F464807
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 359 | 1138 | 374 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100070931|Ga0070663_1000709312 |
| Length | 416 |
| Sequence | MTVAAAGIAVKRHAEGEILPLRSFVAGDVMLAPWTGGTGTRHASAVLTIDLEAISRNYRLLAERVGPGVTCAGVVKADAYGLGADRVAPALYRAGCRAFFVAHLDEGLDLQTHLARDVTIYVLNGLPSGSERDCAEAGIIPVLNSREQLEAWSDQARQRGRILPAVVQVDSGMSRLGMSPREVAELSGKDTSVLDIQMVMSHLACADTPEHPANAHQLTAFQALAKRFPAARQSLANSSGIFLGRNYHHDLVRPGAALYGLNPHPAQSNPMLPVVRLTAQVIQTRDVEADAHVGYGWTFRATKPTRLATLAIGYADGLQRAFGNGGAVYFRGRRLAVAGRVSMDSLTVDLGDLPPGMLARGSQVEIIGGHQSLDALAAAAGTIGYEMLTSLGQRYERIYSDEIDVRWTARSGGAVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 51 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 127 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 128 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 129 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 130 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 132 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 133 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 134 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 135 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 208 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 211 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 212 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 213 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 234 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 239 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 241 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 247 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 248 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 249 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 251 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 257 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 259 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 260 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 261 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 262 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 263 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 264 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 265 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 266 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 268 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 269 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 271 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 272 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 273 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 275 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 276 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 277 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 278 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 279 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 283 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 284 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 285 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 286 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 287 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 288 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 289 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 290 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 291 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 292 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 293 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 294 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 295 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 296 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 297 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 298 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 299 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 300 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 301 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 302 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 303 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 304 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 305 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 306 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 307 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 308 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 309 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 310 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 311 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 312 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 313 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 314 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 315 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 316 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 317 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 318 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 319 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 320 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 321 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 322 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 323 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 324 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 325 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 326 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 327 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 328 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 329 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 330 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 331 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 332 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 333 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 334 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 335 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 336 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 337 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 338 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 339 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 340 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 341 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 342 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 343 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 344 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 345 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 346 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 347 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 348 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 349 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 350 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 351 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 352 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 353 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 354 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 355 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 356 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 357 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 358 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 359 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.04 |
| Metatranscriptomes | 2.46 |
| Isolates | 13.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.81 |
| Nodule | 6.84 |
| Rhizoplane | 2.63 |
| Rhizosphere | 65.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070663_100070931 | 3300005455 | Bacteria | 2534 |
