025263 Bacteria 1250
180 Ga0209455_1000515 3300025272 Bacteria 27385
181 Ga0209673_1011367 3300025273 Bacteria 3676
182 Ga0209130_1000990 3300025284 Bacteria 22166
183 Ga0209130_1013661 3300025284 Bacteria 2071
184 Ga0207673_1006146 3300025290 Bacteria 1480
185 Ga0209675_1000149 3300025291 Bacteria 93109
186 Ga0209675_1000250 3300025291 Bacteria 53412
187 Ga0209675_1000722 3300025291 Bacteria 22494
188 Ga0209676_1000014 3300025292 Bacteria 793514
189 Ga0209676_1003098 3300025292 Bacteria 10694
190 Ga0209025_1000018 3300025294 Bacteria 686898
191 Ga0209025_1000115 3300025294 Bacteria 218871
192 Ga0209025_1000522 3300025294 Bacteria 73140
193 Ga0209025_1001089 3300025294 Bacteria 39299
194 Ga0209025_1013887 3300025294 Bacteria 5016
195 Ga0209564_1003403 3300025295 Bacteria 10940
196 Ga0209564_1003556 3300025295 Bacteria 10461
197 Ga0209564_1023976 3300025295 Bacteria 2099
198 Ga0209758_1000020 3300025297 Bacteria 734220
199 Ga0209758_1019907 3300025297 Bacteria 3207
200 Ga0209050_1001037 3300025298 Bacteria 34453
201 Ga0209050_1013802 3300025298 Bacteria 3549
202 Ga0209256_1000280 3300025299 Bacteria 89706
203 Ga0209256_1000625 3300025299 Bacteria 48667
204 Ga0209256_1001989 3300025299 Bacteria 18379
205 Ga0209256_1002500 3300025299 Bacteria 14836
206 Ga0207426_1001293 3300025302 Bacteria 21613
207 Ga0209257_1000003 3300025304 Bacteria 1702593
208 Ga0207697_10015856 3300025315 Bacteria 3108
209 Ga0207697_10019635 3300025315 Bacteria 2769
210 Ga0207688_10015702 3300025901 Bacteria 4108
211 Ga0207645_10006952 3300025907 Bacteria 8057
212 Ga0207643_10001107 3300025908 Bacteria 15985
213 Ga0207654_10012463 3300025911 Bacteria 4356
214 Ga0207707_10024191 3300025912 Bacteria 5313
215 Ga0207695_10008662 3300025913 Bacteria 12692
216 Ga0207695_10016694 3300025913 Bacteria 8579
217 Ga0207695_10377419 3300025913 Bacteria 1303
218 Ga0207671_10068927 3300025914 Bacteria 2636
219 Ga0207671_10079071 3300025914 Bacteria 2464
220 Ga0207660_10036839 3300025917 Bacteria 3403
221 Ga0207657_10007584 3300025919 Bacteria 11119
222 Ga0207681_10164130 3300025923 Bacteria 1677
223 Ga0207694_10001629 3300025924 Bacteria 18867
224 Ga0207694_10239374 3300025924 Unclassified 1483
225 Ga0207650_10042006 3300025925 Bacteria 3353
226 Ga0207650_10116033 3300025925 Bacteria 2079
227 Ga0207659_10068983 3300025926 Bacteria 2573
228 Ga0207659_10222924 3300025926 Bacteria 1517
229 Ga0207644_10017444 3300025931 Bacteria 4847
230 Ga0207644_10069053 3300025931 Bacteria 2579
231 Ga0207644_10387375 3300025931 Bacteria 1141
232 Ga0207706_10016696 3300025933 Bacteria 6625
233 Ga0207686_10041023 3300025934 Bacteria 2819
234 Ga0207709_10000170 3300025935 Bacteria 87011
235 Ga0207709_10448542 3300025935 Bacteria 997
236 Ga0207670_10072333 3300025936 Bacteria 2387
237 Ga0207669_10041700 3300025937 Bacteria 2674
238 Ga0207669_10084550 3300025937 Bacteria 2045
239 Ga0207704_10114711 3300025938 Bacteria 1829
240 Ga0207691_10017249 3300025940 Bacteria 6848
241 Ga0207711_10002151 3300025941 Bacteria 17750
242 Ga0207711_10020864 3300025941 Bacteria 5468
243 Ga0207711_10174985 3300025941 Bacteria 1949
244 Ga0207689_10000974 3300025942 Bacteria 27470
245 Ga0207689_10011213 3300025942 Bacteria 7691
246 Ga0207689_10142650 3300025942 Bacteria 1973
247 Ga0207679_10099505 3300025945 Bacteria 2271
248 Ga0207679_10171176 3300025945 Bacteria 1788
249 Ga0207667_10000036 3300025949 Bacteria 297966
250 Ga0207667_10003025 3300025949 Bacteria 20864
251 Ga0207667_10349225 3300025949 Bacteria 1509
252 Ga0207667_10431595 3300025949 Bacteria 1340
253 Ga0207667_10433986 3300025949 Bacteria 1336
254 Ga0207651_10122637 3300025960 Bacteria 1974
255 Ga0207651_10248247 3300025960 Bacteria 1454
256 Ga0207668_10123300 3300025972 Bacteria 1966
257 Ga0207640_10056548 3300025981 Bacteria 2576
258 Ga0207640_10081723 3300025981 Bacteria 2210
259 Ga0207658_10157464 3300025986 Bacteria 1858
260 Ga0207677_10026341 3300026023 Bacteria 3645
261 Ga0207703_10200367 3300026035 Bacteria 1774
262 Ga0207639_10032487 3300026041 Bacteria 3842
263 Ga0207708_10002945 3300026075 Bacteria 12557
264 Ga0207702_10256429 3300026078 Bacteria 1645
265 Ga0207641_10230822 3300026088 Bacteria 1720
266 Ga0207648_10016310 3300026089 Bacteria 6791
267 Ga0207648_10307103 3300026089 Bacteria 1423
268 Ga0207676_10029810 3300026095 Bacteria 4089
269 Ga0207674_10075367 3300026116 Bacteria 3384
270 Ga0207674_10078367 3300026116 Bacteria 3309
271 Ga0207674_10080680 3300026116 Bacteria 3256
272 Ga0207675_100036828 3300026118 Bacteria 4563
273 Ga0207675_100062827 3300026118 Bacteria 3469
274 Ga0207683_10003576 3300026121 Bacteria 13558
275 Ga0207683_10019454 3300026121 Bacteria 5798
276 Ga0207698_10212559 3300026142 Bacteria 1741
277 Ga0209281_1000007 3300027111 Bacteria 938265
278 Ga0209969_1000556 3300027360 Bacteria 5017
279 Ga0210000_1011120 3300027462 Bacteria 1332
280 Ga0209995_1003898 3300027471 Bacteria 2381
281 Ga0209282_1000028 3300027666 Bacteria 159466
282 Ga0209588_1004797 3300027671 Bacteria 3837
283 Ga0209588_1011598 3300027671 Bacteria 2664
284 Ga0209813_10005486 3300027866 Bacteria 3083
285 Ga0209974_10002299 3300027876 Bacteria 6942
286 Ga0207428_10009367 3300027907 Bacteria 8784
287 Ga0268266_10072113 3300028379 Bacteria 2994
288 Ga0268266_10290333 3300028379 Bacteria 1523
289 Ga0268266_10424949 3300028379 Bacteria 1260
290 Ga0268265_10025659 3300028380 Bacteria 4187
291 Ga0268265_10193069 3300028380 Bacteria 1760
292 Ga0265318_10016824 3300028577 Bacteria 3013
293 Ga0265330_10007917 3300031235 Bacteria 5149
294 Ga0265332_10000024 3300031238 Bacteria 209663
295 Ga0265332_10005145 3300031238 Bacteria 6057
296 Ga0265328_10000042 3300031239 Bacteria 89241
297 Ga0265328_10000626 3300031239 Bacteria 16367
298 Ga0265328_10033455 3300031239 Bacteria 1906
299 Ga0265328_10086353 3300031239 Bacteria 1158
300 Ga0265320_10112576 3300031240 Bacteria 1246
301 Ga0265329_10007591 3300031242 Bacteria 4182
302 Ga0265331_10000115 3300031250 Bacteria 105212
303 Ga0265331_10015706 3300031250 Bacteria 3991
304 Ga0265327_10000045 3300031251 Bacteria 282880
305 Ga0265327_10000471 3300031251 Bacteria 71254
306 Ga0265327_10001889 3300031251 Bacteria 24237
307 Ga0265327_10003449 3300031251 Bacteria 15063
308 Ga0265327_10009656 3300031251 Bacteria 6922
309 Ga0265316_10029365 3300031344 Bacteria 4523
310 Ga0265316_10116944 3300031344 Bacteria 2016
311 Ga0307408_100006211 3300031548 Bacteria 7935
312 Ga0307408_100299448 3300031548 Bacteria 1346
313 Ga0265314_10008502 3300031711 Bacteria 8776
314 Ga0265314_10009621 3300031711 Bacteria 8142
