F464807

General Info

Members Datasets Scaffolds Average Seq Length
570 359 1138 374

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100070931|Ga0070663_1000709312
Length 416
Sequence MTVAAAGIAVKRHAEGEILPLRSFVAGDVMLAPWTGGTGTRHASAVLTIDLEAISRNYRLLAERVGPGVTCAGVVKADAYGLGADRVAPALYRAGCRAFFVAHLDEGLDLQTHLARDVTIYVLNGLPSGSERDCAEAGIIPVLNSREQLEAWSDQARQRGRILPAVVQVDSGMSRLGMSPREVAELSGKDTSVLDIQMVMSHLACADTPEHPANAHQLTAFQALAKRFPAARQSLANSSGIFLGRNYHHDLVRPGAALYGLNPHPAQSNPMLPVVRLTAQVIQTRDVEADAHVGYGWTFRATKPTRLATLAIGYADGLQRAFGNGGAVYFRGRRLAVAGRVSMDSLTVDLGDLPPGMLARGSQVEIIGGHQSLDALAAAAGTIGYEMLTSLGQRYERIYSDEIDVRWTARSGGAVR

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
241 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
247 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
259 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
267 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
268 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
272 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
276 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
284 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
285 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
286 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
287 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
288 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
289 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
290 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
291 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
292 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
293 2643221556 Massilia sp. Root1485 Isolate Unclassified
294 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
295 2643221684 Massilia sp. Root133 Isolate Unclassified
296 2751185800 Brucella pituitosa AA2 Isolate Unclassified
297 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
298 2818991435 Caulobacter henricii 536 Isolate Unclassified
299 2818991436 Collimonas arenae 515 Isolate Unclassified
300 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
301 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
302 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
303 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
304 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
305 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
306 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
307 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
308 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
309 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
310 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
311 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
312 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
313 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
314 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
315 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
316 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
317 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
318 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
319 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
320 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
321 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
322 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
323 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
324 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
325 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
326 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
327 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
328 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
329 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
330 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
331 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
332 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
333 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
334 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
335 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
336 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
337 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
338 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
339 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
340 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
341 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
342 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
343 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
344 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
345 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
346 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
347 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
348 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
349 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
350 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
351 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
352 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
353 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
354 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
355 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
356 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
357 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
358 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
359 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.04
Metatranscriptomes 2.46
Isolates 13.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.81
Nodule 6.84
Rhizoplane 2.63
Rhizosphere 65.44
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100070931 3300005455 Bacteria 2534
2 JGI24741J21665_1000260 3300001915 Bacteria 15816
3 JGI24741J21665_1000419 3300001915 Bacteria 12882
4 JGI24740J21852_10000367 3300001979 Bacteria 19388
5 JGI24740J21852_10014752 3300001979 Bacteria 2872
6 JGI24739J22299_10021453 3300001989 Bacteria 2298
7 JGI24737J22298_10052345 3300001990 Bacteria 1238
8 JGI24735J21928_10007699 3300002067 Bacteria 3503
9 JGI24738J21930_10001501 3300002075 Bacteria 6465
10 JGI25162J39368_1000023 3300002737 Bacteria 236658
11 Ga0006765J45826_110238 3300003161 Bacteria 1601
12 Ga0006778J45830_1020868 3300003162 Bacteria 3144
13 Ga0006759J45824_1015261 3300003163 Bacteria 2302
14 JGI25151J46595_10035708 3300003187 Unclassified 1884
15 JGI25165J46597_1000030 3300003214 Bacteria 305254
