F462879

General Info

Members Datasets Scaffolds Average Seq Length
553 322 553 89

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100342918|Ga0307416_1003429182
Length 109
Sequence MEHEWSNGQTGLESDPKDAAMIEQDLTVTNRLGLHARATAKLVQTLSAYRSSATLTAKGREVNAKSIMGVMLLAAGQGTQVKLRVEGDDEDQAAAAVVSLFERRFDEDS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
77 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
78 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
79 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
80 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
81 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
97 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
182 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
183 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
186 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
187 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
202 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
203 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
204 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
205 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
210 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
219 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
294 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
295 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
296 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
297 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
298 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
299 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
304 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
305 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
306 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.19
Nodule 0
Rhizoplane 2.71
Rhizosphere 72.51
Stem 0
Stem Tuber 0
Unclassified 9.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_145288 2162886007 Bacteria 5558
2 JGI25152J39213_1000866 3300002773 Bacteria 14941
3 JGI25150J39212_1005456 3300002774 Bacteria 2711
4 JGI25159J45721_1041898 3300002987 Bacteria 664
5 JGI25159J45721_1047796 3300002987 Bacteria 596
6 JGI25151J46595_10000351 3300003187 Bacteria 49103
7 JGI25151J46595_10070536 3300003187 Bacteria 1060
8 JGI25151J46595_10070674 3300003187 Bacteria 1058
9 JGI25153J46596_10000219 3300003215 Bacteria 49103
10 rootH1_10228024 3300003323 Bacteria 1233
11 Ga0055526_1000428 3300003771 Bacteria 33858
12 Ga0055537_1000017 3300003773 Bacteria 123856
13 Ga0055537_1001080 3300003773 Bacteria 11996
14 Ga0055524_1000280 3300003775 Bacteria 50037
15 Ga0055524_1031360 3300003775 Bacteria 1530
16 Ga0055536_1004171 3300003781 Bacteria 7477
17 Ga0055536_1004653 3300003781 Bacteria 6939
18 Ga0055534_1000163 3300003784 Bacteria 50001
19 Ga0055534_1000267 3300003784 Bacteria 36162
20 Ga0055534_1018274 3300003784 Bacteria 1222
21 Ga0055528_1000182 3300003790 Bacteria 53454
22 Ga0055528_1000204 3300003790 Bacteria 50037
23 Ga0055530_10001486 3300003791 Bacteria 17027
24 Ga0055530_10004170 3300003791 Bacteria 7633
25 Ga0055530_10031900 3300003791 Bacteria 1377
26 Ga0055531_10019722 3300003794 Bacteria 2709
27 Ga0055531_10031196 3300003794 Bacteria 1771
28 Ga0055531_10047038 3300003794 Bacteria 1178
29 Ga0065704_10070357 3300005289 Bacteria 30374
30 Ga0065707_10102372 3300005295 Bacteria 2810
31 Ga0065707_10299350 3300005295 Bacteria 1008
32 Ga0070676_10182928 3300005328 Bacteria 1364
33 Ga0070676_10828839 3300005328 Bacteria 684
34 Ga0070677_10406146 3300005333 Bacteria 719
35 Ga0068869_100063267 3300005334 Bacteria 2717
36 Ga0068868_100276504 3300005338 Bacteria 1420
37 Ga0070689_100097433 3300005340 Bacteria 2326
38 Ga0070689_101370967 3300005340 Bacteria 638
39 Ga0070691_10452015 3300005341 Bacteria 734
40 Ga0070668_100101467 3300005347 Bacteria 2280
41 Ga0070668_100308055 3300005347 Bacteria 1330
42 Ga0070669_100284429 3300005353 Bacteria 1326
43 Ga0070669_100522997 3300005353 Bacteria 986
44 Ga0070675_100030112 3300005354 Bacteria 4379
45 Ga0070674_100004643 3300005356 Bacteria 7847
46 Ga0070674_101538441 3300005356 Bacteria 599
47 Ga0070673_100134417 3300005364 Bacteria 2080
48 Ga0070673_100814779 3300005364 Bacteria 863
49 Ga0070667_100049436 3300005367 Bacteria 3542
50 Ga0070667_100293756 3300005367 Bacteria 1462
51 Ga0070701_10092027 3300005438 Bacteria 1663
52 Ga0070701_10112782 3300005438 Bacteria 1521
53 Ga0070700_100051280 3300005441 Bacteria 2568
54 Ga0070700_100111477 3300005441 Bacteria 1819
55 Ga0070700_100715563 3300005441 Bacteria 798
56 Ga0070700_101971092 3300005441 Bacteria 506
57 Ga0070694_100058025 3300005444 Bacteria 2632
58 Ga0070663_100182455 3300005455 Bacteria 1629
59 Ga0070678_100110589 3300005456 Bacteria 2149
60 Ga0068867_100005133 3300005459 Bacteria 9252
61 Ga0070685_10066300 3300005466 Bacteria 2127
62 Ga0070686_100609991 3300005544 Bacteria 861
63 Ga0070695_100067019 3300005545 Bacteria 2341
64 Ga0070696_100703984 3300005546 Bacteria 824
65 Ga0070693_100996030 3300005547 Bacteria 634
66 Ga0070665_100000426 3300005548 Bacteria 61588
67 Ga0070665_100016620 3300005548 Bacteria 7373
68 Ga0070704_100339417 3300005549 Bacteria 1265
69 Ga0070702_100032620 3300005615 Bacteria 2859
70 Ga0070702_100228661 3300005615 Bacteria 1248
71 Ga0068859_100283262 3300005617 Bacteria 1750
72 Ga0068859_101275388 3300005617 Bacteria 809
73 Ga0068866_10078681 3300005718 Bacteria 1765
74 Ga0068861_100006910 3300005719 Bacteria 7753
75 Ga0068861_100704301 3300005719 Bacteria 939
76 Ga0068870_10060897 3300005840 Bacteria 2027
77 Ga0068858_100087721 3300005842 Bacteria 2894
78 Ga0068858_100279118 3300005842 Bacteria 1591
79 Ga0068860_100001559 3300005843 Bacteria 24688
80 Ga0068862_100018269 3300005844 Bacteria 5839
81 Ga0068862_100232682 3300005844 Bacteria 1672
82 Ga0068862_100835671 3300005844 Bacteria 902
83 Ga0081539_10052951 3300005985 Bacteria 2275
84 Ga0075365_10025358 3300006038 Bacteria 3752
85 Ga0075363_100176930 3300006048 Bacteria 1213
86 Ga0075363_100613147 3300006048 Bacteria 653
87 Ga0075364_10046386 3300006051 Bacteria 2829
88 Ga0075364_10116412 3300006051 Bacteria 1787
89 Ga0070716_100398343 3300006173 Bacteria 989
90 Ga0075366_10050179 3300006195 Bacteria 2477
91 Ga0075366_10326750 3300006195 Bacteria 940
92 Ga0068871_100684907 3300006358 Bacteria 938
93 Ga0068871_100978936 3300006358 Bacteria 787
94 Ga0075428_100015486 3300006844 Bacteria 8455
95 Ga0075428_100538086 3300006844 Unclassified 1249
96 Ga0075431_100072888 3300006847 Bacteria 3543
97 Ga0075431_100924156 3300006847 Bacteria 841
98 Ga0075433_10255655 3300006852 Bacteria 1554
99 Ga0075434_100152692 3300006871 Unclassified 2329
100 Ga0075434_101981006 3300006871 Bacteria 588
101 Ga0075429_100040836 3300006880 Bacteria 4039
102 Ga0075429_100360121 3300006880 Bacteria 1274
103 Ga0068865_100003673 3300006881 Bacteria 9217
104 Ga0075436_100000080 3300006914 Bacteria 55351
105 Ga0075436_100011138 3300006914 Bacteria 6167
106 Ga0097620_100283260 3300006931 Bacteria 1750
107 Ga0097620_101275417 3300006931 Bacteria 809
108 Ga0075435_100273660 3300007076 Bacteria 1441
109 Ga0075435_101069815 3300007076 Bacteria 705
110 Ga0105251_10002785 3300009011 Bacteria 13292
111 Ga0105244_10069296 3300009036 Bacteria 1761
112 Ga0105244_10095776 3300009036 Bacteria 1456
113 Ga0111539_10037006 3300009094 Bacteria 5897
114 Ga0111539_11445837 3300009094 Bacteria 797
115 Ga0105245_10386246 3300009098 Bacteria 1395
116 Ga0114129_10066031 3300009147 Bacteria 5047
117 Ga0114129_10496808 3300009147 Unclassified 1594
118 Ga0114129_11082380 3300009147 Bacteria 1005
119 Ga0114129_11481661 3300009147 Bacteria 834
120 Ga0105243_10276007 3300009148 Bacteria 1512
121 Ga0105243_10663225 3300009148 Bacteria 1012
122 Ga0105248_10178904 3300009177 Bacteria 2390
123 Ga0105238_11705139 3300009551 Bacteria 661
124 Ga0105249_10028331 3300009553 Bacteria 5056