315 Ga0265342_10088468 3300031712 Bacteria 1778
316 Ga0265342_10093434 3300031712 Bacteria 1722
317 Ga0307516_10096592 3300031730 Bacteria 2775
318 Ga0307412_10028620 3300031911 Bacteria 3488
319 Ga0307412_10062734 3300031911 Bacteria 2504
320 Ga0307412_10338543 3300031911 Bacteria 1203
321 Ga0307409_100186417 3300031995 Bacteria 1842
322 Ga0307416_100053451 3300032002 Bacteria 3240
323 Ga0307416_100250158 3300032002 Bacteria 1724
324 Ga0307414_10026182 3300032004 Bacteria 3750
325 Ga0307414_10349215 3300032004 Bacteria 1269
326 Ga0307411_10034295 3300032005 Bacteria 3157
327 Ga0316583_10001168 3300032133 Bacteria 8592
328 Ga0373950_0032454 3300034818 Bacteria 972
329 Ga0373934_0000570 3300035086 Bacteria 12966
330 Ga0373934_0000979 3300035086 Bacteria 10357
331 Ga0373923_0041834 3300035111 Bacteria 1890
332 Ga0373953_0019485 3300035117 Bacteria 2524
333 Ga0373954_0048064 3300035118 Bacteria 1998
334 Ga0373954_0049526 3300035118 Bacteria 1969
335 Ga0373956_0000668 3300035119 Bacteria 14111
336 Ga0373956_0018855 3300035119 Bacteria 2923
337 Ga0373946_0084791 3300035171 Bacteria 1394
338 Ga0373955_0065946 3300035172 Bacteria 2011
339 Ga0373955_0077317 3300035172 Bacteria 1874
340 Ga0373955_0215845 3300035172 Bacteria 1145
341 Ga0373924_0029925 3300035410 Bacteria 2179
342 Ga0373935_0036800 3300035692 Bacteria 3061
343 Ga0373927_0024467 3300035695 Bacteria 3950
344 Ga0373933_0000312 3300035724 Bacteria 31477
345 Ga0373947_0116830 3300035725 Bacteria 1692
346 Ga0373937_0000096 3300036401 Bacteria 81963
347 Ga0373937_0063375 3300036401 Bacteria 3399
348 Ga0373937_0074010 3300036401 Bacteria 3143
349 Ga0373937_0125903 3300036401 Bacteria 2390
350 Ga0373925_0321237 3300037068 Bacteria 1253
351 Ga0395899_0003631 3300037312 Bacteria 12212
352 Ga0395900_0006730 3300037418 Bacteria 11931
353 Ga0395900_0011176 3300037418 Bacteria 9179
354 Ga0395900_0224553 3300037418 Bacteria 1891
355 Ga0395898_0012245 3300037466 Bacteria 8867
356 Ga0395898_0593602 3300037466 Bacteria 1050
357 Ga0395905_0015722 3300037471 Bacteria 7189
358 Ga0395901_0004717 3300038443 Bacteria 13763
359 Ga0395901_0257640 3300038443 Bacteria 1816
360 Ga0395901_0603104 3300038443 Bacteria 1107
361 Ga0400483_273072 3300039062 Bacteria 1764
362 Ga0436361_0075458 3300039447 Bacteria 23492
363 Ga0436361_0130398 3300039447 Bacteria 1614
364 Ga0436361_0161338 3300039447 Bacteria 23900
365 Ga0436361_0498219 3300039447 Bacteria 1527
366 Ga0439448_0000613 3300042005 Bacteria 8389
367 Ga0451577_0006152 3300042876 Bacteria 12056
368 Ga0451577_0056941 3300042876 Bacteria 3486
369 Ga0451577_0069235 3300042876 Bacteria 3147
370 Ga0451577_0303443 3300042876 Bacteria 1447
371 Ga0466972_0100988 3300044658 Bacteria 1365
372 Ga0453683_0036914 3300044673 Bacteria 3075
373 Ga0466961_0024750 3300044693 Bacteria 3862
374 Ga0453684_0000512 3300044712 Bacteria 150627
375 Ga0466970_0053063 3300044765 Bacteria 2165
376 Ga0451576_0000461 3300045051 Bacteria 92083
377 Ga0451576_0001379 3300045051 Bacteria 41763
378 Ga0451576_0154932 3300045051 Bacteria 2390
379 Ga0451576_0316028 3300045051 Bacteria 1634
380 Ga0495627_000059 3300046453 Bacteria 142466
381 Ga0495592_0010946 3300046454 Bacteria 6845
382 Ga0495629_0129323 3300046459 Bacteria 1759
383 Ga0495641_0007072 3300046461 Bacteria 7104
384 Ga0495651_0000085 3300046462 Bacteria 68214
385 Ga0495651_0003739 3300046462 Bacteria 11646
386 Ga0495653_0004139 3300046463 Bacteria 11734
387 Ga0495580_0071895 3300046472 Bacteria 2416
388 Ga0495605_0020153 3300046474 Bacteria 3547
389 Ga0495639_0079477 3300046475 Bacteria 1525
390 Ga0495664_0015172 3300046477 Bacteria 4377
391 Ga0495594_0035137 3300046499 Bacteria 2729
392 Ga0495596_0003212 3300046500 Bacteria 8398
393 Ga0495606_0021265 3300046507 Bacteria 4755
394 Ga0495610_0006379 3300046512 Bacteria 8135
395 Ga0495616_0003605 3300046513 Bacteria 9894
396 Ga0495628_0010478 3300046516 Bacteria 7873
397 Ga0495628_0107704 3300046516 Bacteria 2145
398 Ga0495628_0121673 3300046516 Bacteria 2001
399 Ga0495630_0170219 3300046517 Bacteria 1659
400 Ga0495666_0060025 3300046526 Bacteria 1818
401 Ga0495642_0021059 3300046528 Bacteria 2563
402 Ga0495652_0011388 3300046529 Bacteria 8044
403 Ga0495652_0109930 3300046529 Bacteria 2218
404 Ga0495586_0135999 3300046535 Bacteria 1377
405 Ga0495587_0047226 3300046536 Bacteria 2553
406 Ga0495609_0039759 3300046538 Bacteria 2117
407 Ga0495645_0004672 3300046543 Bacteria 9347
408 Ga0495667_0038807 3300046559 Bacteria 3171
409 Ga0495634_0025817 3300046642 Bacteria 4103
410 Ga0495588_0036981 3300046674 Bacteria 2479
411 Ga0495657_0003454 3300046675 Bacteria 12887
412 Ga0495599_0019078 3300046678 Bacteria 4275
413 Ga0495599_0053278 3300046678 Bacteria 2534
414 Ga0495647_0007574 3300046681 Bacteria 3643
415 Ga0495658_0036657 3300046683 Bacteria 2707
416 Ga0495613_0021414 3300046689 Bacteria 4819
417 Ga0495624_0048321 3300046690 Bacteria 2701
418 Ga0495671_0004725 3300046692 Bacteria 8049
419 Ga0495600_0001200 3300046809 Bacteria 14187
420 Ga0495636_0002422 3300047318 Bacteria 7152
421 Ga0495680_0105899 3300047322 Bacteria 2090
422 Ga0495680_0254305 3300047322 Bacteria 1244
423 Ga0495681_0087311 3300047470 Bacteria 1383
424 Ga0495684_0008067 3300047471 Bacteria 8144
425 Ga0495615_0037335 3300048090 Bacteria 1196
426 Ga0496100_0136578 3300048903 Bacteria 1733
427 Ga0496106_0175447 3300048909 Bacteria 1700
428 Ga0496108_0065401 3300048911 Bacteria 3065
429 Ga0496108_0070161 3300048911 Bacteria 2957
430 Ga0496110_0466300 3300048913 Bacteria 1151
431 Ga0496112_0007864 3300048915 Bacteria 9494
432 Ga0496112_0197214 3300048915 Bacteria 1974
433 Ga0496114_0084585 3300048917 Bacteria 2686
434 Ga0496114_0358863 3300048917 Bacteria 1289
435 Ga0496116_0005400 3300048919 Bacteria 11889
436 Ga0496116_0039578 3300048919 Bacteria 3258
437 Ga0496118_0013169 3300048921 Bacteria 7848
438 Ga0496118_0100931 3300048921 Bacteria 1950
439 Ga0496119_0009171 3300048922 Bacteria 8547
440 Ga0496120_0010157 3300048923 Bacteria 6592
441 Ga0496121_0000124 3300048924 Bacteria 170427
442 Ga0496121_0062567 3300048924 Bacteria 3047
443 Ga0496121_0176489 3300048924 Bacteria 1546
444 Ga0496122_0000316 3300048925 Bacteria 106100
445 Ga0496124_0000004 3300048927 Bacteria 976131
446 Ga0496124_0010343 3300048927 Bacteria 9465
447 Ga0496124_0020950 3300048927 Bacteria 6030
448 Ga0496125_0000570 3300048928 Bacteria 63252
449 Ga0496125_0180128 3300048928 Bacteria 1409
450 Ga0496126_0037857 3300048929 Bacteria 4494
451 Ga0501307_002280 3300049162 Bacteria 1767
452 Ga0501311_001681 3300049527 Bacteria 1988
453 Ga0501033_0127826 3300049570 Bacteria 1842