16 JGI25153J46596_10039803 3300003215 Bacteria 1465
17 Ga0006770J48903_1032935 3300003305 Bacteria 1976
18 Ga0006777J48905_1023824 3300003308 Bacteria 2136
19 rootL2_10033365 3300003322 Bacteria 4811
20 Ga0007417J51691_1011869 3300003544 Bacteria 2113
21 Ga0007410J51695_1009390 3300003574 Bacteria 3901
22 Ga0007410J51695_1014429 3300003574 Bacteria 2353
23 Ga0007416J51690_1008920 3300003577 Bacteria 2141
24 Ga0007416J51690_1018576 3300003577 Bacteria 2880
25 Ga0007416J51690_1024555 3300003577 Bacteria 1246
26 Ga0007429J51699_1028792 3300003579 Bacteria 2795
27 Ga0032354_1007554 3300003693 Bacteria 2758
28 Ga0032354_1019704 3300003693 Bacteria 3664
29 Ga0055538_1000017 3300003751 Bacteria 305254
30 Ga0055539_1000022 3300003752 Bacteria 305254
31 Ga0055533_1000030 3300003756 Bacteria 305254
32 Ga0055525_1000008 3300003759 Bacteria 604287
33 Ga0055525_1000034 3300003759 Bacteria 305254
34 Ga0055534_1009225 3300003784 Bacteria 2162
35 Ga0055541_1000015 3300003841 Bacteria 305254
36 Ga0065165_1014489 3300005262 Bacteria 3059
37 Ga0065704_10002162 3300005289 Bacteria 5738
38 Ga0070658_10084785 3300005327 Bacteria 2605
39 Ga0070670_100006633 3300005331 Bacteria 9812
40 Ga0070660_100074145 3300005339 Bacteria 2662
41 Ga0070660_100237871 3300005339 Bacteria 1482
42 Ga0070661_100042881 3300005344 Bacteria 3304
43 Ga0070661_100055517 3300005344 Bacteria 2900
44 Ga0070661_100059034 3300005344 Bacteria 2812
45 Ga0070671_100002581 3300005355 Bacteria 14035
46 Ga0070659_100008470 3300005366 Bacteria 7514
47 Ga0070667_100003584 3300005367 Bacteria 13215
48 Ga0070663_100001722 3300005455 Bacteria 12136
49 Ga0070663_100270009 3300005455 Bacteria 1352
50 Ga0070684_100172668 3300005535 Bacteria 1964
51 Ga0068853_100001039 3300005539 Bacteria 19609
52 Ga0068853_100046985 3300005539 Bacteria 3704
53 Ga0070665_100000927 3300005548 Bacteria 37571
54 Ga0070665_100008868 3300005548 Bacteria 10182
55 Ga0070665_100011097 3300005548 Bacteria 9102
56 Ga0068855_100000165 3300005563 Bacteria 85018
57 Ga0068855_100013735 3300005563 Bacteria 9761
58 Ga0068855_100037456 3300005563 Bacteria 5766
59 Ga0068855_100125837 3300005563 Bacteria 2930
60 Ga0070664_100008914 3300005564 Bacteria 8130
61 Ga0070664_100010691 3300005564 Bacteria 7441
62 Ga0070664_100139180 3300005564 Bacteria 2136
63 Ga0068857_100001505 3300005577 Bacteria 18584
64 Ga0068857_100262820 3300005577 Bacteria 1584
65 Ga0068856_100262344 3300005614 Bacteria 1743
66 Ga0068852_100002547 3300005616 Bacteria 12557
67 Ga0068859_100083338 3300005617 Bacteria 3240
68 Ga0068864_100007096 3300005618 Bacteria 9200
69 Ga0068863_100004007 3300005841 Bacteria 14541
70 Ga0068863_100006004 3300005841 Bacteria 11910
71 Ga0068858_100001747 3300005842 Bacteria 22173
72 Ga0068858_100271511 3300005842 Bacteria 1614
73 Ga0075365_10006738 3300006038 Bacteria 6354
74 Ga0075369_10054291 3300006186 Bacteria 1740
75 Ga0075369_10082362 3300006186 Bacteria 1428
76 Ga0075366_10030923 3300006195 Bacteria 3149
77 Ga0068871_100114981 3300006358 Bacteria 2267
78 Ga0075430_100017802 3300006846 Bacteria 6049
79 Ga0075430_100064109 3300006846 Bacteria 3086
80 Ga0075429_100012542 3300006880 Bacteria 7354
81 Ga0097620_100083346 3300006931 Bacteria 3240
82 Ga0105244_10035551 3300009036 Bacteria 2617
83 Ga0105240_10433822 3300009093 Bacteria 1474
84 Ga0105245_10013465 3300009098 Bacteria 7124
85 Ga0105241_10137254 3300009174 Bacteria 1987
86 Ga0105242_10130978 3300009176 Bacteria 2165
87 Ga0105248_10014264 3300009177 Bacteria 8747
88 Ga0105249_10230353 3300009553 Bacteria 1827
89 Ga0105239_10287338 3300010375 Bacteria 1852
90 Ga0105246_10010241 3300011119 Bacteria 5791
91 Ga0157373_10007598 3300013100 Bacteria 8058
92 Ga0157373_10148746 3300013100 Bacteria 1648
93 Ga0157370_10234319 3300013104 Bacteria 1699
94 Ga0157369_10000454 3300013105 Bacteria 54339
95 Ga0157374_10002222 3300013296 Bacteria 16365
96 Ga0157374_10051713 3300013296 Bacteria 3824
97 Ga0157375_10024501 3300013308 Bacteria 5586
98 Ga0182008_10000245 3300014497 Bacteria 42026
99 Ga0157379_10235838 3300014968 Bacteria 1659
100 Ga0157376_10323459 3300014969 Bacteria 1467
101 Ga0157376_10356168 3300014969 Bacteria 1402
102 Ga0182006_1000002 3300015261 Bacteria 887990
103 Ga0182006_1013052 3300015261 Bacteria 3617
104 Ga0182007_10000085 3300015262 Bacteria 70105
105 Ga0182005_1000002 3300015265 Bacteria 908499
106 Ga0182005_1000510 3300015265 Bacteria 19866
107 Ga0163161_10011348 3300017792 Bacteria 6177
108 Ga0163161_10035548 3300017792 Bacteria 3567
109 Ga0163161_10175728 3300017792 Bacteria 1639
110 Ga0209784_100034 3300025224 Bacteria 305504
111 Ga0209566_100038 3300025225 Bacteria 305504
112 Ga0209674_100056 3300025226 Bacteria 305504
113 Ga0209563_100003 3300025230 Bacteria 1932942
114 Ga0209563_100057 3300025230 Bacteria 305604
115 Ga0207427_100856 3300025231 Bacteria 13520
116 Ga0209437_100071 3300025233 Bacteria 305604
117 Ga0209677_100035 3300025253 Bacteria 305504
118 Ga0209148_1001190 3300025254 Bacteria 14889
119 Ga0209233_1000094 3300025261 Bacteria 305604
120 Ga0209675_1000327 3300025291 Bacteria 41873
121 Ga0209025_1000718 3300025294 Bacteria 56292
122 Ga0209564_1000904 3300025295 Bacteria 38851
123 Ga0209758_1001538 3300025297 Bacteria 26527
124 Ga0207655_1055289 3300025728 Bacteria 1572
125 Ga0207680_10041120 3300025903 Bacteria 2695
126 Ga0207647_10087987 3300025904 Bacteria 1855
127 Ga0207671_10031186 3300025914 Bacteria 3972
128 Ga0207671_10209230 3300025914 Bacteria 1525
129 Ga0207657_10025883 3300025919 Bacteria 5403
130 Ga0207649_10045722 3300025920 Bacteria 2685
131 Ga0207650_10053055 3300025925 Bacteria 3005
132 Ga0207706_10057966 3300025933 Bacteria 3412
133 Ga0207686_10180008 3300025934 Bacteria 1498
134 Ga0207679_10010981 3300025945 Bacteria 5844
135 Ga0207667_10000102 3300025949 Bacteria 137469
136 Ga0207667_10027752 3300025949 Bacteria 6157
137 Ga0207640_10150762 3300025981 Bacteria 1708
138 Ga0207658_10108525 3300025986 Bacteria 2189
139 Ga0207639_10000172 3300026041 Bacteria 50146
140 Ga0207639_10000862 3300026041 Bacteria 20567
141 Ga0207678_10002803 3300026067 Bacteria 15819
142 Ga0207678_10228110 3300026067 Bacteria 1594
143 Ga0207678_10364918 3300026067 Bacteria 1247
144 Ga0207702_10001274 3300026078 Bacteria 25302
145 Ga0207702_10001506 3300026078 Bacteria 23033
146 Ga0207702_10362263 3300026078 Bacteria 1390
147 Ga0207641_10030848 3300026088 Bacteria 4442