125 Ga0105032_102131 3300009979 Bacteria 1787
126 Ga0105028_109473 3300009993 Bacteria 1021
127 Ga0157328_1011098 3300012478 Bacteria 634
128 Ga0157318_1018201 3300012482 Bacteria 600
129 Ga0157313_1020458 3300012503 Bacteria 670
130 Ga0157327_1007886 3300012512 Bacteria 940
131 Ga0157373_10184015 3300013100 Bacteria 1471
132 Ga0157371_10002186 3300013102 Bacteria 18979
133 Ga0157371_10020416 3300013102 Bacteria 4875
134 Ga0157370_10010646 3300013104 Bacteria 9681
135 Ga0157370_10112942 3300013104 Bacteria 2539
136 Ga0157378_10001811 3300013297 Bacteria 19191
137 Ga0163162_10017493 3300013306 Bacteria 7014
138 Ga0163162_10383025 3300013306 Bacteria 1540
139 Ga0163163_11825605 3300014325 Bacteria 668
140 Ga0157380_10017645 3300014326 Bacteria 5284
141 Ga0157380_10131540 3300014326 Bacteria 2136
142 Ga0157380_10712059 3300014326 Bacteria 1010
143 Ga0157380_11318696 3300014326 Bacteria 770
144 Ga0182008_10000096 3300014497 Bacteria 67450
145 Ga0182008_10001301 3300014497 Bacteria 17041
146 Ga0157377_11581326 3300014745 Bacteria 524
147 Ga0157379_10227952 3300014968 Bacteria 1688
148 Ga0157376_10578350 3300014969 Bacteria 1115
149 Ga0157376_11242481 3300014969 Bacteria 774
150 Ga0182006_1008250 3300015261 Bacteria 4725
151 Ga0182006_1110862 3300015261 Bacteria 963
152 Ga0182007_10000048 3300015262 Bacteria 103024
153 Ga0182005_1003480 3300015265 Bacteria 5327
154 Ga0183360_10001 3300015689 Bacteria 3943671
155 Ga0183361_11453 3300016635 Bacteria 1217
156 Ga0163161_10030249 3300017792 Bacteria 3852
157 Ga0163161_10541904 3300017792 Bacteria 953
158 Ga0163161_10609356 3300017792 Bacteria 901
159 Ga0207425_1000111 3300025245 Bacteria 77375
160 Ga0207425_1026892 3300025245 Bacteria 1177
161 Ga0209129_1000087 3300025258 Bacteria 179582
162 Ga0209565_1000005 3300025263 Bacteria 947317
163 Ga0209565_1000031 3300025263 Bacteria 320341
164 Ga0209673_1000011 3300025273 Bacteria 586604
165 Ga0209673_1000164 3300025273 Bacteria 138082
166 Ga0209673_1004282 3300025273 Bacteria 7731
167 Ga0209673_1064512 3300025273 Bacteria 898
168 Ga0209130_1002494 3300025284 Bacteria 9108
169 Ga0209130_1005265 3300025284 Bacteria 4553
170 Ga0209675_1000004 3300025291 Bacteria 947166
171 Ga0209675_1000015 3300025291 Bacteria 403517
172 Ga0209675_1006953 3300025291 Bacteria 4437
173 Ga0209675_1015895 3300025291 Bacteria 2215
174 Ga0209676_1000027 3300025292 Bacteria 560222
175 Ga0209676_1000110 3300025292 Bacteria 214083
176 Ga0209676_1001028 3300025292 Bacteria 32470
177 Ga0209676_1001231 3300025292 Bacteria 27052
178 Ga0209676_1005673 3300025292 Bacteria 6424
179 Ga0209676_1016472 3300025292 Bacteria 2666
180 Ga0209025_1000013 3300025294 Bacteria 871757
181 Ga0209025_1003537 3300025294 Bacteria 14653
182 Ga0209025_1007002 3300025294 Bacteria 8559
183 Ga0209025_1042768 3300025294 Bacteria 1919
184 Ga0209025_1048110 3300025294 Bacteria 1732
185 Ga0209025_1116044 3300025294 Bacteria 810
186 Ga0209564_1000018 3300025295 Bacteria 586913
187 Ga0209564_1000037 3300025295 Bacteria 414794
188 Ga0209564_1008868 3300025295 Bacteria 4891
189 Ga0209758_1000014 3300025297 Bacteria 871757
190 Ga0209758_1037036 3300025297 Bacteria 1892
191 Ga0209050_1000417 3300025298 Bacteria 78631
192 Ga0209050_1001410 3300025298 Bacteria 26010
193 Ga0209050_1002473 3300025298 Bacteria 15717
194 Ga0209050_1015285 3300025298 Bacteria 3236
195 Ga0209256_1000021 3300025299 Bacteria 537097
196 Ga0209256_1002158 3300025299 Bacteria 16970
197 Ga0209256_1002613 3300025299 Bacteria 14247
198 Ga0209256_1008601 3300025299 Bacteria 4688
199 Ga0209256_1015165 3300025299 Bacteria 2715
200 Ga0209051_1001882 3300025303 Bacteria 16414
201 Ga0209051_1039697 3300025303 Bacteria 1696
202 Ga0209257_1000129 3300025304 Bacteria 214155
203 Ga0209257_1000274 3300025304 Bacteria 117076
204 Ga0209257_1000670 3300025304 Bacteria 53641
205 Ga0209257_1001580 3300025304 Bacteria 26249
206 Ga0209257_1003605 3300025304 Bacteria 13052
207 Ga0207655_1050978 3300025728 Bacteria 1677
208 Ga0207713_1037920 3300025735 Bacteria 2050
209 Ga0207682_10037813 3300025893 Bacteria 1956
210 Ga0207645_10372596 3300025907 Bacteria 957
211 Ga0207643_10025859 3300025908 Bacteria 3247
212 Ga0207662_10062619 3300025918 Bacteria 2236
213 Ga0207662_10125440 3300025918 Bacteria 1614
214 Ga0207681_10129166 3300025923 Bacteria 1866
215 Ga0207681_10500011 3300025923 Bacteria 995
216 Ga0207659_10155795 3300025926 Bacteria 1788
217 Ga0207687_11544644 3300025927 Bacteria 570
218 Ga0207709_10001341 3300025935 Bacteria 17363
219 Ga0207670_10848363 3300025936 Bacteria 763
220 Ga0207669_10067732 3300025937 Bacteria 2226
221 Ga0207704_10021633 3300025938 Bacteria 3429
222 Ga0207704_11851762 3300025938 Bacteria 519
223 Ga0207691_10394107 3300025940 Bacteria 1181
224 Ga0207711_10525154 3300025941 Unclassified 1104
225 Ga0207689_10023675 3300025942 Bacteria 5150
226 Ga0207651_10074768 3300025960 Bacteria 2414
227 Ga0207651_10108211 3300025960 Bacteria 2080
228 Ga0207651_10647467 3300025960 Bacteria 927
229 Ga0207712_10066694 3300025961 Bacteria 2573
230 Ga0207668_10171005 3300025972 Bacteria 1704
231 Ga0207668_10226106 3300025972 Bacteria 1506
232 Ga0207668_10276307 3300025972 Bacteria 1375
233 Ga0207658_10219884 3300025986 Bacteria 1597
234 Ga0207658_10557962 3300025986 Bacteria 1025
235 Ga0207703_10057752 3300026035 Bacteria 3165
236 Ga0207703_10209043 3300026035 Bacteria 1739
237 Ga0207678_10096767 3300026067 Bacteria 2523
238 Ga0207708_10044954 3300026075 Bacteria 3365
239 Ga0207708_11440849 3300026075 Bacteria 605
240 Ga0207648_10000419 3300026089 Bacteria 46680
241 Ga0207676_11025538 3300026095 Bacteria 814
242 Ga0207675_100004240 3300026118 Bacteria 13863
243 Ga0207675_100746718 3300026118 Bacteria 990
244 Ga0207675_101334667 3300026118 Bacteria 738
245 Ga0207683_10107322 3300026121 Bacteria 2498
246 Ga0209969_1025153 3300027360 Bacteria 897
247 Ga0209981_1017637 3300027378 Bacteria 1009
248 Ga0209996_1012267 3300027395 Bacteria 1150
249 Ga0210000_1057197 3300027462 Bacteria 629
250 Ga0209995_1030699 3300027471 Bacteria 899
251 Ga0209968_1018613 3300027526 Bacteria 1114
252 Ga0209982_1002284 3300027552 Bacteria 2685
253 Ga0209983_1019290 3300027665 Bacteria 1417
254 Ga0209588_1099186 3300027671 Bacteria 937
255 Ga0209971_1003169 3300027682 Bacteria 3923
256 Ga0209966_1002105 3300027695 Bacteria 3324
257 Ga0209998_10116260 3300027717 Bacteria 671
258 Ga0209974_10027381 3300027876 Bacteria 1885
259 Ga0207428_10075254 3300027907 Bacteria 2646
260 Ga0207428_10095871 3300027907 Bacteria 2298
261 Ga0268266_10000741 3300028379 Bacteria 43685
262 Ga0268266_10059786 3300028379 Bacteria 3283
263 Ga0268265_10019602 3300028380 Bacteria 4705
264 Ga0268265_10096628 3300028380 Bacteria 2375
265 Ga0268265_10397887 3300028380 Bacteria 1272
266 Ga0268265_12647744 3300028380 Bacteria 507
267 Ga0268264_10002884 3300028381 Bacteria 14955
268 Ga0307515_10093168 3300028794 Bacteria 3739
269 Ga0316176_1013813 3300030732 Bacteria 3135
270 Ga0316176_1040133 3300030732 Bacteria 1165
271 Ga0316181_1005833 3300030744 Bacteria 3389
272 Ga0316182_1061642 3300030745 Bacteria 870
273 Ga0265330_10084253 3300031235 Bacteria 1368
274 Ga0265316_10333791 3300031344 Bacteria 1100
275 Ga0307513_10151000 3300031456 Bacteria 2232
276 Ga0307408_100360066 3300031548 Bacteria 1237
277 Ga0307408_101008178 3300031548 Bacteria 768
278 Ga0307408_101078557 3300031548 Bacteria 744
279 Ga0307408_101344831 3300031548 Bacteria 671
280 Ga0307408_102213959 3300031548 Bacteria 531
281 Ga0307508_10066109 3300031616 Bacteria 3184
282 Ga0307405_10229291 3300031731 Bacteria 1368
283 Ga0307405_10318632 3300031731 Bacteria 1187
284 Ga0307405_10338901 3300031731 Bacteria 1155
285 Ga0307405_10497702 3300031731 Bacteria 976
286 Ga0307405_10783784 3300031731 Bacteria 797
287 Ga0307405_11353224 3300031731 Bacteria 621
288 Ga0307413_10042618 3300031824 Bacteria 2669