454 Ga0501034_0013068 3300049571 Bacteria 8557
455 Ga0501034_0241305 3300049571 Bacteria 1753
456 Ga0501037_0140735 3300049573 Bacteria 1727
457 Ga0501037_0177104 3300049573 Bacteria 1514
458 Ga0501038_0301457 3300049574 Bacteria 1258
459 Ga0501039_0018419 3300049575 Bacteria 5359
460 Ga0501040_0176206 3300049576 Bacteria 1515
461 Ga0501041_0006003 3300049577 Bacteria 7105
462 Ga0501043_0000855 3300049579 Bacteria 26972
463 Ga0501043_0269615 3300049579 Bacteria 1307
464 Ga0501046_0000007 3300049580 Bacteria 356002
465 Ga0501046_0085944 3300049580 Bacteria 2425
466 Ga0501047_0013419 3300049581 Bacteria 7766
467 Ga0501047_0024128 3300049581 Bacteria 5842
468 Ga0501048_0004461 3300049582 Bacteria 10652
469 Ga0501048_0177371 3300049582 Bacteria 1510
470 Ga0501071_0079465 3300049587 Bacteria 2398
471 Ga0501072_0044808 3300049588 Bacteria 3478
472 Ga0501075_0006985 3300049591 Bacteria 7800
473 Ga0501076_0064907 3300049592 Bacteria 2910
474 Ga0501076_0268235 3300049592 Bacteria 1398
475 Ga0501077_0148819 3300049593 Bacteria 1485
476 Ga0501079_0006588 3300049741 Bacteria 8737
477 Ga0501079_0213302 3300049741 Bacteria 1508
478 Ga0501080_0027052 3300049742 Bacteria 5333
479 Ga0501081_0002716 3300049743 Bacteria 11200
480 Ga0501081_0113410 3300049743 Bacteria 1925
481 Ga0501083_0000046 3300049744 Bacteria 88934
482 Ga0501035_0008381 3300049822 Bacteria 9624
483 Ga0501035_0029021 3300049822 Bacteria 5046
484 Ga0501035_0066145 3300049822 Bacteria 3208
485 Ga0501044_0001867 3300049823 Bacteria 24425
486 Ga0501044_0004875 3300049823 Bacteria 14994
487 Ga0501044_0007692 3300049823 Bacteria 11850
488 Ga0501044_0062432 3300049823 Bacteria 3808
489 Ga0501045_0071570 3300049824 Bacteria 2552
490 Ga0501045_0107811 3300049824 Bacteria 2064
491 nmdc:mga03683_43400_c1 3300050489 Bacteria 1855
492 nmdc:mga03n38_12945_c1 3300050490 Bacteria 3156
493 nmdc:mga00v17_1526_c1 3300050491 Bacteria 12076
494 nmdc:mga00v17_191673_c1 3300050491 Bacteria 1320
495 nmdc:mga00v17_37490_c1 3300050491 Bacteria 2896
496 nmdc:mga0yw44_728_c1 3300050492 Bacteria 12120
497 nmdc:mga0k408_8277_c1 3300050493 Bacteria 5580
498 nmdc:mga06z11_46252_c1 3300050494 Bacteria 2205
499 nmdc:mga04h51_524_c1 3300050495 Bacteria 9100
500 nmdc:mga07m45_12364_c1 3300050496 Bacteria 4510
501 nmdc:mga09592_1274_c1 3300050508 Bacteria 13551
502 nmdc:mga09592_184331_c1 3300050508 Bacteria 1806
503 nmdc:mga0qj67_14999_c1 3300050509 Bacteria 5862
504 nmdc:mga0qj67_399746_c1 3300050509 Bacteria 1109
505 nmdc:mga06r32_113877_c1 3300050510 Bacteria 2663
506 nmdc:mga08y16_417295_c1 3300050511 Bacteria 1372
507 nmdc:mga08y16_551_c1 3300050511 Bacteria 34725
508 nmdc:mga08x19_13687_c1 3300050514 Bacteria 4909
509 Ga0495601_0002619 3300053077 Bacteria 10205
510 Ga0495601_0056928 3300053077 Bacteria 2476
511 Ga0495595_0012537 3300053084 Bacteria 3565
512 Ga0495619_0003254 3300053085 Bacteria 10513
513 Ga0500622_0000001 3300053156 Bacteria 657715
514 Ga0500634_0016885 3300053161 Bacteria 3901
515 Ga0500637_0182814 3300053178 Bacteria 1201
516 Ga0590074_018351 3300059423 Bacteria 1196
517 Ga0590077_014556 3300059426 Bacteria 1639
518 Ga0587066_030398 3300059490 Bacteria 959
519 Ga0501082_0001560 3300060353 Bacteria 20176
520 Ga0530510_0098723 3300061734 Bacteria 2135

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0000855 Ga0501043_0000855_7634_8506 247
2 3300049580 Ga0501046_0000007 Ga0501046_0000007_144465_145337 247
3 3300049581 Ga0501047_0013419 Ga0501047_0013419_4726_5598 247
4 3300049582 Ga0501048_0004461 Ga0501048_0004461_3861_4733 247
5 3300049744 Ga0501083_0000046 Ga0501083_0000046_62728_63600 247
6 3300049822 Ga0501035_0008381 Ga0501035_0008381_885_1757 247
7 3300049823 Ga0501044_0062432 Ga0501044_0062432_2355_3227 247
8 3300049824 Ga0501045_0107811 Ga0501045_0107811_711_1583 247
9 3300017792 Ga0163161_10038025 Ga0163161_100380253 249
10 3300049573 Ga0501037_0140735 Ga0501037_0140735_181_1038 261
11 3300049823 Ga0501044_0004875 Ga0501044_0004875_9090_9947 261
12 3300031711 Ga0265314_10009621 Ga0265314_100096212 263
13 3300031712 Ga0265342_10093434 Ga0265342_100934342 263
14 3300048927 Ga0496124_0010343 Ga0496124_0010343_5781_6656 268
15 3300031239 Ga0265328_10000042 Ga0265328_1000004274 269
16 3300031344 Ga0265316_10116944 Ga0265316_101169442 269
17 3300031239 Ga0265328_10000626 Ga0265328_100006267 272
18 3300031250 Ga0265331_10000115 Ga0265331_1000011526 272
19 3300031251 Ga0265327_10000045 Ga0265327_1000004578 272
20 3300044658 Ga0466972_0100988 Ga0466972_0100988_392_1273 272
21 3300031911 Ga0307412_10338543 Ga0307412_103385432 274
22 3300031995 Ga0307409_100186417 Ga0307409_1001864172 274
23 3300032002 Ga0307416_100250158 Ga0307416_1002501582 274
24 3300006844 Ga0075428_100000245 Ga0075428_10000024515 275
25 3300006847 Ga0075431_100197206 Ga0075431_1001972062 275
26 3300006880 Ga0075429_100030290 Ga0075429_1000302902 275
27 3300009094 Ga0111539_10000383 Ga0111539_100003833 275
28 3300009094 Ga0111539_10159164 Ga0111539_101591641 275
29 3300013306 Ga0163162_10045102 Ga0163162_100451025 275
30 3300027907 Ga0207428_10009367 Ga0207428_100093676 275
31 3300048924 Ga0496121_0176489 Ga0496121_0176489_641_1525 275
32 3300050508 nmdc:mga09592_1274_c1 nmdc:mga09592_1274_c1_3441_4280 275
33 3300050511 nmdc:mga08y16_551_c1 nmdc:mga08y16_551_c1_4913_5752 275
34 3300035725 Ga0373947_0116830 Ga0373947_0116830_65_928 276
35 3300005444 Ga0070694_100197072 Ga0070694_1001970722 278
36 3300005545 Ga0070695_100007395 Ga0070695_1000073952 278
37 3300025263 Ga0209565_1023911 Ga0209565_10239111 278
38 3300050511 nmdc:mga08y16_417295_c1 nmdc:mga08y16_417295_c1_446_1294 278
39 iso_pu_bacteria 2887375801 2887379434 278
40 3300003354 JGI25160J50197_1004394 JGI25160J50197_10043942 279
41 3300003771 Ga0055526_1017220 Ga0055526_10172202 279
42 3300003775 Ga0055524_1021989 Ga0055524_10219891 279
43 3300003790 Ga0055528_1013339 Ga0055528_10133394 279
44 3300003791 Ga0055530_10010065 Ga0055530_100100654 279
45 3300014325 Ga0163163_10260928 Ga0163163_102609282 279
46 3300025208 Ga0209436_100479 Ga0209436_1004792 279
47 3300025263 Ga0209565_1000983 Ga0209565_100098316 279
48 3300025284 Ga0209130_1000990 Ga0209130_10009908 279
49 3300025284 Ga0209130_1013661 Ga0209130_10136612 279
50 3300025291 Ga0209675_1000250 Ga0209675_10002508 279
51 3300025295 Ga0209564_1003556 Ga0209564_10035562 279
52 3300025298 Ga0209050_1013802 Ga0209050_10138022 279
53 3300025299 Ga0209256_1002500 Ga0209256_10025008 279
54 3300025302 Ga0207426_1001293 Ga0207426_100129322 279
55 3300025304 Ga0209257_1000003 Ga0209257_1000003287 279
