F462879
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 322 | 553 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100342918|Ga0307416_1003429182 |
| Length | 109 |
| Sequence | MEHEWSNGQTGLESDPKDAAMIEQDLTVTNRLGLHARATAKLVQTLSAYRSSATLTAKGREVNAKSIMGVMLLAAGQGTQVKLRVEGDDEDQAAAAVVSLFERRFDEDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 77 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 78 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 79 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 80 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 81 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 97 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 159 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 160 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 182 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 183 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 184 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 185 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 186 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 187 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 188 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 189 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 190 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 191 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 192 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 193 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 202 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 203 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 204 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 205 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 208 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 209 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 210 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 211 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 212 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 213 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 214 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 215 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 216 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 217 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 218 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 219 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 220 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 223 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 224 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 225 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 266 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 267 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 294 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 295 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 298 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 299 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 304 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 305 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 306 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.19 |
| Nodule | 0 |
| Rhizoplane | 2.71 |
| Rhizosphere | 72.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_145288 | 2162886007 | Bacteria | 5558 |
| 2 | JGI25152J39213_1000866 | 3300002773 | Bacteria | 14941 |
| 3 | JGI25150J39212_1005456 | 3300002774 | Bacteria | 2711 |
| 4 | JGI25159J45721_1041898 | 3300002987 | Bacteria | 664 |
| 5 | JGI25159J45721_1047796 | 3300002987 | Bacteria | 596 |
| 6 | JGI25151J46595_10000351 | 3300003187 | Bacteria | 49103 |
| 7 | JGI25151J46595_10070536 | 3300003187 | Bacteria | 1060 |
| 8 | JGI25151J46595_10070674 | 3300003187 | Bacteria | 1058 |
| 9 | JGI25153J46596_10000219 | 3300003215 | Bacteria | 49103 |
| 10 | rootH1_10228024 | 3300003323 | Bacteria | 1233 |
| 11 | Ga0055526_1000428 | 3300003771 | Bacteria | 33858 |
| 12 | Ga0055537_1000017 | 3300003773 | Bacteria | 123856 |
| 13 | Ga0055537_1001080 | 3300003773 | Bacteria | 11996 |
| 14 | Ga0055524_1000280 | 3300003775 | Bacteria | 50037 |
| 15 | Ga0055524_1031360 | 3300003775 | Bacteria | 1530 |
| 16 | Ga0055536_1004171 | 3300003781 | Bacteria | 7477 |
| 17 | Ga0055536_1004653 | 3300003781 | Bacteria | 6939 |
| 18 | Ga0055534_1000163 | 3300003784 | Bacteria | 50001 |
| 19 | Ga0055534_1000267 | 3300003784 | Bacteria | 36162 |
| 20 | Ga0055534_1018274 | 3300003784 | Bacteria | 1222 |
| 21 | Ga0055528_1000182 | 3300003790 | Bacteria | 53454 |
| 22 | Ga0055528_1000204 | 3300003790 | Bacteria | 50037 |
| 23 | Ga0055530_10001486 | 3300003791 | Bacteria | 17027 |
| 24 | Ga0055530_10004170 | 3300003791 | Bacteria | 7633 |
| 25 | Ga0055530_10031900 | 3300003791 | Bacteria | 1377 |
| 26 | Ga0055531_10019722 | 3300003794 | Bacteria | 2709 |
| 27 | Ga0055531_10031196 | 3300003794 | Bacteria | 1771 |
| 28 | Ga0055531_10047038 | 3300003794 | Bacteria | 1178 |
| 29 | Ga0065704_10070357 | 3300005289 | Bacteria | 30374 |
| 30 | Ga0065707_10102372 | 3300005295 | Bacteria | 2810 |
| 31 | Ga0065707_10299350 | 3300005295 | Bacteria | 1008 |
| 32 | Ga0070676_10182928 | 3300005328 | Bacteria | 1364 |
| 33 | Ga0070676_10828839 | 3300005328 | Bacteria | 684 |
| 34 | Ga0070677_10406146 | 3300005333 | Bacteria | 719 |
| 35 | Ga0068869_100063267 | 3300005334 | Bacteria | 2717 |
| 36 | Ga0068868_100276504 | 3300005338 | Bacteria | 1420 |
| 37 | Ga0070689_100097433 | 3300005340 | Bacteria | 2326 |
| 38 | Ga0070689_101370967 | 3300005340 | Bacteria | 638 |
| 39 | Ga0070691_10452015 | 3300005341 | Bacteria | 734 |
| 40 | Ga0070668_100101467 | 3300005347 | Bacteria | 2280 |
| 41 | Ga0070668_100308055 | 3300005347 | Bacteria | 1330 |
| 42 | Ga0070669_100284429 | 3300005353 | Bacteria | 1326 |
| 43 | Ga0070669_100522997 | 3300005353 | Bacteria | 986 |
| 44 | Ga0070675_100030112 | 3300005354 | Bacteria | 4379 |
| 45 | Ga0070674_100004643 | 3300005356 | Bacteria | 7847 |
| 46 | Ga0070674_101538441 | 3300005356 | Bacteria | 599 |
| 47 | Ga0070673_100134417 | 3300005364 | Bacteria | 2080 |
| 48 | Ga0070673_100814779 | 3300005364 | Bacteria | 863 |
| 49 | Ga0070667_100049436 | 3300005367 | Bacteria | 3542 |
| 50 | Ga0070667_100293756 | 3300005367 | Bacteria | 1462 |
| 51 | Ga0070701_10092027 | 3300005438 | Bacteria | 1663 |
| 52 | Ga0070701_10112782 | 3300005438 | Bacteria | 1521 |
| 53 | Ga0070700_100051280 | 3300005441 | Bacteria | 2568 |
| 54 | Ga0070700_100111477 | 3300005441 | Bacteria | 1819 |
| 55 | Ga0070700_100715563 | 3300005441 | Bacteria | 798 |
| 56 | Ga0070700_101971092 | 3300005441 | Bacteria | 506 |
| 57 | Ga0070694_100058025 | 3300005444 | Bacteria | 2632 |
| 58 | Ga0070663_100182455 | 3300005455 | Bacteria | 1629 |
| 59 | Ga0070678_100110589 | 3300005456 | Bacteria | 2149 |
| 60 | Ga0068867_100005133 | 3300005459 | Bacteria | 9252 |
| 61 | Ga0070685_10066300 | 3300005466 | Bacteria | 2127 |
| 62 | Ga0070686_100609991 | 3300005544 | Bacteria | 861 |
| 63 | Ga0070695_100067019 | 3300005545 | Bacteria | 2341 |
| 64 | Ga0070696_100703984 | 3300005546 | Bacteria | 824 |
| 65 | Ga0070693_100996030 | 3300005547 | Bacteria | 634 |
| 66 | Ga0070665_100000426 | 3300005548 | Bacteria | 61588 |
| 67 | Ga0070665_100016620 | 3300005548 | Bacteria | 7373 |
| 68 | Ga0070704_100339417 | 3300005549 | Bacteria | 1265 |
| 69 | Ga0070702_100032620 | 3300005615 | Bacteria | 2859 |
| 70 | Ga0070702_100228661 | 3300005615 | Bacteria | 1248 |
| 71 | Ga0068859_100283262 | 3300005617 | Bacteria | 1750 |
| 72 | Ga0068859_101275388 | 3300005617 | Bacteria | 809 |
| 73 | Ga0068866_10078681 | 3300005718 | Bacteria | 1765 |
| 74 | Ga0068861_100006910 | 3300005719 | Bacteria | 7753 |
| 75 | Ga0068861_100704301 | 3300005719 | Bacteria | 939 |
| 76 | Ga0068870_10060897 | 3300005840 | Bacteria | 2027 |
| 77 | Ga0068858_100087721 | 3300005842 | Bacteria | 2894 |
| 78 | Ga0068858_100279118 | 3300005842 | Bacteria | 1591 |
| 79 | Ga0068860_100001559 | 3300005843 | Bacteria | 24688 |
| 80 | Ga0068862_100018269 | 3300005844 | Bacteria | 5839 |
| 81 | Ga0068862_100232682 | 3300005844 | Bacteria | 1672 |
| 82 | Ga0068862_100835671 | 3300005844 | Bacteria | 902 |
| 83 | Ga0081539_10052951 | 3300005985 | Bacteria | 2275 |
| 84 | Ga0075365_10025358 | 3300006038 | Bacteria | 3752 |
| 85 | Ga0075363_100176930 | 3300006048 | Bacteria | 1213 |
| 86 | Ga0075363_100613147 | 3300006048 | Bacteria | 653 |
| 87 | Ga0075364_10046386 | 3300006051 | Bacteria | 2829 |
| 88 | Ga0075364_10116412 | 3300006051 | Bacteria | 1787 |
| 89 | Ga0070716_100398343 | 3300006173 | Bacteria | 989 |
| 90 | Ga0075366_10050179 | 3300006195 | Bacteria | 2477 |
| 91 | Ga0075366_10326750 | 3300006195 | Bacteria | 940 |
| 92 | Ga0068871_100684907 | 3300006358 | Bacteria | 938 |
| 93 | Ga0068871_100978936 | 3300006358 | Bacteria | 787 |
| 94 | Ga0075428_100015486 | 3300006844 | Bacteria | 8455 |
| 95 | Ga0075428_100538086 | 3300006844 | Unclassified | 1249 |
| 96 | Ga0075431_100072888 | 3300006847 | Bacteria | 3543 |
| 97 | Ga0075431_100924156 | 3300006847 | Bacteria | 841 |
| 98 | Ga0075433_10255655 | 3300006852 | Bacteria | 1554 |
| 99 | Ga0075434_100152692 | 3300006871 | Unclassified | 2329 |
| 100 | Ga0075434_101981006 | 3300006871 | Bacteria | 588 |
| 101 | Ga0075429_100040836 | 3300006880 | Bacteria | 4039 |
| 102 | Ga0075429_100360121 | 3300006880 | Bacteria | 1274 |
| 103 | Ga0068865_100003673 | 3300006881 | Bacteria | 9217 |
| 104 | Ga0075436_100000080 | 3300006914 | Bacteria | 55351 |
| 105 | Ga0075436_100011138 | 3300006914 | Bacteria | 6167 |
| 106 | Ga0097620_100283260 | 3300006931 | Bacteria | 1750 |
| 107 | Ga0097620_101275417 | 3300006931 | Bacteria | 809 |