289 Ga0307413_10151902 3300031824 Bacteria 1615
290 Ga0307413_10569113 3300031824 Bacteria 922
291 Ga0307413_10896730 3300031824 Bacteria 753
292 Ga0307413_11082303 3300031824 Bacteria 691
293 Ga0307413_11397568 3300031824 Bacteria 615
294 Ga0307410_11277569 3300031852 Bacteria 641
295 Ga0307406_10089496 3300031901 Bacteria 2068
296 Ga0307406_10578196 3300031901 Bacteria 923
297 Ga0307407_10540640 3300031903 Bacteria 860
298 Ga0307412_10055820 3300031911 Bacteria 2629
299 Ga0307412_10070447 3300031911 Bacteria 2383
300 Ga0307412_10093932 3300031911 Bacteria 2105
301 Ga0307412_10904203 3300031911 Bacteria 774
302 Ga0307412_11195568 3300031911 Bacteria 680
303 Ga0307409_100793194 3300031995 Bacteria 954
304 Ga0307409_101205923 3300031995 Bacteria 780
305 Ga0307409_101248142 3300031995 Bacteria 767
306 Ga0307409_101995134 3300031995 Bacteria 610
307 Ga0307416_100168763 3300032002 Bacteria 2034
308 Ga0307416_100201334 3300032002 Bacteria 1889
309 Ga0307416_100342918 3300032002 Bacteria 1508
310 Ga0307416_101201320 3300032002 Bacteria 864
311 Ga0307416_101280090 3300032002 Bacteria 839
312 Ga0307416_103273529 3300032002 Bacteria 542
313 Ga0307416_103373793 3300032002 Bacteria 534
314 Ga0307414_10008172 3300032004 Bacteria 5917
315 Ga0307414_10010308 3300032004 Bacteria 5415
316 Ga0307414_10024671 3300032004 Bacteria 3838
317 Ga0307414_10034606 3300032004 Bacteria 3352
318 Ga0307414_10044477 3300032004 Bacteria 3033
319 Ga0307414_10057247 3300032004 Bacteria 2739
320 Ga0307414_10094649 3300032004 Bacteria 2230
321 Ga0307414_10097637 3300032004 Bacteria 2201
322 Ga0307414_10236817 3300032004 Bacteria 1508
323 Ga0307414_10526910 3300032004 Bacteria 1049
324 Ga0307414_10714026 3300032004 Bacteria 908
325 Ga0307414_11621869 3300032004 Bacteria 603
326 Ga0307411_10010665 3300032005 Bacteria 4912
327 Ga0307411_10012920 3300032005 Bacteria 4581
328 Ga0307411_10315419 3300032005 Bacteria 1260
329 Ga0307411_10327677 3300032005 Bacteria 1239
330 Ga0307411_10377285 3300032005 Bacteria 1165
331 Ga0373946_0438101 3300035171 Bacteria 664
332 Ga0373961_0000811 3300035241 Bacteria 10650
333 Ga0373924_0257993 3300035410 Bacteria 772
334 Ga0373935_0000870 3300035692 Bacteria 16289
335 Ga0373935_0712215 3300035692 Bacteria 738
336 Ga0373925_0011924 3300037068 Bacteria 6290
337 Ga0237819_00040 3300038705 Bacteria 45528
338 Ga0400488_58698 3300038741 Bacteria 2800
339 Ga0400486_30163 3300038742 Bacteria 9678
340 Ga0400483_151922 3300039062 Bacteria 3455
341 Ga0400489_75675 3300039093 Bacteria 7837
342 Ga0400487_48277 3300039110 Bacteria 1769
343 Ga0237816_01328 3300039145 Bacteria 1999
344 Ga0439436_0009624 3300041404 Bacteria 2963
345 Ga0439436_0093051 3300041404 Bacteria 839
346 Ga0439439_0018976 3300041406 Bacteria 1703
347 Ga0439439_0034156 3300041406 Bacteria 1304
348 Ga0439439_0274738 3300041406 Bacteria 504
349 Ga0439453_0063592 3300041408 Bacteria 769
350 Ga0439466_0207546 3300041411 Bacteria 595
351 Ga0439465_0005832 3300041413 Bacteria 3921
352 Ga0439465_0008429 3300041413 Bacteria 3254
353 Ga0439465_0013607 3300041413 Bacteria 2534
354 Ga0439465_0329133 3300041413 Bacteria 575
355 Ga0451787_065104 3300041441 Bacteria 1318
356 Ga0451791_0906637 3300041451 Bacteria 579
357 Ga0451793_0670350 3300041452 Bacteria 1676
358 Ga0451797_0158336 3300041453 Bacteria 772
359 Ga0451795_0787166 3300041456 Bacteria 776
360 Ga0451795_1518945 3300041456 Bacteria 702
361 Ga0451802_2076607 3300041460 Bacteria 892
362 Ga0451804_1029255 3300041463 Bacteria 1278
363 Ga0451807_0199166 3300041486 Unclassified 1161
364 Ga0451807_2137752 3300041486 Bacteria 781
365 Ga0451807_2709952 3300041486 Bacteria 3601
366 Ga0451837_1410386 3300041494 Bacteria 527
367 Ga0451841_0417243 3300041498 Bacteria 556
368 Ga0451841_0652781 3300041498 Bacteria 683
369 Ga0451849_0218415 3300041505 Bacteria 855
370 Ga0451849_0443800 3300041505 Bacteria 818
371 Ga0451843_0941578 3300041509 Bacteria 642
372 Ga0451843_1288714 3300041509 Bacteria 1290
373 Ga0451855_1858647 3300041511 Bacteria 593
374 Ga0451853_1337486 3300041512 Bacteria 643
375 Ga0439431_0120939 3300041997 Bacteria 730
376 Ga0439433_0015296 3300041999 Bacteria 1694
377 Ga0439433_0026976 3300041999 Bacteria 1301
378 Ga0439441_009870 3300042001 Bacteria 1590
379 Ga0439443_003655 3300042003 Bacteria 1958
380 Ga0439445_0007424 3300042004 Bacteria 2542
381 Ga0439432_006888 3300042006 Bacteria 4047
382 Ga0439432_013892 3300042006 Bacteria 2730
383 Ga0439432_032834 3300042006 Bacteria 1672
384 Ga0439432_083027 3300042006 Bacteria 969
385 Ga0439432_152561 3300042006 Bacteria 678
386 Ga0439449_0000004 3300042007 Bacteria 82454
387 Ga0439449_0004225 3300042007 Bacteria 5551
388 Ga0439449_0011914 3300042007 Bacteria 3269
389 Ga0439449_0019204 3300042007 Bacteria 2562
390 Ga0439449_0023109 3300042007 Bacteria 2327
391 Ga0439449_0042411 3300042007 Bacteria 1690
392 Ga0439449_0158662 3300042007 Bacteria 844
393 Ga0439452_006295 3300042010 Bacteria 3726
394 Ga0439456_055061 3300042013 Bacteria 871
395 Ga0439457_028763 3300042014 Bacteria 1231
396 Ga0439462_0038859 3300042015 Bacteria 1268
397 Ga0439462_0142312 3300042015 Bacteria 672
398 Ga0450913_000155 3300042117 Bacteria 2172
399 Ga0450905_039642 3300042142 Bacteria 746
400 Ga0439446_0319122 3300042156 Bacteria 548
401 Ga0439434_0237040 3300042435 Bacteria 622
402 Ga0439435_0022550 3300042436 Bacteria 1644
403 Ga0439444_0004861 3300042437 Bacteria 1969
404 Ga0439460_0006933 3300042461 Bacteria 2822
405 Ga0450901_013957 3300042533 Bacteria 843
406 Ga0451577_0002652 3300042876 Bacteria 20952
407 Ga0451577_0075623 3300042876 Bacteria 3003
408 Ga0453684_0000316 3300044712 Bacteria 204457
409 Ga0453684_0193639 3300044712 Bacteria 2376
410 Ga0451576_0000128 3300045051 Bacteria 192071
411 Ga0451576_0145340 3300045051 Bacteria 2472
412 Ga0451576_1427909 3300045051 Bacteria 720
413 Ga0466967_0965632 3300045976 Bacteria 848
414 Ga0495627_008906 3300046453 Bacteria 3718
415 Ga0495590_0124383 3300046457 Bacteria 925
416 Ga0495591_023418 3300046458 Bacteria 1979
417 Ga0495638_0000881 3300046460 Bacteria 30946
418 Ga0495638_0032950 3300046460 Bacteria 3316
419 Ga0495638_0134946 3300046460 Bacteria 1446
420 Ga0495639_0170148 3300046475 Bacteria 1057
421 Ga0495584_0104222 3300046491 Bacteria 1434
422 Ga0495610_0003046 3300046512 Bacteria 13417
423 Ga0495610_0108996 3300046512 Bacteria 1229
424 Ga0495616_0037555 3300046513 Bacteria 2491
425 Ga0495628_0093103 3300046516 Bacteria 2331
426 Ga0495631_0001525 3300046518 Bacteria 13955
427 Ga0495632_0385726 3300046519 Bacteria 613
428 Ga0495663_0110065 3300046525 Bacteria 914
429 Ga0495640_0025999 3300046533 Bacteria 4238
430 Ga0495586_0010802 3300046535 Bacteria 4855
431 Ga0495609_0174390 3300046538 Bacteria 907
432 Ga0495633_0026731 3300046558 Bacteria 2828
433 Ga0495633_0043387 3300046558 Bacteria 2134
434 Ga0495633_0113725 3300046558 Bacteria 1255
435 Ga0495656_0001001 3300046615 Bacteria 9129
436 Ga0495625_0058167 3300046660 Bacteria 2747
437 Ga0495625_0653762 3300046660 Bacteria 625
438 Ga0495635_0082917 3300046663 Bacteria 2194
439 Ga0495647_0458191 3300046681 Bacteria 591
440 Ga0495669_0101260 3300046684 Bacteria 1338
441 Ga0495670_0022391 3300046691 Bacteria 3120
442 Ga0495660_0026745 3300046810 Bacteria 3268
443 Ga0495604_0052433 3300047317 Bacteria 3159
444 Ga0495636_0048228 3300047318 Bacteria 1779
445 Ga0495672_0000090 3300047320 Bacteria 148367
446 Ga0495672_0068871 3300047320 Bacteria 2010
447 Ga0495681_0101983 3300047470 Bacteria 1253
448 Ga0495686_0016694 3300047472 Bacteria 4970
449 Ga0495686_0104192 3300047472 Bacteria 1708
450 Ga0496104_0425145 3300048907 Bacteria 1240
451 Ga0496110_0224170 3300048913 Bacteria 1710
452 Ga0496111_0981890 3300048914 Bacteria 606
453 Ga0496114_0000013 3300048917 Bacteria 317623
454 Ga0496116_0021188 3300048919 Bacteria 4908
455 Ga0496116_0119316 3300048919 Bacteria 1530
456 Ga0496117_0000617 3300048920 Bacteria 57555