56 3300031548 Ga0307408_100006211 Ga0307408_1000062118 279
57 3300031548 Ga0307408_100299448 Ga0307408_1002994482 279
58 3300032002 Ga0307416_100053451 Ga0307416_1000534512 279
59 3300036401 Ga0373937_0125903 Ga0373937_0125903_774_1631 279
60 3300046517 Ga0495630_0170219 Ga0495630_0170219_759_1616 279
61 3300046559 Ga0495667_0038807 Ga0495667_0038807_464_1321 279
62 3300047322 Ga0495680_0105899 Ga0495680_0105899_483_1340 279
63 3300049162 Ga0501307_002280 Ga0501307_002280_15_929 279
64 3300049527 Ga0501311_001681 Ga0501311_001681_1060_1974 279
65 3300007265 Ga0099794_10026857 Ga0099794_100268573 280
66 3300007265 Ga0099794_10038181 Ga0099794_100381812 280
67 3300027671 Ga0209588_1004797 Ga0209588_10047973 280
68 3300027671 Ga0209588_1011598 Ga0209588_10115982 280
69 3300028379 Ga0268266_10424949 Ga0268266_104249492 280
70 3300021361 Ga0213872_10082680 Ga0213872_100826802 281
71 3300039447 Ga0436361_0130398 Ga0436361_0130398_228_1139 281
72 3300005339 Ga0070660_100001298 Ga0070660_1000012985 282
73 3300005563 Ga0068855_100010957 Ga0068855_1000109574 282
74 3300009545 Ga0105237_10005766 Ga0105237_100057664 282
75 3300010375 Ga0105239_10037494 Ga0105239_100374942 282
76 3300013100 Ga0157373_10004456 Ga0157373_100044562 282
77 3300013105 Ga0157369_10000979 Ga0157369_1000097915 282
78 3300013296 Ga0157374_10000107 Ga0157374_1000010718 282
79 3300013307 Ga0157372_10002854 Ga0157372_100028548 282
80 3300020076 Ga0206355_1291451 Ga0206355_12914511 282
81 3300021361 Ga0213872_10000001 Ga0213872_10000001288 282
82 3300021361 Ga0213872_10015634 Ga0213872_100156341 282
83 3300021361 Ga0213872_10073098 Ga0213872_100730982 282
84 3300025256 Ga0209759_1003925 Ga0209759_10039252 282
85 3300025913 Ga0207695_10016694 Ga0207695_100166943 282
86 3300025914 Ga0207671_10068927 Ga0207671_100689271 282
87 3300025919 Ga0207657_10007584 Ga0207657_100075845 282
88 3300025949 Ga0207667_10003025 Ga0207667_100030254 282
89 3300039447 Ga0436361_0075458 Ga0436361_0075458_15489_16403 282
90 3300039447 Ga0436361_0498219 Ga0436361_0498219_577_1488 282
91 3300042005 Ga0439448_0000613 Ga0439448_0000613_4496_5404 282
92 3300005289 Ga0065704_10171474 Ga0065704_101714741 283
93 3300031251 Ga0265327_10000471 Ga0265327_100004719 283
94 3300006946 Ga0079104_1000025 Ga0079104_10000257 284
95 3300009148 Ga0105243_10000729 Ga0105243_1000072917 284
96 3300034818 Ga0373950_0032454 Ga0373950_0032454_20_886 284
97 3300035172 Ga0373955_0215845 Ga0373955_0215845_157_1053 284
98 3300037068 Ga0373925_0321237 Ga0373925_0321237_316_1212 284
99 3300045051 Ga0451576_0154932 Ga0451576_0154932_1483_2370 284
100 3300050490 nmdc:mga03n38_12945_c1 nmdc:mga03n38_12945_c1_1751_2626 284
101 3300050491 nmdc:mga00v17_37490_c1 nmdc:mga00v17_37490_c1_847_1722 284
102 3300050492 nmdc:mga0yw44_728_c1 nmdc:mga0yw44_728_c1_4187_5062 284
103 3300050494 nmdc:mga06z11_46252_c1 nmdc:mga06z11_46252_c1_1018_1893 284
104 3300050495 nmdc:mga04h51_524_c1 nmdc:mga04h51_524_c1_391_1266 284
105 3300050496 nmdc:mga07m45_12364_c1 nmdc:mga07m45_12364_c1_491_1366 284
106 iso_pu_bacteria 2895511927 2895517532 284
107 3300003215 JGI25153J46596_10002002 JGI25153J46596_100020027 285
108 3300025245 Ga0207425_1000001 Ga0207425_1000001823 285
109 3300025258 Ga0209129_1000003 Ga0209129_1000003823 285
110 3300025297 Ga0209758_1000020 Ga0209758_1000020453 285
111 3300025299 Ga0209256_1001989 Ga0209256_100198919 285
112 3300025935 Ga0207709_10000170 Ga0207709_1000017072 285
113 3300027111 Ga0209281_1000007 Ga0209281_1000007213 285
114 iso_pu_bacteria 2599185292 2599907033 285
115 iso_pu_bacteria 2643221569 2643863237 285
116 iso_pu_bacteria 2643221594 2643978643 285
117 iso_pu_bacteria 2643221621 2644121789 285
118 iso_pu_bacteria 2739367655 2739612664 285
119 iso_pu_bacteria 2808606395 2809036600 285
120 iso_pu_bacteria 2855730933 2855731459 285
121 iso_pu_bacteria 2855767633 2855768165 285
122 iso_pu_bacteria 2857537821 2857541213 285
123 iso_pu_bacteria 2857542790 2857545905 285
124 iso_pu_bacteria 2858950400 2858953882 285
125 iso_pu_bacteria 2881412998 2881413665 285
126 iso_pu_bacteria 2881927736 2881928339 285
127 iso_pu_bacteria 2941479691 2941481086 285
128 iso_pu_bacteria 8002392321 8002394453 285
129 iso_pu_bacteria 8055225921 8055228148 285
130 3300006195 Ga0075366_10008907 Ga0075366_100089076 286
131 3300006846 Ga0075430_100015261 Ga0075430_1000152614 286
132 3300006847 Ga0075431_100003069 Ga0075431_10000306916 286
133 3300048917 Ga0496114_0084585 Ga0496114_0084585_1221_2114 286
134 3300050508 nmdc:mga09592_184331_c1 nmdc:mga09592_184331_c1_539_1441 286
135 3300050509 nmdc:mga0qj67_14999_c1 nmdc:mga0qj67_14999_c1_3350_4252 286
136 3300050510 nmdc:mga06r32_113877_c1 nmdc:mga06r32_113877_c1_176_1078 286
137 iso_pu_bacteria 2526164512 2526213515 286
138 iso_pu_bacteria 2547132512 2548846818 286
139 iso_pu_bacteria 2891633521 2891634579 286
140 iso_pu_bacteria 2894023352 2894026480 286
141 iso_pu_bacteria 639633007 639787056 286
142 3300049592 Ga0501076_0268235 Ga0501076_0268235_126_1040 287
143 3300049743 Ga0501081_0113410 Ga0501081_0113410_631_1545 287
144 iso_pu_bacteria 2513237150 2513955198 287
145 iso_pu_bacteria 2513237165 2514043660 287
146 iso_pu_bacteria 2643221660 2644337636 287
147 iso_pu_bacteria 2721755523 2722882556 287
148 iso_pu_bacteria 2831864461 2831866367 287
149 iso_pu_bacteria 2834641062 2834642737 287
150 iso_pu_bacteria 2839138175 2839141182 287
151 iso_pu_bacteria 2858688981 2858693951 287
152 iso_pu_bacteria 2901300506 2901311273 287
153 iso_pu_bacteria 644736347 644747996 287
154 iso_pu_bacteria 8003400568 8003401514 287
155 3300005518 Ga0070699_100152459 Ga0070699_1001524591 288
156 3300013296 Ga0157374_10000145 Ga0157374_1000014513 288
157 3300031239 Ga0265328_10086353 Ga0265328_100863531 288
158 3300031240 Ga0265320_10112576 Ga0265320_101125762 288
159 3300031251 Ga0265327_10001889 Ga0265327_1000188912 288
160 3300031251 Ga0265327_10003449 Ga0265327_1000344910 288
161 3300031251 Ga0265327_10009656 Ga0265327_100096568 288
162 3300031730 Ga0307516_10096592 Ga0307516_100965923 288
163 3300032004 Ga0307414_10349215 Ga0307414_103492151 288
164 3300035086 Ga0373934_0000979 Ga0373934_0000979_5234_6154 288
165 3300035119 Ga0373956_0000668 Ga0373956_0000668_739_1659 288
166 3300035172 Ga0373955_0065946 Ga0373955_0065946_354_1274 288
167 3300035724 Ga0373933_0000312 Ga0373933_0000312_2492_3412 288
168 3300036401 Ga0373937_0000096 Ga0373937_0000096_29613_30533 288
169 3300039062 Ga0400483_273072 Ga0400483_273072_853_1728 288
170 3300046462 Ga0495651_0000085 Ga0495651_0000085_53542_54462 288