| 108 | Ga0075435_100273660 | 3300007076 | Bacteria | 1441 |
| 109 | Ga0075435_101069815 | 3300007076 | Bacteria | 705 |
| 110 | Ga0105251_10002785 | 3300009011 | Bacteria | 13292 |
| 111 | Ga0105244_10069296 | 3300009036 | Bacteria | 1761 |
| 112 | Ga0105244_10095776 | 3300009036 | Bacteria | 1456 |
| 113 | Ga0111539_10037006 | 3300009094 | Bacteria | 5897 |
| 114 | Ga0111539_11445837 | 3300009094 | Bacteria | 797 |
| 115 | Ga0105245_10386246 | 3300009098 | Bacteria | 1395 |
| 116 | Ga0114129_10066031 | 3300009147 | Bacteria | 5047 |
| 117 | Ga0114129_10496808 | 3300009147 | Unclassified | 1594 |
| 118 | Ga0114129_11082380 | 3300009147 | Bacteria | 1005 |
| 119 | Ga0114129_11481661 | 3300009147 | Bacteria | 834 |
| 120 | Ga0105243_10276007 | 3300009148 | Bacteria | 1512 |
| 121 | Ga0105243_10663225 | 3300009148 | Bacteria | 1012 |
| 122 | Ga0105248_10178904 | 3300009177 | Bacteria | 2390 |
| 123 | Ga0105238_11705139 | 3300009551 | Bacteria | 661 |
| 124 | Ga0105249_10028331 | 3300009553 | Bacteria | 5056 |
| 125 | Ga0105032_102131 | 3300009979 | Bacteria | 1787 |
| 126 | Ga0105028_109473 | 3300009993 | Bacteria | 1021 |
| 127 | Ga0157328_1011098 | 3300012478 | Bacteria | 634 |
| 128 | Ga0157318_1018201 | 3300012482 | Bacteria | 600 |
| 129 | Ga0157313_1020458 | 3300012503 | Bacteria | 670 |
| 130 | Ga0157327_1007886 | 3300012512 | Bacteria | 940 |
| 131 | Ga0157373_10184015 | 3300013100 | Bacteria | 1471 |
| 132 | Ga0157371_10002186 | 3300013102 | Bacteria | 18979 |
| 133 | Ga0157371_10020416 | 3300013102 | Bacteria | 4875 |
| 134 | Ga0157370_10010646 | 3300013104 | Bacteria | 9681 |
| 135 | Ga0157370_10112942 | 3300013104 | Bacteria | 2539 |
| 136 | Ga0157378_10001811 | 3300013297 | Bacteria | 19191 |
| 137 | Ga0163162_10017493 | 3300013306 | Bacteria | 7014 |
| 138 | Ga0163162_10383025 | 3300013306 | Bacteria | 1540 |
| 139 | Ga0163163_11825605 | 3300014325 | Bacteria | 668 |
| 140 | Ga0157380_10017645 | 3300014326 | Bacteria | 5284 |
| 141 | Ga0157380_10131540 | 3300014326 | Bacteria | 2136 |
| 142 | Ga0157380_10712059 | 3300014326 | Bacteria | 1010 |
| 143 | Ga0157380_11318696 | 3300014326 | Bacteria | 770 |
| 144 | Ga0182008_10000096 | 3300014497 | Bacteria | 67450 |
| 145 | Ga0182008_10001301 | 3300014497 | Bacteria | 17041 |
| 146 | Ga0157377_11581326 | 3300014745 | Bacteria | 524 |
| 147 | Ga0157379_10227952 | 3300014968 | Bacteria | 1688 |
| 148 | Ga0157376_10578350 | 3300014969 | Bacteria | 1115 |
| 149 | Ga0157376_11242481 | 3300014969 | Bacteria | 774 |
| 150 | Ga0182006_1008250 | 3300015261 | Bacteria | 4725 |
| 151 | Ga0182006_1110862 | 3300015261 | Bacteria | 963 |
| 152 | Ga0182007_10000048 | 3300015262 | Bacteria | 103024 |
| 153 | Ga0182005_1003480 | 3300015265 | Bacteria | 5327 |
| 154 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 155 | Ga0183361_11453 | 3300016635 | Bacteria | 1217 |
| 156 | Ga0163161_10030249 | 3300017792 | Bacteria | 3852 |
| 157 | Ga0163161_10541904 | 3300017792 | Bacteria | 953 |
| 158 | Ga0163161_10609356 | 3300017792 | Bacteria | 901 |
| 159 | Ga0207425_1000111 | 3300025245 | Bacteria | 77375 |
| 160 | Ga0207425_1026892 | 3300025245 | Bacteria | 1177 |
| 161 | Ga0209129_1000087 | 3300025258 | Bacteria | 179582 |
| 162 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 163 | Ga0209565_1000031 | 3300025263 | Bacteria | 320341 |
| 164 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 165 | Ga0209673_1000164 | 3300025273 | Bacteria | 138082 |
| 166 | Ga0209673_1004282 | 3300025273 | Bacteria | 7731 |
| 167 | Ga0209673_1064512 | 3300025273 | Bacteria | 898 |
| 168 | Ga0209130_1002494 | 3300025284 | Bacteria | 9108 |
| 169 | Ga0209130_1005265 | 3300025284 | Bacteria | 4553 |
| 170 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 171 | Ga0209675_1000015 | 3300025291 | Bacteria | 403517 |
| 172 | Ga0209675_1006953 | 3300025291 | Bacteria | 4437 |
| 173 | Ga0209675_1015895 | 3300025291 | Bacteria | 2215 |
| 174 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 175 | Ga0209676_1000110 | 3300025292 | Bacteria | 214083 |
| 176 | Ga0209676_1001028 | 3300025292 | Bacteria | 32470 |
| 177 | Ga0209676_1001231 | 3300025292 | Bacteria | 27052 |
| 178 | Ga0209676_1005673 | 3300025292 | Bacteria | 6424 |
| 179 | Ga0209676_1016472 | 3300025292 | Bacteria | 2666 |
| 180 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 181 | Ga0209025_1003537 | 3300025294 | Bacteria | 14653 |
| 182 | Ga0209025_1007002 | 3300025294 | Bacteria | 8559 |
| 183 | Ga0209025_1042768 | 3300025294 | Bacteria | 1919 |
| 184 | Ga0209025_1048110 | 3300025294 | Bacteria | 1732 |
| 185 | Ga0209025_1116044 | 3300025294 | Bacteria | 810 |
| 186 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 187 | Ga0209564_1000037 | 3300025295 | Bacteria | 414794 |
| 188 | Ga0209564_1008868 | 3300025295 | Bacteria | 4891 |
| 189 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 190 | Ga0209758_1037036 | 3300025297 | Bacteria | 1892 |
| 191 | Ga0209050_1000417 | 3300025298 | Bacteria | 78631 |
| 192 | Ga0209050_1001410 | 3300025298 | Bacteria | 26010 |
| 193 | Ga0209050_1002473 | 3300025298 | Bacteria | 15717 |
| 194 | Ga0209050_1015285 | 3300025298 | Bacteria | 3236 |
| 195 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 196 | Ga0209256_1002158 | 3300025299 | Bacteria | 16970 |
| 197 | Ga0209256_1002613 | 3300025299 | Bacteria | 14247 |
| 198 | Ga0209256_1008601 | 3300025299 | Bacteria | 4688 |
| 199 | Ga0209256_1015165 | 3300025299 | Bacteria | 2715 |
| 200 | Ga0209051_1001882 | 3300025303 | Bacteria | 16414 |
| 201 | Ga0209051_1039697 | 3300025303 | Bacteria | 1696 |
| 202 | Ga0209257_1000129 | 3300025304 | Bacteria | 214155 |
| 203 | Ga0209257_1000274 | 3300025304 | Bacteria | 117076 |
| 204 | Ga0209257_1000670 | 3300025304 | Bacteria | 53641 |
| 205 | Ga0209257_1001580 | 3300025304 | Bacteria | 26249 |
| 206 | Ga0209257_1003605 | 3300025304 | Bacteria | 13052 |
| 207 | Ga0207655_1050978 | 3300025728 | Bacteria | 1677 |
| 208 | Ga0207713_1037920 | 3300025735 | Bacteria | 2050 |
| 209 | Ga0207682_10037813 | 3300025893 | Bacteria | 1956 |
| 210 | Ga0207645_10372596 | 3300025907 | Bacteria | 957 |
| 211 | Ga0207643_10025859 | 3300025908 | Bacteria | 3247 |
| 212 | Ga0207662_10062619 | 3300025918 | Bacteria | 2236 |
| 213 | Ga0207662_10125440 | 3300025918 | Bacteria | 1614 |
| 214 | Ga0207681_10129166 | 3300025923 | Bacteria | 1866 |
| 215 | Ga0207681_10500011 | 3300025923 | Bacteria | 995 |
| 216 | Ga0207659_10155795 | 3300025926 | Bacteria | 1788 |
| 217 | Ga0207687_11544644 | 3300025927 | Bacteria | 570 |
| 218 | Ga0207709_10001341 | 3300025935 | Bacteria | 17363 |
| 219 | Ga0207670_10848363 | 3300025936 | Bacteria | 763 |
| 220 | Ga0207669_10067732 | 3300025937 | Bacteria | 2226 |
| 221 | Ga0207704_10021633 | 3300025938 | Bacteria | 3429 |
| 222 | Ga0207704_11851762 | 3300025938 | Bacteria | 519 |
| 223 | Ga0207691_10394107 | 3300025940 | Bacteria | 1181 |
| 224 | Ga0207711_10525154 | 3300025941 | Unclassified | 1104 |
| 225 | Ga0207689_10023675 | 3300025942 | Bacteria | 5150 |
| 226 | Ga0207651_10074768 | 3300025960 | Bacteria | 2414 |
| 227 | Ga0207651_10108211 | 3300025960 | Bacteria | 2080 |
| 228 | Ga0207651_10647467 | 3300025960 | Bacteria | 927 |
| 229 | Ga0207712_10066694 | 3300025961 | Bacteria | 2573 |
| 230 | Ga0207668_10171005 | 3300025972 | Bacteria | 1704 |
| 231 | Ga0207668_10226106 | 3300025972 | Bacteria | 1506 |
| 232 | Ga0207668_10276307 | 3300025972 | Bacteria | 1375 |
| 233 | Ga0207658_10219884 | 3300025986 | Bacteria | 1597 |
| 234 | Ga0207658_10557962 | 3300025986 | Bacteria | 1025 |
| 235 | Ga0207703_10057752 | 3300026035 | Bacteria | 3165 |
| 236 | Ga0207703_10209043 | 3300026035 | Bacteria | 1739 |
| 237 | Ga0207678_10096767 | 3300026067 | Bacteria | 2523 |
| 238 | Ga0207708_10044954 | 3300026075 | Bacteria | 3365 |
| 239 | Ga0207708_11440849 | 3300026075 | Bacteria | 605 |
| 240 | Ga0207648_10000419 | 3300026089 | Bacteria | 46680 |
| 241 | Ga0207676_11025538 | 3300026095 | Bacteria | 814 |
| 242 | Ga0207675_100004240 | 3300026118 | Bacteria | 13863 |
| 243 | Ga0207675_100746718 | 3300026118 | Bacteria | 990 |
| 244 | Ga0207675_101334667 | 3300026118 | Bacteria | 738 |
| 245 | Ga0207683_10107322 | 3300026121 | Bacteria | 2498 |
| 246 | Ga0209969_1025153 | 3300027360 | Bacteria | 897 |
| 247 | Ga0209981_1017637 | 3300027378 | Bacteria | 1009 |
| 248 | Ga0209996_1012267 | 3300027395 | Bacteria | 1150 |
| 249 | Ga0210000_1057197 | 3300027462 | Bacteria | 629 |
| 250 | Ga0209995_1030699 | 3300027471 | Bacteria | 899 |
| 251 | Ga0209968_1018613 | 3300027526 | Bacteria | 1114 |
| 252 | Ga0209982_1002284 | 3300027552 | Bacteria | 2685 |
| 253 | Ga0209983_1019290 | 3300027665 | Bacteria | 1417 |
| 254 | Ga0209588_1099186 | 3300027671 | Bacteria | 937 |
| 255 | Ga0209971_1003169 | 3300027682 | Bacteria | 3923 |
| 256 | Ga0209966_1002105 | 3300027695 | Bacteria | 3324 |
| 257 | Ga0209998_10116260 | 3300027717 | Bacteria | 671 |
| 258 | Ga0209974_10027381 | 3300027876 | Bacteria | 1885 |
| 259 | Ga0207428_10075254 | 3300027907 | Bacteria | 2646 |
| 260 | Ga0207428_10095871 | 3300027907 | Bacteria | 2298 |
| 261 | Ga0268266_10000741 | 3300028379 | Bacteria | 43685 |
| 262 | Ga0268266_10059786 | 3300028379 | Bacteria | 3283 |
| 263 | Ga0268265_10019602 | 3300028380 | Bacteria | 4705 |
| 264 | Ga0268265_10096628 | 3300028380 | Bacteria | 2375 |
| 265 | Ga0268265_10397887 | 3300028380 | Bacteria | 1272 |
| 266 | Ga0268265_12647744 | 3300028380 | Bacteria | 507 |
| 267 | Ga0268264_10002884 | 3300028381 | Bacteria | 14955 |
| 268 | Ga0307515_10093168 | 3300028794 | Bacteria | 3739 |
| 269 | Ga0316176_1013813 | 3300030732 | Bacteria | 3135 |
| 270 | Ga0316176_1040133 | 3300030732 | Bacteria | 1165 |