| 2 | JGI24741J21665_1000260 | 3300001915 | Bacteria | 15816 |
| 3 | JGI24741J21665_1000419 | 3300001915 | Bacteria | 12882 |
| 4 | JGI24740J21852_10000367 | 3300001979 | Bacteria | 19388 |
| 5 | JGI24740J21852_10014752 | 3300001979 | Bacteria | 2872 |
| 6 | JGI24739J22299_10021453 | 3300001989 | Bacteria | 2298 |
| 7 | JGI24737J22298_10052345 | 3300001990 | Bacteria | 1238 |
| 8 | JGI24735J21928_10007699 | 3300002067 | Bacteria | 3503 |
| 9 | JGI24738J21930_10001501 | 3300002075 | Bacteria | 6465 |
| 10 | JGI25162J39368_1000023 | 3300002737 | Bacteria | 236658 |
| 11 | Ga0006765J45826_110238 | 3300003161 | Bacteria | 1601 |
| 12 | Ga0006778J45830_1020868 | 3300003162 | Bacteria | 3144 |
| 13 | Ga0006759J45824_1015261 | 3300003163 | Bacteria | 2302 |
| 14 | JGI25151J46595_10035708 | 3300003187 | Unclassified | 1884 |
| 15 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 16 | JGI25153J46596_10039803 | 3300003215 | Bacteria | 1465 |
| 17 | Ga0006770J48903_1032935 | 3300003305 | Bacteria | 1976 |
| 18 | Ga0006777J48905_1023824 | 3300003308 | Bacteria | 2136 |
| 19 | rootL2_10033365 | 3300003322 | Bacteria | 4811 |
| 20 | Ga0007417J51691_1011869 | 3300003544 | Bacteria | 2113 |
| 21 | Ga0007410J51695_1009390 | 3300003574 | Bacteria | 3901 |
| 22 | Ga0007410J51695_1014429 | 3300003574 | Bacteria | 2353 |
| 23 | Ga0007416J51690_1008920 | 3300003577 | Bacteria | 2141 |
| 24 | Ga0007416J51690_1018576 | 3300003577 | Bacteria | 2880 |
| 25 | Ga0007416J51690_1024555 | 3300003577 | Bacteria | 1246 |
| 26 | Ga0007429J51699_1028792 | 3300003579 | Bacteria | 2795 |
| 27 | Ga0032354_1007554 | 3300003693 | Bacteria | 2758 |
| 28 | Ga0032354_1019704 | 3300003693 | Bacteria | 3664 |
| 29 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 30 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 31 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 32 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 33 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 34 | Ga0055534_1009225 | 3300003784 | Bacteria | 2162 |
| 35 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 36 | Ga0065165_1014489 | 3300005262 | Bacteria | 3059 |
| 37 | Ga0065704_10002162 | 3300005289 | Bacteria | 5738 |
| 38 | Ga0070658_10084785 | 3300005327 | Bacteria | 2605 |
| 39 | Ga0070670_100006633 | 3300005331 | Bacteria | 9812 |
| 40 | Ga0070660_100074145 | 3300005339 | Bacteria | 2662 |
| 41 | Ga0070660_100237871 | 3300005339 | Bacteria | 1482 |
| 42 | Ga0070661_100042881 | 3300005344 | Bacteria | 3304 |
| 43 | Ga0070661_100055517 | 3300005344 | Bacteria | 2900 |
| 44 | Ga0070661_100059034 | 3300005344 | Bacteria | 2812 |
| 45 | Ga0070671_100002581 | 3300005355 | Bacteria | 14035 |
| 46 | Ga0070659_100008470 | 3300005366 | Bacteria | 7514 |
| 47 | Ga0070667_100003584 | 3300005367 | Bacteria | 13215 |
| 48 | Ga0070663_100001722 | 3300005455 | Bacteria | 12136 |
| 49 | Ga0070663_100270009 | 3300005455 | Bacteria | 1352 |
| 50 | Ga0070684_100172668 | 3300005535 | Bacteria | 1964 |
| 51 | Ga0068853_100001039 | 3300005539 | Bacteria | 19609 |
| 52 | Ga0068853_100046985 | 3300005539 | Bacteria | 3704 |
| 53 | Ga0070665_100000927 | 3300005548 | Bacteria | 37571 |
| 54 | Ga0070665_100008868 | 3300005548 | Bacteria | 10182 |
| 55 | Ga0070665_100011097 | 3300005548 | Bacteria | 9102 |
| 56 | Ga0068855_100000165 | 3300005563 | Bacteria | 85018 |
| 57 | Ga0068855_100013735 | 3300005563 | Bacteria | 9761 |
| 58 | Ga0068855_100037456 | 3300005563 | Bacteria | 5766 |
| 59 | Ga0068855_100125837 | 3300005563 | Bacteria | 2930 |
| 60 | Ga0070664_100008914 | 3300005564 | Bacteria | 8130 |
| 61 | Ga0070664_100010691 | 3300005564 | Bacteria | 7441 |
| 62 | Ga0070664_100139180 | 3300005564 | Bacteria | 2136 |
| 63 | Ga0068857_100001505 | 3300005577 | Bacteria | 18584 |
| 64 | Ga0068857_100262820 | 3300005577 | Bacteria | 1584 |
| 65 | Ga0068856_100262344 | 3300005614 | Bacteria | 1743 |
| 66 | Ga0068852_100002547 | 3300005616 | Bacteria | 12557 |
| 67 | Ga0068859_100083338 | 3300005617 | Bacteria | 3240 |
| 68 | Ga0068864_100007096 | 3300005618 | Bacteria | 9200 |
| 69 | Ga0068863_100004007 | 3300005841 | Bacteria | 14541 |
| 70 | Ga0068863_100006004 | 3300005841 | Bacteria | 11910 |
| 71 | Ga0068858_100001747 | 3300005842 | Bacteria | 22173 |
| 72 | Ga0068858_100271511 | 3300005842 | Bacteria | 1614 |
| 73 | Ga0075365_10006738 | 3300006038 | Bacteria | 6354 |
| 74 | Ga0075369_10054291 | 3300006186 | Bacteria | 1740 |
| 75 | Ga0075369_10082362 | 3300006186 | Bacteria | 1428 |
| 76 | Ga0075366_10030923 | 3300006195 | Bacteria | 3149 |
| 77 | Ga0068871_100114981 | 3300006358 | Bacteria | 2267 |
| 78 | Ga0075430_100017802 | 3300006846 | Bacteria | 6049 |
| 79 | Ga0075430_100064109 | 3300006846 | Bacteria | 3086 |
| 80 | Ga0075429_100012542 | 3300006880 | Bacteria | 7354 |
| 81 | Ga0097620_100083346 | 3300006931 | Bacteria | 3240 |
| 82 | Ga0105244_10035551 | 3300009036 | Bacteria | 2617 |
| 83 | Ga0105240_10433822 | 3300009093 | Bacteria | 1474 |
| 84 | Ga0105245_10013465 | 3300009098 | Bacteria | 7124 |
| 85 | Ga0105241_10137254 | 3300009174 | Bacteria | 1987 |
| 86 | Ga0105242_10130978 | 3300009176 | Bacteria | 2165 |
| 87 | Ga0105248_10014264 | 3300009177 | Bacteria | 8747 |
| 88 | Ga0105249_10230353 | 3300009553 | Bacteria | 1827 |
| 89 | Ga0105239_10287338 | 3300010375 | Bacteria | 1852 |
| 90 | Ga0105246_10010241 | 3300011119 | Bacteria | 5791 |
| 91 | Ga0157373_10007598 | 3300013100 | Bacteria | 8058 |
| 92 | Ga0157373_10148746 | 3300013100 | Bacteria | 1648 |
| 93 | Ga0157370_10234319 | 3300013104 | Bacteria | 1699 |
| 94 | Ga0157369_10000454 | 3300013105 | Bacteria | 54339 |
| 95 | Ga0157374_10002222 | 3300013296 | Bacteria | 16365 |
| 96 | Ga0157374_10051713 | 3300013296 | Bacteria | 3824 |
| 97 | Ga0157375_10024501 | 3300013308 | Bacteria | 5586 |
| 98 | Ga0182008_10000245 | 3300014497 | Bacteria | 42026 |
| 99 | Ga0157379_10235838 | 3300014968 | Bacteria | 1659 |
| 100 | Ga0157376_10323459 | 3300014969 | Bacteria | 1467 |
| 101 | Ga0157376_10356168 | 3300014969 | Bacteria | 1402 |
| 102 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 103 | Ga0182006_1013052 | 3300015261 | Bacteria | 3617 |
| 104 | Ga0182007_10000085 | 3300015262 | Bacteria | 70105 |
| 105 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 106 | Ga0182005_1000510 | 3300015265 | Bacteria | 19866 |
| 107 | Ga0163161_10011348 | 3300017792 | Bacteria | 6177 |
| 108 | Ga0163161_10035548 | 3300017792 | Bacteria | 3567 |
| 109 | Ga0163161_10175728 | 3300017792 | Bacteria | 1639 |
| 110 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 111 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 112 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 113 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 114 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 115 | Ga0207427_100856 | 3300025231 | Bacteria | 13520 |
| 116 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 117 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 118 | Ga0209148_1001190 | 3300025254 | Bacteria | 14889 |
| 119 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 120 | Ga0209675_1000327 | 3300025291 | Bacteria | 41873 |
| 121 | Ga0209025_1000718 | 3300025294 | Bacteria | 56292 |
| 122 | Ga0209564_1000904 | 3300025295 | Bacteria | 38851 |
| 123 | Ga0209758_1001538 | 3300025297 | Bacteria | 26527 |
| 124 | Ga0207655_1055289 | 3300025728 | Bacteria | 1572 |
| 125 | Ga0207680_10041120 | 3300025903 | Bacteria | 2695 |
| 126 | Ga0207647_10087987 | 3300025904 | Bacteria | 1855 |
| 127 | Ga0207671_10031186 | 3300025914 | Bacteria | 3972 |
| 128 | Ga0207671_10209230 | 3300025914 | Bacteria | 1525 |