457 Ga0496117_0003428 3300048920 Bacteria 18442
458 Ga0496117_0008591 3300048920 Bacteria 9679
459 Ga0496117_0057014 3300048920 Bacteria 2716
460 Ga0496118_0000404 3300048921 Bacteria 72202
461 Ga0496118_0000737 3300048921 Bacteria 52822
462 Ga0496118_0044462 3300048921 Bacteria 3477
463 Ga0496118_0049885 3300048921 Bacteria 3218
464 Ga0496118_0079564 3300048921 Bacteria 2312
465 Ga0496119_0000329 3300048922 Bacteria 66425
466 Ga0496120_0000147 3300048923 Bacteria 117881
467 Ga0496121_0002594 3300048924 Bacteria 27284
468 Ga0496121_0074522 3300048924 Bacteria 2714
469 Ga0496121_0135493 3300048924 Bacteria 1835
470 Ga0496122_0420970 3300048925 Bacteria 671
471 Ga0496122_0452535 3300048925 Bacteria 636
472 Ga0496123_0113760 3300048926 Bacteria 1540
473 Ga0496123_0361682 3300048926 Bacteria 671
474 Ga0496124_0000680 3300048927 Bacteria 55821
475 Ga0496124_0006616 3300048927 Bacteria 12584
476 Ga0496124_0117367 3300048927 Bacteria 2131
477 Ga0496124_0216655 3300048927 Bacteria 1443
478 Ga0496124_0250764 3300048927 Bacteria 1309
479 Ga0496124_0847527 3300048927 Bacteria 560
480 Ga0496125_0026103 3300048928 Bacteria 5334
481 Ga0496125_0026456 3300048928 Bacteria 5287
482 Ga0496125_0085664 3300048928 Bacteria 2386
483 Ga0496125_0120654 3300048928 Bacteria 1871
484 Ga0496125_0199951 3300048928 Bacteria 1309
485 Ga0496126_0000967 3300048929 Bacteria 49289
486 Ga0496126_0011304 3300048929 Bacteria 9261
487 Ga0501290_002699 3300049513 Bacteria 2277
488 Ga0501031_0016530 3300049568 Bacteria 4793
489 Ga0501032_0364104 3300049569 Bacteria 930
490 Ga0501033_0024972 3300049570 Bacteria 4503
491 Ga0501034_0000552 3300049571 Bacteria 59397
492 Ga0501034_0193975 3300049571 Bacteria 1992
493 Ga0501036_0142199 3300049572 Bacteria 2024
494 Ga0501037_0046698 3300049573 Bacteria 3176
495 Ga0501038_0015316 3300049574 Bacteria 6971
496 Ga0501039_0027266 3300049575 Bacteria 4392
497 Ga0501040_0962210 3300049576 Bacteria 619
498 Ga0501043_0001713 3300049579 Bacteria 18952
499 Ga0501043_0120368 3300049579 Bacteria 2058
500 Ga0501047_0163739 3300049581 Bacteria 2095
501 Ga0501067_0003235 3300049583 Bacteria 8968
502 Ga0501068_0013166 3300049584 Bacteria 4703
503 Ga0501070_0037650 3300049586 Bacteria 4038
504 Ga0501071_0182798 3300049587 Bacteria 1571
505 Ga0501072_0351258 3300049588 Bacteria 1171
506 Ga0501075_0001709 3300049591 Bacteria 14423
507 Ga0501076_0874263 3300049592 Bacteria 741
508 Ga0501076_0945664 3300049592 Bacteria 710
509 Ga0501077_0000027 3300049593 Bacteria 75456
510 Ga0501202_070303 3300049652 Bacteria 806
511 Ga0501216_055228 3300049660 Bacteria 789
512 Ga0501227_244124 3300049665 Bacteria 512
513 Ga0501242_026322 3300049674 Bacteria 769
514 Ga0501243_031548 3300049675 Bacteria 906
515 Ga0501221_126955 3300049704 Bacteria 657
516 Ga0501225_0002344 3300049705 Bacteria 5843
517 Ga0501225_0369284 3300049705 Bacteria 500
518 Ga0501079_0756017 3300049741 Bacteria 765
519 Ga0501080_0004080 3300049742 Bacteria 12938
520 Ga0501080_0255110 3300049742 Bacteria 1599
521 Ga0501081_0018085 3300049743 Bacteria 4677
522 Ga0501263_082043 3300049760 Bacteria 534
523 Ga0501265_034996 3300049762 Bacteria 738
524 Ga0501275_000326 3300049772 Bacteria 5419
525 Ga0501283_013123 3300049779 Bacteria 1252
526 Ga0501035_0061152 3300049822 Bacteria 3352
527 Ga0501044_0147113 3300049823 Bacteria 2340
528 Ga0501045_0233189 3300049824 Bacteria 1370
529 nmdc:mga00v17_107765_c1 3300050491 Bacteria 1765
530 nmdc:mga0yw44_181472_c1 3300050492 Bacteria 1385
531 nmdc:mga0k408_86383_c1 3300050493 Bacteria 1841
532 nmdc:mga05p37_194609_c1 3300050507 Bacteria 2459
533 nmdc:mga05p37_300249_c1 3300050507 Bacteria 1908
534 nmdc:mga05p37_385218_c1 3300050507 Bacteria 1641
535 nmdc:mga05p37_404497_c1 3300050507 Unclassified 1593
536 nmdc:mga09592_359249_c1 3300050508 Bacteria 1261
537 nmdc:mga09592_380982_c1 3300050508 Bacteria 1220
538 nmdc:mga0qj67_153139_c1 3300050509 Bacteria 1871
539 nmdc:mga0qj67_334250_c1 3300050509 Bacteria 1226
540 nmdc:mga0qj67_828319_c1 3300050509 Bacteria 732
541 nmdc:mga06r32_1584980_c1 3300050510 Bacteria 594
542 nmdc:mga06r32_257641_c1 3300050510 Bacteria 1732
543 nmdc:mga06r32_655568_c1 3300050510 Bacteria 1018
544 nmdc:mga08y16_1433197_c1 3300050511 Bacteria 653
545 nmdc:mga08y16_15097_c1 3300050511 Bacteria 8121
546 nmdc:mga08y16_885874_c1 3300050511 Bacteria 880
547 nmdc:mga0n895_212888_c1 3300050512 Bacteria 1963
548 nmdc:mga08x19_186_c1 3300050514 Bacteria 49520
549 nmdc:mga08x19_5414_c1 3300050514 Bacteria 7550
550 nmdc:mga0a205_398937_c1 3300050515 Bacteria 1239
551 Ga0495601_0262205 3300053077 Bacteria 1128
552 Ga0501082_0001428 3300060353 Bacteria 20984
553 Ga0501082_0768563 3300060353 Bacteria 843

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031344 Ga0265316_10333791 Ga0265316_103337912 88
2 2162886007 SwRhRL2b_contig_145288 SwRhRL2b_0907.00000390 89
3 3300002773 JGI25152J39213_1000866 JGI25152J39213_10008663 89
4 3300002774 JGI25150J39212_1005456 JGI25150J39212_10054563 89
5 3300002987 JGI25159J45721_1041898 JGI25159J45721_10418981 89
6 3300002987 JGI25159J45721_1047796 JGI25159J45721_10477961 89
7 3300003187 JGI25151J46595_10000351 JGI25151J46595_1000035152 89
8 3300003187 JGI25151J46595_10070536 JGI25151J46595_100705362 89
9 3300003187 JGI25151J46595_10070674 JGI25151J46595_100706741 89
10 3300003215 JGI25153J46596_10000219 JGI25153J46596_1000021952 89
11 3300003323 rootH1_10228024 rootH1_102280242 89
12 3300003771 Ga0055526_1000428 Ga0055526_10004284 89
13 3300003773 Ga0055537_1000017 Ga0055537_100001783 89
14 3300003773 Ga0055537_1001080 Ga0055537_10010806 89
15 3300003775 Ga0055524_1000280 Ga0055524_100028010 89
16 3300003775 Ga0055524_1031360 Ga0055524_10313602 89
17 3300003781 Ga0055536_1004171 Ga0055536_10041712 89
18 3300003781 Ga0055536_1004653 Ga0055536_10046534 89
19 3300003784 Ga0055534_1000163 Ga0055534_100016311 89
20 3300003784 Ga0055534_1000267 Ga0055534_10002675 89
21 3300003784 Ga0055534_1018274 Ga0055534_10182742 89
22 3300003790 Ga0055528_1000182 Ga0055528_100018239 89
23 3300003790 Ga0055528_1000204 Ga0055528_100020410 89
24 3300003791 Ga0055530_10001486 Ga0055530_1000148621 89
25 3300003791 Ga0055530_10004170 Ga0055530_100041708 89
26 3300003791 Ga0055530_10031900 Ga0055530_100319002 89
27 3300003794 Ga0055531_10019722 Ga0055531_100197222 89
28 3300003794 Ga0055531_10031196 Ga0055531_100311962 89
29 3300003794 Ga0055531_10047038 Ga0055531_100470382 89
30 3300005289 Ga0065704_10070357 Ga0065704_1007035729 89
31 3300005295 Ga0065707_10102372 Ga0065707_101023722 89
32 3300005295 Ga0065707_10299350 Ga0065707_102993502 89
33 3300005328 Ga0070676_10182928 Ga0070676_101829281 89
34 3300005328 Ga0070676_10828839 Ga0070676_108288392 89
35 3300005333 Ga0070677_10406146 Ga0070677_104061462 89
36 3300005334 Ga0068869_100063267 Ga0068869_1000632672 89
37 3300005338 Ga0068868_100276504 Ga0068868_1002765043 89
38 3300005340 Ga0070689_100097433 Ga0070689_1000974333 89
39 3300005340 Ga0070689_101370967 Ga0070689_1013709672 89
40 3300005341 Ga0070691_10452015 Ga0070691_104520151 89
41 3300005347 Ga0070668_100101467 Ga0070668_1001014673 89
42 3300005347 Ga0070668_100308055 Ga0070668_1003080552 89
43 3300005353 Ga0070669_100284429 Ga0070669_1002844293 89
44 3300005353 Ga0070669_100522997 Ga0070669_1005229972 89
45 3300005354 Ga0070675_100030112 Ga0070675_1000301122 89
46 3300005356 Ga0070674_100004643 Ga0070674_10000464310 89
47 3300005356 Ga0070674_101538441 Ga0070674_1015384412 89
48 3300005364 Ga0070673_100134417 Ga0070673_1001344171 89
49 3300005364 Ga0070673_100814779 Ga0070673_1008147792 89
50 3300005367 Ga0070667_100049436 Ga0070667_1000494362 89
51 3300005367 Ga0070667_100293756 Ga0070667_1002937563 89
52 3300005438 Ga0070701_10092027 Ga0070701_100920273 89
53 3300005438 Ga0070701_10112782 Ga0070701_101127822 89
54 3300005441 Ga0070700_100051280 Ga0070700_1000512803 89