| 271 | Ga0316181_1005833 | 3300030744 | Bacteria | 3389 |
| 272 | Ga0316182_1061642 | 3300030745 | Bacteria | 870 |
| 273 | Ga0265330_10084253 | 3300031235 | Bacteria | 1368 |
| 274 | Ga0265316_10333791 | 3300031344 | Bacteria | 1100 |
| 275 | Ga0307513_10151000 | 3300031456 | Bacteria | 2232 |
| 276 | Ga0307408_100360066 | 3300031548 | Bacteria | 1237 |
| 277 | Ga0307408_101008178 | 3300031548 | Bacteria | 768 |
| 278 | Ga0307408_101078557 | 3300031548 | Bacteria | 744 |
| 279 | Ga0307408_101344831 | 3300031548 | Bacteria | 671 |
| 280 | Ga0307408_102213959 | 3300031548 | Bacteria | 531 |
| 281 | Ga0307508_10066109 | 3300031616 | Bacteria | 3184 |
| 282 | Ga0307405_10229291 | 3300031731 | Bacteria | 1368 |
| 283 | Ga0307405_10318632 | 3300031731 | Bacteria | 1187 |
| 284 | Ga0307405_10338901 | 3300031731 | Bacteria | 1155 |
| 285 | Ga0307405_10497702 | 3300031731 | Bacteria | 976 |
| 286 | Ga0307405_10783784 | 3300031731 | Bacteria | 797 |
| 287 | Ga0307405_11353224 | 3300031731 | Bacteria | 621 |
| 288 | Ga0307413_10042618 | 3300031824 | Bacteria | 2669 |
| 289 | Ga0307413_10151902 | 3300031824 | Bacteria | 1615 |
| 290 | Ga0307413_10569113 | 3300031824 | Bacteria | 922 |
| 291 | Ga0307413_10896730 | 3300031824 | Bacteria | 753 |
| 292 | Ga0307413_11082303 | 3300031824 | Bacteria | 691 |
| 293 | Ga0307413_11397568 | 3300031824 | Bacteria | 615 |
| 294 | Ga0307410_11277569 | 3300031852 | Bacteria | 641 |
| 295 | Ga0307406_10089496 | 3300031901 | Bacteria | 2068 |
| 296 | Ga0307406_10578196 | 3300031901 | Bacteria | 923 |
| 297 | Ga0307407_10540640 | 3300031903 | Bacteria | 860 |
| 298 | Ga0307412_10055820 | 3300031911 | Bacteria | 2629 |
| 299 | Ga0307412_10070447 | 3300031911 | Bacteria | 2383 |
| 300 | Ga0307412_10093932 | 3300031911 | Bacteria | 2105 |
| 301 | Ga0307412_10904203 | 3300031911 | Bacteria | 774 |
| 302 | Ga0307412_11195568 | 3300031911 | Bacteria | 680 |
| 303 | Ga0307409_100793194 | 3300031995 | Bacteria | 954 |
| 304 | Ga0307409_101205923 | 3300031995 | Bacteria | 780 |
| 305 | Ga0307409_101248142 | 3300031995 | Bacteria | 767 |
| 306 | Ga0307409_101995134 | 3300031995 | Bacteria | 610 |
| 307 | Ga0307416_100168763 | 3300032002 | Bacteria | 2034 |
| 308 | Ga0307416_100201334 | 3300032002 | Bacteria | 1889 |
| 309 | Ga0307416_100342918 | 3300032002 | Bacteria | 1508 |
| 310 | Ga0307416_101201320 | 3300032002 | Bacteria | 864 |
| 311 | Ga0307416_101280090 | 3300032002 | Bacteria | 839 |
| 312 | Ga0307416_103273529 | 3300032002 | Bacteria | 542 |
| 313 | Ga0307416_103373793 | 3300032002 | Bacteria | 534 |
| 314 | Ga0307414_10008172 | 3300032004 | Bacteria | 5917 |
| 315 | Ga0307414_10010308 | 3300032004 | Bacteria | 5415 |
| 316 | Ga0307414_10024671 | 3300032004 | Bacteria | 3838 |
| 317 | Ga0307414_10034606 | 3300032004 | Bacteria | 3352 |
| 318 | Ga0307414_10044477 | 3300032004 | Bacteria | 3033 |
| 319 | Ga0307414_10057247 | 3300032004 | Bacteria | 2739 |
| 320 | Ga0307414_10094649 | 3300032004 | Bacteria | 2230 |
| 321 | Ga0307414_10097637 | 3300032004 | Bacteria | 2201 |
| 322 | Ga0307414_10236817 | 3300032004 | Bacteria | 1508 |
| 323 | Ga0307414_10526910 | 3300032004 | Bacteria | 1049 |
| 324 | Ga0307414_10714026 | 3300032004 | Bacteria | 908 |
| 325 | Ga0307414_11621869 | 3300032004 | Bacteria | 603 |
| 326 | Ga0307411_10010665 | 3300032005 | Bacteria | 4912 |
| 327 | Ga0307411_10012920 | 3300032005 | Bacteria | 4581 |
| 328 | Ga0307411_10315419 | 3300032005 | Bacteria | 1260 |
| 329 | Ga0307411_10327677 | 3300032005 | Bacteria | 1239 |
| 330 | Ga0307411_10377285 | 3300032005 | Bacteria | 1165 |
| 331 | Ga0373946_0438101 | 3300035171 | Bacteria | 664 |
| 332 | Ga0373961_0000811 | 3300035241 | Bacteria | 10650 |
| 333 | Ga0373924_0257993 | 3300035410 | Bacteria | 772 |
| 334 | Ga0373935_0000870 | 3300035692 | Bacteria | 16289 |
| 335 | Ga0373935_0712215 | 3300035692 | Bacteria | 738 |
| 336 | Ga0373925_0011924 | 3300037068 | Bacteria | 6290 |
| 337 | Ga0237819_00040 | 3300038705 | Bacteria | 45528 |
| 338 | Ga0400488_58698 | 3300038741 | Bacteria | 2800 |
| 339 | Ga0400486_30163 | 3300038742 | Bacteria | 9678 |
| 340 | Ga0400483_151922 | 3300039062 | Bacteria | 3455 |
| 341 | Ga0400489_75675 | 3300039093 | Bacteria | 7837 |
| 342 | Ga0400487_48277 | 3300039110 | Bacteria | 1769 |
| 343 | Ga0237816_01328 | 3300039145 | Bacteria | 1999 |
| 344 | Ga0439436_0009624 | 3300041404 | Bacteria | 2963 |
| 345 | Ga0439436_0093051 | 3300041404 | Bacteria | 839 |
| 346 | Ga0439439_0018976 | 3300041406 | Bacteria | 1703 |
| 347 | Ga0439439_0034156 | 3300041406 | Bacteria | 1304 |
| 348 | Ga0439439_0274738 | 3300041406 | Bacteria | 504 |
| 349 | Ga0439453_0063592 | 3300041408 | Bacteria | 769 |
| 350 | Ga0439466_0207546 | 3300041411 | Bacteria | 595 |
| 351 | Ga0439465_0005832 | 3300041413 | Bacteria | 3921 |
| 352 | Ga0439465_0008429 | 3300041413 | Bacteria | 3254 |
| 353 | Ga0439465_0013607 | 3300041413 | Bacteria | 2534 |
| 354 | Ga0439465_0329133 | 3300041413 | Bacteria | 575 |
| 355 | Ga0451787_065104 | 3300041441 | Bacteria | 1318 |
| 356 | Ga0451791_0906637 | 3300041451 | Bacteria | 579 |
| 357 | Ga0451793_0670350 | 3300041452 | Bacteria | 1676 |
| 358 | Ga0451797_0158336 | 3300041453 | Bacteria | 772 |
| 359 | Ga0451795_0787166 | 3300041456 | Bacteria | 776 |
| 360 | Ga0451795_1518945 | 3300041456 | Bacteria | 702 |
| 361 | Ga0451802_2076607 | 3300041460 | Bacteria | 892 |
| 362 | Ga0451804_1029255 | 3300041463 | Bacteria | 1278 |
| 363 | Ga0451807_0199166 | 3300041486 | Unclassified | 1161 |
| 364 | Ga0451807_2137752 | 3300041486 | Bacteria | 781 |
| 365 | Ga0451807_2709952 | 3300041486 | Bacteria | 3601 |
| 366 | Ga0451837_1410386 | 3300041494 | Bacteria | 527 |
| 367 | Ga0451841_0417243 | 3300041498 | Bacteria | 556 |
| 368 | Ga0451841_0652781 | 3300041498 | Bacteria | 683 |
| 369 | Ga0451849_0218415 | 3300041505 | Bacteria | 855 |
| 370 | Ga0451849_0443800 | 3300041505 | Bacteria | 818 |
| 371 | Ga0451843_0941578 | 3300041509 | Bacteria | 642 |
| 372 | Ga0451843_1288714 | 3300041509 | Bacteria | 1290 |
| 373 | Ga0451855_1858647 | 3300041511 | Bacteria | 593 |
| 374 | Ga0451853_1337486 | 3300041512 | Bacteria | 643 |
| 375 | Ga0439431_0120939 | 3300041997 | Bacteria | 730 |
| 376 | Ga0439433_0015296 | 3300041999 | Bacteria | 1694 |
| 377 | Ga0439433_0026976 | 3300041999 | Bacteria | 1301 |
| 378 | Ga0439441_009870 | 3300042001 | Bacteria | 1590 |
| 379 | Ga0439443_003655 | 3300042003 | Bacteria | 1958 |
| 380 | Ga0439445_0007424 | 3300042004 | Bacteria | 2542 |
| 381 | Ga0439432_006888 | 3300042006 | Bacteria | 4047 |
| 382 | Ga0439432_013892 | 3300042006 | Bacteria | 2730 |
| 383 | Ga0439432_032834 | 3300042006 | Bacteria | 1672 |
| 384 | Ga0439432_083027 | 3300042006 | Bacteria | 969 |
| 385 | Ga0439432_152561 | 3300042006 | Bacteria | 678 |
| 386 | Ga0439449_0000004 | 3300042007 | Bacteria | 82454 |
| 387 | Ga0439449_0004225 | 3300042007 | Bacteria | 5551 |
| 388 | Ga0439449_0011914 | 3300042007 | Bacteria | 3269 |
| 389 | Ga0439449_0019204 | 3300042007 | Bacteria | 2562 |
| 390 | Ga0439449_0023109 | 3300042007 | Bacteria | 2327 |
| 391 | Ga0439449_0042411 | 3300042007 | Bacteria | 1690 |
| 392 | Ga0439449_0158662 | 3300042007 | Bacteria | 844 |
| 393 | Ga0439452_006295 | 3300042010 | Bacteria | 3726 |
| 394 | Ga0439456_055061 | 3300042013 | Bacteria | 871 |
| 395 | Ga0439457_028763 | 3300042014 | Bacteria | 1231 |
| 396 | Ga0439462_0038859 | 3300042015 | Bacteria | 1268 |
| 397 | Ga0439462_0142312 | 3300042015 | Bacteria | 672 |
| 398 | Ga0450913_000155 | 3300042117 | Bacteria | 2172 |
| 399 | Ga0450905_039642 | 3300042142 | Bacteria | 746 |
| 400 | Ga0439446_0319122 | 3300042156 | Bacteria | 548 |
| 401 | Ga0439434_0237040 | 3300042435 | Bacteria | 622 |
| 402 | Ga0439435_0022550 | 3300042436 | Bacteria | 1644 |
| 403 | Ga0439444_0004861 | 3300042437 | Bacteria | 1969 |
| 404 | Ga0439460_0006933 | 3300042461 | Bacteria | 2822 |
| 405 | Ga0450901_013957 | 3300042533 | Bacteria | 843 |
| 406 | Ga0451577_0002652 | 3300042876 | Bacteria | 20952 |
| 407 | Ga0451577_0075623 | 3300042876 | Bacteria | 3003 |
| 408 | Ga0453684_0000316 | 3300044712 | Bacteria | 204457 |
| 409 | Ga0453684_0193639 | 3300044712 | Bacteria | 2376 |
| 410 | Ga0451576_0000128 | 3300045051 | Bacteria | 192071 |
| 411 | Ga0451576_0145340 | 3300045051 | Bacteria | 2472 |
| 412 | Ga0451576_1427909 | 3300045051 | Bacteria | 720 |
| 413 | Ga0466967_0965632 | 3300045976 | Bacteria | 848 |
| 414 | Ga0495627_008906 | 3300046453 | Bacteria | 3718 |
| 415 | Ga0495590_0124383 | 3300046457 | Bacteria | 925 |
| 416 | Ga0495591_023418 | 3300046458 | Bacteria | 1979 |
| 417 | Ga0495638_0000881 | 3300046460 | Bacteria | 30946 |
| 418 | Ga0495638_0032950 | 3300046460 | Bacteria | 3316 |
| 419 | Ga0495638_0134946 | 3300046460 | Bacteria | 1446 |
| 420 | Ga0495639_0170148 | 3300046475 | Bacteria | 1057 |
| 421 | Ga0495584_0104222 | 3300046491 | Bacteria | 1434 |
| 422 | Ga0495610_0003046 | 3300046512 | Bacteria | 13417 |
| 423 | Ga0495610_0108996 | 3300046512 | Bacteria | 1229 |
| 424 | Ga0495616_0037555 | 3300046513 | Bacteria | 2491 |
| 425 | Ga0495628_0093103 | 3300046516 | Bacteria | 2331 |
| 426 | Ga0495631_0001525 | 3300046518 | Bacteria | 13955 |
| 427 | Ga0495632_0385726 | 3300046519 | Bacteria | 613 |
| 428 | Ga0495663_0110065 | 3300046525 | Bacteria | 914 |
| 429 | Ga0495640_0025999 | 3300046533 | Bacteria | 4238 |
| 430 | Ga0495586_0010802 | 3300046535 | Bacteria | 4855 |
| 431 | Ga0495609_0174390 | 3300046538 | Bacteria | 907 |
| 432 | Ga0495633_0026731 | 3300046558 | Bacteria | 2828 |
| 433 | Ga0495633_0043387 | 3300046558 | Bacteria | 2134 |
| 434 | Ga0495633_0113725 | 3300046558 | Bacteria | 1255 |