| 129 | Ga0207657_10025883 | 3300025919 | Bacteria | 5403 |
| 130 | Ga0207649_10045722 | 3300025920 | Bacteria | 2685 |
| 131 | Ga0207650_10053055 | 3300025925 | Bacteria | 3005 |
| 132 | Ga0207706_10057966 | 3300025933 | Bacteria | 3412 |
| 133 | Ga0207686_10180008 | 3300025934 | Bacteria | 1498 |
| 134 | Ga0207679_10010981 | 3300025945 | Bacteria | 5844 |
| 135 | Ga0207667_10000102 | 3300025949 | Bacteria | 137469 |
| 136 | Ga0207667_10027752 | 3300025949 | Bacteria | 6157 |
| 137 | Ga0207640_10150762 | 3300025981 | Bacteria | 1708 |
| 138 | Ga0207658_10108525 | 3300025986 | Bacteria | 2189 |
| 139 | Ga0207639_10000172 | 3300026041 | Bacteria | 50146 |
| 140 | Ga0207639_10000862 | 3300026041 | Bacteria | 20567 |
| 141 | Ga0207678_10002803 | 3300026067 | Bacteria | 15819 |
| 142 | Ga0207678_10228110 | 3300026067 | Bacteria | 1594 |
| 143 | Ga0207678_10364918 | 3300026067 | Bacteria | 1247 |
| 144 | Ga0207702_10001274 | 3300026078 | Bacteria | 25302 |
| 145 | Ga0207702_10001506 | 3300026078 | Bacteria | 23033 |
| 146 | Ga0207702_10362263 | 3300026078 | Bacteria | 1390 |
| 147 | Ga0207641_10030848 | 3300026088 | Bacteria | 4442 |
| 148 | Ga0207674_10002930 | 3300026116 | Bacteria | 21206 |
| 149 | Ga0207674_10213527 | 3300026116 | Bacteria | 1878 |
| 150 | Ga0207698_10005652 | 3300026142 | Bacteria | 7742 |
| 151 | Ga0207698_10078006 | 3300026142 | Bacteria | 2658 |
| 152 | Ga0207428_10087142 | 3300027907 | Bacteria | 2429 |
| 153 | Ga0268266_10005842 | 3300028379 | Bacteria | 11386 |
| 154 | Ga0268266_10026341 | 3300028379 | Bacteria | 4947 |
| 155 | Ga0268264_10258314 | 3300028381 | Bacteria | 1621 |
| 156 | Ga0307515_10096394 | 3300028794 | Bacteria | 3628 |
| 157 | Ga0307405_10000797 | 3300031731 | Bacteria | 12360 |
| 158 | Ga0307405_10033612 | 3300031731 | Bacteria | 3043 |
| 159 | Ga0307413_10053665 | 3300031824 | Bacteria | 2441 |
| 160 | Ga0307412_10172932 | 3300031911 | Bacteria | 1616 |
| 161 | Ga0307409_100050064 | 3300031995 | Bacteria | 3188 |
| 162 | Ga0307416_100006045 | 3300032002 | Bacteria | 7534 |
| 163 | Ga0307416_100034262 | 3300032002 | Bacteria | 3862 |
| 164 | Ga0307414_10000811 | 3300032004 | Bacteria | 15938 |
| 165 | Ga0307414_10001083 | 3300032004 | Bacteria | 13923 |
| 166 | Ga0307411_10059708 | 3300032005 | Bacteria | 2529 |
| 167 | Ga0395899_0000611 | 3300037312 | Bacteria | 37215 |
| 168 | Ga0395899_0001045 | 3300037312 | Bacteria | 25131 |
| 169 | Ga0395899_0001645 | 3300037312 | Bacteria | 18655 |
| 170 | Ga0395899_0001913 | 3300037312 | Bacteria | 17173 |
| 171 | Ga0395899_0002844 | 3300037312 | Bacteria | 13933 |
| 172 | Ga0395899_0006861 | 3300037312 | Bacteria | 8819 |
| 173 | Ga0395899_0024620 | 3300037312 | Bacteria | 4549 |
| 174 | Ga0395899_0110444 | 3300037312 | Bacteria | 1977 |
| 175 | Ga0395900_0000065 | 3300037418 | Bacteria | 196327 |
| 176 | Ga0395900_0001188 | 3300037418 | Bacteria | 32276 |
| 177 | Ga0395900_0003753 | 3300037418 | Bacteria | 16318 |
| 178 | Ga0395900_0029650 | 3300037418 | Bacteria | 5613 |
| 179 | Ga0395900_0038860 | 3300037418 | Bacteria | 4905 |
| 180 | Ga0395900_0079373 | 3300037418 | Bacteria | 3372 |
| 181 | Ga0395900_0121501 | 3300037418 | Bacteria | 2679 |
| 182 | Ga0395900_0135831 | 3300037418 | Bacteria | 2519 |
| 183 | Ga0395900_0168018 | 3300037418 | Bacteria | 2234 |
| 184 | Ga0395900_0386474 | 3300037418 | Bacteria | 1366 |
| 185 | Ga0395900_0427393 | 3300037418 | Bacteria | 1284 |
| 186 | Ga0395898_0002178 | 3300037466 | Bacteria | 23964 |
| 187 | Ga0395898_0052348 | 3300037466 | Bacteria | 3988 |
| 188 | Ga0395898_0063613 | 3300037466 | Bacteria | 3580 |
| 189 | Ga0395898_0146441 | 3300037466 | Bacteria | 2260 |
| 190 | Ga0395898_0147897 | 3300037466 | Bacteria | 2248 |
| 191 | Ga0395898_0199890 | 3300037466 | Bacteria | 1908 |
| 192 | Ga0395905_0009767 | 3300037471 | Bacteria | 9358 |
| 193 | Ga0395905_0009921 | 3300037471 | Bacteria | 9279 |
| 194 | Ga0395905_0044930 | 3300037471 | Bacteria | 4144 |
| 195 | Ga0395905_0079883 | 3300037471 | Bacteria | 3065 |
| 196 | Ga0395905_0205777 | 3300037471 | Bacteria | 1844 |
| 197 | Ga0395905_0219066 | 3300037471 | Bacteria | 1781 |
| 198 | Ga0395905_0247987 | 3300037471 | Bacteria | 1663 |
| 199 | Ga0395901_0000639 | 3300038443 | Bacteria | 40528 |
| 200 | Ga0395901_0001168 | 3300038443 | Bacteria | 27890 |
| 201 | Ga0395901_0026367 | 3300038443 | Bacteria | 5966 |
| 202 | Ga0395901_0087254 | 3300038443 | Bacteria | 3262 |
| 203 | Ga0395901_0088362 | 3300038443 | Bacteria | 3241 |
| 204 | Ga0395901_0146006 | 3300038443 | Bacteria | 2486 |
| 205 | Ga0395901_0151420 | 3300038443 | Bacteria | 2437 |
| 206 | Ga0395901_0162969 | 3300038443 | Bacteria | 2341 |
| 207 | Ga0395901_0173338 | 3300038443 | Bacteria | 2263 |
| 208 | Ga0237819_00294 | 3300038705 | Bacteria | 18381 |
| 209 | Ga0436360_0133011 | 3300039438 | Bacteria | 1791 |
| 210 | Ga0436360_0276241 | 3300039438 | Bacteria | 2196 |
| 211 | Ga0436360_0592760 | 3300039438 | Bacteria | 1696 |
| 212 | Ga0436361_0680047 | 3300039447 | Bacteria | 1583 |
| 213 | Ga0436361_0782000 | 3300039447 | Bacteria | 3539 |
| 214 | Ga0436361_0958713 | 3300039447 | Bacteria | 3392 |
| 215 | Ga0436361_0997150 | 3300039447 | Bacteria | 20731 |
| 216 | Ga0439465_0011183 | 3300041413 | Bacteria | 2816 |
| 217 | Ga0451807_2630938 | 3300041486 | Bacteria | 2818 |
| 218 | Ga0451843_1375105 | 3300041509 | Bacteria | 4595 |
| 219 | Ga0439448_0000958 | 3300042005 | Bacteria | 7126 |
| 220 | Ga0439450_005353 | 3300042008 | Bacteria | 2252 |
| 221 | Ga0439450_014675 | 3300042008 | Bacteria | 1592 |
| 222 | Ga0439458_0007464 | 3300042157 | Bacteria | 2435 |
| 223 | Ga0451577_0046403 | 3300042876 | Bacteria | 3887 |
| 224 | Ga0466972_0000360 | 3300044658 | Bacteria | 24585 |
| 225 | Ga0466972_0007306 | 3300044658 | Bacteria | 5546 |
| 226 | Ga0466972_0022679 | 3300044658 | Bacteria | 3124 |
| 227 | Ga0466972_0027029 | 3300044658 | Bacteria | 2841 |
| 228 | Ga0466965_0014090 | 3300044683 | Bacteria | 3782 |
| 229 | Ga0466966_0003020 | 3300044684 | Bacteria | 11101 |
| 230 | Ga0466966_0007250 | 3300044684 | Bacteria | 7352 |
| 231 | Ga0466964_0001175 | 3300044706 | Bacteria | 8845 |
| 232 | Ga0466964_0016570 | 3300044706 | Bacteria | 2815 |
| 233 | Ga0466964_0025539 | 3300044706 | Bacteria | 2307 |
| 234 | Ga0466964_0029681 | 3300044706 | Bacteria | 2160 |
| 235 | Ga0466964_0045855 | 3300044706 | Bacteria | 1780 |
| 236 | Ga0453684_0002679 | 3300044712 | Bacteria | 42376 |
| 237 | Ga0466968_0005763 | 3300044735 | Bacteria | 4647 |
| 238 | Ga0466968_0011790 | 3300044735 | Bacteria | 3409 |
| 239 | Ga0466968_0011965 | 3300044735 | Bacteria | 3388 |
| 240 | Ga0466968_0059125 | 3300044735 | Bacteria | 1650 |
| 241 | Ga0466970_0038393 | 3300044765 | Bacteria | 2540 |
| 242 | Ga0466957_0000075 | 3300044842 | Bacteria | 38931 |
| 243 | Ga0466957_0022510 | 3300044842 | Bacteria | 3719 |
| 244 | Ga0466959_0018360 | 3300045049 | Bacteria | 5134 |
| 245 | Ga0466959_0032797 | 3300045049 | Bacteria | 3844 |
| 246 | Ga0466959_0059294 | 3300045049 | Bacteria | 2787 |
| 247 | Ga0451576_0009832 | 3300045051 | Bacteria | 11053 |
| 248 | Ga0495617_004157 | 3300046452 | Bacteria | 5304 |
| 249 | Ga0495627_000997 | 3300046453 | Bacteria | 19039 |
| 250 | Ga0495592_0008029 | 3300046454 | Bacteria | 7924 |
| 251 | Ga0495590_0001969 | 3300046457 | Bacteria | 8658 |
| 252 | Ga0495590_0022312 | 3300046457 | Bacteria | 2239 |
| 253 | Ga0495638_0034096 | 3300046460 | Bacteria | 3251 |
| 254 | Ga0495638_0103587 | 3300046460 | Bacteria | 1698 |
| 255 | Ga0495651_0008679 | 3300046462 | Bacteria | 7798 |
| 256 | Ga0495651_0047640 | 3300046462 | Bacteria | 3312 |