148 Ga0207674_10002930 3300026116 Bacteria 21206
149 Ga0207674_10213527 3300026116 Bacteria 1878
150 Ga0207698_10005652 3300026142 Bacteria 7742
151 Ga0207698_10078006 3300026142 Bacteria 2658
152 Ga0207428_10087142 3300027907 Bacteria 2429
153 Ga0268266_10005842 3300028379 Bacteria 11386
154 Ga0268266_10026341 3300028379 Bacteria 4947
155 Ga0268264_10258314 3300028381 Bacteria 1621
156 Ga0307515_10096394 3300028794 Bacteria 3628
157 Ga0307405_10000797 3300031731 Bacteria 12360
158 Ga0307405_10033612 3300031731 Bacteria 3043
159 Ga0307413_10053665 3300031824 Bacteria 2441
160 Ga0307412_10172932 3300031911 Bacteria 1616
161 Ga0307409_100050064 3300031995 Bacteria 3188
162 Ga0307416_100006045 3300032002 Bacteria 7534
163 Ga0307416_100034262 3300032002 Bacteria 3862
164 Ga0307414_10000811 3300032004 Bacteria 15938
165 Ga0307414_10001083 3300032004 Bacteria 13923
166 Ga0307411_10059708 3300032005 Bacteria 2529
167 Ga0395899_0000611 3300037312 Bacteria 37215
168 Ga0395899_0001045 3300037312 Bacteria 25131
169 Ga0395899_0001645 3300037312 Bacteria 18655
170 Ga0395899_0001913 3300037312 Bacteria 17173
171 Ga0395899_0002844 3300037312 Bacteria 13933
172 Ga0395899_0006861 3300037312 Bacteria 8819
173 Ga0395899_0024620 3300037312 Bacteria 4549
174 Ga0395899_0110444 3300037312 Bacteria 1977
175 Ga0395900_0000065 3300037418 Bacteria 196327
176 Ga0395900_0001188 3300037418 Bacteria 32276
177 Ga0395900_0003753 3300037418 Bacteria 16318
178 Ga0395900_0029650 3300037418 Bacteria 5613
179 Ga0395900_0038860 3300037418 Bacteria 4905
180 Ga0395900_0079373 3300037418 Bacteria 3372
181 Ga0395900_0121501 3300037418 Bacteria 2679
182 Ga0395900_0135831 3300037418 Bacteria 2519
183 Ga0395900_0168018 3300037418 Bacteria 2234
184 Ga0395900_0386474 3300037418 Bacteria 1366
185 Ga0395900_0427393 3300037418 Bacteria 1284
186 Ga0395898_0002178 3300037466 Bacteria 23964
187 Ga0395898_0052348 3300037466 Bacteria 3988
188 Ga0395898_0063613 3300037466 Bacteria 3580
189 Ga0395898_0146441 3300037466 Bacteria 2260
190 Ga0395898_0147897 3300037466 Bacteria 2248
191 Ga0395898_0199890 3300037466 Bacteria 1908
192 Ga0395905_0009767 3300037471 Bacteria 9358
193 Ga0395905_0009921 3300037471 Bacteria 9279
194 Ga0395905_0044930 3300037471 Bacteria 4144
195 Ga0395905_0079883 3300037471 Bacteria 3065
196 Ga0395905_0205777 3300037471 Bacteria 1844
197 Ga0395905_0219066 3300037471 Bacteria 1781
198 Ga0395905_0247987 3300037471 Bacteria 1663
199 Ga0395901_0000639 3300038443 Bacteria 40528
200 Ga0395901_0001168 3300038443 Bacteria 27890
201 Ga0395901_0026367 3300038443 Bacteria 5966
202 Ga0395901_0087254 3300038443 Bacteria 3262
203 Ga0395901_0088362 3300038443 Bacteria 3241
204 Ga0395901_0146006 3300038443 Bacteria 2486
205 Ga0395901_0151420 3300038443 Bacteria 2437
206 Ga0395901_0162969 3300038443 Bacteria 2341
207 Ga0395901_0173338 3300038443 Bacteria 2263
208 Ga0237819_00294 3300038705 Bacteria 18381
209 Ga0436360_0133011 3300039438 Bacteria 1791
210 Ga0436360_0276241 3300039438 Bacteria 2196
211 Ga0436360_0592760 3300039438 Bacteria 1696
212 Ga0436361_0680047 3300039447 Bacteria 1583
213 Ga0436361_0782000 3300039447 Bacteria 3539
214 Ga0436361_0958713 3300039447 Bacteria 3392
215 Ga0436361_0997150 3300039447 Bacteria 20731
216 Ga0439465_0011183 3300041413 Bacteria 2816
217 Ga0451807_2630938 3300041486 Bacteria 2818
218 Ga0451843_1375105 3300041509 Bacteria 4595
219 Ga0439448_0000958 3300042005 Bacteria 7126
220 Ga0439450_005353 3300042008 Bacteria 2252
221 Ga0439450_014675 3300042008 Bacteria 1592
222 Ga0439458_0007464 3300042157 Bacteria 2435
223 Ga0451577_0046403 3300042876 Bacteria 3887
224 Ga0466972_0000360 3300044658 Bacteria 24585
225 Ga0466972_0007306 3300044658 Bacteria 5546
226 Ga0466972_0022679 3300044658 Bacteria 3124
227 Ga0466972_0027029 3300044658 Bacteria 2841
228 Ga0466965_0014090 3300044683 Bacteria 3782
229 Ga0466966_0003020 3300044684 Bacteria 11101
230 Ga0466966_0007250 3300044684 Bacteria 7352
231 Ga0466964_0001175 3300044706 Bacteria 8845
232 Ga0466964_0016570 3300044706 Bacteria 2815
233 Ga0466964_0025539 3300044706 Bacteria 2307
234 Ga0466964_0029681 3300044706 Bacteria 2160
235 Ga0466964_0045855 3300044706 Bacteria 1780
236 Ga0453684_0002679 3300044712 Bacteria 42376
237 Ga0466968_0005763 3300044735 Bacteria 4647
238 Ga0466968_0011790 3300044735 Bacteria 3409
239 Ga0466968_0011965 3300044735 Bacteria 3388
240 Ga0466968_0059125 3300044735 Bacteria 1650
241 Ga0466970_0038393 3300044765 Bacteria 2540
242 Ga0466957_0000075 3300044842 Bacteria 38931
243 Ga0466957_0022510 3300044842 Bacteria 3719
244 Ga0466959_0018360 3300045049 Bacteria 5134
245 Ga0466959_0032797 3300045049 Bacteria 3844
246 Ga0466959_0059294 3300045049 Bacteria 2787
247 Ga0451576_0009832 3300045051 Bacteria 11053
248 Ga0495617_004157 3300046452 Bacteria 5304
249 Ga0495627_000997 3300046453 Bacteria 19039
250 Ga0495592_0008029 3300046454 Bacteria 7924
251 Ga0495590_0001969 3300046457 Bacteria 8658
252 Ga0495590_0022312 3300046457 Bacteria 2239
253 Ga0495638_0034096 3300046460 Bacteria 3251
254 Ga0495638_0103587 3300046460 Bacteria 1698
255 Ga0495651_0008679 3300046462 Bacteria 7798
256 Ga0495651_0047640 3300046462 Bacteria 3312
257 Ga0495653_0132489 3300046463 Bacteria 1762
258 Ga0495650_0007760 3300046471 Bacteria 6384
259 Ga0495605_0000160 3300046474 Bacteria 86202
260 Ga0495605_0003001 3300046474 Bacteria 10192
261 Ga0495605_0059261 3300046474 Bacteria 1839
262 Ga0495584_0000390 3300046491 Bacteria 30206
263 Ga0495607_0002570 3300046501 Bacteria 14663
264 Ga0495607_0002908 3300046501 Bacteria 13508
265 Ga0495607_0010437 3300046501 Bacteria 6244
266 Ga0495607_0011676 3300046501 Bacteria 5833
267 Ga0495607_0055842 3300046501 Bacteria 2269
268 Ga0495607_0059626 3300046501 Bacteria 2176
269 Ga0495606_0000015 3300046507 Bacteria 288808
270 Ga0495606_0002709 3300046507 Bacteria 19972
271 Ga0495606_0025445 3300046507 Bacteria 4238
272 Ga0495606_0097112 3300046507 Bacteria 1801
273 Ga0495608_0005101 3300046511 Bacteria 9380
274 Ga0495610_0000034 3300046512 Bacteria 201408
275 Ga0495610_0028111 3300046512 Bacteria 2979
276 Ga0495616_0002266 3300046513 Bacteria 12867
277 Ga0495616_0047147 3300046513 Bacteria 2171
278 Ga0495618_0004649 3300046514 Bacteria 8402
279 Ga0495620_0021068 3300046515 Bacteria 3171
280 Ga0495628_0003140 3300046516 Bacteria 14828
281 Ga0495628_0004352 3300046516 Bacteria 12563
282 Ga0495628_0089965 3300046516 Bacteria 2376
283 Ga0495632_0005457 3300046519 Bacteria 8404