| 435 | Ga0495656_0001001 | 3300046615 | Bacteria | 9129 |
| 436 | Ga0495625_0058167 | 3300046660 | Bacteria | 2747 |
| 437 | Ga0495625_0653762 | 3300046660 | Bacteria | 625 |
| 438 | Ga0495635_0082917 | 3300046663 | Bacteria | 2194 |
| 439 | Ga0495647_0458191 | 3300046681 | Bacteria | 591 |
| 440 | Ga0495669_0101260 | 3300046684 | Bacteria | 1338 |
| 441 | Ga0495670_0022391 | 3300046691 | Bacteria | 3120 |
| 442 | Ga0495660_0026745 | 3300046810 | Bacteria | 3268 |
| 443 | Ga0495604_0052433 | 3300047317 | Bacteria | 3159 |
| 444 | Ga0495636_0048228 | 3300047318 | Bacteria | 1779 |
| 445 | Ga0495672_0000090 | 3300047320 | Bacteria | 148367 |
| 446 | Ga0495672_0068871 | 3300047320 | Bacteria | 2010 |
| 447 | Ga0495681_0101983 | 3300047470 | Bacteria | 1253 |
| 448 | Ga0495686_0016694 | 3300047472 | Bacteria | 4970 |
| 449 | Ga0495686_0104192 | 3300047472 | Bacteria | 1708 |
| 450 | Ga0496104_0425145 | 3300048907 | Bacteria | 1240 |
| 451 | Ga0496110_0224170 | 3300048913 | Bacteria | 1710 |
| 452 | Ga0496111_0981890 | 3300048914 | Bacteria | 606 |
| 453 | Ga0496114_0000013 | 3300048917 | Bacteria | 317623 |
| 454 | Ga0496116_0021188 | 3300048919 | Bacteria | 4908 |
| 455 | Ga0496116_0119316 | 3300048919 | Bacteria | 1530 |
| 456 | Ga0496117_0000617 | 3300048920 | Bacteria | 57555 |
| 457 | Ga0496117_0003428 | 3300048920 | Bacteria | 18442 |
| 458 | Ga0496117_0008591 | 3300048920 | Bacteria | 9679 |
| 459 | Ga0496117_0057014 | 3300048920 | Bacteria | 2716 |
| 460 | Ga0496118_0000404 | 3300048921 | Bacteria | 72202 |
| 461 | Ga0496118_0000737 | 3300048921 | Bacteria | 52822 |
| 462 | Ga0496118_0044462 | 3300048921 | Bacteria | 3477 |
| 463 | Ga0496118_0049885 | 3300048921 | Bacteria | 3218 |
| 464 | Ga0496118_0079564 | 3300048921 | Bacteria | 2312 |
| 465 | Ga0496119_0000329 | 3300048922 | Bacteria | 66425 |
| 466 | Ga0496120_0000147 | 3300048923 | Bacteria | 117881 |
| 467 | Ga0496121_0002594 | 3300048924 | Bacteria | 27284 |
| 468 | Ga0496121_0074522 | 3300048924 | Bacteria | 2714 |
| 469 | Ga0496121_0135493 | 3300048924 | Bacteria | 1835 |
| 470 | Ga0496122_0420970 | 3300048925 | Bacteria | 671 |
| 471 | Ga0496122_0452535 | 3300048925 | Bacteria | 636 |
| 472 | Ga0496123_0113760 | 3300048926 | Bacteria | 1540 |
| 473 | Ga0496123_0361682 | 3300048926 | Bacteria | 671 |
| 474 | Ga0496124_0000680 | 3300048927 | Bacteria | 55821 |
| 475 | Ga0496124_0006616 | 3300048927 | Bacteria | 12584 |
| 476 | Ga0496124_0117367 | 3300048927 | Bacteria | 2131 |
| 477 | Ga0496124_0216655 | 3300048927 | Bacteria | 1443 |
| 478 | Ga0496124_0250764 | 3300048927 | Bacteria | 1309 |
| 479 | Ga0496124_0847527 | 3300048927 | Bacteria | 560 |
| 480 | Ga0496125_0026103 | 3300048928 | Bacteria | 5334 |
| 481 | Ga0496125_0026456 | 3300048928 | Bacteria | 5287 |
| 482 | Ga0496125_0085664 | 3300048928 | Bacteria | 2386 |
| 483 | Ga0496125_0120654 | 3300048928 | Bacteria | 1871 |
| 484 | Ga0496125_0199951 | 3300048928 | Bacteria | 1309 |
| 485 | Ga0496126_0000967 | 3300048929 | Bacteria | 49289 |
| 486 | Ga0496126_0011304 | 3300048929 | Bacteria | 9261 |
| 487 | Ga0501290_002699 | 3300049513 | Bacteria | 2277 |
| 488 | Ga0501031_0016530 | 3300049568 | Bacteria | 4793 |
| 489 | Ga0501032_0364104 | 3300049569 | Bacteria | 930 |
| 490 | Ga0501033_0024972 | 3300049570 | Bacteria | 4503 |
| 491 | Ga0501034_0000552 | 3300049571 | Bacteria | 59397 |
| 492 | Ga0501034_0193975 | 3300049571 | Bacteria | 1992 |
| 493 | Ga0501036_0142199 | 3300049572 | Bacteria | 2024 |
| 494 | Ga0501037_0046698 | 3300049573 | Bacteria | 3176 |
| 495 | Ga0501038_0015316 | 3300049574 | Bacteria | 6971 |
| 496 | Ga0501039_0027266 | 3300049575 | Bacteria | 4392 |
| 497 | Ga0501040_0962210 | 3300049576 | Bacteria | 619 |
| 498 | Ga0501043_0001713 | 3300049579 | Bacteria | 18952 |
| 499 | Ga0501043_0120368 | 3300049579 | Bacteria | 2058 |
| 500 | Ga0501047_0163739 | 3300049581 | Bacteria | 2095 |
| 501 | Ga0501067_0003235 | 3300049583 | Bacteria | 8968 |
| 502 | Ga0501068_0013166 | 3300049584 | Bacteria | 4703 |
| 503 | Ga0501070_0037650 | 3300049586 | Bacteria | 4038 |
| 504 | Ga0501071_0182798 | 3300049587 | Bacteria | 1571 |
| 505 | Ga0501072_0351258 | 3300049588 | Bacteria | 1171 |
| 506 | Ga0501075_0001709 | 3300049591 | Bacteria | 14423 |
| 507 | Ga0501076_0874263 | 3300049592 | Bacteria | 741 |
| 508 | Ga0501076_0945664 | 3300049592 | Bacteria | 710 |
| 509 | Ga0501077_0000027 | 3300049593 | Bacteria | 75456 |
| 510 | Ga0501202_070303 | 3300049652 | Bacteria | 806 |
| 511 | Ga0501216_055228 | 3300049660 | Bacteria | 789 |
| 512 | Ga0501227_244124 | 3300049665 | Bacteria | 512 |
| 513 | Ga0501242_026322 | 3300049674 | Bacteria | 769 |
| 514 | Ga0501243_031548 | 3300049675 | Bacteria | 906 |
| 515 | Ga0501221_126955 | 3300049704 | Bacteria | 657 |
| 516 | Ga0501225_0002344 | 3300049705 | Bacteria | 5843 |
| 517 | Ga0501225_0369284 | 3300049705 | Bacteria | 500 |
| 518 | Ga0501079_0756017 | 3300049741 | Bacteria | 765 |
| 519 | Ga0501080_0004080 | 3300049742 | Bacteria | 12938 |
| 520 | Ga0501080_0255110 | 3300049742 | Bacteria | 1599 |
| 521 | Ga0501081_0018085 | 3300049743 | Bacteria | 4677 |
| 522 | Ga0501263_082043 | 3300049760 | Bacteria | 534 |
| 523 | Ga0501265_034996 | 3300049762 | Bacteria | 738 |
| 524 | Ga0501275_000326 | 3300049772 | Bacteria | 5419 |
| 525 | Ga0501283_013123 | 3300049779 | Bacteria | 1252 |
| 526 | Ga0501035_0061152 | 3300049822 | Bacteria | 3352 |
| 527 | Ga0501044_0147113 | 3300049823 | Bacteria | 2340 |
| 528 | Ga0501045_0233189 | 3300049824 | Bacteria | 1370 |
| 529 | nmdc:mga00v17_107765_c1 | 3300050491 | Bacteria | 1765 |
| 530 | nmdc:mga0yw44_181472_c1 | 3300050492 | Bacteria | 1385 |
| 531 | nmdc:mga0k408_86383_c1 | 3300050493 | Bacteria | 1841 |
| 532 | nmdc:mga05p37_194609_c1 | 3300050507 | Bacteria | 2459 |
| 533 | nmdc:mga05p37_300249_c1 | 3300050507 | Bacteria | 1908 |
| 534 | nmdc:mga05p37_385218_c1 | 3300050507 | Bacteria | 1641 |
| 535 | nmdc:mga05p37_404497_c1 | 3300050507 | Unclassified | 1593 |
| 536 | nmdc:mga09592_359249_c1 | 3300050508 | Bacteria | 1261 |
| 537 | nmdc:mga09592_380982_c1 | 3300050508 | Bacteria | 1220 |
| 538 | nmdc:mga0qj67_153139_c1 | 3300050509 | Bacteria | 1871 |
| 539 | nmdc:mga0qj67_334250_c1 | 3300050509 | Bacteria | 1226 |
| 540 | nmdc:mga0qj67_828319_c1 | 3300050509 | Bacteria | 732 |
| 541 | nmdc:mga06r32_1584980_c1 | 3300050510 | Bacteria | 594 |
| 542 | nmdc:mga06r32_257641_c1 | 3300050510 | Bacteria | 1732 |
| 543 | nmdc:mga06r32_655568_c1 | 3300050510 | Bacteria | 1018 |
| 544 | nmdc:mga08y16_1433197_c1 | 3300050511 | Bacteria | 653 |
| 545 | nmdc:mga08y16_15097_c1 | 3300050511 | Bacteria | 8121 |
| 546 | nmdc:mga08y16_885874_c1 | 3300050511 | Bacteria | 880 |
| 547 | nmdc:mga0n895_212888_c1 | 3300050512 | Bacteria | 1963 |
| 548 | nmdc:mga08x19_186_c1 | 3300050514 | Bacteria | 49520 |
| 549 | nmdc:mga08x19_5414_c1 | 3300050514 | Bacteria | 7550 |
| 550 | nmdc:mga0a205_398937_c1 | 3300050515 | Bacteria | 1239 |
| 551 | Ga0495601_0262205 | 3300053077 | Bacteria | 1128 |
| 552 | Ga0501082_0001428 | 3300060353 | Bacteria | 20984 |
| 553 | Ga0501082_0768563 | 3300060353 | Bacteria | 843 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031344 | Ga0265316_10333791 | Ga0265316_103337912 | 88 |
| 2 | 2162886007 | SwRhRL2b_contig_145288 | SwRhRL2b_0907.00000390 | 89 |
| 3 | 3300002773 | JGI25152J39213_1000866 | JGI25152J39213_10008663 | 89 |
| 4 | 3300002774 | JGI25150J39212_1005456 | JGI25150J39212_10054563 | 89 |
| 5 | 3300002987 | JGI25159J45721_1041898 | JGI25159J45721_10418981 | 89 |
| 6 | 3300002987 | JGI25159J45721_1047796 | JGI25159J45721_10477961 | 89 |
| 7 | 3300003187 | JGI25151J46595_10000351 | JGI25151J46595_1000035152 | 89 |
| 8 | 3300003187 | JGI25151J46595_10070536 | JGI25151J46595_100705362 | 89 |
| 9 | 3300003187 | JGI25151J46595_10070674 | JGI25151J46595_100706741 | 89 |
| 10 | 3300003215 | JGI25153J46596_10000219 | JGI25153J46596_1000021952 | 89 |
| 11 | 3300003323 | rootH1_10228024 | rootH1_102280242 | 89 |
| 12 | 3300003771 | Ga0055526_1000428 | Ga0055526_10004284 | 89 |
| 13 | 3300003773 | Ga0055537_1000017 | Ga0055537_100001783 | 89 |
| 14 | 3300003773 | Ga0055537_1001080 | Ga0055537_10010806 | 89 |
| 15 | 3300003775 | Ga0055524_1000280 | Ga0055524_100028010 | 89 |
| 16 | 3300003775 | Ga0055524_1031360 | Ga0055524_10313602 | 89 |
| 17 | 3300003781 | Ga0055536_1004171 | Ga0055536_10041712 | 89 |
| 18 | 3300003781 | Ga0055536_1004653 | Ga0055536_10046534 | 89 |
| 19 | 3300003784 | Ga0055534_1000163 | Ga0055534_100016311 | 89 |
| 20 | 3300003784 | Ga0055534_1000267 | Ga0055534_10002675 | 89 |
| 21 | 3300003784 | Ga0055534_1018274 | Ga0055534_10182742 | 89 |
| 22 | 3300003790 | Ga0055528_1000182 | Ga0055528_100018239 | 89 |
| 23 | 3300003790 | Ga0055528_1000204 | Ga0055528_100020410 | 89 |
| 24 | 3300003791 | Ga0055530_10001486 | Ga0055530_1000148621 | 89 |
| 25 | 3300003791 | Ga0055530_10004170 | Ga0055530_100041708 | 89 |
| 26 | 3300003791 | Ga0055530_10031900 | Ga0055530_100319002 | 89 |
| 27 | 3300003794 | Ga0055531_10019722 | Ga0055531_100197222 | 89 |
| 28 | 3300003794 | Ga0055531_10031196 | Ga0055531_100311962 | 89 |
| 29 | 3300003794 | Ga0055531_10047038 | Ga0055531_100470382 | 89 |
| 30 | 3300005289 | Ga0065704_10070357 | Ga0065704_1007035729 | 89 |
| 31 | 3300005295 | Ga0065707_10102372 | Ga0065707_101023722 | 89 |
| 32 | 3300005295 | Ga0065707_10299350 | Ga0065707_102993502 | 89 |
| 33 | 3300005328 | Ga0070676_10182928 | Ga0070676_101829281 | 89 |
| 34 | 3300005328 | Ga0070676_10828839 | Ga0070676_108288392 | 89 |
| 35 | 3300005333 | Ga0070677_10406146 | Ga0070677_104061462 | 89 |
| 36 | 3300005334 | Ga0068869_100063267 | Ga0068869_1000632672 | 89 |
| 37 | 3300005338 | Ga0068868_100276504 | Ga0068868_1002765043 | 89 |