55 3300005441 Ga0070700_100111477 Ga0070700_1001114773 89
56 3300005441 Ga0070700_100715563 Ga0070700_1007155632 89
57 3300005441 Ga0070700_101971092 Ga0070700_1019710921 89
58 3300005444 Ga0070694_100058025 Ga0070694_1000580251 89
59 3300005455 Ga0070663_100182455 Ga0070663_1001824552 89
60 3300005456 Ga0070678_100110589 Ga0070678_1001105893 89
61 3300005459 Ga0068867_100005133 Ga0068867_1000051333 89
62 3300005466 Ga0070685_10066300 Ga0070685_100663001 89
63 3300005544 Ga0070686_100609991 Ga0070686_1006099912 89
64 3300005545 Ga0070695_100067019 Ga0070695_1000670192 89
65 3300005546 Ga0070696_100703984 Ga0070696_1007039842 89
66 3300005547 Ga0070693_100996030 Ga0070693_1009960301 89
67 3300005548 Ga0070665_100000426 Ga0070665_10000042636 89
68 3300005548 Ga0070665_100016620 Ga0070665_10001662010 89
69 3300005549 Ga0070704_100339417 Ga0070704_1003394172 89
70 3300005615 Ga0070702_100032620 Ga0070702_1000326203 89
71 3300005615 Ga0070702_100228661 Ga0070702_1002286612 89
72 3300005617 Ga0068859_100283262 Ga0068859_1002832623 89
73 3300005617 Ga0068859_101275388 Ga0068859_1012753882 89
74 3300005718 Ga0068866_10078681 Ga0068866_100786812 89
75 3300005719 Ga0068861_100006910 Ga0068861_1000069103 89
76 3300005719 Ga0068861_100704301 Ga0068861_1007043012 89
77 3300005840 Ga0068870_10060897 Ga0068870_100608973 89
78 3300005842 Ga0068858_100087721 Ga0068858_1000877214 89
79 3300005842 Ga0068858_100279118 Ga0068858_1002791182 89
80 3300005843 Ga0068860_100001559 Ga0068860_1000015592 89
81 3300005844 Ga0068862_100018269 Ga0068862_1000182693 89
82 3300005844 Ga0068862_100232682 Ga0068862_1002326822 89
83 3300005844 Ga0068862_100835671 Ga0068862_1008356712 89
84 3300005985 Ga0081539_10052951 Ga0081539_100529514 89
85 3300006038 Ga0075365_10025358 Ga0075365_100253583 89
86 3300006048 Ga0075363_100176930 Ga0075363_1001769302 89
87 3300006048 Ga0075363_100613147 Ga0075363_1006131472 89
88 3300006051 Ga0075364_10046386 Ga0075364_100463862 89
89 3300006051 Ga0075364_10116412 Ga0075364_101164122 89
90 3300006173 Ga0070716_100398343 Ga0070716_1003983432 89
91 3300006195 Ga0075366_10050179 Ga0075366_100501793 89
92 3300006195 Ga0075366_10326750 Ga0075366_103267502 89
93 3300006358 Ga0068871_100684907 Ga0068871_1006849072 89
94 3300006358 Ga0068871_100978936 Ga0068871_1009789362 89
95 3300006844 Ga0075428_100015486 Ga0075428_1000154867 89
96 3300006844 Ga0075428_100538086 Ga0075428_1005380861 89
97 3300006847 Ga0075431_100072888 Ga0075431_1000728884 89
98 3300006847 Ga0075431_100924156 Ga0075431_1009241562 89
99 3300006852 Ga0075433_10255655 Ga0075433_102556553 89
100 3300006871 Ga0075434_100152692 Ga0075434_1001526922 89
101 3300006871 Ga0075434_101981006 Ga0075434_1019810061 89
102 3300006880 Ga0075429_100040836 Ga0075429_1000408364 89
103 3300006880 Ga0075429_100360121 Ga0075429_1003601212 89
104 3300006881 Ga0068865_100003673 Ga0068865_1000036733 89
105 3300006914 Ga0075436_100000080 Ga0075436_1000000803 89
106 3300006914 Ga0075436_100011138 Ga0075436_1000111387 89
107 3300006931 Ga0097620_100283260 Ga0097620_1002832603 89
108 3300006931 Ga0097620_101275417 Ga0097620_1012754172 89
109 3300007076 Ga0075435_100273660 Ga0075435_1002736602 89
110 3300007076 Ga0075435_101069815 Ga0075435_1010698152 89
111 3300009011 Ga0105251_10002785 Ga0105251_1000278516 89
112 3300009036 Ga0105244_10069296 Ga0105244_100692962 89
113 3300009036 Ga0105244_10095776 Ga0105244_100957763 89
114 3300009094 Ga0111539_10037006 Ga0111539_100370067 89
115 3300009094 Ga0111539_11445837 Ga0111539_114458372 89
116 3300009098 Ga0105245_10386246 Ga0105245_103862462 89
117 3300009147 Ga0114129_10066031 Ga0114129_100660313 89
118 3300009147 Ga0114129_10496808 Ga0114129_104968083 89
119 3300009147 Ga0114129_11082380 Ga0114129_110823802 89
120 3300009147 Ga0114129_11481661 Ga0114129_114816612 89
121 3300009148 Ga0105243_10276007 Ga0105243_102760072 89
122 3300009148 Ga0105243_10663225 Ga0105243_106632253 89
123 3300009177 Ga0105248_10178904 Ga0105248_101789043 89
124 3300009551 Ga0105238_11705139 Ga0105238_117051392 89
125 3300009553 Ga0105249_10028331 Ga0105249_100283315 89
126 3300009979 Ga0105032_102131 Ga0105032_1021312 89
127 3300009993 Ga0105028_109473 Ga0105028_1094732 89
128 3300012478 Ga0157328_1011098 Ga0157328_10110982 89
129 3300012482 Ga0157318_1018201 Ga0157318_10182011 89
130 3300012503 Ga0157313_1020458 Ga0157313_10204581 89
131 3300012512 Ga0157327_1007886 Ga0157327_10078862 89
132 3300013100 Ga0157373_10184015 Ga0157373_101840153 89
133 3300013102 Ga0157371_10002186 Ga0157371_100021868 89
134 3300013102 Ga0157371_10020416 Ga0157371_100204162 89
135 3300013104 Ga0157370_10010646 Ga0157370_100106462 89
136 3300013104 Ga0157370_10112942 Ga0157370_101129422 89
137 3300013297 Ga0157378_10001811 Ga0157378_1000181120 89
138 3300013306 Ga0163162_10017493 Ga0163162_100174937 89
139 3300013306 Ga0163162_10383025 Ga0163162_103830252 89
140 3300014325 Ga0163163_11825605 Ga0163163_118256052 89
141 3300014326 Ga0157380_10017645 Ga0157380_100176457 89
142 3300014326 Ga0157380_10131540 Ga0157380_101315402 89
143 3300014326 Ga0157380_10712059 Ga0157380_107120592 89
144 3300014326 Ga0157380_11318696 Ga0157380_113186961 89
145 3300014497 Ga0182008_10000096 Ga0182008_1000009665 89
146 3300014497 Ga0182008_10001301 Ga0182008_1000130121 89
147 3300014745 Ga0157377_11581326 Ga0157377_115813261 89
148 3300014968 Ga0157379_10227952 Ga0157379_102279522 89
149 3300014969 Ga0157376_10578350 Ga0157376_105783503 89
150 3300014969 Ga0157376_11242481 Ga0157376_112424811 89
151 3300015261 Ga0182006_1008250 Ga0182006_10082507 89
152 3300015261 Ga0182006_1110862 Ga0182006_11108622 89
153 3300015262 Ga0182007_10000048 Ga0182007_1000004892 89
154 3300015265 Ga0182005_1003480 Ga0182005_10034802 89
155 3300015689 Ga0183360_10001 Ga0183360_10001271 89
156 3300016635 Ga0183361_11453 Ga0183361_114532 89
157 3300017792 Ga0163161_10030249 Ga0163161_100302492 89
158 3300017792 Ga0163161_10541904 Ga0163161_105419042 89
159 3300017792 Ga0163161_10609356 Ga0163161_106093562 89
160 3300025245 Ga0207425_1000111 Ga0207425_100011131 89
161 3300025245 Ga0207425_1026892 Ga0207425_10268921 89
162 3300025258 Ga0209129_1000087 Ga0209129_1000087146 89
163 3300025263 Ga0209565_1000005 Ga0209565_1000005851 89
164 3300025263 Ga0209565_1000031 Ga0209565_1000031147 89
165 3300025273 Ga0209673_1000011 Ga0209673_1000011506 89
166 3300025273 Ga0209673_1000164 Ga0209673_100016472 89
167 3300025273 Ga0209673_1004282 Ga0209673_10042822 89
168 3300025273 Ga0209673_1064512 Ga0209673_10645122 89
169 3300025284 Ga0209130_1002494 Ga0209130_10024948 89
170 3300025284 Ga0209130_1005265 Ga0209130_10052653 89
171 3300025291 Ga0209675_1000004 Ga0209675_1000004851 89
172 3300025291 Ga0209675_1000015 Ga0209675_1000015246 89
173 3300025291 Ga0209675_1006953 Ga0209675_10069532 89
174 3300025291 Ga0209675_1015895 Ga0209675_10158952 89
175 3300025292 Ga0209676_1000027 Ga0209676_1000027214 89
176 3300025292 Ga0209676_1000110 Ga0209676_1000110174 89
177 3300025292 Ga0209676_1001028 Ga0209676_100102826 89
178 3300025292 Ga0209676_1001231 Ga0209676_100123121 89
179 3300025292 Ga0209676_1005673 Ga0209676_10056733 89
180 3300025292 Ga0209676_1016472 Ga0209676_10164722 89
181 3300025294 Ga0209025_1000013 Ga0209025_1000013427 89
182 3300025294 Ga0209025_1003537 Ga0209025_10035379 89
183 3300025294 Ga0209025_1007002 Ga0209025_10070029 89
184 3300025294 Ga0209025_1042768 Ga0209025_10427682 89
185 3300025294 Ga0209025_1048110 Ga0209025_10481102 89
186 3300025294 Ga0209025_1116044 Ga0209025_11160442 89
187 3300025295 Ga0209564_1000018 Ga0209564_1000018506 89
188 3300025295 Ga0209564_1000037 Ga0209564_1000037123 89
189 3300025295 Ga0209564_1008868 Ga0209564_10088682 89
190 3300025297 Ga0209758_1000014 Ga0209758_1000014427 89
191 3300025297 Ga0209758_1037036 Ga0209758_10370362 89
192 3300025298 Ga0209050_1000417 Ga0209050_100041768 89