284 Ga0495637_0003352 3300046520 Bacteria 8520
285 Ga0495643_0000552 3300046522 Bacteria 46298
286 Ga0495643_0008044 3300046522 Bacteria 6722
287 Ga0495643_0012127 3300046522 Bacteria 5210
288 Ga0495643_0038432 3300046522 Bacteria 2621
289 Ga0495648_0001544 3300046524 Bacteria 22488
290 Ga0495642_0001857 3300046528 Bacteria 9016
291 Ga0495652_0066761 3300046529 Bacteria 3017
292 Ga0495654_0010220 3300046530 Bacteria 5114
293 Ga0495654_0035216 3300046530 Bacteria 2523
294 Ga0495609_0000445 3300046538 Bacteria 34051
295 Ga0495645_0009925 3300046543 Bacteria 6663
296 Ga0495645_0025971 3300046543 Bacteria 4252
297 Ga0495622_0012410 3300046557 Bacteria 3945
298 Ga0495622_0017469 3300046557 Bacteria 3340
299 Ga0495622_0027224 3300046557 Bacteria 2668
300 Ga0495633_0000711 3300046558 Bacteria 30230
301 Ga0495625_0039830 3300046660 Bacteria 3429
302 Ga0495661_0001097 3300046665 Bacteria 23749
303 Ga0495661_0001236 3300046665 Bacteria 22115
304 Ga0495661_0003616 3300046665 Bacteria 11388
305 Ga0495661_0007134 3300046665 Bacteria 7801
306 Ga0495661_0013687 3300046665 Bacteria 5446
307 Ga0495588_0000052 3300046674 Bacteria 304493
308 Ga0495657_0042999 3300046675 Bacteria 3082
309 Ga0495599_0003817 3300046678 Bacteria 8846
310 Ga0495623_0020353 3300046679 Bacteria 4288
311 Ga0495624_0050935 3300046690 Bacteria 2622
312 Ga0495670_0019283 3300046691 Bacteria 3360
313 Ga0495671_0024825 3300046692 Bacteria 3118
314 Ga0495649_0144317 3300046694 Bacteria 1252
315 Ga0495589_0000058 3300046794 Bacteria 107640
316 Ga0495589_0001047 3300046794 Bacteria 16678
317 Ga0495600_0033868 3300046809 Bacteria 3316
318 Ga0495660_0000050 3300046810 Bacteria 140329
319 Ga0495660_0025808 3300046810 Bacteria 3335
320 Ga0495604_0006330 3300047317 Bacteria 9389
321 Ga0495672_0000060 3300047320 Bacteria 214547
322 Ga0495672_0006470 3300047320 Bacteria 9062
323 Ga0495687_000003 3300047443 Bacteria 859509
324 Ga0495687_000073 3300047443 Bacteria 155429
325 Ga0495687_000489 3300047443 Bacteria 47669
326 Ga0495687_044756 3300047443 Bacteria 1921
327 Ga0495677_0000144 3300047445 Bacteria 34126
328 Ga0495677_0006075 3300047445 Bacteria 4564
329 Ga0495673_0000204 3300047469 Bacteria 89887
330 Ga0495681_0000058 3300047470 Bacteria 103041
331 Ga0495681_0001199 3300047470 Bacteria 19723
332 Ga0495686_0000051 3300047472 Bacteria 263489
333 Ga0495686_0000573 3300047472 Bacteria 52364
334 Ga0495686_0001671 3300047472 Bacteria 23058
335 Ga0495602_0129347 3300048088 Bacteria 2016
336 Ga0495615_0000046 3300048090 Bacteria 41047
337 Ga0495626_0000066 3300048091 Bacteria 141280
338 Ga0495626_0000145 3300048091 Bacteria 89603
339 Ga0495626_0016842 3300048091 Bacteria 3703
340 Ga0495626_0072257 3300048091 Bacteria 1548
341 Ga0496101_0052496 3300048904 Bacteria 2940
342 Ga0496102_0000315 3300048905 Bacteria 60883
343 Ga0496102_0091726 3300048905 Bacteria 2812
344 Ga0496103_0000993 3300048906 Bacteria 19978
345 Ga0496103_0198464 3300048906 Bacteria 1290
346 Ga0496108_0001356 3300048911 Bacteria 19238
347 Ga0496109_0276196 3300048912 Bacteria 1583
348 Ga0496110_0017163 3300048913 Bacteria 6052
349 Ga0496110_0095948 3300048913 Bacteria 2657
350 Ga0496111_0113171 3300048914 Bacteria 1999
351 Ga0496113_0007646 3300048916 Bacteria 6974
352 Ga0496114_0000732 3300048917 Bacteria 24476
353 Ga0496116_0005871 3300048919 Bacteria 11279
354 Ga0496116_0013744 3300048919 Bacteria 6507
355 Ga0496116_0114901 3300048919 Bacteria 1571
356 Ga0496117_0000001 3300048920 Bacteria 2526244
357 Ga0496117_0000484 3300048920 Bacteria 65863
358 Ga0496118_0000002 3300048921 Bacteria 1690764
359 Ga0496118_0000486 3300048921 Bacteria 65791
360 Ga0496118_0035701 3300048921 Bacteria 4032
361 Ga0496118_0125353 3300048921 Bacteria 1664
362 Ga0496118_0159930 3300048921 Bacteria 1394
363 Ga0496119_0089097 3300048922 Bacteria 1757
364 Ga0496120_0001456 3300048923 Bacteria 28320
365 Ga0496120_0025297 3300048923 Bacteria 3687
366 Ga0496120_0092559 3300048923 Bacteria 1612
367 Ga0496121_0000065 3300048924 Bacteria 269310
368 Ga0496121_0001005 3300048924 Bacteria 50368
369 Ga0496121_0015782 3300048924 Bacteria 7867
370 Ga0496121_0055011 3300048924 Bacteria 3319
371 Ga0496121_0061810 3300048924 Bacteria 3071
372 Ga0496121_0074390 3300048924 Bacteria 2718
373 Ga0496122_0002401 3300048925 Bacteria 26723
374 Ga0496122_0005248 3300048925 Bacteria 15531
375 Ga0496122_0006637 3300048925 Bacteria 13197
376 Ga0496122_0017991 3300048925 Bacteria 6557
377 Ga0496122_0055659 3300048925 Bacteria 2956
378 Ga0496123_0001631 3300048926 Bacteria 30231
379 Ga0496123_0001840 3300048926 Bacteria 27847
380 Ga0496123_0010024 3300048926 Bacteria 8440
381 Ga0496123_0015195 3300048926 Bacteria 6332
382 Ga0496124_0000091 3300048927 Bacteria 189706
383 Ga0496124_0002145 3300048927 Bacteria 26496
384 Ga0496124_0005692 3300048927 Bacteria 13887
385 Ga0496124_0063422 3300048927 Bacteria 3087
386 Ga0496124_0092560 3300048927 Bacteria 2462
387 Ga0496124_0134262 3300048927 Bacteria 1962
388 Ga0496125_0009340 3300048928 Bacteria 10102
389 Ga0496125_0020498 3300048928 Bacteria 6204
390 Ga0496125_0022434 3300048928 Bacteria 5863
391 Ga0496125_0043939 3300048928 Bacteria 3786
392 Ga0496125_0118063 3300048928 Bacteria 1901
393 Ga0496125_0140072 3300048928 Bacteria 1683
394 Ga0496125_0272524 3300048928 Bacteria 1053
395 Ga0496126_0023730 3300048929 Bacteria 5939
396 Ga0495678_049617 3300049459 Bacteria 1630
397 Ga0495682_0011423 3300049460 Bacteria 3416
398 Ga0501031_0000011 3300049568 Bacteria 142761
399 Ga0501031_0042119 3300049568 Bacteria 2981
400 Ga0501032_0000006 3300049569 Bacteria 261727
401 Ga0501032_0000709 3300049569 Bacteria 27160
402 Ga0501032_0058310 3300049569 Bacteria 2592
403 Ga0501033_0000039 3300049570 Bacteria 142732
404 Ga0501033_0001176 3300049570 Bacteria 23604
405 Ga0501033_0022985 3300049570 Bacteria 4700
406 Ga0501034_0000030 3300049571 Bacteria 248180
407 Ga0501034_0000249 3300049571 Bacteria 99562
408 Ga0501034_0002073 3300049571 Bacteria 25028
409 Ga0501036_0000003 3300049572 Bacteria 261545
410 Ga0501036_0007299 3300049572 Bacteria 9002
411 Ga0501037_0000003 3300049573 Bacteria 261548
412 Ga0501037_0000397 3300049573 Bacteria 36172
413 Ga0501038_0000004 3300049574 Bacteria 261289
414 Ga0501038_0000600 3300049574 Bacteria 31954
415 Ga0501039_0000008 3300049575 Bacteria 274778
416 Ga0501039_0000027 3300049575 Bacteria 150215
417 Ga0501039_0133217 3300049575 Bacteria 1951
418 Ga0501040_0028066 3300049576 Bacteria 3792