| 257 | Ga0495653_0132489 | 3300046463 | Bacteria | 1762 |
| 258 | Ga0495650_0007760 | 3300046471 | Bacteria | 6384 |
| 259 | Ga0495605_0000160 | 3300046474 | Bacteria | 86202 |
| 260 | Ga0495605_0003001 | 3300046474 | Bacteria | 10192 |
| 261 | Ga0495605_0059261 | 3300046474 | Bacteria | 1839 |
| 262 | Ga0495584_0000390 | 3300046491 | Bacteria | 30206 |
| 263 | Ga0495607_0002570 | 3300046501 | Bacteria | 14663 |
| 264 | Ga0495607_0002908 | 3300046501 | Bacteria | 13508 |
| 265 | Ga0495607_0010437 | 3300046501 | Bacteria | 6244 |
| 266 | Ga0495607_0011676 | 3300046501 | Bacteria | 5833 |
| 267 | Ga0495607_0055842 | 3300046501 | Bacteria | 2269 |
| 268 | Ga0495607_0059626 | 3300046501 | Bacteria | 2176 |
| 269 | Ga0495606_0000015 | 3300046507 | Bacteria | 288808 |
| 270 | Ga0495606_0002709 | 3300046507 | Bacteria | 19972 |
| 271 | Ga0495606_0025445 | 3300046507 | Bacteria | 4238 |
| 272 | Ga0495606_0097112 | 3300046507 | Bacteria | 1801 |
| 273 | Ga0495608_0005101 | 3300046511 | Bacteria | 9380 |
| 274 | Ga0495610_0000034 | 3300046512 | Bacteria | 201408 |
| 275 | Ga0495610_0028111 | 3300046512 | Bacteria | 2979 |
| 276 | Ga0495616_0002266 | 3300046513 | Bacteria | 12867 |
| 277 | Ga0495616_0047147 | 3300046513 | Bacteria | 2171 |
| 278 | Ga0495618_0004649 | 3300046514 | Bacteria | 8402 |
| 279 | Ga0495620_0021068 | 3300046515 | Bacteria | 3171 |
| 280 | Ga0495628_0003140 | 3300046516 | Bacteria | 14828 |
| 281 | Ga0495628_0004352 | 3300046516 | Bacteria | 12563 |
| 282 | Ga0495628_0089965 | 3300046516 | Bacteria | 2376 |
| 283 | Ga0495632_0005457 | 3300046519 | Bacteria | 8404 |
| 284 | Ga0495637_0003352 | 3300046520 | Bacteria | 8520 |
| 285 | Ga0495643_0000552 | 3300046522 | Bacteria | 46298 |
| 286 | Ga0495643_0008044 | 3300046522 | Bacteria | 6722 |
| 287 | Ga0495643_0012127 | 3300046522 | Bacteria | 5210 |
| 288 | Ga0495643_0038432 | 3300046522 | Bacteria | 2621 |
| 289 | Ga0495648_0001544 | 3300046524 | Bacteria | 22488 |
| 290 | Ga0495642_0001857 | 3300046528 | Bacteria | 9016 |
| 291 | Ga0495652_0066761 | 3300046529 | Bacteria | 3017 |
| 292 | Ga0495654_0010220 | 3300046530 | Bacteria | 5114 |
| 293 | Ga0495654_0035216 | 3300046530 | Bacteria | 2523 |
| 294 | Ga0495609_0000445 | 3300046538 | Bacteria | 34051 |
| 295 | Ga0495645_0009925 | 3300046543 | Bacteria | 6663 |
| 296 | Ga0495645_0025971 | 3300046543 | Bacteria | 4252 |
| 297 | Ga0495622_0012410 | 3300046557 | Bacteria | 3945 |
| 298 | Ga0495622_0017469 | 3300046557 | Bacteria | 3340 |
| 299 | Ga0495622_0027224 | 3300046557 | Bacteria | 2668 |
| 300 | Ga0495633_0000711 | 3300046558 | Bacteria | 30230 |
| 301 | Ga0495625_0039830 | 3300046660 | Bacteria | 3429 |
| 302 | Ga0495661_0001097 | 3300046665 | Bacteria | 23749 |
| 303 | Ga0495661_0001236 | 3300046665 | Bacteria | 22115 |
| 304 | Ga0495661_0003616 | 3300046665 | Bacteria | 11388 |
| 305 | Ga0495661_0007134 | 3300046665 | Bacteria | 7801 |
| 306 | Ga0495661_0013687 | 3300046665 | Bacteria | 5446 |
| 307 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 308 | Ga0495657_0042999 | 3300046675 | Bacteria | 3082 |
| 309 | Ga0495599_0003817 | 3300046678 | Bacteria | 8846 |
| 310 | Ga0495623_0020353 | 3300046679 | Bacteria | 4288 |
| 311 | Ga0495624_0050935 | 3300046690 | Bacteria | 2622 |
| 312 | Ga0495670_0019283 | 3300046691 | Bacteria | 3360 |
| 313 | Ga0495671_0024825 | 3300046692 | Bacteria | 3118 |
| 314 | Ga0495649_0144317 | 3300046694 | Bacteria | 1252 |
| 315 | Ga0495589_0000058 | 3300046794 | Bacteria | 107640 |
| 316 | Ga0495589_0001047 | 3300046794 | Bacteria | 16678 |
| 317 | Ga0495600_0033868 | 3300046809 | Bacteria | 3316 |
| 318 | Ga0495660_0000050 | 3300046810 | Bacteria | 140329 |
| 319 | Ga0495660_0025808 | 3300046810 | Bacteria | 3335 |
| 320 | Ga0495604_0006330 | 3300047317 | Bacteria | 9389 |
| 321 | Ga0495672_0000060 | 3300047320 | Bacteria | 214547 |
| 322 | Ga0495672_0006470 | 3300047320 | Bacteria | 9062 |
| 323 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 324 | Ga0495687_000073 | 3300047443 | Bacteria | 155429 |
| 325 | Ga0495687_000489 | 3300047443 | Bacteria | 47669 |
| 326 | Ga0495687_044756 | 3300047443 | Bacteria | 1921 |
| 327 | Ga0495677_0000144 | 3300047445 | Bacteria | 34126 |
| 328 | Ga0495677_0006075 | 3300047445 | Bacteria | 4564 |
| 329 | Ga0495673_0000204 | 3300047469 | Bacteria | 89887 |
| 330 | Ga0495681_0000058 | 3300047470 | Bacteria | 103041 |
| 331 | Ga0495681_0001199 | 3300047470 | Bacteria | 19723 |
| 332 | Ga0495686_0000051 | 3300047472 | Bacteria | 263489 |
| 333 | Ga0495686_0000573 | 3300047472 | Bacteria | 52364 |
| 334 | Ga0495686_0001671 | 3300047472 | Bacteria | 23058 |
| 335 | Ga0495602_0129347 | 3300048088 | Bacteria | 2016 |
| 336 | Ga0495615_0000046 | 3300048090 | Bacteria | 41047 |
| 337 | Ga0495626_0000066 | 3300048091 | Bacteria | 141280 |
| 338 | Ga0495626_0000145 | 3300048091 | Bacteria | 89603 |
| 339 | Ga0495626_0016842 | 3300048091 | Bacteria | 3703 |
| 340 | Ga0495626_0072257 | 3300048091 | Bacteria | 1548 |
| 341 | Ga0496101_0052496 | 3300048904 | Bacteria | 2940 |
| 342 | Ga0496102_0000315 | 3300048905 | Bacteria | 60883 |
| 343 | Ga0496102_0091726 | 3300048905 | Bacteria | 2812 |
| 344 | Ga0496103_0000993 | 3300048906 | Bacteria | 19978 |
| 345 | Ga0496103_0198464 | 3300048906 | Bacteria | 1290 |
| 346 | Ga0496108_0001356 | 3300048911 | Bacteria | 19238 |
| 347 | Ga0496109_0276196 | 3300048912 | Bacteria | 1583 |
| 348 | Ga0496110_0017163 | 3300048913 | Bacteria | 6052 |
| 349 | Ga0496110_0095948 | 3300048913 | Bacteria | 2657 |
| 350 | Ga0496111_0113171 | 3300048914 | Bacteria | 1999 |
| 351 | Ga0496113_0007646 | 3300048916 | Bacteria | 6974 |
| 352 | Ga0496114_0000732 | 3300048917 | Bacteria | 24476 |
| 353 | Ga0496116_0005871 | 3300048919 | Bacteria | 11279 |
| 354 | Ga0496116_0013744 | 3300048919 | Bacteria | 6507 |
| 355 | Ga0496116_0114901 | 3300048919 | Bacteria | 1571 |
| 356 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 357 | Ga0496117_0000484 | 3300048920 | Bacteria | 65863 |
| 358 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 359 | Ga0496118_0000486 | 3300048921 | Bacteria | 65791 |
| 360 | Ga0496118_0035701 | 3300048921 | Bacteria | 4032 |
| 361 | Ga0496118_0125353 | 3300048921 | Bacteria | 1664 |
| 362 | Ga0496118_0159930 | 3300048921 | Bacteria | 1394 |
| 363 | Ga0496119_0089097 | 3300048922 | Bacteria | 1757 |
| 364 | Ga0496120_0001456 | 3300048923 | Bacteria | 28320 |
| 365 | Ga0496120_0025297 | 3300048923 | Bacteria | 3687 |
| 366 | Ga0496120_0092559 | 3300048923 | Bacteria | 1612 |
| 367 | Ga0496121_0000065 | 3300048924 | Bacteria | 269310 |
| 368 | Ga0496121_0001005 | 3300048924 | Bacteria | 50368 |
| 369 | Ga0496121_0015782 | 3300048924 | Bacteria | 7867 |
| 370 | Ga0496121_0055011 | 3300048924 | Bacteria | 3319 |
| 371 | Ga0496121_0061810 | 3300048924 | Bacteria | 3071 |
| 372 | Ga0496121_0074390 | 3300048924 | Bacteria | 2718 |
| 373 | Ga0496122_0002401 | 3300048925 | Bacteria | 26723 |
| 374 | Ga0496122_0005248 | 3300048925 | Bacteria | 15531 |
| 375 | Ga0496122_0006637 | 3300048925 | Bacteria | 13197 |
| 376 | Ga0496122_0017991 | 3300048925 | Bacteria | 6557 |
| 377 | Ga0496122_0055659 | 3300048925 | Bacteria | 2956 |
| 378 | Ga0496123_0001631 | 3300048926 | Bacteria | 30231 |
| 379 | Ga0496123_0001840 | 3300048926 | Bacteria | 27847 |
| 380 | Ga0496123_0010024 | 3300048926 | Bacteria | 8440 |
| 381 | Ga0496123_0015195 | 3300048926 | Bacteria | 6332 |
| 382 | Ga0496124_0000091 | 3300048927 | Bacteria | 189706 |
| 383 | Ga0496124_0002145 | 3300048927 | Bacteria | 26496 |
| 384 | Ga0496124_0005692 | 3300048927 | Bacteria | 13887 |
| 385 | Ga0496124_0063422 | 3300048927 | Bacteria | 3087 |