193 3300025298 Ga0209050_1001410 Ga0209050_100141021 89
194 3300025298 Ga0209050_1002473 Ga0209050_10024733 89
195 3300025298 Ga0209050_1015285 Ga0209050_10152856 89
196 3300025299 Ga0209256_1000021 Ga0209256_1000021454 89
197 3300025299 Ga0209256_1002158 Ga0209256_10021588 89
198 3300025299 Ga0209256_1002613 Ga0209256_100261317 89
199 3300025299 Ga0209256_1008601 Ga0209256_10086017 89
200 3300025299 Ga0209256_1015165 Ga0209256_10151652 89
201 3300025303 Ga0209051_1001882 Ga0209051_10018823 89
202 3300025303 Ga0209051_1039697 Ga0209051_10396973 89
203 3300025304 Ga0209257_1000129 Ga0209257_1000129174 89
204 3300025304 Ga0209257_1000274 Ga0209257_100027411 89
205 3300025304 Ga0209257_1000670 Ga0209257_100067047 89
206 3300025304 Ga0209257_1001580 Ga0209257_100158012 89
207 3300025304 Ga0209257_1003605 Ga0209257_100360511 89
208 3300025728 Ga0207655_1050978 Ga0207655_10509782 89
209 3300025735 Ga0207713_1037920 Ga0207713_10379203 89
210 3300025893 Ga0207682_10037813 Ga0207682_100378132 89
211 3300025907 Ga0207645_10372596 Ga0207645_103725963 89
212 3300025908 Ga0207643_10025859 Ga0207643_100258593 89
213 3300025918 Ga0207662_10062619 Ga0207662_100626192 89
214 3300025918 Ga0207662_10125440 Ga0207662_101254403 89
215 3300025923 Ga0207681_10129166 Ga0207681_101291663 89
216 3300025923 Ga0207681_10500011 Ga0207681_105000112 89
217 3300025926 Ga0207659_10155795 Ga0207659_101557953 89
218 3300025927 Ga0207687_11544644 Ga0207687_115446442 89
219 3300025935 Ga0207709_10001341 Ga0207709_100013416 89
220 3300025936 Ga0207670_10848363 Ga0207670_108483631 89
221 3300025937 Ga0207669_10067732 Ga0207669_100677323 89
222 3300025938 Ga0207704_10021633 Ga0207704_100216332 89
223 3300025938 Ga0207704_11851762 Ga0207704_118517622 89
224 3300025940 Ga0207691_10394107 Ga0207691_103941073 89
225 3300025941 Ga0207711_10525154 Ga0207711_105251542 89
226 3300025942 Ga0207689_10023675 Ga0207689_100236754 89
227 3300025960 Ga0207651_10074768 Ga0207651_100747681 89
228 3300025960 Ga0207651_10108211 Ga0207651_101082112 89
229 3300025960 Ga0207651_10647467 Ga0207651_106474672 89
230 3300025961 Ga0207712_10066694 Ga0207712_100666942 89
231 3300025972 Ga0207668_10171005 Ga0207668_101710053 89
232 3300025972 Ga0207668_10226106 Ga0207668_102261062 89
233 3300025972 Ga0207668_10276307 Ga0207668_102763072 89
234 3300025986 Ga0207658_10219884 Ga0207658_102198842 89
235 3300025986 Ga0207658_10557962 Ga0207658_105579623 89
236 3300026035 Ga0207703_10057752 Ga0207703_100577524 89
237 3300026035 Ga0207703_10209043 Ga0207703_102090433 89
238 3300026067 Ga0207678_10096767 Ga0207678_100967673 89
239 3300026075 Ga0207708_10044954 Ga0207708_100449542 89
240 3300026075 Ga0207708_11440849 Ga0207708_114408492 89
241 3300026089 Ga0207648_10000419 Ga0207648_100004193 89
242 3300026095 Ga0207676_11025538 Ga0207676_110255382 89
243 3300026118 Ga0207675_100004240 Ga0207675_10000424015 89
244 3300026118 Ga0207675_100746718 Ga0207675_1007467182 89
245 3300026118 Ga0207675_101334667 Ga0207675_1013346672 89
246 3300026121 Ga0207683_10107322 Ga0207683_101073223 89
247 3300027360 Ga0209969_1025153 Ga0209969_10251533 89
248 3300027378 Ga0209981_1017637 Ga0209981_10176371 89
249 3300027395 Ga0209996_1012267 Ga0209996_10122672 89
250 3300027462 Ga0210000_1057197 Ga0210000_10571971 89
251 3300027471 Ga0209995_1030699 Ga0209995_10306992 89
252 3300027526 Ga0209968_1018613 Ga0209968_10186132 89
253 3300027552 Ga0209982_1002284 Ga0209982_10022842 89
254 3300027665 Ga0209983_1019290 Ga0209983_10192903 89
255 3300027671 Ga0209588_1099186 Ga0209588_10991862 89
256 3300027682 Ga0209971_1003169 Ga0209971_10031694 89
257 3300027695 Ga0209966_1002105 Ga0209966_10021056 89
258 3300027717 Ga0209998_10116260 Ga0209998_101162602 89
259 3300027876 Ga0209974_10027381 Ga0209974_100273812 89
260 3300027907 Ga0207428_10075254 Ga0207428_100752542 89
261 3300027907 Ga0207428_10095871 Ga0207428_100958713 89
262 3300028379 Ga0268266_10000741 Ga0268266_100007417 89
263 3300028379 Ga0268266_10059786 Ga0268266_100597862 89
264 3300028380 Ga0268265_10019602 Ga0268265_100196022 89
265 3300028380 Ga0268265_10096628 Ga0268265_100966282 89
266 3300028380 Ga0268265_10397887 Ga0268265_103978872 89
267 3300028380 Ga0268265_12647744 Ga0268265_126477442 89
268 3300028381 Ga0268264_10002884 Ga0268264_100028842 89
269 3300028794 Ga0307515_10093168 Ga0307515_100931686 89
270 3300030732 Ga0316176_1013813 Ga0316176_10138133 89
271 3300030732 Ga0316176_1040133 Ga0316176_10401331 89
272 3300030744 Ga0316181_1005833 Ga0316181_10058332 89
273 3300030745 Ga0316182_1061642 Ga0316182_10616421 89
274 3300031235 Ga0265330_10084253 Ga0265330_100842532 89
275 3300031456 Ga0307513_10151000 Ga0307513_101510003 89
276 3300031548 Ga0307408_100360066 Ga0307408_1003600663 89
277 3300031548 Ga0307408_101008178 Ga0307408_1010081781 89
278 3300031548 Ga0307408_101078557 Ga0307408_1010785572 89
279 3300031548 Ga0307408_101344831 Ga0307408_1013448313 89
280 3300031548 Ga0307408_102213959 Ga0307408_1022139592 89
281 3300031616 Ga0307508_10066109 Ga0307508_100661092 89
282 3300031731 Ga0307405_10229291 Ga0307405_102292911 89
283 3300031731 Ga0307405_10318632 Ga0307405_103186322 89
284 3300031731 Ga0307405_10338901 Ga0307405_103389013 89
285 3300031731 Ga0307405_10497702 Ga0307405_104977022 89
286 3300031731 Ga0307405_10783784 Ga0307405_107837842 89
287 3300031731 Ga0307405_11353224 Ga0307405_113532242 89
288 3300031824 Ga0307413_10042618 Ga0307413_100426182 89
289 3300031824 Ga0307413_10151902 Ga0307413_101519022 89
290 3300031824 Ga0307413_10569113 Ga0307413_105691132 89
291 3300031824 Ga0307413_10896730 Ga0307413_108967302 89
292 3300031824 Ga0307413_11082303 Ga0307413_110823032 89
293 3300031824 Ga0307413_11397568 Ga0307413_113975681 89
294 3300031852 Ga0307410_11277569 Ga0307410_112775692 89
295 3300031901 Ga0307406_10089496 Ga0307406_100894962 89
296 3300031901 Ga0307406_10578196 Ga0307406_105781962 89
297 3300031903 Ga0307407_10540640 Ga0307407_105406402 89
298 3300031911 Ga0307412_10055820 Ga0307412_100558204 89
299 3300031911 Ga0307412_10070447 Ga0307412_100704472 89
300 3300031911 Ga0307412_10093932 Ga0307412_100939324 89
301 3300031911 Ga0307412_10904203 Ga0307412_109042032 89
302 3300031911 Ga0307412_11195568 Ga0307412_111955682 89
303 3300031995 Ga0307409_100793194 Ga0307409_1007931942 89
304 3300031995 Ga0307409_101205923 Ga0307409_1012059232 89
305 3300031995 Ga0307409_101248142 Ga0307409_1012481422 89
306 3300031995 Ga0307409_101995134 Ga0307409_1019951341 89
307 3300032002 Ga0307416_100168763 Ga0307416_1001687632 89
308 3300032002 Ga0307416_100201334 Ga0307416_1002013343 89
309 3300032002 Ga0307416_100342918 Ga0307416_1003429182 89
310 3300032002 Ga0307416_101201320 Ga0307416_1012013202 89
311 3300032002 Ga0307416_101280090 Ga0307416_1012800902 89
312 3300032002 Ga0307416_103273529 Ga0307416_1032735292 89
313 3300032002 Ga0307416_103373793 Ga0307416_1033737932 89
314 3300032004 Ga0307414_10008172 Ga0307414_100081723 89
315 3300032004 Ga0307414_10010308 Ga0307414_100103083 89
316 3300032004 Ga0307414_10024671 Ga0307414_100246711 89
317 3300032004 Ga0307414_10034606 Ga0307414_100346066 89
318 3300032004 Ga0307414_10044477 Ga0307414_100444772 89
319 3300032004 Ga0307414_10057247 Ga0307414_100572473 89
320 3300032004 Ga0307414_10094649 Ga0307414_100946494 89
321 3300032004 Ga0307414_10097637 Ga0307414_100976374 89
322 3300032004 Ga0307414_10236817 Ga0307414_102368172 89
323 3300032004 Ga0307414_10526910 Ga0307414_105269101 89
324 3300032004 Ga0307414_10714026 Ga0307414_107140262 89
325 3300032004 Ga0307414_11621869 Ga0307414_116218692 89
326 3300032005 Ga0307411_10010665 Ga0307411_100106654 89
327 3300032005 Ga0307411_10012920 Ga0307411_100129202 89
328 3300032005 Ga0307411_10315419 Ga0307411_103154192 89
329 3300032005 Ga0307411_10327677 Ga0307411_103276772 89
330 3300032005 Ga0307411_10377285 Ga0307411_103772852 89