171 3300046674 Ga0495588_0036981 Ga0495588_0036981_423_1298 288
172 3300047322 Ga0495680_0254305 Ga0495680_0254305_68_988 288
173 3300053156 Ga0500622_0000001 Ga0500622_0000001_289891_290766 288
174 iso_pu_bacteria 2643221603 2644027274 288
175 iso_pu_bacteria 2842718218 2842721014 288
176 iso_pu_bacteria 2974320154 2974323927 288
177 3300005328 Ga0070676_10057426 Ga0070676_100574262 289
178 3300005330 Ga0070690_100018947 Ga0070690_1000189473 289
179 3300005331 Ga0070670_100046142 Ga0070670_1000461423 289
180 3300005334 Ga0068869_100003267 Ga0068869_1000032674 289
181 3300005334 Ga0068869_100122415 Ga0068869_1001224152 289
182 3300005334 Ga0068869_100130306 Ga0068869_1001303062 289
183 3300005338 Ga0068868_100013526 Ga0068868_1000135265 289
184 3300005340 Ga0070689_100519148 Ga0070689_1005191481 289
185 3300005354 Ga0070675_100035020 Ga0070675_1000350204 289
186 3300005354 Ga0070675_100161662 Ga0070675_1001616622 289
187 3300005355 Ga0070671_100108894 Ga0070671_1001088942 289
188 3300005356 Ga0070674_100035299 Ga0070674_1000352993 289
189 3300005356 Ga0070674_100060608 Ga0070674_1000606083 289
190 3300005364 Ga0070673_100100428 Ga0070673_1001004283 289
191 3300005364 Ga0070673_100229297 Ga0070673_1002292972 289
192 3300005366 Ga0070659_100324752 Ga0070659_1003247521 289
193 3300005367 Ga0070667_100084285 Ga0070667_1000842851 289
194 3300005367 Ga0070667_100237088 Ga0070667_1002370882 289
195 3300005456 Ga0070678_100014278 Ga0070678_1000142785 289
196 3300005456 Ga0070678_100148987 Ga0070678_1001489871 289
197 3300005458 Ga0070681_10054614 Ga0070681_100546142 289
198 3300005458 Ga0070681_10099387 Ga0070681_100993873 289
199 3300005459 Ga0068867_100332156 Ga0068867_1003321562 289
200 3300005535 Ga0070684_100327803 Ga0070684_1003278032 289
201 3300005539 Ga0068853_100055595 Ga0068853_1000555953 289
202 3300005539 Ga0068853_100314356 Ga0068853_1003143562 289
203 3300005548 Ga0070665_100054543 Ga0070665_1000545432 289
204 3300005548 Ga0070665_100138102 Ga0070665_1001381023 289
205 3300005564 Ga0070664_100015472 Ga0070664_1000154724 289
206 3300005577 Ga0068857_100060442 Ga0068857_1000604423 289
207 3300005614 Ga0068856_100304393 Ga0068856_1003043932 289
208 3300005616 Ga0068852_100079188 Ga0068852_1000791883 289
209 3300005617 Ga0068859_100250726 Ga0068859_1002507262 289
210 3300005618 Ga0068864_100077826 Ga0068864_1000778264 289
211 3300005618 Ga0068864_100150849 Ga0068864_1001508493 289
212 3300005719 Ga0068861_100132738 Ga0068861_1001327381 289
213 3300005719 Ga0068861_100186196 Ga0068861_1001861962 289
214 3300005834 Ga0068851_10006259 Ga0068851_100062595 289
215 3300005841 Ga0068863_100255161 Ga0068863_1002551611 289
216 3300005842 Ga0068858_100043999 Ga0068858_1000439992 289
217 3300005843 Ga0068860_100223993 Ga0068860_1002239932 289
218 3300005844 Ga0068862_100102333 Ga0068862_1001023332 289
219 3300006051 Ga0075364_10003579 Ga0075364_100035798 289
220 3300006051 Ga0075364_10022675 Ga0075364_100226751 289
221 3300006237 Ga0097621_100011505 Ga0097621_1000115054 289
222 3300006237 Ga0097621_100021575 Ga0097621_1000215753 289
223 3300006237 Ga0097621_100359059 Ga0097621_1003590592 289
224 3300006358 Ga0068871_100031771 Ga0068871_1000317713 289
225 3300006358 Ga0068871_100509762 Ga0068871_1005097621 289
226 3300006847 Ga0075431_100174842 Ga0075431_1001748421 289
227 3300006881 Ga0068865_100045835 Ga0068865_1000458352 289
228 3300006931 Ga0097620_100250739 Ga0097620_1002507392 289
229 3300009098 Ga0105245_10220811 Ga0105245_102208111 289
230 3300009101 Ga0105247_10130261 Ga0105247_101302612 289
231 3300009148 Ga0105243_10033164 Ga0105243_100331644 289
232 3300009148 Ga0105243_10079014 Ga0105243_100790143 289
233 3300009174 Ga0105241_10307760 Ga0105241_103077602 289
234 3300009176 Ga0105242_10039525 Ga0105242_100395252 289
235 3300009176 Ga0105242_10196791 Ga0105242_101967912 289
236 3300009177 Ga0105248_10002407 Ga0105248_100024078 289
237 3300009177 Ga0105248_10218927 Ga0105248_102189272 289
238 3300009545 Ga0105237_10025618 Ga0105237_100256186 289
239 3300010375 Ga0105239_10039314 Ga0105239_100393145 289
240 3300011119 Ga0105246_10108932 Ga0105246_101089321 289
241 3300013104 Ga0157370_10213618 Ga0157370_102136182 289
242 3300013105 Ga0157369_10160429 Ga0157369_101604293 289
243 3300013296 Ga0157374_10052521 Ga0157374_100525214 289
244 3300013296 Ga0157374_10259174 Ga0157374_102591742 289
245 3300013297 Ga0157378_10219365 Ga0157378_102193653 289
246 3300013306 Ga0163162_10019867 Ga0163162_100198674 289
247 3300013306 Ga0163162_10078206 Ga0163162_100782064 289
248 3300014326 Ga0157380_10194863 Ga0157380_101948632 289
249 3300014968 Ga0157379_10109018 Ga0157379_101090182 289
250 3300014969 Ga0157376_10062291 Ga0157376_100622913 289
251 3300014969 Ga0157376_10246115 Ga0157376_102461152 289
252 3300025290 Ga0207673_1006146 Ga0207673_10061462 289
253 3300025292 Ga0209676_1003098 Ga0209676_100309810 289
254 3300025294 Ga0209025_1000018 Ga0209025_1000018492 289
255 3300025298 Ga0209050_1001037 Ga0209050_100103730 289
256 3300025315 Ga0207697_10015856 Ga0207697_100158564 289
257 3300025315 Ga0207697_10019635 Ga0207697_100196352 289
258 3300025901 Ga0207688_10015702 Ga0207688_100157023 289
259 3300025907 Ga0207645_10006952 Ga0207645_100069525 289
260 3300025908 Ga0207643_10001107 Ga0207643_1000110715 289
261 3300025911 Ga0207654_10012463 Ga0207654_100124635 289
262 3300025912 Ga0207707_10024191 Ga0207707_100241916 289
263 3300025913 Ga0207695_10377419 Ga0207695_103774192 289
264 3300025917 Ga0207660_10036839 Ga0207660_100368394 289
265 3300025923 Ga0207681_10164130 Ga0207681_101641302 289
266 3300025925 Ga0207650_10042006 Ga0207650_100420062 289
267 3300025926 Ga0207659_10068983 Ga0207659_100689832 289
268 3300025926 Ga0207659_10222924 Ga0207659_102229242 289
269 3300025931 Ga0207644_10017444 Ga0207644_100174442 289
270 3300025931 Ga0207644_10387375 Ga0207644_103873752 289
271 3300025933 Ga0207706_10016696 Ga0207706_100166965 289
272 3300025934 Ga0207686_10041023 Ga0207686_100410233 289
273 3300025935 Ga0207709_10448542 Ga0207709_104485421 289
274 3300025936 Ga0207670_10072333 Ga0207670_100723332 289
275 3300025937 Ga0207669_10041700 Ga0207669_100417002 289
276 3300025938 Ga0207704_10114711 Ga0207704_101147112 289
277 3300025941 Ga0207711_10020864 Ga0207711_100208642 289
278 3300025941 Ga0207711_10174985 Ga0207711_101749852 289
279 3300025942 Ga0207689_10000974 Ga0207689_1000097416 289
280 3300025942 Ga0207689_10011213 Ga0207689_100112134 289
281 3300025942 Ga0207689_10142650 Ga0207689_101426502 289
282 3300025945 Ga0207679_10099505 Ga0207679_100995052 289