419 Ga0501043_0000047 3300049579 Bacteria 110659
420 Ga0501043_0002417 3300049579 Bacteria 15803
421 Ga0501046_0105576 3300049580 Bacteria 2157
422 Ga0501047_0009317 3300049581 Bacteria 9271
423 Ga0501070_0011330 3300049586 Bacteria 7534
424 Ga0501208_000284 3300049655 Bacteria 3729
425 Ga0501223_000029 3300049663 Bacteria 51244
426 Ga0501223_006205 3300049663 Bacteria 2481
427 Ga0501224_001692 3300049664 Bacteria 2958
428 Ga0501227_003707 3300049665 Bacteria 3308
429 Ga0501235_004256 3300049669 Bacteria 3101
430 Ga0501246_000084 3300049676 Bacteria 5360
431 Ga0501249_000808 3300049679 Bacteria 6950
432 Ga0501259_001172 3300049688 Bacteria 4366
433 Ga0501260_001377 3300049689 Bacteria 1999
434 Ga0501225_0000118 3300049705 Bacteria 24573
435 Ga0501225_0000127 3300049705 Bacteria 23477
436 Ga0501035_0000031 3300049822 Bacteria 175591
437 Ga0501035_0000132 3300049822 Bacteria 90625
438 Ga0501035_0000552 3300049822 Bacteria 41623
439 Ga0501035_0033002 3300049822 Bacteria 4708
440 Ga0501035_0033894 3300049822 Bacteria 4642
441 Ga0501044_0000008 3300049823 Bacteria 274778
442 Ga0501044_0003531 3300049823 Bacteria 17604
443 Ga0501044_0126666 3300049823 Bacteria 2551
444 Ga0501045_0185056 3300049824 Bacteria 1552
445 Ga0501204_000078 3300049850 Bacteria 6894
446 Ga0501212_001435 3300049851 Bacteria 2687
447 nmdc:mga00v17_68363_c1 3300050491 Bacteria 2196
448 nmdc:mga0yw44_41152_c1 3300050492 Bacteria 2749
449 nmdc:mga0k408_7821_c1 3300050493 Bacteria 5715
450 nmdc:mga07m45_156967_c1 3300050496 Bacteria 1320
451 nmdc:mga09592_11020_c1 3300050508 Bacteria 7354
452 nmdc:mga0sz30_60190_c1 3300050516 Bacteria 1621
453 Ga0495601_0120744 3300053077 Bacteria 1702
454 Ga0495619_0024288 3300053085 Bacteria 3887
455 Ga0500651_0019866 3300053093 Bacteria 4180
456 Ga0500651_0020261 3300053093 Bacteria 4139
457 Ga0500566_0026793 3300053094 Bacteria 3374
458 Ga0500650_0000508 3300053098 Bacteria 9861
459 Ga0500650_0068455 3300053098 Bacteria 1659
460 Ga0500554_001632 3300053102 Bacteria 4309
461 Ga0500556_0000016 3300053104 Bacteria 194958
462 Ga0500556_0000810 3300053104 Bacteria 18182
463 Ga0500562_003048 3300053108 Bacteria 4188
464 Ga0500569_012416 3300053109 Bacteria 2060
465 Ga0500572_010855 3300053111 Bacteria 2190
466 Ga0500572_025169 3300053111 Bacteria 1612
467 Ga0500592_001844 3300053116 Bacteria 3416
468 Ga0500592_003932 3300053116 Bacteria 2373
469 Ga0500595_001202 3300053119 Bacteria 14313
470 Ga0500608_003662 3300053122 Bacteria 5809
471 Ga0500642_0000017 3300053130 Bacteria 167670
472 Ga0500652_000306 3300053131 Bacteria 17755
473 Ga0500559_0017685 3300053136 Bacteria 3012
474 Ga0500568_0002231 3300053139 Bacteria 11614
475 Ga0500586_086745 3300053145 Bacteria 1099
476 Ga0500588_0007028 3300053146 Bacteria 2580
477 Ga0500604_0000678 3300053151 Bacteria 9334
478 Ga0500616_0000169 3300053153 Bacteria 109205
479 Ga0500619_002793 3300053154 Bacteria 3442
480 Ga0500620_001058 3300053155 Bacteria 4859
481 Ga0500622_0001376 3300053156 Bacteria 19604
482 Ga0500622_0010216 3300053156 Bacteria 5160
483 Ga0500624_002796 3300053157 Bacteria 2321
484 Ga0500627_0000006 3300053158 Bacteria 165989
485 Ga0500627_0025346 3300053158 Bacteria 2436
486 Ga0500634_0000026 3300053161 Bacteria 81353
487 Ga0500634_0023416 3300053161 Bacteria 3356
488 Ga0500636_0000001 3300053177 Bacteria 324086
489 Ga0500636_0004081 3300053177 Bacteria 8246
490 Ga0500645_001113 3300053730 Bacteria 14678
491 Ga0500645_010101 3300053730 Bacteria 3140
492 Ga0500645_035591 3300053730 Bacteria 1482
493 2511123988 2510917020 Bacteria 5657507
494 2513866721 2513237138 Bacteria 7368160
495 2514586834 2513237351 Bacteria 6968952
496 2524610887 2524023250 Bacteria 5457705
497 2526213480 2526164512 Bacteria 4025691
498 2574430901 2574179768 Bacteria 4907129
499 2585401472 2582581867 Bacteria 7184437
500 2585821165 2585427590 Bacteria 6824633
501 2601667785 2600255292 Bacteria 6300551
502 2603858198 2602042107 Bacteria 6226103
503 2643797234 2643221556 Bacteria 7251154
504 2644027328 2643221603 Bacteria 6147767
505 2644474224 2643221684 Bacteria 7145183
506 2753359969 2751185800 Bacteria 5467370
507 2758642288 2758568016 Bacteria 5645291
508 2819538862 2818991435 Bacteria 5433759
509 2819542120 2818991436 Bacteria 5376622
510 2842333518 2842333319 Bacteria 8899485
511 2847690422 2847686936 Bacteria 6278406
512 2857527589 2857524615 Bacteria 6615449
513 2857550187 2857547612 Bacteria 6179999
514 2871448662 2871444079 Bacteria 6423508
515 2871497708 2871495908 Bacteria 6935695
516 2874103827 2874102143 Bacteria 6342645
517 2876396576 2876392853 Bacteria 6660880
518 2878761931 2878760144 Bacteria 6823465
519 2878768897 2878767105 Bacteria 6898628
520 2881165905 2881161766 Bacteria 7127907
521 2882806923 2882806704 Bacteria 3007728
522 2883581075 2883577096 Bacteria 4709178
523 2885082550 2885080285 Bacteria 6355622
524 2885307391 2885305155 Bacteria 7348390
525 2885327548 2885326080 Bacteria 7134805
526 2885340136 2885334103 Bacteria 7216818
527 2893067080 2893066018 Bacteria 6158120
528 2894818603 2894817345 Bacteria 4892941
529 2903542506 2903540706 Bacteria 7062119
530 2904663352 2904659560 Bacteria 6685615
531 2906333593 2906328253 Bacteria 6585166
532 2915653354 2915650412 Bacteria 4288180
533 2919073441 2919073203 Bacteria 6531949
534 2919142002 2919138771 Bacteria 5281312
535 2919713096 2919709256 Bacteria 4318106
536 2923556947 2923556063 Bacteria 6793593
537 2924732912 2924726620 Bacteria 6271473
538 2924767308 2924762789 Bacteria 6561353
539 2928135224 2928130867 Bacteria 5467269
540 2932411397 2932410948 Bacteria 6312192
541 2932419036 2932416698 Bacteria 6315112
542 2937825342 2937822353 Bacteria 7290551
543 2937896474 2937891427 Bacteria 6357007
544 2937996359 2937994558 Bacteria 7036190
545 2958115246 2958115193 Bacteria 6923548
546 2958166829 2958165035 Bacteria 6906348
547 2961118379 2961114664 Bacteria 6680456
548 2961165299 2961163497 Bacteria 6901077
549 2965020121 2965018300 Bacteria 6883036
550 2965066652 2965062239 Bacteria 7412989
551 2968091743 2968091066 Bacteria 6052692
552 2968101585 2968097103 Bacteria 6107094
553 2968114440 2968110612 Bacteria 6814636
554 2968133286 2968128360 Bacteria 6270294
555 2968173700 2968171901 Bacteria 6894245
556 2970556786 2970554993 Bacteria 6814252
557 2977861455 2977858184 Bacteria 6215359
558 2977868821 2977864932 Bacteria 7534097
559 2979785843 2979779861 Bacteria 6219781