331 3300035171 Ga0373946_0438101 Ga0373946_0438101_141_410 89
332 3300035241 Ga0373961_0000811 Ga0373961_0000811_3374_3643 89
333 3300035410 Ga0373924_0257993 Ga0373924_0257993_313_582 89
334 3300035692 Ga0373935_0000870 Ga0373935_0000870_10476_10745 89
335 3300035692 Ga0373935_0712215 Ga0373935_0712215_81_350 89
336 3300037068 Ga0373925_0011924 Ga0373925_0011924_3122_3391 89
337 3300038705 Ga0237819_00040 Ga0237819_00040_44729_44998 89
338 3300038741 Ga0400488_58698 Ga0400488_58698_1319_1588 89
339 3300038742 Ga0400486_30163 Ga0400486_30163_4597_4866 89
340 3300039062 Ga0400483_151922 Ga0400483_151922_783_1052 89
341 3300039093 Ga0400489_75675 Ga0400489_75675_4067_4336 89
342 3300039110 Ga0400487_48277 Ga0400487_48277_869_1138 89
343 3300039145 Ga0237816_01328 Ga0237816_01328_979_1248 89
344 3300041404 Ga0439436_0009624 Ga0439436_0009624_230_499 89
345 3300041404 Ga0439436_0093051 Ga0439436_0093051_475_744 89
346 3300041406 Ga0439439_0018976 Ga0439439_0018976_372_641 89
347 3300041406 Ga0439439_0034156 Ga0439439_0034156_436_705 89
348 3300041406 Ga0439439_0274738 Ga0439439_0274738_176_445 89
349 3300041408 Ga0439453_0063592 Ga0439453_0063592_159_428 89
350 3300041411 Ga0439466_0207546 Ga0439466_0207546_148_417 89
351 3300041413 Ga0439465_0005832 Ga0439465_0005832_1726_2007 89
352 3300041413 Ga0439465_0008429 Ga0439465_0008429_1350_1619 89
353 3300041413 Ga0439465_0013607 Ga0439465_0013607_1618_1887 89
354 3300041413 Ga0439465_0329133 Ga0439465_0329133_183_452 89
355 3300041441 Ga0451787_065104 Ga0451787_065104_327_596 89
356 3300041451 Ga0451791_0906637 Ga0451791_0906637_111_380 89
357 3300041452 Ga0451793_0670350 Ga0451793_0670350_970_1239 89
358 3300041453 Ga0451797_0158336 Ga0451797_0158336_341_610 89
359 3300041456 Ga0451795_0787166 Ga0451795_0787166_400_687 89
360 3300041456 Ga0451795_1518945 Ga0451795_1518945_304_573 89
361 3300041460 Ga0451802_2076607 Ga0451802_2076607_37_306 89
362 3300041463 Ga0451804_1029255 Ga0451804_1029255_737_1006 89
363 3300041486 Ga0451807_0199166 Ga0451807_0199166_711_980 89
364 3300041486 Ga0451807_2137752 Ga0451807_2137752_221_490 89
365 3300041486 Ga0451807_2709952 Ga0451807_2709952_1149_1418 89
366 3300041494 Ga0451837_1410386 Ga0451837_1410386_207_476 89
367 3300041498 Ga0451841_0417243 Ga0451841_0417243_171_440 89
368 3300041498 Ga0451841_0652781 Ga0451841_0652781_278_547 89
369 3300041505 Ga0451849_0218415 Ga0451849_0218415_299_568 89
370 3300041505 Ga0451849_0443800 Ga0451849_0443800_156_425 89
371 3300041509 Ga0451843_0941578 Ga0451843_0941578_134_403 89
372 3300041509 Ga0451843_1288714 Ga0451843_1288714_671_940 89
373 3300041511 Ga0451855_1858647 Ga0451855_1858647_31_300 89
374 3300041512 Ga0451853_1337486 Ga0451853_1337486_249_518 89
375 3300041997 Ga0439431_0120939 Ga0439431_0120939_427_699 89
376 3300041999 Ga0439433_0015296 Ga0439433_0015296_975_1244 89
377 3300041999 Ga0439433_0026976 Ga0439433_0026976_763_1032 89
378 3300042001 Ga0439441_009870 Ga0439441_009870_387_656 89
379 3300042003 Ga0439443_003655 Ga0439443_003655_350_619 89
380 3300042004 Ga0439445_0007424 Ga0439445_0007424_358_630 89
381 3300042006 Ga0439432_006888 Ga0439432_006888_1213_1482 89
382 3300042006 Ga0439432_013892 Ga0439432_013892_800_1069 89
383 3300042006 Ga0439432_032834 Ga0439432_032834_269_556 89
384 3300042006 Ga0439432_083027 Ga0439432_083027_406_675 89
385 3300042006 Ga0439432_152561 Ga0439432_152561_387_656 89
386 3300042007 Ga0439449_0000004 Ga0439449_0000004_11430_11711 89
387 3300042007 Ga0439449_0004225 Ga0439449_0004225_3665_3934 89
388 3300042007 Ga0439449_0011914 Ga0439449_0011914_1228_1497 89
389 3300042007 Ga0439449_0019204 Ga0439449_0019204_1757_2026 89
390 3300042007 Ga0439449_0023109 Ga0439449_0023109_855_1124 89
391 3300042007 Ga0439449_0042411 Ga0439449_0042411_903_1172 89
392 3300042007 Ga0439449_0158662 Ga0439449_0158662_43_312 89
393 3300042010 Ga0439452_006295 Ga0439452_006295_92_361 89
394 3300042013 Ga0439456_055061 Ga0439456_055061_375_644 89
395 3300042014 Ga0439457_028763 Ga0439457_028763_695_964 89
396 3300042015 Ga0439462_0038859 Ga0439462_0038859_789_1058 89
397 3300042015 Ga0439462_0142312 Ga0439462_0142312_87_356 89
398 3300042117 Ga0450913_000155 Ga0450913_000155_522_791 89
399 3300042142 Ga0450905_039642 Ga0450905_039642_388_675 89
400 3300042156 Ga0439446_0319122 Ga0439446_0319122_194_463 89
401 3300042435 Ga0439434_0237040 Ga0439434_0237040_273_542 89
402 3300042436 Ga0439435_0022550 Ga0439435_0022550_1160_1429 89
403 3300042437 Ga0439444_0004861 Ga0439444_0004861_558_827 89
404 3300042461 Ga0439460_0006933 Ga0439460_0006933_1994_2263 89
405 3300042533 Ga0450901_013957 Ga0450901_013957_58_327 89
406 3300042876 Ga0451577_0002652 Ga0451577_0002652_7773_8042 89
407 3300042876 Ga0451577_0075623 Ga0451577_0075623_2339_2626 89
408 3300044712 Ga0453684_0000316 Ga0453684_0000316_95697_95966 89
409 3300044712 Ga0453684_0193639 Ga0453684_0193639_1965_2234 89
410 3300045051 Ga0451576_0000128 Ga0451576_0000128_83311_83580 89
411 3300045051 Ga0451576_0145340 Ga0451576_0145340_505_774 89
412 3300045051 Ga0451576_1427909 Ga0451576_1427909_305_574 89
413 3300045976 Ga0466967_0965632 Ga0466967_0965632_507_776 89
414 3300046453 Ga0495627_008906 Ga0495627_008906_3049_3318 89
415 3300046457 Ga0495590_0124383 Ga0495590_0124383_191_460 89
416 3300046458 Ga0495591_023418 Ga0495591_023418_1016_1285 89
417 3300046460 Ga0495638_0000881 Ga0495638_0000881_14198_14467 89
418 3300046460 Ga0495638_0032950 Ga0495638_0032950_1762_2031 89
419 3300046460 Ga0495638_0134946 Ga0495638_0134946_592_879 89
420 3300046475 Ga0495639_0170148 Ga0495639_0170148_486_755 89
421 3300046491 Ga0495584_0104222 Ga0495584_0104222_906_1175 89
422 3300046512 Ga0495610_0003046 Ga0495610_0003046_7589_7858 89
423 3300046512 Ga0495610_0108996 Ga0495610_0108996_30_317 89
424 3300046513 Ga0495616_0037555 Ga0495616_0037555_1129_1416 89
425 3300046516 Ga0495628_0093103 Ga0495628_0093103_1194_1463 89
426 3300046518 Ga0495631_0001525 Ga0495631_0001525_8557_8826 89
427 3300046519 Ga0495632_0385726 Ga0495632_0385726_296_583 89
428 3300046525 Ga0495663_0110065 Ga0495663_0110065_291_560 89
429 3300046533 Ga0495640_0025999 Ga0495640_0025999_2492_2761 89
430 3300046535 Ga0495586_0010802 Ga0495586_0010802_616_885 89
431 3300046538 Ga0495609_0174390 Ga0495609_0174390_510_779 89
432 3300046558 Ga0495633_0026731 Ga0495633_0026731_2047_2316 89
433 3300046558 Ga0495633_0043387 Ga0495633_0043387_22_309 89
434 3300046558 Ga0495633_0113725 Ga0495633_0113725_432_701 89
435 3300046615 Ga0495656_0001001 Ga0495656_0001001_1191_1460 89
436 3300046660 Ga0495625_0058167 Ga0495625_0058167_468_737 89
437 3300046660 Ga0495625_0653762 Ga0495625_0653762_327_614 89
438 3300046663 Ga0495635_0082917 Ga0495635_0082917_400_669 89
439 3300046681 Ga0495647_0458191 Ga0495647_0458191_243_512 89
440 3300046684 Ga0495669_0101260 Ga0495669_0101260_547_816 89
441 3300046691 Ga0495670_0022391 Ga0495670_0022391_1464_1733 89
442 3300046810 Ga0495660_0026745 Ga0495660_0026745_2176_2463 89
443 3300047317 Ga0495604_0052433 Ga0495604_0052433_887_1156 89
444 3300047318 Ga0495636_0048228 Ga0495636_0048228_1132_1401 89
445 3300047320 Ga0495672_0000090 Ga0495672_0000090_52533_52802 89
446 3300047320 Ga0495672_0068871 Ga0495672_0068871_215_502 89
447 3300047470 Ga0495681_0101983 Ga0495681_0101983_315_584 89
448 3300047472 Ga0495686_0016694 Ga0495686_0016694_4448_4717 89
449 3300047472 Ga0495686_0104192 Ga0495686_0104192_1413_1682 89
450 3300048907 Ga0496104_0425145 Ga0496104_0425145_690_959 89
451 3300048913 Ga0496110_0224170 Ga0496110_0224170_871_1140 89
452 3300048914 Ga0496111_0981890 Ga0496111_0981890_302_589 89
453 3300048917 Ga0496114_0000013 Ga0496114_0000013_183602_183871 89
454 3300048919 Ga0496116_0021188 Ga0496116_0021188_1101_1388 89
455 3300048919 Ga0496116_0119316 Ga0496116_0119316_147_434 89