283 3300025945 Ga0207679_10171176 Ga0207679_101711761 289
284 3300025960 Ga0207651_10122637 Ga0207651_101226373 289
285 3300025960 Ga0207651_10248247 Ga0207651_102482472 289
286 3300025972 Ga0207668_10123300 Ga0207668_101233003 289
287 3300025981 Ga0207640_10056548 Ga0207640_100565481 289
288 3300025986 Ga0207658_10157464 Ga0207658_101574642 289
289 3300026023 Ga0207677_10026341 Ga0207677_100263413 289
290 3300026035 Ga0207703_10200367 Ga0207703_102003672 289
291 3300026041 Ga0207639_10032487 Ga0207639_100324873 289
292 3300026075 Ga0207708_10002945 Ga0207708_100029454 289
293 3300026078 Ga0207702_10256429 Ga0207702_102564292 289
294 3300026088 Ga0207641_10230822 Ga0207641_102308222 289
295 3300026089 Ga0207648_10016310 Ga0207648_100163104 289
296 3300026089 Ga0207648_10307103 Ga0207648_103071031 289
297 3300026095 Ga0207676_10029810 Ga0207676_100298101 289
298 3300026116 Ga0207674_10075367 Ga0207674_100753672 289
299 3300026116 Ga0207674_10078367 Ga0207674_100783673 289
300 3300026118 Ga0207675_100036828 Ga0207675_1000368282 289
301 3300026118 Ga0207675_100062827 Ga0207675_1000628272 289
302 3300026121 Ga0207683_10003576 Ga0207683_100035763 289
303 3300026121 Ga0207683_10019454 Ga0207683_100194544 289
304 3300026142 Ga0207698_10212559 Ga0207698_102125592 289
305 3300028379 Ga0268266_10072113 Ga0268266_100721134 289
306 3300028379 Ga0268266_10290333 Ga0268266_102903331 289
307 3300028380 Ga0268265_10025659 Ga0268265_100256592 289
308 3300028380 Ga0268265_10193069 Ga0268265_101930691 289
309 3300028577 Ga0265318_10016824 Ga0265318_100168241 289
310 3300031235 Ga0265330_10007917 Ga0265330_100079172 289
311 3300031238 Ga0265332_10005145 Ga0265332_100051454 289
312 3300031239 Ga0265328_10033455 Ga0265328_100334552 289
313 3300031242 Ga0265329_10007591 Ga0265329_100075912 289
314 3300031250 Ga0265331_10015706 Ga0265331_100157064 289
315 3300031344 Ga0265316_10029365 Ga0265316_100293654 289
316 3300031711 Ga0265314_10008502 Ga0265314_100085027 289
317 3300031712 Ga0265342_10088468 Ga0265342_100884681 289
318 3300031911 Ga0307412_10028620 Ga0307412_100286202 289
319 3300032004 Ga0307414_10026182 Ga0307414_100261824 289
320 3300032005 Ga0307411_10034295 Ga0307411_100342954 289
321 3300035172 Ga0373955_0077317 Ga0373955_0077317_12_896 289
322 3300036401 Ga0373937_0074010 Ga0373937_0074010_1174_2058 289
323 3300037418 Ga0395900_0011176 Ga0395900_0011176_312_1202 289
324 3300038443 Ga0395901_0603104 Ga0395901_0603104_87_977 289
325 3300044765 Ga0466970_0053063 Ga0466970_0053063_34_912 289
326 3300046528 Ga0495642_0021059 Ga0495642_0021059_1497_2399 289
327 3300046683 Ga0495658_0036657 Ga0495658_0036657_1620_2522 289
328 3300047470 Ga0495681_0087311 Ga0495681_0087311_73_975 289
329 3300048903 Ga0496100_0136578 Ga0496100_0136578_34_936 289
330 3300048909 Ga0496106_0175447 Ga0496106_0175447_32_934 289
331 3300048911 Ga0496108_0070161 Ga0496108_0070161_1633_2535 289
332 3300048913 Ga0496110_0466300 Ga0496110_0466300_94_996 289
333 3300048915 Ga0496112_0197214 Ga0496112_0197214_400_1299 289
334 3300048917 Ga0496114_0358863 Ga0496114_0358863_370_1272 289
335 3300048919 Ga0496116_0039578 Ga0496116_0039578_1963_2841 289
336 3300048921 Ga0496118_0013169 Ga0496118_0013169_6302_7180 289
337 3300048921 Ga0496118_0100931 Ga0496118_0100931_757_1635 289
338 3300048922 Ga0496119_0009171 Ga0496119_0009171_3725_4603 289
339 3300048923 Ga0496120_0010157 Ga0496120_0010157_4818_5696 289
340 3300048924 Ga0496121_0000124 Ga0496121_0000124_97100_97978 289
341 3300048924 Ga0496121_0062567 Ga0496121_0062567_18_896 289
342 3300048925 Ga0496122_0000316 Ga0496122_0000316_96455_97333 289
343 3300048927 Ga0496124_0000004 Ga0496124_0000004_385749_386627 289
344 3300048927 Ga0496124_0020950 Ga0496124_0020950_2486_3364 289
345 3300048928 Ga0496125_0000570 Ga0496125_0000570_20472_21350 289
346 3300048928 Ga0496125_0180128 Ga0496125_0180128_182_1060 289
347 3300048929 Ga0496126_0037857 Ga0496126_0037857_3546_4424 289
348 3300049570 Ga0501033_0127826 Ga0501033_0127826_74_952 289
349 3300049571 Ga0501034_0241305 Ga0501034_0241305_421_1299 289
350 3300049574 Ga0501038_0301457 Ga0501038_0301457_71_949 289
351 3300049579 Ga0501043_0269615 Ga0501043_0269615_104_982 289
352 3300049581 Ga0501047_0024128 Ga0501047_0024128_308_1186 289
353 3300049822 Ga0501035_0029021 Ga0501035_0029021_1647_2525 289
354 3300049822 Ga0501035_0066145 Ga0501035_0066145_794_1672 289
355 3300049823 Ga0501044_0001867 Ga0501044_0001867_1521_2399 289
356 3300049823 Ga0501044_0007692 Ga0501044_0007692_4544_5422 289
357 3300050491 nmdc:mga00v17_1526_c1 nmdc:mga00v17_1526_c1_1738_2616 289
358 3300050491 nmdc:mga00v17_191673_c1 nmdc:mga00v17_191673_c1_408_1286 289
359 3300003763 Ga0055529_1000977 Ga0055529_10009776 290
360 3300005289 Ga0065704_10107675 Ga0065704_101076752 290
361 3300005444 Ga0070694_100228004 Ga0070694_1002280042 290
362 3300005444 Ga0070694_100276990 Ga0070694_1002769901 290
363 3300005842 Ga0068858_100179395 Ga0068858_1001793952 290
364 3300006846 Ga0075430_100040292 Ga0075430_1000402924 290
365 3300009551 Ga0105238_10115807 Ga0105238_101158072 290
366 3300014968 Ga0157379_10137413 Ga0157379_101374132 290
367 3300025242 Ga0209258_103478 Ga0209258_1034783 290
368 3300025272 Ga0209455_1000515 Ga0209455_100051513 290
369 3300025924 Ga0207694_10239374 Ga0207694_102393741 290
370 3300031238 Ga0265332_10000024 Ga0265332_1000002495 290
371 3300031911 Ga0307412_10062734 Ga0307412_100627342 290
372 3300032133 Ga0316583_10001168 Ga0316583_100011682 290
373 3300042876 Ga0451577_0006152 Ga0451577_0006152_4320_5213 290
374 3300042876 Ga0451577_0056941 Ga0451577_0056941_2494_3387 290
375 3300042876 Ga0451577_0069235 Ga0451577_0069235_896_1783 290
376 3300044673 Ga0453683_0036914 Ga0453683_0036914_823_1716 290
377 3300044712 Ga0453684_0000512 Ga0453684_0000512_5327_6220 290
378 3300045051 Ga0451576_0000461 Ga0451576_0000461_68558_69451 290
379 3300045051 Ga0451576_0001379 Ga0451576_0001379_3222_4115 290
380 3300045051 Ga0451576_0316028 Ga0451576_0316028_530_1420 290
381 3300049573 Ga0501037_0177104 Ga0501037_0177104_371_1261 290
382 3300049575 Ga0501039_0018419 Ga0501039_0018419_3869_4759 290
383 3300049576 Ga0501040_0176206 Ga0501040_0176206_395_1285 290
384 3300049577 Ga0501041_0006003 Ga0501041_0006003_1532_2422 290
385 3300049580 Ga0501046_0085944 Ga0501046_0085944_739_1629 290
386 3300049582 Ga0501048_0177371 Ga0501048_0177371_514_1404 290
387 3300049587 Ga0501071_0079465 Ga0501071_0079465_923_1813 290
388 3300049588 Ga0501072_0044808 Ga0501072_0044808_1095_1985 290