| 38 | 3300005340 | Ga0070689_100097433 | Ga0070689_1000974333 | 89 |
| 39 | 3300005340 | Ga0070689_101370967 | Ga0070689_1013709672 | 89 |
| 40 | 3300005341 | Ga0070691_10452015 | Ga0070691_104520151 | 89 |
| 41 | 3300005347 | Ga0070668_100101467 | Ga0070668_1001014673 | 89 |
| 42 | 3300005347 | Ga0070668_100308055 | Ga0070668_1003080552 | 89 |
| 43 | 3300005353 | Ga0070669_100284429 | Ga0070669_1002844293 | 89 |
| 44 | 3300005353 | Ga0070669_100522997 | Ga0070669_1005229972 | 89 |
| 45 | 3300005354 | Ga0070675_100030112 | Ga0070675_1000301122 | 89 |
| 46 | 3300005356 | Ga0070674_100004643 | Ga0070674_10000464310 | 89 |
| 47 | 3300005356 | Ga0070674_101538441 | Ga0070674_1015384412 | 89 |
| 48 | 3300005364 | Ga0070673_100134417 | Ga0070673_1001344171 | 89 |
| 49 | 3300005364 | Ga0070673_100814779 | Ga0070673_1008147792 | 89 |
| 50 | 3300005367 | Ga0070667_100049436 | Ga0070667_1000494362 | 89 |
| 51 | 3300005367 | Ga0070667_100293756 | Ga0070667_1002937563 | 89 |
| 52 | 3300005438 | Ga0070701_10092027 | Ga0070701_100920273 | 89 |
| 53 | 3300005438 | Ga0070701_10112782 | Ga0070701_101127822 | 89 |
| 54 | 3300005441 | Ga0070700_100051280 | Ga0070700_1000512803 | 89 |
| 55 | 3300005441 | Ga0070700_100111477 | Ga0070700_1001114773 | 89 |
| 56 | 3300005441 | Ga0070700_100715563 | Ga0070700_1007155632 | 89 |
| 57 | 3300005441 | Ga0070700_101971092 | Ga0070700_1019710921 | 89 |
| 58 | 3300005444 | Ga0070694_100058025 | Ga0070694_1000580251 | 89 |
| 59 | 3300005455 | Ga0070663_100182455 | Ga0070663_1001824552 | 89 |
| 60 | 3300005456 | Ga0070678_100110589 | Ga0070678_1001105893 | 89 |
| 61 | 3300005459 | Ga0068867_100005133 | Ga0068867_1000051333 | 89 |
| 62 | 3300005466 | Ga0070685_10066300 | Ga0070685_100663001 | 89 |
| 63 | 3300005544 | Ga0070686_100609991 | Ga0070686_1006099912 | 89 |
| 64 | 3300005545 | Ga0070695_100067019 | Ga0070695_1000670192 | 89 |
| 65 | 3300005546 | Ga0070696_100703984 | Ga0070696_1007039842 | 89 |
| 66 | 3300005547 | Ga0070693_100996030 | Ga0070693_1009960301 | 89 |
| 67 | 3300005548 | Ga0070665_100000426 | Ga0070665_10000042636 | 89 |
| 68 | 3300005548 | Ga0070665_100016620 | Ga0070665_10001662010 | 89 |
| 69 | 3300005549 | Ga0070704_100339417 | Ga0070704_1003394172 | 89 |
| 70 | 3300005615 | Ga0070702_100032620 | Ga0070702_1000326203 | 89 |
| 71 | 3300005615 | Ga0070702_100228661 | Ga0070702_1002286612 | 89 |
| 72 | 3300005617 | Ga0068859_100283262 | Ga0068859_1002832623 | 89 |
| 73 | 3300005617 | Ga0068859_101275388 | Ga0068859_1012753882 | 89 |
| 74 | 3300005718 | Ga0068866_10078681 | Ga0068866_100786812 | 89 |
| 75 | 3300005719 | Ga0068861_100006910 | Ga0068861_1000069103 | 89 |
| 76 | 3300005719 | Ga0068861_100704301 | Ga0068861_1007043012 | 89 |
| 77 | 3300005840 | Ga0068870_10060897 | Ga0068870_100608973 | 89 |
| 78 | 3300005842 | Ga0068858_100087721 | Ga0068858_1000877214 | 89 |
| 79 | 3300005842 | Ga0068858_100279118 | Ga0068858_1002791182 | 89 |
| 80 | 3300005843 | Ga0068860_100001559 | Ga0068860_1000015592 | 89 |
| 81 | 3300005844 | Ga0068862_100018269 | Ga0068862_1000182693 | 89 |
| 82 | 3300005844 | Ga0068862_100232682 | Ga0068862_1002326822 | 89 |
| 83 | 3300005844 | Ga0068862_100835671 | Ga0068862_1008356712 | 89 |
| 84 | 3300005985 | Ga0081539_10052951 | Ga0081539_100529514 | 89 |
| 85 | 3300006038 | Ga0075365_10025358 | Ga0075365_100253583 | 89 |
| 86 | 3300006048 | Ga0075363_100176930 | Ga0075363_1001769302 | 89 |
| 87 | 3300006048 | Ga0075363_100613147 | Ga0075363_1006131472 | 89 |
| 88 | 3300006051 | Ga0075364_10046386 | Ga0075364_100463862 | 89 |
| 89 | 3300006051 | Ga0075364_10116412 | Ga0075364_101164122 | 89 |
| 90 | 3300006173 | Ga0070716_100398343 | Ga0070716_1003983432 | 89 |
| 91 | 3300006195 | Ga0075366_10050179 | Ga0075366_100501793 | 89 |
| 92 | 3300006195 | Ga0075366_10326750 | Ga0075366_103267502 | 89 |
| 93 | 3300006358 | Ga0068871_100684907 | Ga0068871_1006849072 | 89 |
| 94 | 3300006358 | Ga0068871_100978936 | Ga0068871_1009789362 | 89 |
| 95 | 3300006844 | Ga0075428_100015486 | Ga0075428_1000154867 | 89 |
| 96 | 3300006844 | Ga0075428_100538086 | Ga0075428_1005380861 | 89 |
| 97 | 3300006847 | Ga0075431_100072888 | Ga0075431_1000728884 | 89 |
| 98 | 3300006847 | Ga0075431_100924156 | Ga0075431_1009241562 | 89 |
| 99 | 3300006852 | Ga0075433_10255655 | Ga0075433_102556553 | 89 |
| 100 | 3300006871 | Ga0075434_100152692 | Ga0075434_1001526922 | 89 |
| 101 | 3300006871 | Ga0075434_101981006 | Ga0075434_1019810061 | 89 |
| 102 | 3300006880 | Ga0075429_100040836 | Ga0075429_1000408364 | 89 |
| 103 | 3300006880 | Ga0075429_100360121 | Ga0075429_1003601212 | 89 |
| 104 | 3300006881 | Ga0068865_100003673 | Ga0068865_1000036733 | 89 |
| 105 | 3300006914 | Ga0075436_100000080 | Ga0075436_1000000803 | 89 |
| 106 | 3300006914 | Ga0075436_100011138 | Ga0075436_1000111387 | 89 |
| 107 | 3300006931 | Ga0097620_100283260 | Ga0097620_1002832603 | 89 |
| 108 | 3300006931 | Ga0097620_101275417 | Ga0097620_1012754172 | 89 |
| 109 | 3300007076 | Ga0075435_100273660 | Ga0075435_1002736602 | 89 |
| 110 | 3300007076 | Ga0075435_101069815 | Ga0075435_1010698152 | 89 |
| 111 | 3300009011 | Ga0105251_10002785 | Ga0105251_1000278516 | 89 |
| 112 | 3300009036 | Ga0105244_10069296 | Ga0105244_100692962 | 89 |
| 113 | 3300009036 | Ga0105244_10095776 | Ga0105244_100957763 | 89 |
| 114 | 3300009094 | Ga0111539_10037006 | Ga0111539_100370067 | 89 |
| 115 | 3300009094 | Ga0111539_11445837 | Ga0111539_114458372 | 89 |
| 116 | 3300009098 | Ga0105245_10386246 | Ga0105245_103862462 | 89 |
| 117 | 3300009147 | Ga0114129_10066031 | Ga0114129_100660313 | 89 |
| 118 | 3300009147 | Ga0114129_10496808 | Ga0114129_104968083 | 89 |
| 119 | 3300009147 | Ga0114129_11082380 | Ga0114129_110823802 | 89 |
| 120 | 3300009147 | Ga0114129_11481661 | Ga0114129_114816612 | 89 |
| 121 | 3300009148 | Ga0105243_10276007 | Ga0105243_102760072 | 89 |
| 122 | 3300009148 | Ga0105243_10663225 | Ga0105243_106632253 | 89 |
| 123 | 3300009177 | Ga0105248_10178904 | Ga0105248_101789043 | 89 |
| 124 | 3300009551 | Ga0105238_11705139 | Ga0105238_117051392 | 89 |
| 125 | 3300009553 | Ga0105249_10028331 | Ga0105249_100283315 | 89 |
| 126 | 3300009979 | Ga0105032_102131 | Ga0105032_1021312 | 89 |
| 127 | 3300009993 | Ga0105028_109473 | Ga0105028_1094732 | 89 |
| 128 | 3300012478 | Ga0157328_1011098 | Ga0157328_10110982 | 89 |
| 129 | 3300012482 | Ga0157318_1018201 | Ga0157318_10182011 | 89 |
| 130 | 3300012503 | Ga0157313_1020458 | Ga0157313_10204581 | 89 |
| 131 | 3300012512 | Ga0157327_1007886 | Ga0157327_10078862 | 89 |
| 132 | 3300013100 | Ga0157373_10184015 | Ga0157373_101840153 | 89 |
| 133 | 3300013102 | Ga0157371_10002186 | Ga0157371_100021868 | 89 |
| 134 | 3300013102 | Ga0157371_10020416 | Ga0157371_100204162 | 89 |
| 135 | 3300013104 | Ga0157370_10010646 | Ga0157370_100106462 | 89 |
| 136 | 3300013104 | Ga0157370_10112942 | Ga0157370_101129422 | 89 |
| 137 | 3300013297 | Ga0157378_10001811 | Ga0157378_1000181120 | 89 |
| 138 | 3300013306 | Ga0163162_10017493 | Ga0163162_100174937 | 89 |
| 139 | 3300013306 | Ga0163162_10383025 | Ga0163162_103830252 | 89 |
| 140 | 3300014325 | Ga0163163_11825605 | Ga0163163_118256052 | 89 |
| 141 | 3300014326 | Ga0157380_10017645 | Ga0157380_100176457 | 89 |
| 142 | 3300014326 | Ga0157380_10131540 | Ga0157380_101315402 | 89 |
| 143 | 3300014326 | Ga0157380_10712059 | Ga0157380_107120592 | 89 |
| 144 | 3300014326 | Ga0157380_11318696 | Ga0157380_113186961 | 89 |
| 145 | 3300014497 | Ga0182008_10000096 | Ga0182008_1000009665 | 89 |
| 146 | 3300014497 | Ga0182008_10001301 | Ga0182008_1000130121 | 89 |
| 147 | 3300014745 | Ga0157377_11581326 | Ga0157377_115813261 | 89 |
| 148 | 3300014968 | Ga0157379_10227952 | Ga0157379_102279522 | 89 |
| 149 | 3300014969 | Ga0157376_10578350 | Ga0157376_105783503 | 89 |
| 150 | 3300014969 | Ga0157376_11242481 | Ga0157376_112424811 | 89 |
| 151 | 3300015261 | Ga0182006_1008250 | Ga0182006_10082507 | 89 |
| 152 | 3300015261 | Ga0182006_1110862 | Ga0182006_11108622 | 89 |
| 153 | 3300015262 | Ga0182007_10000048 | Ga0182007_1000004892 | 89 |
| 154 | 3300015265 | Ga0182005_1003480 | Ga0182005_10034802 | 89 |
| 155 | 3300015689 | Ga0183360_10001 | Ga0183360_10001271 | 89 |
| 156 | 3300016635 | Ga0183361_11453 | Ga0183361_114532 | 89 |
| 157 | 3300017792 | Ga0163161_10030249 | Ga0163161_100302492 | 89 |
| 158 | 3300017792 | Ga0163161_10541904 | Ga0163161_105419042 | 89 |
| 159 | 3300017792 | Ga0163161_10609356 | Ga0163161_106093562 | 89 |
| 160 | 3300025245 | Ga0207425_1000111 | Ga0207425_100011131 | 89 |
| 161 | 3300025245 | Ga0207425_1026892 | Ga0207425_10268921 | 89 |
| 162 | 3300025258 | Ga0209129_1000087 | Ga0209129_1000087146 | 89 |
| 163 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005851 | 89 |
| 164 | 3300025263 | Ga0209565_1000031 | Ga0209565_1000031147 | 89 |
| 165 | 3300025273 | Ga0209673_1000011 | Ga0209673_1000011506 | 89 |
| 166 | 3300025273 | Ga0209673_1000164 | Ga0209673_100016472 | 89 |
| 167 | 3300025273 | Ga0209673_1004282 | Ga0209673_10042822 | 89 |
| 168 | 3300025273 | Ga0209673_1064512 | Ga0209673_10645122 | 89 |
| 169 | 3300025284 | Ga0209130_1002494 | Ga0209130_10024948 | 89 |
| 170 | 3300025284 | Ga0209130_1005265 | Ga0209130_10052653 | 89 |
| 171 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004851 | 89 |
| 172 | 3300025291 | Ga0209675_1000015 | Ga0209675_1000015246 | 89 |
| 173 | 3300025291 | Ga0209675_1006953 | Ga0209675_10069532 | 89 |
| 174 | 3300025291 | Ga0209675_1015895 | Ga0209675_10158952 | 89 |
| 175 | 3300025292 | Ga0209676_1000027 | Ga0209676_1000027214 | 89 |
| 176 | 3300025292 | Ga0209676_1000110 | Ga0209676_1000110174 | 89 |
| 177 | 3300025292 | Ga0209676_1001028 | Ga0209676_100102826 | 89 |