456 3300048920 Ga0496117_0000617 Ga0496117_0000617_43038_43325 89
457 3300048920 Ga0496117_0003428 Ga0496117_0003428_211_498 89
458 3300048920 Ga0496117_0008591 Ga0496117_0008591_3086_3355 89
459 3300048920 Ga0496117_0057014 Ga0496117_0057014_997_1284 89
460 3300048921 Ga0496118_0000404 Ga0496118_0000404_67240_67527 89
461 3300048921 Ga0496118_0000737 Ga0496118_0000737_43759_44046 89
462 3300048921 Ga0496118_0044462 Ga0496118_0044462_456_743 89
463 3300048921 Ga0496118_0049885 Ga0496118_0049885_1135_1422 89
464 3300048921 Ga0496118_0079564 Ga0496118_0079564_1432_1701 89
465 3300048922 Ga0496119_0000329 Ga0496119_0000329_24174_24461 89
466 3300048923 Ga0496120_0000147 Ga0496120_0000147_41839_42108 89
467 3300048924 Ga0496121_0002594 Ga0496121_0002594_17119_17388 89
468 3300048924 Ga0496121_0074522 Ga0496121_0074522_50_337 89
469 3300048924 Ga0496121_0135493 Ga0496121_0135493_1264_1533 89
470 3300048925 Ga0496122_0420970 Ga0496122_0420970_161_430 89
471 3300048925 Ga0496122_0452535 Ga0496122_0452535_45_332 89
472 3300048926 Ga0496123_0113760 Ga0496123_0113760_1194_1481 89
473 3300048926 Ga0496123_0361682 Ga0496123_0361682_224_511 89
474 3300048927 Ga0496124_0000680 Ga0496124_0000680_9110_9379 89
475 3300048927 Ga0496124_0006616 Ga0496124_0006616_6178_6447 89
476 3300048927 Ga0496124_0117367 Ga0496124_0117367_1735_2004 89
477 3300048927 Ga0496124_0216655 Ga0496124_0216655_854_1141 89
478 3300048927 Ga0496124_0250764 Ga0496124_0250764_933_1220 89
479 3300048927 Ga0496124_0847527 Ga0496124_0847527_224_511 89
480 3300048928 Ga0496125_0026103 Ga0496125_0026103_2215_2502 89
481 3300048928 Ga0496125_0026456 Ga0496125_0026456_15_302 89
482 3300048928 Ga0496125_0085664 Ga0496125_0085664_205_492 89
483 3300048928 Ga0496125_0120654 Ga0496125_0120654_259_546 89
484 3300048928 Ga0496125_0199951 Ga0496125_0199951_13_300 89
485 3300048929 Ga0496126_0000967 Ga0496126_0000967_40050_40337 89
486 3300048929 Ga0496126_0011304 Ga0496126_0011304_7426_7695 89
487 3300049513 Ga0501290_002699 Ga0501290_002699_1214_1483 89
488 3300049568 Ga0501031_0016530 Ga0501031_0016530_382_651 89
489 3300049569 Ga0501032_0364104 Ga0501032_0364104_527_796 89
490 3300049570 Ga0501033_0024972 Ga0501033_0024972_1775_2044 89
491 3300049571 Ga0501034_0000552 Ga0501034_0000552_18467_18754 89
492 3300049571 Ga0501034_0193975 Ga0501034_0193975_652_921 89
493 3300049572 Ga0501036_0142199 Ga0501036_0142199_438_707 89
494 3300049573 Ga0501037_0046698 Ga0501037_0046698_1640_1909 89
495 3300049574 Ga0501038_0015316 Ga0501038_0015316_4286_4555 89
496 3300049575 Ga0501039_0027266 Ga0501039_0027266_1080_1349 89
497 3300049576 Ga0501040_0962210 Ga0501040_0962210_71_340 89
498 3300049579 Ga0501043_0001713 Ga0501043_0001713_3536_3805 89
499 3300049579 Ga0501043_0120368 Ga0501043_0120368_660_929 89
500 3300049581 Ga0501047_0163739 Ga0501047_0163739_841_1110 89
501 3300049583 Ga0501067_0003235 Ga0501067_0003235_1594_1863 89
502 3300049584 Ga0501068_0013166 Ga0501068_0013166_1626_1895 89
503 3300049586 Ga0501070_0037650 Ga0501070_0037650_2238_2507 89
504 3300049587 Ga0501071_0182798 Ga0501071_0182798_484_753 89
505 3300049588 Ga0501072_0351258 Ga0501072_0351258_585_854 89
506 3300049591 Ga0501075_0001709 Ga0501075_0001709_3410_3679 89
507 3300049592 Ga0501076_0874263 Ga0501076_0874263_91_360 89
508 3300049592 Ga0501076_0945664 Ga0501076_0945664_136_405 89
509 3300049593 Ga0501077_0000027 Ga0501077_0000027_74813_75082 89
510 3300049652 Ga0501202_070303 Ga0501202_070303_74_343 89
511 3300049660 Ga0501216_055228 Ga0501216_055228_404_673 89
512 3300049665 Ga0501227_244124 Ga0501227_244124_200_469 89
513 3300049674 Ga0501242_026322 Ga0501242_026322_80_349 89
514 3300049675 Ga0501243_031548 Ga0501243_031548_319_588 89
515 3300049704 Ga0501221_126955 Ga0501221_126955_54_323 89
516 3300049705 Ga0501225_0002344 Ga0501225_0002344_1678_1950 89
517 3300049705 Ga0501225_0369284 Ga0501225_0369284_108_377 89
518 3300049741 Ga0501079_0756017 Ga0501079_0756017_148_417 89
519 3300049742 Ga0501080_0004080 Ga0501080_0004080_5573_5842 89
520 3300049742 Ga0501080_0255110 Ga0501080_0255110_26_295 89
521 3300049743 Ga0501081_0018085 Ga0501081_0018085_1783_2052 89
522 3300049760 Ga0501263_082043 Ga0501263_082043_231_500 89
523 3300049762 Ga0501265_034996 Ga0501265_034996_176_445 89
524 3300049772 Ga0501275_000326 Ga0501275_000326_3665_3934 89
525 3300049779 Ga0501283_013123 Ga0501283_013123_181_450 89
526 3300049822 Ga0501035_0061152 Ga0501035_0061152_1072_1341 89
527 3300049823 Ga0501044_0147113 Ga0501044_0147113_1152_1421 89
528 3300049824 Ga0501045_0233189 Ga0501045_0233189_32_301 89
529 3300050491 nmdc:mga00v17_107765_c1 nmdc:mga00v17_107765_c1_1038_1307 89
530 3300050492 nmdc:mga0yw44_181472_c1 nmdc:mga0yw44_181472_c1_414_701 89
531 3300050493 nmdc:mga0k408_86383_c1 nmdc:mga0k408_86383_c1_954_1223 89
532 3300050507 nmdc:mga05p37_194609_c1 nmdc:mga05p37_194609_c1_2054_2323 89
533 3300050507 nmdc:mga05p37_300249_c1 nmdc:mga05p37_300249_c1_1527_1796 89
534 3300050507 nmdc:mga05p37_385218_c1 nmdc:mga05p37_385218_c1_732_1001 89
535 3300050507 nmdc:mga05p37_404497_c1 nmdc:mga05p37_404497_c1_382_651 89
536 3300050508 nmdc:mga09592_359249_c1 nmdc:mga09592_359249_c1_86_355 89
537 3300050508 nmdc:mga09592_380982_c1 nmdc:mga09592_380982_c1_256_525 89
538 3300050509 nmdc:mga0qj67_153139_c1 nmdc:mga0qj67_153139_c1_1408_1677 89
539 3300050509 nmdc:mga0qj67_334250_c1 nmdc:mga0qj67_334250_c1_261_530 89
540 3300050509 nmdc:mga0qj67_828319_c1 nmdc:mga0qj67_828319_c1_50_319 89
541 3300050510 nmdc:mga06r32_1584980_c1 nmdc:mga06r32_1584980_c1_121_390 89
542 3300050510 nmdc:mga06r32_257641_c1 nmdc:mga06r32_257641_c1_269_538 89
543 3300050510 nmdc:mga06r32_655568_c1 nmdc:mga06r32_655568_c1_208_477 89
544 3300050511 nmdc:mga08y16_1433197_c1 nmdc:mga08y16_1433197_c1_134_403 89
545 3300050511 nmdc:mga08y16_15097_c1 nmdc:mga08y16_15097_c1_6591_6860 89
546 3300050511 nmdc:mga08y16_885874_c1 nmdc:mga08y16_885874_c1_336_605 89
547 3300050512 nmdc:mga0n895_212888_c1 nmdc:mga0n895_212888_c1_52_321 89
548 3300050514 nmdc:mga08x19_186_c1 nmdc:mga08x19_186_c1_31734_32003 89
549 3300050514 nmdc:mga08x19_5414_c1 nmdc:mga08x19_5414_c1_5413_5682 89
550 3300050515 nmdc:mga0a205_398937_c1 nmdc:mga0a205_398937_c1_236_505 89
551 3300053077 Ga0495601_0262205 Ga0495601_0262205_821_1090 89
552 3300060353 Ga0501082_0001428 Ga0501082_0001428_11261_11530 89
553 3300060353 Ga0501082_0768563 Ga0501082_0768563_87_356 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

22

103

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lfg-assembly2.cif.gz_B crystal structure of hpr-c-his from thermoanaerobacter tengcongensis 0.9751 1 85
1sph-assembly1.cif.gz_B refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition 0.9695 2 80
7ff5-assembly3.cif.gz_C the crystal structure of ruminiclostridium cellulolyticum phosphocarrier 0.969 1 81
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.9617 2 81
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9609 1 81
ID Description Score Start End Superfamily
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9665 4 81 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9619 2 85 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9592 1 83 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9517 2 81 3.30.1340.10
af_P32670_5_87_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9288 4 81 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A0G3LRK3-F1-model_v4 deleted 1.006 1 89
AF-A0A3R8U1J6-F1-model_v4 HPr family phosphocarrier protein 1.004 1 89 GO:0005737
GO:0009401
AF-A0A2N1GEX0-F1-model_v4 deleted 1.004 1 89
AF-A0A522Y6K4-F1-model_v4 HPr family phosphocarrier protein 1.004 1 89 GO:0005737
GO:0009401
AF-A0A4R5U1G3-F1-model_v4 HPr family phosphocarrier protein 1.002 1 89 GO:0005737
GO:0009401

Feature Viewer

pLDDT pTM Quality
96.72 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map