| 386 | Ga0496124_0092560 | 3300048927 | Bacteria | 2462 |
| 387 | Ga0496124_0134262 | 3300048927 | Bacteria | 1962 |
| 388 | Ga0496125_0009340 | 3300048928 | Bacteria | 10102 |
| 389 | Ga0496125_0020498 | 3300048928 | Bacteria | 6204 |
| 390 | Ga0496125_0022434 | 3300048928 | Bacteria | 5863 |
| 391 | Ga0496125_0043939 | 3300048928 | Bacteria | 3786 |
| 392 | Ga0496125_0118063 | 3300048928 | Bacteria | 1901 |
| 393 | Ga0496125_0140072 | 3300048928 | Bacteria | 1683 |
| 394 | Ga0496125_0272524 | 3300048928 | Bacteria | 1053 |
| 395 | Ga0496126_0023730 | 3300048929 | Bacteria | 5939 |
| 396 | Ga0495678_049617 | 3300049459 | Bacteria | 1630 |
| 397 | Ga0495682_0011423 | 3300049460 | Bacteria | 3416 |
| 398 | Ga0501031_0000011 | 3300049568 | Bacteria | 142761 |
| 399 | Ga0501031_0042119 | 3300049568 | Bacteria | 2981 |
| 400 | Ga0501032_0000006 | 3300049569 | Bacteria | 261727 |
| 401 | Ga0501032_0000709 | 3300049569 | Bacteria | 27160 |
| 402 | Ga0501032_0058310 | 3300049569 | Bacteria | 2592 |
| 403 | Ga0501033_0000039 | 3300049570 | Bacteria | 142732 |
| 404 | Ga0501033_0001176 | 3300049570 | Bacteria | 23604 |
| 405 | Ga0501033_0022985 | 3300049570 | Bacteria | 4700 |
| 406 | Ga0501034_0000030 | 3300049571 | Bacteria | 248180 |
| 407 | Ga0501034_0000249 | 3300049571 | Bacteria | 99562 |
| 408 | Ga0501034_0002073 | 3300049571 | Bacteria | 25028 |
| 409 | Ga0501036_0000003 | 3300049572 | Bacteria | 261545 |
| 410 | Ga0501036_0007299 | 3300049572 | Bacteria | 9002 |
| 411 | Ga0501037_0000003 | 3300049573 | Bacteria | 261548 |
| 412 | Ga0501037_0000397 | 3300049573 | Bacteria | 36172 |
| 413 | Ga0501038_0000004 | 3300049574 | Bacteria | 261289 |
| 414 | Ga0501038_0000600 | 3300049574 | Bacteria | 31954 |
| 415 | Ga0501039_0000008 | 3300049575 | Bacteria | 274778 |
| 416 | Ga0501039_0000027 | 3300049575 | Bacteria | 150215 |
| 417 | Ga0501039_0133217 | 3300049575 | Bacteria | 1951 |
| 418 | Ga0501040_0028066 | 3300049576 | Bacteria | 3792 |
| 419 | Ga0501043_0000047 | 3300049579 | Bacteria | 110659 |
| 420 | Ga0501043_0002417 | 3300049579 | Bacteria | 15803 |
| 421 | Ga0501046_0105576 | 3300049580 | Bacteria | 2157 |
| 422 | Ga0501047_0009317 | 3300049581 | Bacteria | 9271 |
| 423 | Ga0501070_0011330 | 3300049586 | Bacteria | 7534 |
| 424 | Ga0501208_000284 | 3300049655 | Bacteria | 3729 |
| 425 | Ga0501223_000029 | 3300049663 | Bacteria | 51244 |
| 426 | Ga0501223_006205 | 3300049663 | Bacteria | 2481 |
| 427 | Ga0501224_001692 | 3300049664 | Bacteria | 2958 |
| 428 | Ga0501227_003707 | 3300049665 | Bacteria | 3308 |
| 429 | Ga0501235_004256 | 3300049669 | Bacteria | 3101 |
| 430 | Ga0501246_000084 | 3300049676 | Bacteria | 5360 |
| 431 | Ga0501249_000808 | 3300049679 | Bacteria | 6950 |
| 432 | Ga0501259_001172 | 3300049688 | Bacteria | 4366 |
| 433 | Ga0501260_001377 | 3300049689 | Bacteria | 1999 |
| 434 | Ga0501225_0000118 | 3300049705 | Bacteria | 24573 |
| 435 | Ga0501225_0000127 | 3300049705 | Bacteria | 23477 |
| 436 | Ga0501035_0000031 | 3300049822 | Bacteria | 175591 |
| 437 | Ga0501035_0000132 | 3300049822 | Bacteria | 90625 |
| 438 | Ga0501035_0000552 | 3300049822 | Bacteria | 41623 |
| 439 | Ga0501035_0033002 | 3300049822 | Bacteria | 4708 |
| 440 | Ga0501035_0033894 | 3300049822 | Bacteria | 4642 |
| 441 | Ga0501044_0000008 | 3300049823 | Bacteria | 274778 |
| 442 | Ga0501044_0003531 | 3300049823 | Bacteria | 17604 |
| 443 | Ga0501044_0126666 | 3300049823 | Bacteria | 2551 |
| 444 | Ga0501045_0185056 | 3300049824 | Bacteria | 1552 |
| 445 | Ga0501204_000078 | 3300049850 | Bacteria | 6894 |
| 446 | Ga0501212_001435 | 3300049851 | Bacteria | 2687 |
| 447 | nmdc:mga00v17_68363_c1 | 3300050491 | Bacteria | 2196 |
| 448 | nmdc:mga0yw44_41152_c1 | 3300050492 | Bacteria | 2749 |
| 449 | nmdc:mga0k408_7821_c1 | 3300050493 | Bacteria | 5715 |
| 450 | nmdc:mga07m45_156967_c1 | 3300050496 | Bacteria | 1320 |
| 451 | nmdc:mga09592_11020_c1 | 3300050508 | Bacteria | 7354 |
| 452 | nmdc:mga0sz30_60190_c1 | 3300050516 | Bacteria | 1621 |
| 453 | Ga0495601_0120744 | 3300053077 | Bacteria | 1702 |
| 454 | Ga0495619_0024288 | 3300053085 | Bacteria | 3887 |
| 455 | Ga0500651_0019866 | 3300053093 | Bacteria | 4180 |
| 456 | Ga0500651_0020261 | 3300053093 | Bacteria | 4139 |
| 457 | Ga0500566_0026793 | 3300053094 | Bacteria | 3374 |
| 458 | Ga0500650_0000508 | 3300053098 | Bacteria | 9861 |
| 459 | Ga0500650_0068455 | 3300053098 | Bacteria | 1659 |
| 460 | Ga0500554_001632 | 3300053102 | Bacteria | 4309 |
| 461 | Ga0500556_0000016 | 3300053104 | Bacteria | 194958 |
| 462 | Ga0500556_0000810 | 3300053104 | Bacteria | 18182 |
| 463 | Ga0500562_003048 | 3300053108 | Bacteria | 4188 |
| 464 | Ga0500569_012416 | 3300053109 | Bacteria | 2060 |
| 465 | Ga0500572_010855 | 3300053111 | Bacteria | 2190 |
| 466 | Ga0500572_025169 | 3300053111 | Bacteria | 1612 |
| 467 | Ga0500592_001844 | 3300053116 | Bacteria | 3416 |
| 468 | Ga0500592_003932 | 3300053116 | Bacteria | 2373 |
| 469 | Ga0500595_001202 | 3300053119 | Bacteria | 14313 |
| 470 | Ga0500608_003662 | 3300053122 | Bacteria | 5809 |
| 471 | Ga0500642_0000017 | 3300053130 | Bacteria | 167670 |
| 472 | Ga0500652_000306 | 3300053131 | Bacteria | 17755 |
| 473 | Ga0500559_0017685 | 3300053136 | Bacteria | 3012 |
| 474 | Ga0500568_0002231 | 3300053139 | Bacteria | 11614 |
| 475 | Ga0500586_086745 | 3300053145 | Bacteria | 1099 |
| 476 | Ga0500588_0007028 | 3300053146 | Bacteria | 2580 |
| 477 | Ga0500604_0000678 | 3300053151 | Bacteria | 9334 |
| 478 | Ga0500616_0000169 | 3300053153 | Bacteria | 109205 |
| 479 | Ga0500619_002793 | 3300053154 | Bacteria | 3442 |
| 480 | Ga0500620_001058 | 3300053155 | Bacteria | 4859 |
| 481 | Ga0500622_0001376 | 3300053156 | Bacteria | 19604 |
| 482 | Ga0500622_0010216 | 3300053156 | Bacteria | 5160 |
| 483 | Ga0500624_002796 | 3300053157 | Bacteria | 2321 |
| 484 | Ga0500627_0000006 | 3300053158 | Bacteria | 165989 |
| 485 | Ga0500627_0025346 | 3300053158 | Bacteria | 2436 |
| 486 | Ga0500634_0000026 | 3300053161 | Bacteria | 81353 |
| 487 | Ga0500634_0023416 | 3300053161 | Bacteria | 3356 |
| 488 | Ga0500636_0000001 | 3300053177 | Bacteria | 324086 |
| 489 | Ga0500636_0004081 | 3300053177 | Bacteria | 8246 |
| 490 | Ga0500645_001113 | 3300053730 | Bacteria | 14678 |
| 491 | Ga0500645_010101 | 3300053730 | Bacteria | 3140 |
| 492 | Ga0500645_035591 | 3300053730 | Bacteria | 1482 |
| 493 | 2511123988 | 2510917020 | Bacteria | 5657507 |
| 494 | 2513866721 | 2513237138 | Bacteria | 7368160 |
| 495 | 2514586834 | 2513237351 | Bacteria | 6968952 |
| 496 | 2524610887 | 2524023250 | Bacteria | 5457705 |
| 497 | 2526213480 | 2526164512 | Bacteria | 4025691 |
| 498 | 2574430901 | 2574179768 | Bacteria | 4907129 |
| 499 | 2585401472 | 2582581867 | Bacteria | 7184437 |
| 500 | 2585821165 | 2585427590 | Bacteria | 6824633 |
| 501 | 2601667785 | 2600255292 | Bacteria | 6300551 |
| 502 | 2603858198 | 2602042107 | Bacteria | 6226103 |
| 503 | 2643797234 | 2643221556 | Bacteria | 7251154 |
| 504 | 2644027328 | 2643221603 | Bacteria | 6147767 |
| 505 | 2644474224 | 2643221684 | Bacteria | 7145183 |
| 506 | 2753359969 | 2751185800 | Bacteria | 5467370 |
| 507 | 2758642288 | 2758568016 | Bacteria | 5645291 |
| 508 | 2819538862 | 2818991435 | Bacteria | 5433759 |
| 509 | 2819542120 | 2818991436 | Bacteria | 5376622 |
| 510 | 2842333518 | 2842333319 | Bacteria | 8899485 |
| 511 | 2847690422 | 2847686936 | Bacteria | 6278406 |
| 512 | 2857527589 | 2857524615 | Bacteria | 6615449 |
| 513 | 2857550187 | 2857547612 | Bacteria | 6179999 |
| 514 | 2871448662 | 2871444079 | Bacteria | 6423508 |
| 515 | 2871497708 | 2871495908 | Bacteria | 6935695 |