560 2987661306 2987659509 Bacteria 6966464
561 2987671169 2987666974 Bacteria 6509233
562 2996339363 2996336353 Bacteria 5511628
563 2996348188 2996341866 Bacteria 6643098
564 3004190355 3004188549 Bacteria 6952365
565 8004447533 8004445564 Bacteria 6322258
566 8004714002 8004703790 Bacteria 8006957
567 8047674922 8047673197 Bacteria 7395230
568 8054465297 8054460903 Bacteria 4872905
569 8057103626 8057101203 Bacteria 5034064
570 Ga0070663_100070931
571 JGI24741J21665_1000260
572 JGI24741J21665_1000419
573 JGI24740J21852_10000367
574 JGI24740J21852_10014752
575 JGI24739J22299_10021453
576 JGI24737J22298_10052345
577 JGI24735J21928_10007699
578 JGI24738J21930_10001501
579 JGI25162J39368_1000023
580 Ga0006765J45826_110238
581 Ga0006778J45830_1020868
582 Ga0006759J45824_1015261
583 JGI25151J46595_10035708
584 JGI25165J46597_1000030
585 JGI25153J46596_10039803
586 Ga0006770J48903_1032935
587 Ga0006777J48905_1023824
588 rootL2_10033365
589 Ga0007417J51691_1011869
590 Ga0007410J51695_1009390
591 Ga0007410J51695_1014429
592 Ga0007416J51690_1008920
593 Ga0007416J51690_1018576
594 Ga0007416J51690_1024555
595 Ga0007429J51699_1028792
596 Ga0032354_1007554
597 Ga0032354_1019704
598 Ga0055538_1000017
599 Ga0055539_1000022
600 Ga0055533_1000030
601 Ga0055525_1000008
602 Ga0055525_1000034
603 Ga0055534_1009225
604 Ga0055541_1000015
605 Ga0065165_1014489
606 Ga0065704_10002162
607 Ga0070658_10084785
608 Ga0070670_100006633
609 Ga0070660_100074145
610 Ga0070660_100237871
611 Ga0070661_100042881
612 Ga0070661_100055517
613 Ga0070661_100059034
614 Ga0070671_100002581
615 Ga0070659_100008470
616 Ga0070667_100003584
617 Ga0070663_100001722
618 Ga0070663_100270009
619 Ga0070684_100172668
620 Ga0068853_100001039
621 Ga0068853_100046985
622 Ga0070665_100000927
623 Ga0070665_100008868
624 Ga0070665_100011097
625 Ga0068855_100000165
626 Ga0068855_100013735
627 Ga0068855_100037456
628 Ga0068855_100125837
629 Ga0070664_100008914
630 Ga0070664_100010691
631 Ga0070664_100139180
632 Ga0068857_100001505
633 Ga0068857_100262820
634 Ga0068856_100262344
635 Ga0068852_100002547
636 Ga0068859_100083338
637 Ga0068864_100007096
638 Ga0068863_100004007
639 Ga0068863_100006004
640 Ga0068858_100001747
641 Ga0068858_100271511
642 Ga0075365_10006738
643 Ga0075369_10054291
644 Ga0075369_10082362
645 Ga0075366_10030923
646 Ga0068871_100114981
647 Ga0075430_100017802
648 Ga0075430_100064109
649 Ga0075429_100012542
650 Ga0097620_100083346
651 Ga0105244_10035551
652 Ga0105240_10433822
653 Ga0105245_10013465
654 Ga0105241_10137254
655 Ga0105242_10130978
656 Ga0105248_10014264
657 Ga0105249_10230353
658 Ga0105239_10287338
659 Ga0105246_10010241
660 Ga0157373_10007598
661 Ga0157373_10148746
662 Ga0157370_10234319
663 Ga0157369_10000454
664 Ga0157374_10002222
665 Ga0157374_10051713
666 Ga0157375_10024501
667 Ga0182008_10000245
668 Ga0157379_10235838
669 Ga0157376_10323459
670 Ga0157376_10356168
671 Ga0182006_1000002
672 Ga0182006_1013052
673 Ga0182007_10000085
674 Ga0182005_1000002
675 Ga0182005_1000510
676 Ga0163161_10011348
677 Ga0163161_10035548
678 Ga0163161_10175728
679 Ga0209784_100034
680 Ga0209566_100038
681 Ga0209674_100056
682 Ga0209563_100003
683 Ga0209563_100057
684 Ga0207427_100856
685 Ga0209437_100071
686 Ga0209677_100035
687 Ga0209148_1001190
688 Ga0209233_1000094
689 Ga0209675_1000327
690 Ga0209025_1000718
691 Ga0209564_1000904
692 Ga0209758_1001538
693 Ga0207655_1055289
694 Ga0207680_10041120
695 Ga0207647_10087987
696 Ga0207671_10031186
697 Ga0207671_10209230
698 Ga0207657_10025883
699 Ga0207649_10045722
700 Ga0207650_10053055
701 Ga0207706_10057966
702 Ga0207686_10180008
703 Ga0207679_10010981
704 Ga0207667_10000102
705 Ga0207667_10027752
706 Ga0207640_10150762
707 Ga0207658_10108525
708 Ga0207639_10000172
709 Ga0207639_10000862
710 Ga0207678_10002803
711 Ga0207678_10228110
712 Ga0207678_10364918
713 Ga0207702_10001274
714 Ga0207702_10001506
715 Ga0207702_10362263
716 Ga0207641_10030848
717 Ga0207674_10002930
718 Ga0207674_10213527
719 Ga0207698_10005652
720 Ga0207698_10078006
721 Ga0207428_10087142
722 Ga0268266_10005842
723 Ga0268266_10026341
724 Ga0268264_10258314
725 Ga0307515_10096394
726 Ga0307405_10000797
727 Ga0307405_10033612
728 Ga0307413_10053665
729 Ga0307412_10172932
730 Ga0307409_100050064
731 Ga0307416_100006045
732 Ga0307416_100034262
733 Ga0307414_10000811
734 Ga0307414_10001083
735 Ga0307411_10059708
736 Ga0395899_0000611
737 Ga0395899_0001045
738 Ga0395899_0001645
739 Ga0395899_0001913
740 Ga0395899_0002844
741 Ga0395899_0006861
742 Ga0395899_0024620
743 Ga0395899_0110444
744 Ga0395900_0000065
745 Ga0395900_0001188
746 Ga0395900_0003753
747 Ga0395900_0029650
748 Ga0395900_0038860
749 Ga0395900_0079373
750 Ga0395900_0121501
751 Ga0395900_0135831
752 Ga0395900_0168018
753 Ga0395900_0386474
754 Ga0395900_0427393
755 Ga0395898_0002178
756 Ga0395898_0052348
757 Ga0395898_0063613
758 Ga0395898_0146441
759 Ga0395898_0147897
760 Ga0395898_0199890
761 Ga0395905_0009767
762 Ga0395905_0009921
763 Ga0395905_0044930
764 Ga0395905_0079883
765 Ga0395905_0205777
766 Ga0395905_0219066
767 Ga0395905_0247987
768 Ga0395901_0000639
769 Ga0395901_0001168
770 Ga0395901_0026367
771 Ga0395901_0087254
772 Ga0395901_0088362
773 Ga0395901_0146006
774 Ga0395901_0151420
775 Ga0395901_0162969
776 Ga0395901_0173338
777 Ga0237819_00294
778 Ga0436360_0133011
779 Ga0436360_0276241
780 Ga0436360_0592760
781 Ga0436361_0680047
782 Ga0436361_0782000
783 Ga0436361_0958713
784 Ga0436361_0997150
785 Ga0439465_0011183
786 Ga0451807_2630938
787 Ga0451843_1375105
788 Ga0439448_0000958
789 Ga0439450_005353
790 Ga0439450_014675
791 Ga0439458_0007464
792 Ga0451577_0046403
793 Ga0466972_0000360
794 Ga0466972_0007306
795 Ga0466972_0022679
796 Ga0466972_0027029
797 Ga0466965_0014090
798 Ga0466966_0003020
799 Ga0466966_0007250
800 Ga0466964_0001175
801 Ga0466964_0016570
802 Ga0466964_0025539
803 Ga0466964_0029681
804 Ga0466964_0045855
805 Ga0453684_0002679
806 Ga0466968_0005763
807 Ga0466968_0011790
808 Ga0466968_0011965
809 Ga0466968_0059125
810 Ga0466970_0038393
811 Ga0466957_0000075
812 Ga0466957_0022510
813 Ga0466959_0018360
814 Ga0466959_0032797
815 Ga0466959_0059294
816 Ga0451576_0009832
817 Ga0495617_004157
818 Ga0495627_000997
819 Ga0495592_0008029
820 Ga0495590_0001969
821 Ga0495590_0022312
822 Ga0495638_0034096
823 Ga0495638_0103587
824 Ga0495651_0008679
825 Ga0495651_0047640
826 Ga0495653_0132489
827 Ga0495650_0007760
828 Ga0495605_0000160