389 3300049591 Ga0501075_0006985 Ga0501075_0006985_6095_6985 290
390 3300049592 Ga0501076_0064907 Ga0501076_0064907_616_1506 290
391 3300049593 Ga0501077_0148819 Ga0501077_0148819_151_1041 290
392 3300049741 Ga0501079_0006588 Ga0501079_0006588_5825_6715 290
393 3300049741 Ga0501079_0213302 Ga0501079_0213302_502_1386 290
394 3300049742 Ga0501080_0027052 Ga0501080_0027052_4123_5013 290
395 3300049743 Ga0501081_0002716 Ga0501081_0002716_5621_6511 290
396 3300049824 Ga0501045_0071570 Ga0501045_0071570_354_1244 290
397 3300050509 nmdc:mga0qj67_399746_c1 nmdc:mga0qj67_399746_c1_107_997 290
398 3300053161 Ga0500634_0016885 Ga0500634_0016885_732_1613 290
399 3300059423 Ga0590074_018351 Ga0590074_018351_97_1011 290
400 3300059426 Ga0590077_014556 Ga0590077_014556_277_1161 290
401 3300060353 Ga0501082_0001560 Ga0501082_0001560_14759_15649 290
402 3300061734 Ga0530510_0098723 Ga0530510_0098723_1030_1920 290
403 iso_pu_bacteria 2511231026 2511386667 290
404 iso_pu_bacteria 2521172590 2521558137 290
405 iso_pu_bacteria 2551306416 2553003262 290
406 iso_pu_bacteria 2765235838 2765569270 290
407 iso_pu_bacteria 2808606386 2808983865 290
408 iso_pu_bacteria 2808606415 2809130925 290
409 iso_pu_bacteria 2808606419 2809150740 290
410 iso_pu_bacteria 2818991449 2819614720 290
411 iso_pu_bacteria 2839094727 2839095844 290
412 iso_pu_bacteria 2852618963 2852622258 290
413 iso_pu_bacteria 2904439833 2904441089 290
414 iso_pu_bacteria 2904530477 2904531968 290
415 iso_pu_bacteria 2904584206 2904587806 290
416 iso_pu_bacteria 2904589729 2904590034 290
417 iso_pu_bacteria 2904601388 2904602578 290
418 iso_pu_bacteria 2919046199 2919046600 290
419 iso_pu_bacteria 2919079590 2919079916 290
420 iso_pu_bacteria 2923510766 2923511385 290
421 iso_pu_bacteria 2928130867 2928131316 290
422 3300003187 JGI25151J46595_10005266 JGI25151J46595_100052667 291
423 3300003187 JGI25151J46595_10006164 JGI25151J46595_100061641 291
424 3300003187 JGI25151J46595_10013369 JGI25151J46595_100133693 291
425 3300003773 Ga0055537_1010233 Ga0055537_10102331 291
426 3300003781 Ga0055536_1000211 Ga0055536_100021142 291
427 3300003784 Ga0055534_1001154 Ga0055534_10011541 291
428 3300005331 Ga0070670_100052950 Ga0070670_1000529504 291
429 3300005355 Ga0070671_100009222 Ga0070671_1000092228 291
430 3300005356 Ga0070674_100062878 Ga0070674_1000628783 291
431 3300005367 Ga0070667_100414150 Ga0070667_1004141502 291
432 3300005543 Ga0070672_100004310 Ga0070672_1000043108 291
433 3300005563 Ga0068855_100516689 Ga0068855_1005166891 291
434 3300006042 Ga0075368_10001014 Ga0075368_100010142 291
435 3300006048 Ga0075363_100003480 Ga0075363_1000034806 291
436 3300006051 Ga0075364_10008637 Ga0075364_100086376 291
437 3300006177 Ga0075362_10011738 Ga0075362_100117383 291
438 3300006178 Ga0075367_10004716 Ga0075367_100047166 291
439 3300006186 Ga0075369_10028077 Ga0075369_100280771 291
440 3300006195 Ga0075366_10003213 Ga0075366_100032134 291
441 3300006353 Ga0075370_10007136 Ga0075370_100071362 291
442 3300006948 Ga0099826_10000012 Ga0099826_10000012131 291
443 3300009011 Ga0105251_10054280 Ga0105251_100542802 291
444 3300009177 Ga0105248_10002249 Ga0105248_1000224919 291
445 3300025263 Ga0209565_1000021 Ga0209565_1000021247 291
446 3300025273 Ga0209673_1011367 Ga0209673_10113672 291
447 3300025291 Ga0209675_1000149 Ga0209675_100014938 291
448 3300025291 Ga0209675_1000722 Ga0209675_10007228 291
449 3300025292 Ga0209676_1000014 Ga0209676_1000014691 291
450 3300025294 Ga0209025_1000115 Ga0209025_100011528 291
451 3300025294 Ga0209025_1000522 Ga0209025_100052213 291
452 3300025294 Ga0209025_1001089 Ga0209025_10010892 291
453 3300025294 Ga0209025_1013887 Ga0209025_10138872 291
454 3300025295 Ga0209564_1003403 Ga0209564_100340310 291
455 3300025295 Ga0209564_1023976 Ga0209564_10239761 291
456 3300025297 Ga0209758_1019907 Ga0209758_10199072 291
457 3300025299 Ga0209256_1000280 Ga0209256_10002809 291
458 3300025299 Ga0209256_1000625 Ga0209256_100062530 291
459 3300025925 Ga0207650_10116033 Ga0207650_101160332 291
460 3300025931 Ga0207644_10069053 Ga0207644_100690533 291
461 3300025937 Ga0207669_10084550 Ga0207669_100845502 291
462 3300025940 Ga0207691_10017249 Ga0207691_100172493 291
463 3300025941 Ga0207711_10002151 Ga0207711_1000215116 291
464 3300025949 Ga0207667_10433986 Ga0207667_104339861 291
465 3300027360 Ga0209969_1000556 Ga0209969_10005563 291
466 3300027462 Ga0210000_1011120 Ga0210000_10111201 291
467 3300027471 Ga0209995_1003898 Ga0209995_10038983 291
468 3300027666 Ga0209282_1000028 Ga0209282_1000028103 291
469 3300027866 Ga0209813_10005486 Ga0209813_100054862 291
470 3300027876 Ga0209974_10002299 Ga0209974_100022992 291
471 3300042876 Ga0451577_0303443 Ga0451577_0303443_185_1084 291
472 3300046474 Ga0495605_0020153 Ga0495605_0020153_2072_2950 291
473 3300046500 Ga0495596_0003212 Ga0495596_0003212_6945_7823 291
474 3300046512 Ga0495610_0006379 Ga0495610_0006379_6673_7551 291
475 3300046513 Ga0495616_0003605 Ga0495616_0003605_570_1448 291
476 3300046538 Ga0495609_0039759 Ga0495609_0039759_651_1529 291
477 3300046692 Ga0495671_0004725 Ga0495671_0004725_598_1476 291
478 3300048911 Ga0496108_0065401 Ga0496108_0065401_1881_2759 291
479 3300048915 Ga0496112_0007864 Ga0496112_0007864_4151_5029 291
480 3300048919 Ga0496116_0005400 Ga0496116_0005400_10412_11290 291
481 3300049571 Ga0501034_0013068 Ga0501034_0013068_704_1582 291
482 3300050489 nmdc:mga03683_43400_c1 nmdc:mga03683_43400_c1_847_1743 291
483 3300050493 nmdc:mga0k408_8277_c1 nmdc:mga0k408_8277_c1_847_1743 291
484 3300053178 Ga0500637_0182814 Ga0500637_0182814_228_1124 291
485 3300003163 Ga0006759J45824_1020768 Ga0006759J45824_10207682 292
486 3300003544 Ga0007417J51691_1011547 Ga0007417J51691_10115472 292
487 3300003574 Ga0007410J51695_1010058 Ga0007410J51695_10100582 292
488 3300003575 Ga0007409J51694_1006129 Ga0007409J51694_10061292 292
489 3300003577 Ga0007416J51690_1010384 Ga0007416J51690_10103842 292
490 3300003693 Ga0032354_1020514 Ga0032354_10205142 292
491 3300005536 Ga0070697_100090031 Ga0070697_1000900313 292
492 3300006914 Ga0075436_100085530 Ga0075436_1000855303 292
493 3300025949 Ga0207667_10349225 Ga0207667_103492252 292
494 3300035118 Ga0373954_0048064 Ga0373954_0048064_83_994 292
495 3300037312 Ga0395899_0003631 Ga0395899_0003631_8792_9673 292
496 3300037418 Ga0395900_0006730 Ga0395900_0006730_6422_7303 292
497 3300037418 Ga0395900_0224553 Ga0395900_0224553_497_1378 292
498 3300037466 Ga0395898_0012245 Ga0395898_0012245_6740_7621 292
499 3300037466 Ga0395898_0593602 Ga0395898_0593602_84_965 292
500 3300037471 Ga0395905_0015722 Ga0395905_0015722_468_1349 292