| 178 | 3300025292 | Ga0209676_1001231 | Ga0209676_100123121 | 89 |
| 179 | 3300025292 | Ga0209676_1005673 | Ga0209676_10056733 | 89 |
| 180 | 3300025292 | Ga0209676_1016472 | Ga0209676_10164722 | 89 |
| 181 | 3300025294 | Ga0209025_1000013 | Ga0209025_1000013427 | 89 |
| 182 | 3300025294 | Ga0209025_1003537 | Ga0209025_10035379 | 89 |
| 183 | 3300025294 | Ga0209025_1007002 | Ga0209025_10070029 | 89 |
| 184 | 3300025294 | Ga0209025_1042768 | Ga0209025_10427682 | 89 |
| 185 | 3300025294 | Ga0209025_1048110 | Ga0209025_10481102 | 89 |
| 186 | 3300025294 | Ga0209025_1116044 | Ga0209025_11160442 | 89 |
| 187 | 3300025295 | Ga0209564_1000018 | Ga0209564_1000018506 | 89 |
| 188 | 3300025295 | Ga0209564_1000037 | Ga0209564_1000037123 | 89 |
| 189 | 3300025295 | Ga0209564_1008868 | Ga0209564_10088682 | 89 |
| 190 | 3300025297 | Ga0209758_1000014 | Ga0209758_1000014427 | 89 |
| 191 | 3300025297 | Ga0209758_1037036 | Ga0209758_10370362 | 89 |
| 192 | 3300025298 | Ga0209050_1000417 | Ga0209050_100041768 | 89 |
| 193 | 3300025298 | Ga0209050_1001410 | Ga0209050_100141021 | 89 |
| 194 | 3300025298 | Ga0209050_1002473 | Ga0209050_10024733 | 89 |
| 195 | 3300025298 | Ga0209050_1015285 | Ga0209050_10152856 | 89 |
| 196 | 3300025299 | Ga0209256_1000021 | Ga0209256_1000021454 | 89 |
| 197 | 3300025299 | Ga0209256_1002158 | Ga0209256_10021588 | 89 |
| 198 | 3300025299 | Ga0209256_1002613 | Ga0209256_100261317 | 89 |
| 199 | 3300025299 | Ga0209256_1008601 | Ga0209256_10086017 | 89 |
| 200 | 3300025299 | Ga0209256_1015165 | Ga0209256_10151652 | 89 |
| 201 | 3300025303 | Ga0209051_1001882 | Ga0209051_10018823 | 89 |
| 202 | 3300025303 | Ga0209051_1039697 | Ga0209051_10396973 | 89 |
| 203 | 3300025304 | Ga0209257_1000129 | Ga0209257_1000129174 | 89 |
| 204 | 3300025304 | Ga0209257_1000274 | Ga0209257_100027411 | 89 |
| 205 | 3300025304 | Ga0209257_1000670 | Ga0209257_100067047 | 89 |
| 206 | 3300025304 | Ga0209257_1001580 | Ga0209257_100158012 | 89 |
| 207 | 3300025304 | Ga0209257_1003605 | Ga0209257_100360511 | 89 |
| 208 | 3300025728 | Ga0207655_1050978 | Ga0207655_10509782 | 89 |
| 209 | 3300025735 | Ga0207713_1037920 | Ga0207713_10379203 | 89 |
| 210 | 3300025893 | Ga0207682_10037813 | Ga0207682_100378132 | 89 |
| 211 | 3300025907 | Ga0207645_10372596 | Ga0207645_103725963 | 89 |
| 212 | 3300025908 | Ga0207643_10025859 | Ga0207643_100258593 | 89 |
| 213 | 3300025918 | Ga0207662_10062619 | Ga0207662_100626192 | 89 |
| 214 | 3300025918 | Ga0207662_10125440 | Ga0207662_101254403 | 89 |
| 215 | 3300025923 | Ga0207681_10129166 | Ga0207681_101291663 | 89 |
| 216 | 3300025923 | Ga0207681_10500011 | Ga0207681_105000112 | 89 |
| 217 | 3300025926 | Ga0207659_10155795 | Ga0207659_101557953 | 89 |
| 218 | 3300025927 | Ga0207687_11544644 | Ga0207687_115446442 | 89 |
| 219 | 3300025935 | Ga0207709_10001341 | Ga0207709_100013416 | 89 |
| 220 | 3300025936 | Ga0207670_10848363 | Ga0207670_108483631 | 89 |
| 221 | 3300025937 | Ga0207669_10067732 | Ga0207669_100677323 | 89 |
| 222 | 3300025938 | Ga0207704_10021633 | Ga0207704_100216332 | 89 |
| 223 | 3300025938 | Ga0207704_11851762 | Ga0207704_118517622 | 89 |
| 224 | 3300025940 | Ga0207691_10394107 | Ga0207691_103941073 | 89 |
| 225 | 3300025941 | Ga0207711_10525154 | Ga0207711_105251542 | 89 |
| 226 | 3300025942 | Ga0207689_10023675 | Ga0207689_100236754 | 89 |
| 227 | 3300025960 | Ga0207651_10074768 | Ga0207651_100747681 | 89 |
| 228 | 3300025960 | Ga0207651_10108211 | Ga0207651_101082112 | 89 |
| 229 | 3300025960 | Ga0207651_10647467 | Ga0207651_106474672 | 89 |
| 230 | 3300025961 | Ga0207712_10066694 | Ga0207712_100666942 | 89 |
| 231 | 3300025972 | Ga0207668_10171005 | Ga0207668_101710053 | 89 |
| 232 | 3300025972 | Ga0207668_10226106 | Ga0207668_102261062 | 89 |
| 233 | 3300025972 | Ga0207668_10276307 | Ga0207668_102763072 | 89 |
| 234 | 3300025986 | Ga0207658_10219884 | Ga0207658_102198842 | 89 |
| 235 | 3300025986 | Ga0207658_10557962 | Ga0207658_105579623 | 89 |
| 236 | 3300026035 | Ga0207703_10057752 | Ga0207703_100577524 | 89 |
| 237 | 3300026035 | Ga0207703_10209043 | Ga0207703_102090433 | 89 |
| 238 | 3300026067 | Ga0207678_10096767 | Ga0207678_100967673 | 89 |
| 239 | 3300026075 | Ga0207708_10044954 | Ga0207708_100449542 | 89 |
| 240 | 3300026075 | Ga0207708_11440849 | Ga0207708_114408492 | 89 |
| 241 | 3300026089 | Ga0207648_10000419 | Ga0207648_100004193 | 89 |
| 242 | 3300026095 | Ga0207676_11025538 | Ga0207676_110255382 | 89 |
| 243 | 3300026118 | Ga0207675_100004240 | Ga0207675_10000424015 | 89 |
| 244 | 3300026118 | Ga0207675_100746718 | Ga0207675_1007467182 | 89 |
| 245 | 3300026118 | Ga0207675_101334667 | Ga0207675_1013346672 | 89 |
| 246 | 3300026121 | Ga0207683_10107322 | Ga0207683_101073223 | 89 |
| 247 | 3300027360 | Ga0209969_1025153 | Ga0209969_10251533 | 89 |
| 248 | 3300027378 | Ga0209981_1017637 | Ga0209981_10176371 | 89 |
| 249 | 3300027395 | Ga0209996_1012267 | Ga0209996_10122672 | 89 |
| 250 | 3300027462 | Ga0210000_1057197 | Ga0210000_10571971 | 89 |
| 251 | 3300027471 | Ga0209995_1030699 | Ga0209995_10306992 | 89 |
| 252 | 3300027526 | Ga0209968_1018613 | Ga0209968_10186132 | 89 |
| 253 | 3300027552 | Ga0209982_1002284 | Ga0209982_10022842 | 89 |
| 254 | 3300027665 | Ga0209983_1019290 | Ga0209983_10192903 | 89 |
| 255 | 3300027671 | Ga0209588_1099186 | Ga0209588_10991862 | 89 |
| 256 | 3300027682 | Ga0209971_1003169 | Ga0209971_10031694 | 89 |
| 257 | 3300027695 | Ga0209966_1002105 | Ga0209966_10021056 | 89 |
| 258 | 3300027717 | Ga0209998_10116260 | Ga0209998_101162602 | 89 |
| 259 | 3300027876 | Ga0209974_10027381 | Ga0209974_100273812 | 89 |
| 260 | 3300027907 | Ga0207428_10075254 | Ga0207428_100752542 | 89 |
| 261 | 3300027907 | Ga0207428_10095871 | Ga0207428_100958713 | 89 |
| 262 | 3300028379 | Ga0268266_10000741 | Ga0268266_100007417 | 89 |
| 263 | 3300028379 | Ga0268266_10059786 | Ga0268266_100597862 | 89 |
| 264 | 3300028380 | Ga0268265_10019602 | Ga0268265_100196022 | 89 |
| 265 | 3300028380 | Ga0268265_10096628 | Ga0268265_100966282 | 89 |
| 266 | 3300028380 | Ga0268265_10397887 | Ga0268265_103978872 | 89 |
| 267 | 3300028380 | Ga0268265_12647744 | Ga0268265_126477442 | 89 |
| 268 | 3300028381 | Ga0268264_10002884 | Ga0268264_100028842 | 89 |
| 269 | 3300028794 | Ga0307515_10093168 | Ga0307515_100931686 | 89 |
| 270 | 3300030732 | Ga0316176_1013813 | Ga0316176_10138133 | 89 |
| 271 | 3300030732 | Ga0316176_1040133 | Ga0316176_10401331 | 89 |
| 272 | 3300030744 | Ga0316181_1005833 | Ga0316181_10058332 | 89 |
| 273 | 3300030745 | Ga0316182_1061642 | Ga0316182_10616421 | 89 |
| 274 | 3300031235 | Ga0265330_10084253 | Ga0265330_100842532 | 89 |
| 275 | 3300031456 | Ga0307513_10151000 | Ga0307513_101510003 | 89 |
| 276 | 3300031548 | Ga0307408_100360066 | Ga0307408_1003600663 | 89 |
| 277 | 3300031548 | Ga0307408_101008178 | Ga0307408_1010081781 | 89 |
| 278 | 3300031548 | Ga0307408_101078557 | Ga0307408_1010785572 | 89 |
| 279 | 3300031548 | Ga0307408_101344831 | Ga0307408_1013448313 | 89 |
| 280 | 3300031548 | Ga0307408_102213959 | Ga0307408_1022139592 | 89 |
| 281 | 3300031616 | Ga0307508_10066109 | Ga0307508_100661092 | 89 |
| 282 | 3300031731 | Ga0307405_10229291 | Ga0307405_102292911 | 89 |
| 283 | 3300031731 | Ga0307405_10318632 | Ga0307405_103186322 | 89 |
| 284 | 3300031731 | Ga0307405_10338901 | Ga0307405_103389013 | 89 |
| 285 | 3300031731 | Ga0307405_10497702 | Ga0307405_104977022 | 89 |
| 286 | 3300031731 | Ga0307405_10783784 | Ga0307405_107837842 | 89 |
| 287 | 3300031731 | Ga0307405_11353224 | Ga0307405_113532242 | 89 |
| 288 | 3300031824 | Ga0307413_10042618 | Ga0307413_100426182 | 89 |
| 289 | 3300031824 | Ga0307413_10151902 | Ga0307413_101519022 | 89 |
| 290 | 3300031824 | Ga0307413_10569113 | Ga0307413_105691132 | 89 |
| 291 | 3300031824 | Ga0307413_10896730 | Ga0307413_108967302 | 89 |
| 292 | 3300031824 | Ga0307413_11082303 | Ga0307413_110823032 | 89 |
| 293 | 3300031824 | Ga0307413_11397568 | Ga0307413_113975681 | 89 |
| 294 | 3300031852 | Ga0307410_11277569 | Ga0307410_112775692 | 89 |
| 295 | 3300031901 | Ga0307406_10089496 | Ga0307406_100894962 | 89 |
| 296 | 3300031901 | Ga0307406_10578196 | Ga0307406_105781962 | 89 |
| 297 | 3300031903 | Ga0307407_10540640 | Ga0307407_105406402 | 89 |
| 298 | 3300031911 | Ga0307412_10055820 | Ga0307412_100558204 | 89 |
| 299 | 3300031911 | Ga0307412_10070447 | Ga0307412_100704472 | 89 |
| 300 | 3300031911 | Ga0307412_10093932 | Ga0307412_100939324 | 89 |
| 301 | 3300031911 | Ga0307412_10904203 | Ga0307412_109042032 | 89 |
| 302 | 3300031911 | Ga0307412_11195568 | Ga0307412_111955682 | 89 |
| 303 | 3300031995 | Ga0307409_100793194 | Ga0307409_1007931942 | 89 |
| 304 | 3300031995 | Ga0307409_101205923 | Ga0307409_1012059232 | 89 |
| 305 | 3300031995 | Ga0307409_101248142 | Ga0307409_1012481422 | 89 |
| 306 | 3300031995 | Ga0307409_101995134 | Ga0307409_1019951341 | 89 |
| 307 | 3300032002 | Ga0307416_100168763 | Ga0307416_1001687632 | 89 |
| 308 | 3300032002 | Ga0307416_100201334 | Ga0307416_1002013343 | 89 |
| 309 | 3300032002 | Ga0307416_100342918 | Ga0307416_1003429182 | 89 |
| 310 | 3300032002 | Ga0307416_101201320 | Ga0307416_1012013202 | 89 |
| 311 | 3300032002 | Ga0307416_101280090 | Ga0307416_1012800902 | 89 |
| 312 | 3300032002 | Ga0307416_103273529 | Ga0307416_1032735292 | 89 |
| 313 | 3300032002 | Ga0307416_103373793 | Ga0307416_1033737932 | 89 |
| 314 | 3300032004 | Ga0307414_10008172 | Ga0307414_100081723 | 89 |
| 315 | 3300032004 | Ga0307414_10010308 | Ga0307414_100103083 | 89 |
| 316 | 3300032004 | Ga0307414_10024671 | Ga0307414_100246711 | 89 |
| 317 | 3300032004 | Ga0307414_10034606 | Ga0307414_100346066 | 89 |
| 318 | 3300032004 | Ga0307414_10044477 | Ga0307414_100444772 | 89 |