| 516 | 2874103827 | 2874102143 | Bacteria | 6342645 |
| 517 | 2876396576 | 2876392853 | Bacteria | 6660880 |
| 518 | 2878761931 | 2878760144 | Bacteria | 6823465 |
| 519 | 2878768897 | 2878767105 | Bacteria | 6898628 |
| 520 | 2881165905 | 2881161766 | Bacteria | 7127907 |
| 521 | 2882806923 | 2882806704 | Bacteria | 3007728 |
| 522 | 2883581075 | 2883577096 | Bacteria | 4709178 |
| 523 | 2885082550 | 2885080285 | Bacteria | 6355622 |
| 524 | 2885307391 | 2885305155 | Bacteria | 7348390 |
| 525 | 2885327548 | 2885326080 | Bacteria | 7134805 |
| 526 | 2885340136 | 2885334103 | Bacteria | 7216818 |
| 527 | 2893067080 | 2893066018 | Bacteria | 6158120 |
| 528 | 2894818603 | 2894817345 | Bacteria | 4892941 |
| 529 | 2903542506 | 2903540706 | Bacteria | 7062119 |
| 530 | 2904663352 | 2904659560 | Bacteria | 6685615 |
| 531 | 2906333593 | 2906328253 | Bacteria | 6585166 |
| 532 | 2915653354 | 2915650412 | Bacteria | 4288180 |
| 533 | 2919073441 | 2919073203 | Bacteria | 6531949 |
| 534 | 2919142002 | 2919138771 | Bacteria | 5281312 |
| 535 | 2919713096 | 2919709256 | Bacteria | 4318106 |
| 536 | 2923556947 | 2923556063 | Bacteria | 6793593 |
| 537 | 2924732912 | 2924726620 | Bacteria | 6271473 |
| 538 | 2924767308 | 2924762789 | Bacteria | 6561353 |
| 539 | 2928135224 | 2928130867 | Bacteria | 5467269 |
| 540 | 2932411397 | 2932410948 | Bacteria | 6312192 |
| 541 | 2932419036 | 2932416698 | Bacteria | 6315112 |
| 542 | 2937825342 | 2937822353 | Bacteria | 7290551 |
| 543 | 2937896474 | 2937891427 | Bacteria | 6357007 |
| 544 | 2937996359 | 2937994558 | Bacteria | 7036190 |
| 545 | 2958115246 | 2958115193 | Bacteria | 6923548 |
| 546 | 2958166829 | 2958165035 | Bacteria | 6906348 |
| 547 | 2961118379 | 2961114664 | Bacteria | 6680456 |
| 548 | 2961165299 | 2961163497 | Bacteria | 6901077 |
| 549 | 2965020121 | 2965018300 | Bacteria | 6883036 |
| 550 | 2965066652 | 2965062239 | Bacteria | 7412989 |
| 551 | 2968091743 | 2968091066 | Bacteria | 6052692 |
| 552 | 2968101585 | 2968097103 | Bacteria | 6107094 |
| 553 | 2968114440 | 2968110612 | Bacteria | 6814636 |
| 554 | 2968133286 | 2968128360 | Bacteria | 6270294 |
| 555 | 2968173700 | 2968171901 | Bacteria | 6894245 |
| 556 | 2970556786 | 2970554993 | Bacteria | 6814252 |
| 557 | 2977861455 | 2977858184 | Bacteria | 6215359 |
| 558 | 2977868821 | 2977864932 | Bacteria | 7534097 |
| 559 | 2979785843 | 2979779861 | Bacteria | 6219781 |
| 560 | 2987661306 | 2987659509 | Bacteria | 6966464 |
| 561 | 2987671169 | 2987666974 | Bacteria | 6509233 |
| 562 | 2996339363 | 2996336353 | Bacteria | 5511628 |
| 563 | 2996348188 | 2996341866 | Bacteria | 6643098 |
| 564 | 3004190355 | 3004188549 | Bacteria | 6952365 |
| 565 | 8004447533 | 8004445564 | Bacteria | 6322258 |
| 566 | 8004714002 | 8004703790 | Bacteria | 8006957 |
| 567 | 8047674922 | 8047673197 | Bacteria | 7395230 |
| 568 | 8054465297 | 8054460903 | Bacteria | 4872905 |
| 569 | 8057103626 | 8057101203 | Bacteria | 5034064 |
| 570 | Ga0070663_100070931 | |||
| 571 | JGI24741J21665_1000260 | |||
| 572 | JGI24741J21665_1000419 | |||
| 573 | JGI24740J21852_10000367 | |||
| 574 | JGI24740J21852_10014752 | |||
| 575 | JGI24739J22299_10021453 | |||
| 576 | JGI24737J22298_10052345 | |||
| 577 | JGI24735J21928_10007699 | |||
| 578 | JGI24738J21930_10001501 | |||
| 579 | JGI25162J39368_1000023 | |||
| 580 | Ga0006765J45826_110238 | |||
| 581 | Ga0006778J45830_1020868 | |||
| 582 | Ga0006759J45824_1015261 | |||
| 583 | JGI25151J46595_10035708 | |||
| 584 | JGI25165J46597_1000030 | |||
| 585 | JGI25153J46596_10039803 | |||
| 586 | Ga0006770J48903_1032935 | |||
| 587 | Ga0006777J48905_1023824 | |||
| 588 | rootL2_10033365 | |||
| 589 | Ga0007417J51691_1011869 | |||
| 590 | Ga0007410J51695_1009390 | |||
| 591 | Ga0007410J51695_1014429 | |||
| 592 | Ga0007416J51690_1008920 | |||
| 593 | Ga0007416J51690_1018576 | |||
| 594 | Ga0007416J51690_1024555 | |||
| 595 | Ga0007429J51699_1028792 | |||
| 596 | Ga0032354_1007554 | |||
| 597 | Ga0032354_1019704 | |||
| 598 | Ga0055538_1000017 | |||
| 599 | Ga0055539_1000022 | |||
| 600 | Ga0055533_1000030 | |||
| 601 | Ga0055525_1000008 | |||
| 602 | Ga0055525_1000034 | |||
| 603 | Ga0055534_1009225 | |||
| 604 | Ga0055541_1000015 | |||
| 605 | Ga0065165_1014489 | |||
| 606 | Ga0065704_10002162 | |||
| 607 | Ga0070658_10084785 | |||
| 608 | Ga0070670_100006633 | |||
| 609 | Ga0070660_100074145 | |||
| 610 | Ga0070660_100237871 | |||
| 611 | Ga0070661_100042881 | |||
| 612 | Ga0070661_100055517 | |||
| 613 | Ga0070661_100059034 | |||
| 614 | Ga0070671_100002581 | |||
| 615 | Ga0070659_100008470 | |||
| 616 | Ga0070667_100003584 | |||
| 617 | Ga0070663_100001722 | |||
| 618 | Ga0070663_100270009 | |||
| 619 | Ga0070684_100172668 | |||
| 620 | Ga0068853_100001039 | |||
| 621 | Ga0068853_100046985 | |||
| 622 | Ga0070665_100000927 | |||
| 623 | Ga0070665_100008868 | |||
| 624 | Ga0070665_100011097 | |||
| 625 | Ga0068855_100000165 | |||
| 626 | Ga0068855_100013735 | |||
| 627 | Ga0068855_100037456 | |||
| 628 | Ga0068855_100125837 | |||
| 629 | Ga0070664_100008914 | |||
| 630 | Ga0070664_100010691 | |||
| 631 | Ga0070664_100139180 | |||
| 632 | Ga0068857_100001505 | |||
| 633 | Ga0068857_100262820 | |||
| 634 | Ga0068856_100262344 | |||
| 635 | Ga0068852_100002547 | |||
| 636 | Ga0068859_100083338 | |||
| 637 | Ga0068864_100007096 | |||
| 638 | Ga0068863_100004007 | |||
| 639 | Ga0068863_100006004 | |||
| 640 | Ga0068858_100001747 | |||
| 641 | Ga0068858_100271511 | |||
| 642 | Ga0075365_10006738 | |||
| 643 | Ga0075369_10054291 | |||
| 644 | Ga0075369_10082362 | |||
| 645 | Ga0075366_10030923 | |||
| 646 | Ga0068871_100114981 | |||
| 647 | Ga0075430_100017802 | |||
| 648 | Ga0075430_100064109 | |||
| 649 | Ga0075429_100012542 | |||
| 650 | Ga0097620_100083346 | |||
| 651 | Ga0105244_10035551 | |||
| 652 | Ga0105240_10433822 | |||
| 653 | Ga0105245_10013465 | |||
| 654 | Ga0105241_10137254 | |||
| 655 | Ga0105242_10130978 | |||
| 656 | Ga0105248_10014264 | |||
| 657 | Ga0105249_10230353 | |||
| 658 | Ga0105239_10287338 | |||
| 659 | Ga0105246_10010241 | |||
| 660 | Ga0157373_10007598 | |||
| 661 | Ga0157373_10148746 | |||
| 662 | Ga0157370_10234319 | |||
| 663 | Ga0157369_10000454 | |||
| 664 | Ga0157374_10002222 | |||
| 665 | Ga0157374_10051713 | |||
| 666 | Ga0157375_10024501 | |||
| 667 | Ga0182008_10000245 | |||
| 668 | Ga0157379_10235838 | |||
| 669 | Ga0157376_10323459 | |||
| 670 | Ga0157376_10356168 | |||
| 671 | Ga0182006_1000002 | |||
| 672 | Ga0182006_1013052 | |||
| 673 | Ga0182007_10000085 | |||
| 674 | Ga0182005_1000002 | |||
| 675 | Ga0182005_1000510 | |||
| 676 | Ga0163161_10011348 | |||
| 677 | Ga0163161_10035548 | |||
| 678 | Ga0163161_10175728 | |||
| 679 | Ga0209784_100034 | |||
| 680 | Ga0209566_100038 | |||
| 681 | Ga0209674_100056 | |||
| 682 | Ga0209563_100003 | |||
| 683 | Ga0209563_100057 | |||
| 684 | Ga0207427_100856 | |||
| 685 | Ga0209437_100071 | |||
| 686 | Ga0209677_100035 | |||
| 687 | Ga0209148_1001190 | |||
| 688 | Ga0209233_1000094 | |||
| 689 | Ga0209675_1000327 | |||
| 690 | Ga0209025_1000718 | |||
| 691 | Ga0209564_1000904 | |||
| 692 | Ga0209758_1001538 | |||
| 693 | Ga0207655_1055289 | |||
| 694 | Ga0207680_10041120 | |||
| 695 | Ga0207647_10087987 | |||
| 696 | Ga0207671_10031186 | |||
| 697 | Ga0207671_10209230 | |||
| 698 | Ga0207657_10025883 | |||
| 699 | Ga0207649_10045722 | |||
| 700 | Ga0207650_10053055 | |||
| 701 | Ga0207706_10057966 | |||
| 702 | Ga0207686_10180008 | |||
| 703 | Ga0207679_10010981 | |||
| 704 | Ga0207667_10000102 | |||
| 705 | Ga0207667_10027752 | |||
| 706 | Ga0207640_10150762 | |||
| 707 | Ga0207658_10108525 | |||
| 708 | Ga0207639_10000172 | |||