829 Ga0495605_0003001
830 Ga0495605_0059261
831 Ga0495584_0000390
832 Ga0495607_0002570
833 Ga0495607_0002908
834 Ga0495607_0010437
835 Ga0495607_0011676
836 Ga0495607_0055842
837 Ga0495607_0059626
838 Ga0495606_0000015
839 Ga0495606_0002709
840 Ga0495606_0025445
841 Ga0495606_0097112
842 Ga0495608_0005101
843 Ga0495610_0000034
844 Ga0495610_0028111
845 Ga0495616_0002266
846 Ga0495616_0047147
847 Ga0495618_0004649
848 Ga0495620_0021068
849 Ga0495628_0003140
850 Ga0495628_0004352
851 Ga0495628_0089965
852 Ga0495632_0005457
853 Ga0495637_0003352
854 Ga0495643_0000552
855 Ga0495643_0008044
856 Ga0495643_0012127
857 Ga0495643_0038432
858 Ga0495648_0001544
859 Ga0495642_0001857
860 Ga0495652_0066761
861 Ga0495654_0010220
862 Ga0495654_0035216
863 Ga0495609_0000445
864 Ga0495645_0009925
865 Ga0495645_0025971
866 Ga0495622_0012410
867 Ga0495622_0017469
868 Ga0495622_0027224
869 Ga0495633_0000711
870 Ga0495625_0039830
871 Ga0495661_0001097
872 Ga0495661_0001236
873 Ga0495661_0003616
874 Ga0495661_0007134
875 Ga0495661_0013687
876 Ga0495588_0000052
877 Ga0495657_0042999
878 Ga0495599_0003817
879 Ga0495623_0020353
880 Ga0495624_0050935
881 Ga0495670_0019283
882 Ga0495671_0024825
883 Ga0495649_0144317
884 Ga0495589_0000058
885 Ga0495589_0001047
886 Ga0495600_0033868
887 Ga0495660_0000050
888 Ga0495660_0025808
889 Ga0495604_0006330
890 Ga0495672_0000060
891 Ga0495672_0006470
892 Ga0495687_000003
893 Ga0495687_000073
894 Ga0495687_000489
895 Ga0495687_044756
896 Ga0495677_0000144
897 Ga0495677_0006075
898 Ga0495673_0000204
899 Ga0495681_0000058
900 Ga0495681_0001199
901 Ga0495686_0000051
902 Ga0495686_0000573
903 Ga0495686_0001671
904 Ga0495602_0129347
905 Ga0495615_0000046
906 Ga0495626_0000066
907 Ga0495626_0000145
908 Ga0495626_0016842
909 Ga0495626_0072257
910 Ga0496101_0052496
911 Ga0496102_0000315
912 Ga0496102_0091726
913 Ga0496103_0000993
914 Ga0496103_0198464
915 Ga0496108_0001356
916 Ga0496109_0276196
917 Ga0496110_0017163
918 Ga0496110_0095948
919 Ga0496111_0113171
920 Ga0496113_0007646
921 Ga0496114_0000732
922 Ga0496116_0005871
923 Ga0496116_0013744
924 Ga0496116_0114901
925 Ga0496117_0000001
926 Ga0496117_0000484
927 Ga0496118_0000002
928 Ga0496118_0000486
929 Ga0496118_0035701
930 Ga0496118_0125353
931 Ga0496118_0159930
932 Ga0496119_0089097
933 Ga0496120_0001456
934 Ga0496120_0025297
935 Ga0496120_0092559
936 Ga0496121_0000065
937 Ga0496121_0001005
938 Ga0496121_0015782
939 Ga0496121_0055011
940 Ga0496121_0061810
941 Ga0496121_0074390
942 Ga0496122_0002401
943 Ga0496122_0005248
944 Ga0496122_0006637
945 Ga0496122_0017991
946 Ga0496122_0055659
947 Ga0496123_0001631
948 Ga0496123_0001840
949 Ga0496123_0010024
950 Ga0496123_0015195
951 Ga0496124_0000091
952 Ga0496124_0002145
953 Ga0496124_0005692
954 Ga0496124_0063422
955 Ga0496124_0092560
956 Ga0496124_0134262
957 Ga0496125_0009340
958 Ga0496125_0020498
959 Ga0496125_0022434
960 Ga0496125_0043939
961 Ga0496125_0118063
962 Ga0496125_0140072
963 Ga0496125_0272524
964 Ga0496126_0023730
965 Ga0495678_049617
966 Ga0495682_0011423
967 Ga0501031_0000011
968 Ga0501031_0042119
969 Ga0501032_0000006
970 Ga0501032_0000709
971 Ga0501032_0058310
972 Ga0501033_0000039
973 Ga0501033_0001176
974 Ga0501033_0022985
975 Ga0501034_0000030
976 Ga0501034_0000249
977 Ga0501034_0002073
978 Ga0501036_0000003
979 Ga0501036_0007299
980 Ga0501037_0000003
981 Ga0501037_0000397
982 Ga0501038_0000004
983 Ga0501038_0000600
984 Ga0501039_0000008
985 Ga0501039_0000027
986 Ga0501039_0133217
987 Ga0501040_0028066
988 Ga0501043_0000047
989 Ga0501043_0002417
990 Ga0501046_0105576
991 Ga0501047_0009317
992 Ga0501070_0011330
993 Ga0501208_000284
994 Ga0501223_000029
995 Ga0501223_006205
996 Ga0501224_001692
997 Ga0501227_003707
998 Ga0501235_004256
999 Ga0501246_000084
1000 Ga0501249_000808
1001 Ga0501259_001172
1002 Ga0501260_001377
1003 Ga0501225_0000118
1004 Ga0501225_0000127
1005 Ga0501035_0000031
1006 Ga0501035_0000132
1007 Ga0501035_0000552
1008 Ga0501035_0033002
1009 Ga0501035_0033894
1010 Ga0501044_0000008
1011 Ga0501044_0003531
1012 Ga0501044_0126666
1013 Ga0501045_0185056
1014 Ga0501204_000078
1015 Ga0501212_001435
1016 nmdc:mga00v17_68363_c1
1017 nmdc:mga0yw44_41152_c1
1018 nmdc:mga0k408_7821_c1
1019 nmdc:mga07m45_156967_c1
1020 nmdc:mga09592_11020_c1
1021 nmdc:mga0sz30_60190_c1
1022 Ga0495601_0120744
1023 Ga0495619_0024288
1024 Ga0500651_0019866
1025 Ga0500651_0020261
1026 Ga0500566_0026793
1027 Ga0500650_0000508
1028 Ga0500650_0068455
1029 Ga0500554_001632
1030 Ga0500556_0000016
1031 Ga0500556_0000810
1032 Ga0500562_003048
1033 Ga0500569_012416
1034 Ga0500572_010855
1035 Ga0500572_025169
1036 Ga0500592_001844
1037 Ga0500592_003932
1038 Ga0500595_001202
1039 Ga0500608_003662
1040 Ga0500642_0000017
1041 Ga0500652_000306
1042 Ga0500559_0017685
1043 Ga0500568_0002231
1044 Ga0500586_086745
1045 Ga0500588_0007028
1046 Ga0500604_0000678
1047 Ga0500616_0000169
1048 Ga0500619_002793
1049 Ga0500620_001058
1050 Ga0500622_0001376
1051 Ga0500622_0010216
1052 Ga0500624_002796
1053 Ga0500627_0000006
1054 Ga0500627_0025346
1055 Ga0500634_0000026
1056 Ga0500634_0023416
1057 Ga0500636_0000001
1058 Ga0500636_0004081
1059 Ga0500645_001113
1060 Ga0500645_010101
1061 Ga0500645_035591
1062 2511123988
1063 2513866721
1064 2514586834
1065 2524610887
1066 2526213480
1067 2574430901
1068 2585401472
1069 2585821165
1070 2601667785
1071 2603858198
1072 2643797234
1073 2644027328
1074 2644474224
1075 2753359969
1076 2758642288
1077 2819538862
1078 2819542120
1079 2842333518
1080 2847690422
1081 2857527589
1082 2857550187
1083 2871448662
1084 2871497708
1085 2874103827
1086 2876396576
1087 2878761931
1088 2878768897
1089 2881165905
1090 2882806923
1091 2883581075
1092 2885082550
1093 2885307391
1094 2885327548
1095 2885340136
1096 2893067080
1097 2894818603
1098 2903542506
1099 2904663352
1100 2906333593
1101 2915653354
1102 2919073441
1103 2919142002
1104 2919713096
1105 2923556947
1106 2924732912
1107 2924767308
1108 2928135224
1109 2932411397
1110 2932419036
1111 2937825342
1112 2937896474
1113 2937996359
1114 2958115246
1115 2958166829
1116 2961118379
1117 2961165299
1118 2965020121
1119 2965066652
1120 2968091743
1121 2968101585
1122 2968114440
1123 2968133286
1124 2968173700
1125 2970556786
1126 2977861455
1127 2977868821
1128 2979785843
1129 2987661306
1130 2987671169
1131 2996339363
1132 2996348188
1133 3004190355
1134 8004447533
1135 8004714002
1136 8047674922
1137 8054465297
1138 8057103626

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00842

Ala_racemase_C

Alanine racemase, C-terminal domain

274

399

0.96

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

49

263

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kw3-assembly1.cif.gz_A crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate 0.9644 6 362
3kw3-assembly1.cif.gz_B crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate 0.9621 6 362
3kw3-assembly1.cif.gz_A crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate 0.9562 6 362
3kw3-assembly1.cif.gz_B crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate 0.9543 6 362
6a2f-assembly1.cif.gz_B crystal structure of biosynthetic alanine racemase from pseudomonas aeruginosa 0.9231 6 363
ID Description Score Start End Superfamily
5yycC01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9632 238 360 2.40.37.10
af_P29012_211_355_2.40.37.10 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9593 234 357 2.40.37.10
4tloA01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9592 235 364 2.40.37.10
af_Q9P5N3_224_370_2.40.37.10 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9589 234 357 2.40.37.10
3kw3B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9587 17 225 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A5T2H0X2-F1-model_v4 Alanine racemase 3 0.9891 13 122 GO:0005829
GO:0008784
GO:0030170
GO:0030632
AF-A0A3C0M8M9-F1-model_v4 alanine racemase (EC 5.1.1.1) 0.982 230 361 GO:0005829
GO:0008784
GO:0030170
GO:0030632
AF-A0A848TSL6-F1-model_v4 alanine racemase (EC 5.1.1.1) 0.9815 235 366 GO:0005829
GO:0008784
GO:0030170
GO:0030632
AF-A0A659URN1-F1-model_v4 alanine racemase (EC 5.1.1.1) 0.9794 38 203 GO:0005829
GO:0008784
GO:0030170
GO:0030632
AF-A0A3D2L933-F1-model_v4 alanine racemase (EC 5.1.1.1) 0.9793 230 361 GO:0005829
GO:0008784
GO:0030170
GO:0030632

Map