| 319 | 3300032004 | Ga0307414_10057247 | Ga0307414_100572473 | 89 |
| 320 | 3300032004 | Ga0307414_10094649 | Ga0307414_100946494 | 89 |
| 321 | 3300032004 | Ga0307414_10097637 | Ga0307414_100976374 | 89 |
| 322 | 3300032004 | Ga0307414_10236817 | Ga0307414_102368172 | 89 |
| 323 | 3300032004 | Ga0307414_10526910 | Ga0307414_105269101 | 89 |
| 324 | 3300032004 | Ga0307414_10714026 | Ga0307414_107140262 | 89 |
| 325 | 3300032004 | Ga0307414_11621869 | Ga0307414_116218692 | 89 |
| 326 | 3300032005 | Ga0307411_10010665 | Ga0307411_100106654 | 89 |
| 327 | 3300032005 | Ga0307411_10012920 | Ga0307411_100129202 | 89 |
| 328 | 3300032005 | Ga0307411_10315419 | Ga0307411_103154192 | 89 |
| 329 | 3300032005 | Ga0307411_10327677 | Ga0307411_103276772 | 89 |
| 330 | 3300032005 | Ga0307411_10377285 | Ga0307411_103772852 | 89 |
| 331 | 3300035171 | Ga0373946_0438101 | Ga0373946_0438101_141_410 | 89 |
| 332 | 3300035241 | Ga0373961_0000811 | Ga0373961_0000811_3374_3643 | 89 |
| 333 | 3300035410 | Ga0373924_0257993 | Ga0373924_0257993_313_582 | 89 |
| 334 | 3300035692 | Ga0373935_0000870 | Ga0373935_0000870_10476_10745 | 89 |
| 335 | 3300035692 | Ga0373935_0712215 | Ga0373935_0712215_81_350 | 89 |
| 336 | 3300037068 | Ga0373925_0011924 | Ga0373925_0011924_3122_3391 | 89 |
| 337 | 3300038705 | Ga0237819_00040 | Ga0237819_00040_44729_44998 | 89 |
| 338 | 3300038741 | Ga0400488_58698 | Ga0400488_58698_1319_1588 | 89 |
| 339 | 3300038742 | Ga0400486_30163 | Ga0400486_30163_4597_4866 | 89 |
| 340 | 3300039062 | Ga0400483_151922 | Ga0400483_151922_783_1052 | 89 |
| 341 | 3300039093 | Ga0400489_75675 | Ga0400489_75675_4067_4336 | 89 |
| 342 | 3300039110 | Ga0400487_48277 | Ga0400487_48277_869_1138 | 89 |
| 343 | 3300039145 | Ga0237816_01328 | Ga0237816_01328_979_1248 | 89 |
| 344 | 3300041404 | Ga0439436_0009624 | Ga0439436_0009624_230_499 | 89 |
| 345 | 3300041404 | Ga0439436_0093051 | Ga0439436_0093051_475_744 | 89 |
| 346 | 3300041406 | Ga0439439_0018976 | Ga0439439_0018976_372_641 | 89 |
| 347 | 3300041406 | Ga0439439_0034156 | Ga0439439_0034156_436_705 | 89 |
| 348 | 3300041406 | Ga0439439_0274738 | Ga0439439_0274738_176_445 | 89 |
| 349 | 3300041408 | Ga0439453_0063592 | Ga0439453_0063592_159_428 | 89 |
| 350 | 3300041411 | Ga0439466_0207546 | Ga0439466_0207546_148_417 | 89 |
| 351 | 3300041413 | Ga0439465_0005832 | Ga0439465_0005832_1726_2007 | 89 |
| 352 | 3300041413 | Ga0439465_0008429 | Ga0439465_0008429_1350_1619 | 89 |
| 353 | 3300041413 | Ga0439465_0013607 | Ga0439465_0013607_1618_1887 | 89 |
| 354 | 3300041413 | Ga0439465_0329133 | Ga0439465_0329133_183_452 | 89 |
| 355 | 3300041441 | Ga0451787_065104 | Ga0451787_065104_327_596 | 89 |
| 356 | 3300041451 | Ga0451791_0906637 | Ga0451791_0906637_111_380 | 89 |
| 357 | 3300041452 | Ga0451793_0670350 | Ga0451793_0670350_970_1239 | 89 |
| 358 | 3300041453 | Ga0451797_0158336 | Ga0451797_0158336_341_610 | 89 |
| 359 | 3300041456 | Ga0451795_0787166 | Ga0451795_0787166_400_687 | 89 |
| 360 | 3300041456 | Ga0451795_1518945 | Ga0451795_1518945_304_573 | 89 |
| 361 | 3300041460 | Ga0451802_2076607 | Ga0451802_2076607_37_306 | 89 |
| 362 | 3300041463 | Ga0451804_1029255 | Ga0451804_1029255_737_1006 | 89 |
| 363 | 3300041486 | Ga0451807_0199166 | Ga0451807_0199166_711_980 | 89 |
| 364 | 3300041486 | Ga0451807_2137752 | Ga0451807_2137752_221_490 | 89 |
| 365 | 3300041486 | Ga0451807_2709952 | Ga0451807_2709952_1149_1418 | 89 |
| 366 | 3300041494 | Ga0451837_1410386 | Ga0451837_1410386_207_476 | 89 |
| 367 | 3300041498 | Ga0451841_0417243 | Ga0451841_0417243_171_440 | 89 |
| 368 | 3300041498 | Ga0451841_0652781 | Ga0451841_0652781_278_547 | 89 |
| 369 | 3300041505 | Ga0451849_0218415 | Ga0451849_0218415_299_568 | 89 |
| 370 | 3300041505 | Ga0451849_0443800 | Ga0451849_0443800_156_425 | 89 |
| 371 | 3300041509 | Ga0451843_0941578 | Ga0451843_0941578_134_403 | 89 |
| 372 | 3300041509 | Ga0451843_1288714 | Ga0451843_1288714_671_940 | 89 |
| 373 | 3300041511 | Ga0451855_1858647 | Ga0451855_1858647_31_300 | 89 |
| 374 | 3300041512 | Ga0451853_1337486 | Ga0451853_1337486_249_518 | 89 |
| 375 | 3300041997 | Ga0439431_0120939 | Ga0439431_0120939_427_699 | 89 |
| 376 | 3300041999 | Ga0439433_0015296 | Ga0439433_0015296_975_1244 | 89 |
| 377 | 3300041999 | Ga0439433_0026976 | Ga0439433_0026976_763_1032 | 89 |
| 378 | 3300042001 | Ga0439441_009870 | Ga0439441_009870_387_656 | 89 |
| 379 | 3300042003 | Ga0439443_003655 | Ga0439443_003655_350_619 | 89 |
| 380 | 3300042004 | Ga0439445_0007424 | Ga0439445_0007424_358_630 | 89 |
| 381 | 3300042006 | Ga0439432_006888 | Ga0439432_006888_1213_1482 | 89 |
| 382 | 3300042006 | Ga0439432_013892 | Ga0439432_013892_800_1069 | 89 |
| 383 | 3300042006 | Ga0439432_032834 | Ga0439432_032834_269_556 | 89 |
| 384 | 3300042006 | Ga0439432_083027 | Ga0439432_083027_406_675 | 89 |
| 385 | 3300042006 | Ga0439432_152561 | Ga0439432_152561_387_656 | 89 |
| 386 | 3300042007 | Ga0439449_0000004 | Ga0439449_0000004_11430_11711 | 89 |
| 387 | 3300042007 | Ga0439449_0004225 | Ga0439449_0004225_3665_3934 | 89 |
| 388 | 3300042007 | Ga0439449_0011914 | Ga0439449_0011914_1228_1497 | 89 |
| 389 | 3300042007 | Ga0439449_0019204 | Ga0439449_0019204_1757_2026 | 89 |
| 390 | 3300042007 | Ga0439449_0023109 | Ga0439449_0023109_855_1124 | 89 |
| 391 | 3300042007 | Ga0439449_0042411 | Ga0439449_0042411_903_1172 | 89 |
| 392 | 3300042007 | Ga0439449_0158662 | Ga0439449_0158662_43_312 | 89 |
| 393 | 3300042010 | Ga0439452_006295 | Ga0439452_006295_92_361 | 89 |
| 394 | 3300042013 | Ga0439456_055061 | Ga0439456_055061_375_644 | 89 |
| 395 | 3300042014 | Ga0439457_028763 | Ga0439457_028763_695_964 | 89 |
| 396 | 3300042015 | Ga0439462_0038859 | Ga0439462_0038859_789_1058 | 89 |
| 397 | 3300042015 | Ga0439462_0142312 | Ga0439462_0142312_87_356 | 89 |
| 398 | 3300042117 | Ga0450913_000155 | Ga0450913_000155_522_791 | 89 |
| 399 | 3300042142 | Ga0450905_039642 | Ga0450905_039642_388_675 | 89 |
| 400 | 3300042156 | Ga0439446_0319122 | Ga0439446_0319122_194_463 | 89 |
| 401 | 3300042435 | Ga0439434_0237040 | Ga0439434_0237040_273_542 | 89 |
| 402 | 3300042436 | Ga0439435_0022550 | Ga0439435_0022550_1160_1429 | 89 |
| 403 | 3300042437 | Ga0439444_0004861 | Ga0439444_0004861_558_827 | 89 |
| 404 | 3300042461 | Ga0439460_0006933 | Ga0439460_0006933_1994_2263 | 89 |
| 405 | 3300042533 | Ga0450901_013957 | Ga0450901_013957_58_327 | 89 |
| 406 | 3300042876 | Ga0451577_0002652 | Ga0451577_0002652_7773_8042 | 89 |
| 407 | 3300042876 | Ga0451577_0075623 | Ga0451577_0075623_2339_2626 | 89 |
| 408 | 3300044712 | Ga0453684_0000316 | Ga0453684_0000316_95697_95966 | 89 |
| 409 | 3300044712 | Ga0453684_0193639 | Ga0453684_0193639_1965_2234 | 89 |
| 410 | 3300045051 | Ga0451576_0000128 | Ga0451576_0000128_83311_83580 | 89 |
| 411 | 3300045051 | Ga0451576_0145340 | Ga0451576_0145340_505_774 | 89 |
| 412 | 3300045051 | Ga0451576_1427909 | Ga0451576_1427909_305_574 | 89 |
| 413 | 3300045976 | Ga0466967_0965632 | Ga0466967_0965632_507_776 | 89 |
| 414 | 3300046453 | Ga0495627_008906 | Ga0495627_008906_3049_3318 | 89 |
| 415 | 3300046457 | Ga0495590_0124383 | Ga0495590_0124383_191_460 | 89 |
| 416 | 3300046458 | Ga0495591_023418 | Ga0495591_023418_1016_1285 | 89 |
| 417 | 3300046460 | Ga0495638_0000881 | Ga0495638_0000881_14198_14467 | 89 |
| 418 | 3300046460 | Ga0495638_0032950 | Ga0495638_0032950_1762_2031 | 89 |
| 419 | 3300046460 | Ga0495638_0134946 | Ga0495638_0134946_592_879 | 89 |
| 420 | 3300046475 | Ga0495639_0170148 | Ga0495639_0170148_486_755 | 89 |
| 421 | 3300046491 | Ga0495584_0104222 | Ga0495584_0104222_906_1175 | 89 |
| 422 | 3300046512 | Ga0495610_0003046 | Ga0495610_0003046_7589_7858 | 89 |
| 423 | 3300046512 | Ga0495610_0108996 | Ga0495610_0108996_30_317 | 89 |
| 424 | 3300046513 | Ga0495616_0037555 | Ga0495616_0037555_1129_1416 | 89 |
| 425 | 3300046516 | Ga0495628_0093103 | Ga0495628_0093103_1194_1463 | 89 |
| 426 | 3300046518 | Ga0495631_0001525 | Ga0495631_0001525_8557_8826 | 89 |
| 427 | 3300046519 | Ga0495632_0385726 | Ga0495632_0385726_296_583 | 89 |
| 428 | 3300046525 | Ga0495663_0110065 | Ga0495663_0110065_291_560 | 89 |
| 429 | 3300046533 | Ga0495640_0025999 | Ga0495640_0025999_2492_2761 | 89 |
| 430 | 3300046535 | Ga0495586_0010802 | Ga0495586_0010802_616_885 | 89 |
| 431 | 3300046538 | Ga0495609_0174390 | Ga0495609_0174390_510_779 | 89 |
| 432 | 3300046558 | Ga0495633_0026731 | Ga0495633_0026731_2047_2316 | 89 |
| 433 | 3300046558 | Ga0495633_0043387 | Ga0495633_0043387_22_309 | 89 |
| 434 | 3300046558 | Ga0495633_0113725 | Ga0495633_0113725_432_701 | 89 |
| 435 | 3300046615 | Ga0495656_0001001 | Ga0495656_0001001_1191_1460 | 89 |
| 436 | 3300046660 | Ga0495625_0058167 | Ga0495625_0058167_468_737 | 89 |
| 437 | 3300046660 | Ga0495625_0653762 | Ga0495625_0653762_327_614 | 89 |
| 438 | 3300046663 | Ga0495635_0082917 | Ga0495635_0082917_400_669 | 89 |
| 439 | 3300046681 | Ga0495647_0458191 | Ga0495647_0458191_243_512 | 89 |
| 440 | 3300046684 | Ga0495669_0101260 | Ga0495669_0101260_547_816 | 89 |
| 441 | 3300046691 | Ga0495670_0022391 | Ga0495670_0022391_1464_1733 | 89 |
| 442 | 3300046810 | Ga0495660_0026745 | Ga0495660_0026745_2176_2463 | 89 |
| 443 | 3300047317 | Ga0495604_0052433 | Ga0495604_0052433_887_1156 | 89 |
| 444 | 3300047318 | Ga0495636_0048228 | Ga0495636_0048228_1132_1401 | 89 |
| 445 | 3300047320 | Ga0495672_0000090 | Ga0495672_0000090_52533_52802 | 89 |
| 446 | 3300047320 | Ga0495672_0068871 | Ga0495672_0068871_215_502 | 89 |
| 447 | 3300047470 | Ga0495681_0101983 | Ga0495681_0101983_315_584 | 89 |
| 448 | 3300047472 | Ga0495686_0016694 | Ga0495686_0016694_4448_4717 | 89 |
| 449 | 3300047472 | Ga0495686_0104192 | Ga0495686_0104192_1413_1682 | 89 |