| 709 | Ga0207639_10000862 | |||
| 710 | Ga0207678_10002803 | |||
| 711 | Ga0207678_10228110 | |||
| 712 | Ga0207678_10364918 | |||
| 713 | Ga0207702_10001274 | |||
| 714 | Ga0207702_10001506 | |||
| 715 | Ga0207702_10362263 | |||
| 716 | Ga0207641_10030848 | |||
| 717 | Ga0207674_10002930 | |||
| 718 | Ga0207674_10213527 | |||
| 719 | Ga0207698_10005652 | |||
| 720 | Ga0207698_10078006 | |||
| 721 | Ga0207428_10087142 | |||
| 722 | Ga0268266_10005842 | |||
| 723 | Ga0268266_10026341 | |||
| 724 | Ga0268264_10258314 | |||
| 725 | Ga0307515_10096394 | |||
| 726 | Ga0307405_10000797 | |||
| 727 | Ga0307405_10033612 | |||
| 728 | Ga0307413_10053665 | |||
| 729 | Ga0307412_10172932 | |||
| 730 | Ga0307409_100050064 | |||
| 731 | Ga0307416_100006045 | |||
| 732 | Ga0307416_100034262 | |||
| 733 | Ga0307414_10000811 | |||
| 734 | Ga0307414_10001083 | |||
| 735 | Ga0307411_10059708 | |||
| 736 | Ga0395899_0000611 | |||
| 737 | Ga0395899_0001045 | |||
| 738 | Ga0395899_0001645 | |||
| 739 | Ga0395899_0001913 | |||
| 740 | Ga0395899_0002844 | |||
| 741 | Ga0395899_0006861 | |||
| 742 | Ga0395899_0024620 | |||
| 743 | Ga0395899_0110444 | |||
| 744 | Ga0395900_0000065 | |||
| 745 | Ga0395900_0001188 | |||
| 746 | Ga0395900_0003753 | |||
| 747 | Ga0395900_0029650 | |||
| 748 | Ga0395900_0038860 | |||
| 749 | Ga0395900_0079373 | |||
| 750 | Ga0395900_0121501 | |||
| 751 | Ga0395900_0135831 | |||
| 752 | Ga0395900_0168018 | |||
| 753 | Ga0395900_0386474 | |||
| 754 | Ga0395900_0427393 | |||
| 755 | Ga0395898_0002178 | |||
| 756 | Ga0395898_0052348 | |||
| 757 | Ga0395898_0063613 | |||
| 758 | Ga0395898_0146441 | |||
| 759 | Ga0395898_0147897 | |||
| 760 | Ga0395898_0199890 | |||
| 761 | Ga0395905_0009767 | |||
| 762 | Ga0395905_0009921 | |||
| 763 | Ga0395905_0044930 | |||
| 764 | Ga0395905_0079883 | |||
| 765 | Ga0395905_0205777 | |||
| 766 | Ga0395905_0219066 | |||
| 767 | Ga0395905_0247987 | |||
| 768 | Ga0395901_0000639 | |||
| 769 | Ga0395901_0001168 | |||
| 770 | Ga0395901_0026367 | |||
| 771 | Ga0395901_0087254 | |||
| 772 | Ga0395901_0088362 | |||
| 773 | Ga0395901_0146006 | |||
| 774 | Ga0395901_0151420 | |||
| 775 | Ga0395901_0162969 | |||
| 776 | Ga0395901_0173338 | |||
| 777 | Ga0237819_00294 | |||
| 778 | Ga0436360_0133011 | |||
| 779 | Ga0436360_0276241 | |||
| 780 | Ga0436360_0592760 | |||
| 781 | Ga0436361_0680047 | |||
| 782 | Ga0436361_0782000 | |||
| 783 | Ga0436361_0958713 | |||
| 784 | Ga0436361_0997150 | |||
| 785 | Ga0439465_0011183 | |||
| 786 | Ga0451807_2630938 | |||
| 787 | Ga0451843_1375105 | |||
| 788 | Ga0439448_0000958 | |||
| 789 | Ga0439450_005353 | |||
| 790 | Ga0439450_014675 | |||
| 791 | Ga0439458_0007464 | |||
| 792 | Ga0451577_0046403 | |||
| 793 | Ga0466972_0000360 | |||
| 794 | Ga0466972_0007306 | |||
| 795 | Ga0466972_0022679 | |||
| 796 | Ga0466972_0027029 | |||
| 797 | Ga0466965_0014090 | |||
| 798 | Ga0466966_0003020 | |||
| 799 | Ga0466966_0007250 | |||
| 800 | Ga0466964_0001175 | |||
| 801 | Ga0466964_0016570 | |||
| 802 | Ga0466964_0025539 | |||
| 803 | Ga0466964_0029681 | |||
| 804 | Ga0466964_0045855 | |||
| 805 | Ga0453684_0002679 | |||
| 806 | Ga0466968_0005763 | |||
| 807 | Ga0466968_0011790 | |||
| 808 | Ga0466968_0011965 | |||
| 809 | Ga0466968_0059125 | |||
| 810 | Ga0466970_0038393 | |||
| 811 | Ga0466957_0000075 | |||
| 812 | Ga0466957_0022510 | |||
| 813 | Ga0466959_0018360 | |||
| 814 | Ga0466959_0032797 | |||
| 815 | Ga0466959_0059294 | |||
| 816 | Ga0451576_0009832 | |||
| 817 | Ga0495617_004157 | |||
| 818 | Ga0495627_000997 | |||
| 819 | Ga0495592_0008029 | |||
| 820 | Ga0495590_0001969 | |||
| 821 | Ga0495590_0022312 | |||
| 822 | Ga0495638_0034096 | |||
| 823 | Ga0495638_0103587 | |||
| 824 | Ga0495651_0008679 | |||
| 825 | Ga0495651_0047640 | |||
| 826 | Ga0495653_0132489 | |||
| 827 | Ga0495650_0007760 | |||
| 828 | Ga0495605_0000160 | |||
| 829 | Ga0495605_0003001 | |||
| 830 | Ga0495605_0059261 | |||
| 831 | Ga0495584_0000390 | |||
| 832 | Ga0495607_0002570 | |||
| 833 | Ga0495607_0002908 | |||
| 834 | Ga0495607_0010437 | |||
| 835 | Ga0495607_0011676 | |||
| 836 | Ga0495607_0055842 | |||
| 837 | Ga0495607_0059626 | |||
| 838 | Ga0495606_0000015 | |||
| 839 | Ga0495606_0002709 | |||
| 840 | Ga0495606_0025445 | |||
| 841 | Ga0495606_0097112 | |||
| 842 | Ga0495608_0005101 | |||
| 843 | Ga0495610_0000034 | |||
| 844 | Ga0495610_0028111 | |||
| 845 | Ga0495616_0002266 | |||
| 846 | Ga0495616_0047147 | |||
| 847 | Ga0495618_0004649 | |||
| 848 | Ga0495620_0021068 | |||
| 849 | Ga0495628_0003140 | |||
| 850 | Ga0495628_0004352 | |||
| 851 | Ga0495628_0089965 | |||
| 852 | Ga0495632_0005457 | |||
| 853 | Ga0495637_0003352 | |||
| 854 | Ga0495643_0000552 | |||
| 855 | Ga0495643_0008044 | |||
| 856 | Ga0495643_0012127 | |||
| 857 | Ga0495643_0038432 | |||
| 858 | Ga0495648_0001544 | |||
| 859 | Ga0495642_0001857 | |||
| 860 | Ga0495652_0066761 | |||
| 861 | Ga0495654_0010220 | |||
| 862 | Ga0495654_0035216 | |||
| 863 | Ga0495609_0000445 | |||
| 864 | Ga0495645_0009925 | |||
| 865 | Ga0495645_0025971 | |||
| 866 | Ga0495622_0012410 | |||
| 867 | Ga0495622_0017469 | |||
| 868 | Ga0495622_0027224 | |||
| 869 | Ga0495633_0000711 | |||
| 870 | Ga0495625_0039830 | |||
| 871 | Ga0495661_0001097 | |||
| 872 | Ga0495661_0001236 | |||
| 873 | Ga0495661_0003616 | |||
| 874 | Ga0495661_0007134 | |||
| 875 | Ga0495661_0013687 | |||
| 876 | Ga0495588_0000052 | |||
| 877 | Ga0495657_0042999 | |||
| 878 | Ga0495599_0003817 | |||
| 879 | Ga0495623_0020353 | |||
| 880 | Ga0495624_0050935 | |||
| 881 | Ga0495670_0019283 | |||
| 882 | Ga0495671_0024825 | |||
| 883 | Ga0495649_0144317 | |||
| 884 | Ga0495589_0000058 | |||
| 885 | Ga0495589_0001047 | |||
| 886 | Ga0495600_0033868 | |||
| 887 | Ga0495660_0000050 | |||
| 888 | Ga0495660_0025808 | |||
| 889 | Ga0495604_0006330 | |||
| 890 | Ga0495672_0000060 | |||
| 891 | Ga0495672_0006470 | |||
| 892 | Ga0495687_000003 | |||
| 893 | Ga0495687_000073 | |||
| 894 | Ga0495687_000489 | |||
| 895 | Ga0495687_044756 | |||
| 896 | Ga0495677_0000144 | |||
| 897 | Ga0495677_0006075 | |||
| 898 | Ga0495673_0000204 | |||
| 899 | Ga0495681_0000058 | |||
| 900 | Ga0495681_0001199 | |||
| 901 | Ga0495686_0000051 | |||
| 902 | Ga0495686_0000573 | |||
| 903 | Ga0495686_0001671 | |||
| 904 | Ga0495602_0129347 | |||
| 905 | Ga0495615_0000046 | |||
| 906 | Ga0495626_0000066 | |||
| 907 | Ga0495626_0000145 | |||
| 908 | Ga0495626_0016842 | |||
| 909 | Ga0495626_0072257 | |||
| 910 | Ga0496101_0052496 | |||
| 911 | Ga0496102_0000315 | |||
| 912 | Ga0496102_0091726 | |||
| 913 | Ga0496103_0000993 | |||
| 914 | Ga0496103_0198464 | |||
| 915 | Ga0496108_0001356 | |||
| 916 | Ga0496109_0276196 | |||
| 917 | Ga0496110_0017163 | |||
| 918 | Ga0496110_0095948 | |||
| 919 | Ga0496111_0113171 | |||
| 920 | Ga0496113_0007646 | |||
| 921 | Ga0496114_0000732 | |||
| 922 | Ga0496116_0005871 | |||
| 923 | Ga0496116_0013744 | |||
| 924 | Ga0496116_0114901 | |||
| 925 | Ga0496117_0000001 | |||
| 926 | Ga0496117_0000484 | |||
| 927 | Ga0496118_0000002 | |||
| 928 | Ga0496118_0000486 | |||
| 929 | Ga0496118_0035701 | |||
| 930 | Ga0496118_0125353 | |||
| 931 | Ga0496118_0159930 | |||
| 932 | Ga0496119_0089097 | |||
| 933 | Ga0496120_0001456 | |||
| 934 | Ga0496120_0025297 | |||
| 935 | Ga0496120_0092559 | |||
| 936 | Ga0496121_0000065 | |||
| 937 | Ga0496121_0001005 | |||
| 938 | Ga0496121_0015782 | |||
| 939 | Ga0496121_0055011 | |||
| 940 | Ga0496121_0061810 | |||
| 941 | Ga0496121_0074390 | |||
| 942 | Ga0496122_0002401 | |||
| 943 | Ga0496122_0005248 | |||
| 944 | Ga0496122_0006637 | |||
| 945 | Ga0496122_0017991 | |||
| 946 | Ga0496122_0055659 | |||
| 947 | Ga0496123_0001631 | |||
| 948 | Ga0496123_0001840 | |||
| 949 | Ga0496123_0010024 | |||
| 950 | Ga0496123_0015195 | |||
| 951 | Ga0496124_0000091 | |||
| 952 | Ga0496124_0002145 | |||
| 953 | Ga0496124_0005692 | |||
| 954 | Ga0496124_0063422 | |||
| 955 | Ga0496124_0092560 | |||
| 956 | Ga0496124_0134262 | |||
| 957 | Ga0496125_0009340 | |||
| 958 | Ga0496125_0020498 | |||
| 959 | Ga0496125_0022434 | |||
| 960 | Ga0496125_0043939 | |||
| 961 | Ga0496125_0118063 | |||
| 962 | Ga0496125_0140072 | |||
| 963 | Ga0496125_0272524 | |||
| 964 | Ga0496126_0023730 | |||
| 965 | Ga0495678_049617 | |||
| 966 | Ga0495682_0011423 | |||
| 967 | Ga0501031_0000011 | |||
| 968 | Ga0501031_0042119 | |||
| 969 | Ga0501032_0000006 | |||
| 970 | Ga0501032_0000709 | |||
| 971 | Ga0501032_0058310 | |||
| 972 | Ga0501033_0000039 | |||
| 973 | Ga0501033_0001176 | |||
| 974 | Ga0501033_0022985 | |||
| 975 | Ga0501034_0000030 | |||
| 976 | Ga0501034_0000249 | |||
| 977 | Ga0501034_0002073 | |||
| 978 | Ga0501036_0000003 | |||
| 979 | Ga0501036_0007299 | |||
| 980 | Ga0501037_0000003 | |||
| 981 | Ga0501037_0000397 | |||
| 982 | Ga0501038_0000004 | |||
| 983 | Ga0501038_0000600 | |||
| 984 | Ga0501039_0000008 | |||
| 985 | Ga0501039_0000027 | |||
| 986 | Ga0501039_0133217 | |||
| 987 | Ga0501040_0028066 | |||
| 988 | Ga0501043_0000047 | |||
| 989 | Ga0501043_0002417 | |||
| 990 | Ga0501046_0105576 | |||
| 991 | Ga0501047_0009317 | |||
| 992 | Ga0501070_0011330 | |||
| 993 | Ga0501208_000284 | |||
| 994 | Ga0501223_000029 | |||
| 995 | Ga0501223_006205 | |||
| 996 | Ga0501224_001692 | |||
| 997 | Ga0501227_003707 | |||
| 998 | Ga0501235_004256 | |||
| 999 | Ga0501246_000084 | |||
| 1000 | Ga0501249_000808 | |||
| 1001 | Ga0501259_001172 | |||
| 1002 | Ga0501260_001377 | |||
| 1003 | Ga0501225_0000118 | |||
| 1004 | Ga0501225_0000127 | |||
| 1005 | Ga0501035_0000031 | |||
| 1006 | Ga0501035_0000132 | |||
| 1007 | Ga0501035_0000552 | |||
| 1008 | Ga0501035_0033002 | |||
| 1009 | Ga0501035_0033894 | |||
| 1010 | Ga0501044_0000008 | |||
| 1011 | Ga0501044_0003531 | |||
| 1012 | Ga0501044_0126666 | |||
| 1013 | Ga0501045_0185056 | |||
| 1014 | Ga0501204_000078 | |||
| 1015 | Ga0501212_001435 | |||
| 1016 | nmdc:mga00v17_68363_c1 | |||
| 1017 | nmdc:mga0yw44_41152_c1 | |||
| 1018 | nmdc:mga0k408_7821_c1 | |||
| 1019 | nmdc:mga07m45_156967_c1 | |||
| 1020 | nmdc:mga09592_11020_c1 | |||
| 1021 | nmdc:mga0sz30_60190_c1 | |||
| 1022 | Ga0495601_0120744 | |||
| 1023 | Ga0495619_0024288 | |||
| 1024 | Ga0500651_0019866 | |||
| 1025 | Ga0500651_0020261 | |||
| 1026 | Ga0500566_0026793 | |||
| 1027 | Ga0500650_0000508 | |||
| 1028 | Ga0500650_0068455 | |||
| 1029 | Ga0500554_001632 | |||
| 1030 | Ga0500556_0000016 | |||
| 1031 | Ga0500556_0000810 | |||
| 1032 | Ga0500562_003048 | |||
| 1033 | Ga0500569_012416 | |||
| 1034 | Ga0500572_010855 | |||
| 1035 | Ga0500572_025169 | |||
| 1036 | Ga0500592_001844 | |||
| 1037 | Ga0500592_003932 | |||
| 1038 | Ga0500595_001202 | |||
| 1039 | Ga0500608_003662 | |||
| 1040 | Ga0500642_0000017 | |||
| 1041 | Ga0500652_000306 | |||
| 1042 | Ga0500559_0017685 | |||
| 1043 | Ga0500568_0002231 | |||
| 1044 | Ga0500586_086745 | |||
| 1045 | Ga0500588_0007028 | |||
| 1046 | Ga0500604_0000678 | |||
| 1047 | Ga0500616_0000169 | |||
| 1048 | Ga0500619_002793 | |||
| 1049 | Ga0500620_001058 | |||
| 1050 | Ga0500622_0001376 | |||
| 1051 | Ga0500622_0010216 | |||
| 1052 | Ga0500624_002796 | |||
| 1053 | Ga0500627_0000006 | |||
| 1054 | Ga0500627_0025346 | |||
| 1055 | Ga0500634_0000026 | |||
| 1056 | Ga0500634_0023416 | |||
| 1057 | Ga0500636_0000001 | |||
| 1058 | Ga0500636_0004081 | |||
| 1059 | Ga0500645_001113 | |||
| 1060 | Ga0500645_010101 | |||
| 1061 | Ga0500645_035591 | |||
| 1062 | 2511123988 | |||
| 1063 | 2513866721 | |||
| 1064 | 2514586834 | |||
| 1065 | 2524610887 | |||
| 1066 | 2526213480 | |||
| 1067 | 2574430901 | |||
| 1068 | 2585401472 | |||
| 1069 | 2585821165 | |||
| 1070 | 2601667785 | |||
| 1071 | 2603858198 | |||
| 1072 | 2643797234 | |||
| 1073 | 2644027328 | |||
| 1074 | 2644474224 | |||
| 1075 | 2753359969 | |||
| 1076 | 2758642288 | |||
| 1077 | 2819538862 | |||
| 1078 | 2819542120 | |||
| 1079 | 2842333518 | |||
| 1080 | 2847690422 | |||
| 1081 | 2857527589 | |||
| 1082 | 2857550187 | |||
| 1083 | 2871448662 | |||
| 1084 | 2871497708 | |||
| 1085 | 2874103827 | |||
| 1086 | 2876396576 | |||
| 1087 | 2878761931 | |||
| 1088 | 2878768897 | |||
| 1089 | 2881165905 | |||
| 1090 | 2882806923 | |||
| 1091 | 2883581075 | |||
| 1092 | 2885082550 | |||
| 1093 | 2885307391 | |||
| 1094 | 2885327548 | |||
| 1095 | 2885340136 | |||
| 1096 | 2893067080 | |||
| 1097 | 2894818603 | |||
| 1098 | 2903542506 | |||
| 1099 | 2904663352 | |||
| 1100 | 2906333593 | |||
| 1101 | 2915653354 | |||
| 1102 | 2919073441 | |||
| 1103 | 2919142002 | |||
| 1104 | 2919713096 | |||
| 1105 | 2923556947 | |||
| 1106 | 2924732912 | |||
| 1107 | 2924767308 | |||
| 1108 | 2928135224 | |||
| 1109 | 2932411397 | |||
| 1110 | 2932419036 | |||
| 1111 | 2937825342 | |||
| 1112 | 2937896474 | |||
| 1113 | 2937996359 | |||
| 1114 | 2958115246 | |||
| 1115 | 2958166829 | |||
| 1116 | 2961118379 | |||
| 1117 | 2961165299 | |||
| 1118 | 2965020121 | |||
| 1119 | 2965066652 | |||
| 1120 | 2968091743 | |||
| 1121 | 2968101585 | |||
| 1122 | 2968114440 | |||
| 1123 | 2968133286 | |||
| 1124 | 2968173700 | |||
| 1125 | 2970556786 | |||
| 1126 | 2977861455 | |||
| 1127 | 2977868821 | |||
| 1128 | 2979785843 | |||
| 1129 | 2987661306 | |||
| 1130 | 2987671169 | |||
| 1131 | 2996339363 | |||
| 1132 | 2996348188 | |||
| 1133 | 3004190355 | |||
| 1134 | 8004447533 | |||
| 1135 | 8004714002 | |||
| 1136 | 8047674922 | |||
| 1137 | 8054465297 | |||
| 1138 | 8057103626 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kw3-assembly1.cif.gz_A | crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate | 0.9644 | 6 | 362 |
| 3kw3-assembly1.cif.gz_B | crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate | 0.9621 | 6 | 362 |
| 3kw3-assembly1.cif.gz_A | crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate | 0.9562 | 6 | 362 |
| 3kw3-assembly1.cif.gz_B | crystal structure of alanine racemase from bartonella henselae with covalently bound pyridoxal phosphate | 0.9543 | 6 | 362 |
| 6a2f-assembly1.cif.gz_B | crystal structure of biosynthetic alanine racemase from pseudomonas aeruginosa | 0.9231 | 6 | 363 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5yycC01 | Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 | 0.9632 | 238 | 360 | 2.40.37.10 |
| af_P29012_211_355_2.40.37.10 | Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 | 0.9593 | 234 | 357 | 2.40.37.10 |
| 4tloA01 | Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 | 0.9592 | 235 | 364 | 2.40.37.10 |
| af_Q9P5N3_224_370_2.40.37.10 | Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 | 0.9589 | 234 | 357 | 2.40.37.10 |
| 3kw3B02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9587 | 17 | 225 | 3.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5T2H0X2-F1-model_v4 | Alanine racemase 3 | 0.9891 | 13 | 122 |
GO:0005829
GO:0008784 GO:0030170 GO:0030632 |
| AF-A0A3C0M8M9-F1-model_v4 | alanine racemase (EC 5.1.1.1) | 0.982 | 230 | 361 |
GO:0005829
GO:0008784 GO:0030170 GO:0030632 |
| AF-A0A848TSL6-F1-model_v4 | alanine racemase (EC 5.1.1.1) | 0.9815 | 235 | 366 |
GO:0005829
GO:0008784 GO:0030170 GO:0030632 |
| AF-A0A659URN1-F1-model_v4 | alanine racemase (EC 5.1.1.1) | 0.9794 | 38 | 203 |
GO:0005829
GO:0008784 GO:0030170 GO:0030632 |
| AF-A0A3D2L933-F1-model_v4 | alanine racemase (EC 5.1.1.1) | 0.9793 | 230 | 361 |
GO:0005829
GO:0008784 GO:0030170 GO:0030632 |