501 3300038443 Ga0395901_0004717 Ga0395901_0004717_12752_13633 292
502 3300038443 Ga0395901_0257640 Ga0395901_0257640_77_958 292
503 3300046453 Ga0495627_000059 Ga0495627_000059_93535_94488 292
504 3300046507 Ga0495606_0021265 Ga0495606_0021265_529_1410 292
505 3300046516 Ga0495628_0010478 Ga0495628_0010478_3681_4592 292
506 3300046529 Ga0495652_0011388 Ga0495652_0011388_4109_5020 292
507 3300046543 Ga0495645_0004672 Ga0495645_0004672_6058_6969 292
508 3300047318 Ga0495636_0002422 Ga0495636_0002422_2533_3444 292
509 3300048090 Ga0495615_0037335 Ga0495615_0037335_244_1125 292
510 3300050514 nmdc:mga08x19_13687_c1 nmdc:mga08x19_13687_c1_2695_3606 292
511 3300053077 Ga0495601_0056928 Ga0495601_0056928_1047_1958 292
512 3300059490 Ga0587066_030398 Ga0587066_030398_25_906 292
513 3300005295 Ga0065707_10101473 Ga0065707_101014732 293
514 3300005564 Ga0070664_100371872 Ga0070664_1003718721 293
515 3300035086 Ga0373934_0000570 Ga0373934_0000570_734_1648 293
516 3300035111 Ga0373923_0041834 Ga0373923_0041834_739_1653 293
517 3300035117 Ga0373953_0019485 Ga0373953_0019485_1535_2449 293
518 3300035118 Ga0373954_0049526 Ga0373954_0049526_920_1834 293
519 3300035119 Ga0373956_0018855 Ga0373956_0018855_95_1009 293
520 3300035171 Ga0373946_0084791 Ga0373946_0084791_437_1351 293
521 3300035410 Ga0373924_0029925 Ga0373924_0029925_534_1448 293
522 3300035692 Ga0373935_0036800 Ga0373935_0036800_841_1755 293
523 3300035695 Ga0373927_0024467 Ga0373927_0024467_2128_3042 293
524 3300036401 Ga0373937_0063375 Ga0373937_0063375_1765_2679 293
525 3300046454 Ga0495592_0010946 Ga0495592_0010946_5382_6296 293
526 3300046459 Ga0495629_0129323 Ga0495629_0129323_295_1209 293
527 3300046461 Ga0495641_0007072 Ga0495641_0007072_4701_5615 293
528 3300046462 Ga0495651_0003739 Ga0495651_0003739_1968_2882 293
529 3300046463 Ga0495653_0004139 Ga0495653_0004139_2024_2938 293
530 3300046472 Ga0495580_0071895 Ga0495580_0071895_1457_2371 293
531 3300046475 Ga0495639_0079477 Ga0495639_0079477_239_1153 293
532 3300046477 Ga0495664_0015172 Ga0495664_0015172_2550_3464 293
533 3300046499 Ga0495594_0035137 Ga0495594_0035137_1082_1996 293
534 3300046516 Ga0495628_0107704 Ga0495628_0107704_686_1600 293
535 3300046516 Ga0495628_0121673 Ga0495628_0121673_622_1536 293
536 3300046526 Ga0495666_0060025 Ga0495666_0060025_485_1399 293
537 3300046529 Ga0495652_0109930 Ga0495652_0109930_482_1396 293
538 3300046535 Ga0495586_0135999 Ga0495586_0135999_427_1341 293
539 3300046536 Ga0495587_0047226 Ga0495587_0047226_757_1671 293
540 3300046642 Ga0495634_0025817 Ga0495634_0025817_2291_3205 293
541 3300046675 Ga0495657_0003454 Ga0495657_0003454_10764_11678 293
542 3300046678 Ga0495599_0019078 Ga0495599_0019078_1750_2664 293
543 3300046678 Ga0495599_0053278 Ga0495599_0053278_36_950 293
544 3300046681 Ga0495647_0007574 Ga0495647_0007574_1996_2910 293
545 3300046689 Ga0495613_0021414 Ga0495613_0021414_3184_4098 293
546 3300046690 Ga0495624_0048321 Ga0495624_0048321_723_1637 293
547 3300046809 Ga0495600_0001200 Ga0495600_0001200_8626_9540 293
548 3300047471 Ga0495684_0008067 Ga0495684_0008067_5220_6134 293
549 3300053077 Ga0495601_0002619 Ga0495601_0002619_3631_4545 293
550 3300053084 Ga0495595_0012537 Ga0495595_0012537_2034_2948 293
551 3300053085 Ga0495619_0003254 Ga0495619_0003254_7894_8808 293
552 3300002704 JGI25155J39150_1000372 JGI25155J39150_100037213 294
553 3300003751 Ga0055538_1000002 Ga0055538_1000002515 294
554 3300003752 Ga0055539_1000002 Ga0055539_1000002515 294
555 3300003756 Ga0055533_1000004 Ga0055533_1000004515 294
556 3300003759 Ga0055525_1000002 Ga0055525_1000002515 294
557 3300003841 Ga0055541_1000002 Ga0055541_1000002328 294
558 3300005563 Ga0068855_100001340 Ga0068855_1000013402 294
559 3300005578 Ga0068854_100000993 Ga0068854_10000099313 294
560 3300005834 Ga0068851_10126062 Ga0068851_101260621 294
561 3300006946 Ga0079104_1011224 Ga0079104_10112243 294
562 3300009093 Ga0105240_10035080 Ga0105240_100350803 294
563 3300025224 Ga0209784_100002 Ga0209784_100002743 294
564 3300025225 Ga0209566_100003 Ga0209566_100003743 294
565 3300025226 Ga0209674_100004 Ga0209674_100004743 294
566 3300025230 Ga0209563_100006 Ga0209563_100006743 294
567 3300025253 Ga0209677_100003 Ga0209677_100003743 294
568 3300025913 Ga0207695_10008662 Ga0207695_100086628 294
569 3300025914 Ga0207671_10079071 Ga0207671_100790711 294
570 3300025924 Ga0207694_10001629 Ga0207694_100016298 294
571 3300025949 Ga0207667_10000036 Ga0207667_1000003649 294
572 3300025949 Ga0207667_10431595 Ga0207667_104315952 294
573 3300025981 Ga0207640_10081723 Ga0207640_100817231 294
574 3300026116 Ga0207674_10080680 Ga0207674_100806802 294
575 3300039447 Ga0436361_0161338 Ga0436361_0161338_17686_18573 294
576 3300044693 Ga0466961_0024750 Ga0466961_0024750_963_1862 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00889

EF_TS

Elongation factor TS

111

309

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2do6-assembly1.cif.gz_A solution structure of rsgi ruh-065, a uba domain from human cdna 0.9224 7 46
1tfe-assembly1.cif.gz_A-2 dimerization domain of ef-ts from t. thermophilus 0.9027 148 269
2ooa-assembly2.cif.gz_B crystal structure of the uba domain from cbl-b ubiquitin ligase 0.8968 5 43
1z96-assembly1.cif.gz_A crystal structure of the mud1 uba domain 0.8901 7 41
2oob-assembly1.cif.gz_A crystal structure of the uba domain from cbl-b ubiquitin ligase in complex with ubiquitin 0.8893 4 43
ID Description Score Start End Superfamily
1efuD03 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Elongation factor Ts, dimerisation domain 0.9715 150 268 3.30.479.20
af_Q2FZ23_57_146_3.30.479.20 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Elongation factor Ts, dimerisation domain 0.9598 58 143 3.30.479.20
af_Q80X50_30_89_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.937 7 41 1.10.8.10
1efuD03 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Elongation factor Ts, dimerisation domain 0.9336 150 268 3.30.479.20
3k9oA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9269 7 43 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A2T2V3Z7-F1-model_v4 Elongation factor Ts 0.9481 74 270 GO:0003746
GO:0005737
AF-A0A519T5C5-F1-model_v4 deleted 0.9478 171 264
AF-A0A661B9J7-F1-model_v4 Elongation factor Ts (EF-Ts) 0.9452 74 269 GO:0003746
GO:0005737
AF-A0A0R2QW62-F1-model_v4 Elongation factor Ts 0.942 60 270 GO:0003746
GO:0005737
AF-A0A6L7JRV2-F1-model_v4 Elongation factor Ts 0.9402 50 270 GO:0003746
GO:0005737

Feature Viewer

pLDDT pTM Quality
90.74 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map