| 450 | 3300048907 | Ga0496104_0425145 | Ga0496104_0425145_690_959 | 89 |
| 451 | 3300048913 | Ga0496110_0224170 | Ga0496110_0224170_871_1140 | 89 |
| 452 | 3300048914 | Ga0496111_0981890 | Ga0496111_0981890_302_589 | 89 |
| 453 | 3300048917 | Ga0496114_0000013 | Ga0496114_0000013_183602_183871 | 89 |
| 454 | 3300048919 | Ga0496116_0021188 | Ga0496116_0021188_1101_1388 | 89 |
| 455 | 3300048919 | Ga0496116_0119316 | Ga0496116_0119316_147_434 | 89 |
| 456 | 3300048920 | Ga0496117_0000617 | Ga0496117_0000617_43038_43325 | 89 |
| 457 | 3300048920 | Ga0496117_0003428 | Ga0496117_0003428_211_498 | 89 |
| 458 | 3300048920 | Ga0496117_0008591 | Ga0496117_0008591_3086_3355 | 89 |
| 459 | 3300048920 | Ga0496117_0057014 | Ga0496117_0057014_997_1284 | 89 |
| 460 | 3300048921 | Ga0496118_0000404 | Ga0496118_0000404_67240_67527 | 89 |
| 461 | 3300048921 | Ga0496118_0000737 | Ga0496118_0000737_43759_44046 | 89 |
| 462 | 3300048921 | Ga0496118_0044462 | Ga0496118_0044462_456_743 | 89 |
| 463 | 3300048921 | Ga0496118_0049885 | Ga0496118_0049885_1135_1422 | 89 |
| 464 | 3300048921 | Ga0496118_0079564 | Ga0496118_0079564_1432_1701 | 89 |
| 465 | 3300048922 | Ga0496119_0000329 | Ga0496119_0000329_24174_24461 | 89 |
| 466 | 3300048923 | Ga0496120_0000147 | Ga0496120_0000147_41839_42108 | 89 |
| 467 | 3300048924 | Ga0496121_0002594 | Ga0496121_0002594_17119_17388 | 89 |
| 468 | 3300048924 | Ga0496121_0074522 | Ga0496121_0074522_50_337 | 89 |
| 469 | 3300048924 | Ga0496121_0135493 | Ga0496121_0135493_1264_1533 | 89 |
| 470 | 3300048925 | Ga0496122_0420970 | Ga0496122_0420970_161_430 | 89 |
| 471 | 3300048925 | Ga0496122_0452535 | Ga0496122_0452535_45_332 | 89 |
| 472 | 3300048926 | Ga0496123_0113760 | Ga0496123_0113760_1194_1481 | 89 |
| 473 | 3300048926 | Ga0496123_0361682 | Ga0496123_0361682_224_511 | 89 |
| 474 | 3300048927 | Ga0496124_0000680 | Ga0496124_0000680_9110_9379 | 89 |
| 475 | 3300048927 | Ga0496124_0006616 | Ga0496124_0006616_6178_6447 | 89 |
| 476 | 3300048927 | Ga0496124_0117367 | Ga0496124_0117367_1735_2004 | 89 |
| 477 | 3300048927 | Ga0496124_0216655 | Ga0496124_0216655_854_1141 | 89 |
| 478 | 3300048927 | Ga0496124_0250764 | Ga0496124_0250764_933_1220 | 89 |
| 479 | 3300048927 | Ga0496124_0847527 | Ga0496124_0847527_224_511 | 89 |
| 480 | 3300048928 | Ga0496125_0026103 | Ga0496125_0026103_2215_2502 | 89 |
| 481 | 3300048928 | Ga0496125_0026456 | Ga0496125_0026456_15_302 | 89 |
| 482 | 3300048928 | Ga0496125_0085664 | Ga0496125_0085664_205_492 | 89 |
| 483 | 3300048928 | Ga0496125_0120654 | Ga0496125_0120654_259_546 | 89 |
| 484 | 3300048928 | Ga0496125_0199951 | Ga0496125_0199951_13_300 | 89 |
| 485 | 3300048929 | Ga0496126_0000967 | Ga0496126_0000967_40050_40337 | 89 |
| 486 | 3300048929 | Ga0496126_0011304 | Ga0496126_0011304_7426_7695 | 89 |
| 487 | 3300049513 | Ga0501290_002699 | Ga0501290_002699_1214_1483 | 89 |
| 488 | 3300049568 | Ga0501031_0016530 | Ga0501031_0016530_382_651 | 89 |
| 489 | 3300049569 | Ga0501032_0364104 | Ga0501032_0364104_527_796 | 89 |
| 490 | 3300049570 | Ga0501033_0024972 | Ga0501033_0024972_1775_2044 | 89 |
| 491 | 3300049571 | Ga0501034_0000552 | Ga0501034_0000552_18467_18754 | 89 |
| 492 | 3300049571 | Ga0501034_0193975 | Ga0501034_0193975_652_921 | 89 |
| 493 | 3300049572 | Ga0501036_0142199 | Ga0501036_0142199_438_707 | 89 |
| 494 | 3300049573 | Ga0501037_0046698 | Ga0501037_0046698_1640_1909 | 89 |
| 495 | 3300049574 | Ga0501038_0015316 | Ga0501038_0015316_4286_4555 | 89 |
| 496 | 3300049575 | Ga0501039_0027266 | Ga0501039_0027266_1080_1349 | 89 |
| 497 | 3300049576 | Ga0501040_0962210 | Ga0501040_0962210_71_340 | 89 |
| 498 | 3300049579 | Ga0501043_0001713 | Ga0501043_0001713_3536_3805 | 89 |
| 499 | 3300049579 | Ga0501043_0120368 | Ga0501043_0120368_660_929 | 89 |
| 500 | 3300049581 | Ga0501047_0163739 | Ga0501047_0163739_841_1110 | 89 |
| 501 | 3300049583 | Ga0501067_0003235 | Ga0501067_0003235_1594_1863 | 89 |
| 502 | 3300049584 | Ga0501068_0013166 | Ga0501068_0013166_1626_1895 | 89 |
| 503 | 3300049586 | Ga0501070_0037650 | Ga0501070_0037650_2238_2507 | 89 |
| 504 | 3300049587 | Ga0501071_0182798 | Ga0501071_0182798_484_753 | 89 |
| 505 | 3300049588 | Ga0501072_0351258 | Ga0501072_0351258_585_854 | 89 |
| 506 | 3300049591 | Ga0501075_0001709 | Ga0501075_0001709_3410_3679 | 89 |
| 507 | 3300049592 | Ga0501076_0874263 | Ga0501076_0874263_91_360 | 89 |
| 508 | 3300049592 | Ga0501076_0945664 | Ga0501076_0945664_136_405 | 89 |
| 509 | 3300049593 | Ga0501077_0000027 | Ga0501077_0000027_74813_75082 | 89 |
| 510 | 3300049652 | Ga0501202_070303 | Ga0501202_070303_74_343 | 89 |
| 511 | 3300049660 | Ga0501216_055228 | Ga0501216_055228_404_673 | 89 |
| 512 | 3300049665 | Ga0501227_244124 | Ga0501227_244124_200_469 | 89 |
| 513 | 3300049674 | Ga0501242_026322 | Ga0501242_026322_80_349 | 89 |
| 514 | 3300049675 | Ga0501243_031548 | Ga0501243_031548_319_588 | 89 |
| 515 | 3300049704 | Ga0501221_126955 | Ga0501221_126955_54_323 | 89 |
| 516 | 3300049705 | Ga0501225_0002344 | Ga0501225_0002344_1678_1950 | 89 |
| 517 | 3300049705 | Ga0501225_0369284 | Ga0501225_0369284_108_377 | 89 |
| 518 | 3300049741 | Ga0501079_0756017 | Ga0501079_0756017_148_417 | 89 |
| 519 | 3300049742 | Ga0501080_0004080 | Ga0501080_0004080_5573_5842 | 89 |
| 520 | 3300049742 | Ga0501080_0255110 | Ga0501080_0255110_26_295 | 89 |
| 521 | 3300049743 | Ga0501081_0018085 | Ga0501081_0018085_1783_2052 | 89 |
| 522 | 3300049760 | Ga0501263_082043 | Ga0501263_082043_231_500 | 89 |
| 523 | 3300049762 | Ga0501265_034996 | Ga0501265_034996_176_445 | 89 |
| 524 | 3300049772 | Ga0501275_000326 | Ga0501275_000326_3665_3934 | 89 |
| 525 | 3300049779 | Ga0501283_013123 | Ga0501283_013123_181_450 | 89 |
| 526 | 3300049822 | Ga0501035_0061152 | Ga0501035_0061152_1072_1341 | 89 |
| 527 | 3300049823 | Ga0501044_0147113 | Ga0501044_0147113_1152_1421 | 89 |
| 528 | 3300049824 | Ga0501045_0233189 | Ga0501045_0233189_32_301 | 89 |
| 529 | 3300050491 | nmdc:mga00v17_107765_c1 | nmdc:mga00v17_107765_c1_1038_1307 | 89 |
| 530 | 3300050492 | nmdc:mga0yw44_181472_c1 | nmdc:mga0yw44_181472_c1_414_701 | 89 |
| 531 | 3300050493 | nmdc:mga0k408_86383_c1 | nmdc:mga0k408_86383_c1_954_1223 | 89 |
| 532 | 3300050507 | nmdc:mga05p37_194609_c1 | nmdc:mga05p37_194609_c1_2054_2323 | 89 |
| 533 | 3300050507 | nmdc:mga05p37_300249_c1 | nmdc:mga05p37_300249_c1_1527_1796 | 89 |
| 534 | 3300050507 | nmdc:mga05p37_385218_c1 | nmdc:mga05p37_385218_c1_732_1001 | 89 |
| 535 | 3300050507 | nmdc:mga05p37_404497_c1 | nmdc:mga05p37_404497_c1_382_651 | 89 |
| 536 | 3300050508 | nmdc:mga09592_359249_c1 | nmdc:mga09592_359249_c1_86_355 | 89 |
| 537 | 3300050508 | nmdc:mga09592_380982_c1 | nmdc:mga09592_380982_c1_256_525 | 89 |
| 538 | 3300050509 | nmdc:mga0qj67_153139_c1 | nmdc:mga0qj67_153139_c1_1408_1677 | 89 |
| 539 | 3300050509 | nmdc:mga0qj67_334250_c1 | nmdc:mga0qj67_334250_c1_261_530 | 89 |
| 540 | 3300050509 | nmdc:mga0qj67_828319_c1 | nmdc:mga0qj67_828319_c1_50_319 | 89 |
| 541 | 3300050510 | nmdc:mga06r32_1584980_c1 | nmdc:mga06r32_1584980_c1_121_390 | 89 |
| 542 | 3300050510 | nmdc:mga06r32_257641_c1 | nmdc:mga06r32_257641_c1_269_538 | 89 |
| 543 | 3300050510 | nmdc:mga06r32_655568_c1 | nmdc:mga06r32_655568_c1_208_477 | 89 |
| 544 | 3300050511 | nmdc:mga08y16_1433197_c1 | nmdc:mga08y16_1433197_c1_134_403 | 89 |
| 545 | 3300050511 | nmdc:mga08y16_15097_c1 | nmdc:mga08y16_15097_c1_6591_6860 | 89 |
| 546 | 3300050511 | nmdc:mga08y16_885874_c1 | nmdc:mga08y16_885874_c1_336_605 | 89 |
| 547 | 3300050512 | nmdc:mga0n895_212888_c1 | nmdc:mga0n895_212888_c1_52_321 | 89 |
| 548 | 3300050514 | nmdc:mga08x19_186_c1 | nmdc:mga08x19_186_c1_31734_32003 | 89 |
| 549 | 3300050514 | nmdc:mga08x19_5414_c1 | nmdc:mga08x19_5414_c1_5413_5682 | 89 |
| 550 | 3300050515 | nmdc:mga0a205_398937_c1 | nmdc:mga0a205_398937_c1_236_505 | 89 |
| 551 | 3300053077 | Ga0495601_0262205 | Ga0495601_0262205_821_1090 | 89 |
| 552 | 3300060353 | Ga0501082_0001428 | Ga0501082_0001428_11261_11530 | 89 |
| 553 | 3300060353 | Ga0501082_0768563 | Ga0501082_0768563_87_356 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lfg-assembly2.cif.gz_B | crystal structure of hpr-c-his from thermoanaerobacter tengcongensis | 0.9751 | 1 | 85 |
| 1sph-assembly1.cif.gz_B | refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition | 0.9695 | 2 | 80 |
| 7ff5-assembly3.cif.gz_C | the crystal structure of ruminiclostridium cellulolyticum phosphocarrier | 0.969 | 1 | 81 |
| 3ihs-assembly2.cif.gz_B | crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames | 0.9617 | 2 | 81 |
| 3ccd-assembly1.cif.gz_A | 1.0 a structure of post-succinimide his15asp hpr | 0.9609 | 1 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69811_287_371_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9665 | 4 | 81 | 3.30.1340.10 |
| af_P37349_156_242_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9619 | 2 | 85 | 3.30.1340.10 |
| 3ccdB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9592 | 1 | 83 | 3.30.1340.10 |
| 3ihsB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9517 | 2 | 81 | 3.30.1340.10 |
| af_P32670_5_87_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9288 | 4 | 81 | 3.30.1340.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G3LRK3-F1-model_v4 | deleted | 1.006 | 1 | 89 |
|
| AF-A0A3R8U1J6-F1-model_v4 | HPr family phosphocarrier protein | 1.004 | 1 | 89 |
GO:0005737
GO:0009401 |
| AF-A0A2N1GEX0-F1-model_v4 | deleted | 1.004 | 1 | 89 |
|
| AF-A0A522Y6K4-F1-model_v4 | HPr family phosphocarrier protein | 1.004 | 1 | 89 |
GO:0005737
GO:0009401 |
| AF-A0A4R5U1G3-F1-model_v4 | HPr family phosphocarrier protein | 1.002 | 1 | 89 |
GO:0005737
GO:0009401 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar