F462408
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 549 | 286 | 537 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0315144|Ga0495603_0315144_73_873 |
| Length | 266 |
| Sequence | VTRASKLLIDSSMTLSDPLESCAGRALRLFIPGRDAMIEVYSWATPNGHKVHVMLEECGLAYRAIPVNIGAGDQFKPEFLAISPNNKIPAIVDPDGPDGEPISLFESGAILVYLAAKTGRFLPADLRGRYQTLEWLMFQMGSVGPMLGQTHHFRLYAPEKIPYAIDRYSNEAKRLYNVMDKRLATQSFIATDEYTIADIAIFPWLRSWQNQGIDWADYPNLKDWFDRVAARPAVRRGVEVLAGLRKPLRSDAEREVLFGAKQYERR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 2 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 3 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 4 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 5 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 6 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 7 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 8 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 9 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 10 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 11 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 12 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 181 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 182 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 195 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 196 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 225 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 226 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 229 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 232 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 233 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 269 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 282 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 283 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.81 |
| Metatranscriptomes | 0 |
| Isolates | 2.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.92 |
| Nodule | 0 |
| Rhizoplane | 3.46 |
| Rhizosphere | 86.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000439 | 3300002773 | Bacteria | 24968 |
| 2 | JGI25150J39212_1004101 | 3300002774 | Bacteria | 3290 |
| 3 | JGI25151J46595_10000810 | 3300003187 | Bacteria | 24968 |
| 4 | JGI25153J46596_10000499 | 3300003215 | Bacteria | 24968 |
| 5 | Ga0055526_1000003 | 3300003771 | Bacteria | 413092 |
| 6 | Ga0055537_1000153 | 3300003773 | Bacteria | 51908 |
| 7 | Ga0055524_1000002 | 3300003775 | Bacteria | 459550 |
| 8 | Ga0055534_1000050 | 3300003784 | Bacteria | 92561 |
| 9 | Ga0055528_1000001 | 3300003790 | Bacteria | 402384 |
| 10 | Ga0065704_10047520 | 3300005289 | Bacteria | 787 |
| 11 | Ga0065715_10144662 | 3300005293 | Bacteria | 1805 |
| 12 | Ga0065707_10295144 | 3300005295 | Bacteria | 1016 |
| 13 | Ga0070658_10076359 | 3300005327 | Bacteria | 2748 |
| 14 | Ga0070658_10132516 | 3300005327 | Bacteria | 2077 |
| 15 | Ga0070658_10144630 | 3300005327 | Bacteria | 1987 |
| 16 | Ga0070676_10185903 | 3300005328 | Bacteria | 1354 |
| 17 | Ga0070676_10338872 | 3300005328 | Bacteria | 1031 |
| 18 | Ga0070683_100048721 | 3300005329 | Bacteria | 3917 |
| 19 | Ga0070683_100082137 | 3300005329 | Bacteria | 3017 |
| 20 | Ga0070670_100004050 | 3300005331 | Bacteria | 12237 |
| 21 | Ga0070670_100025326 | 3300005331 | Bacteria | 5105 |
| 22 | Ga0070670_100194202 | 3300005331 | Bacteria | 1763 |
| 23 | Ga0070670_100214101 | 3300005331 | Bacteria | 1675 |
| 24 | Ga0070670_100488998 | 3300005331 | Bacteria | 1093 |
| 25 | Ga0070677_10050908 | 3300005333 | Bacteria | 1674 |
| 26 | Ga0070677_10088667 | 3300005333 | Bacteria | 1341 |
| 27 | Ga0068869_100002292 | 3300005334 | Bacteria | 11512 |
| 28 | Ga0068869_100047188 | 3300005334 | Bacteria | 3110 |
| 29 | Ga0068869_100057427 | 3300005334 | Bacteria | 2841 |
| 30 | Ga0070666_10021839 | 3300005335 | Bacteria | 4150 |
| 31 | Ga0070680_100343151 | 3300005336 | Bacteria | 1269 |
| 32 | Ga0068868_100004360 | 3300005338 | Bacteria | 9917 |
| 33 | Ga0068868_100028768 | 3300005338 | Bacteria | 4252 |
| 34 | Ga0068868_100096926 | 3300005338 | Bacteria | 2383 |
| 35 | Ga0070660_100021608 | 3300005339 | Bacteria | 4748 |
| 36 | Ga0070660_100082046 | 3300005339 | Bacteria | 2531 |
| 37 | Ga0070689_100233147 | 3300005340 | Bacteria | 1514 |
| 38 | Ga0070689_100321859 | 3300005340 | Bacteria | 1292 |
| 39 | Ga0070687_100023721 | 3300005343 | Bacteria | 2918 |
| 40 | Ga0070687_100061789 | 3300005343 | Bacteria | 1981 |
| 41 | Ga0070661_100134064 | 3300005344 | Bacteria | 1862 |
| 42 | Ga0070668_100012013 | 3300005347 | Bacteria | 6450 |
| 43 | Ga0070668_100032116 | 3300005347 | Bacteria | 3995 |
| 44 | Ga0070668_100094447 | 3300005347 | Bacteria | 2361 |
| 45 | Ga0070668_100434819 | 3300005347 | Bacteria | 1125 |
| 46 | Ga0070668_100490661 | 3300005347 | Bacteria | 1062 |
| 47 | Ga0070669_100008268 | 3300005353 | Bacteria | 7428 |
| 48 | Ga0070669_100016134 | 3300005353 | Bacteria | 5329 |
| 49 | Ga0070669_100356473 | 3300005353 | Bacteria | 1188 |
| 50 | Ga0070669_100518619 | 3300005353 | Bacteria | 990 |
| 51 | Ga0070675_100000837 | 3300005354 | Bacteria | 21793 |
| 52 | Ga0070675_100006591 | 3300005354 | Bacteria | 8927 |
| 53 | Ga0070675_100058732 | 3300005354 | Bacteria | 3172 |
| 54 | Ga0070675_100073780 | 3300005354 | Bacteria | 2833 |
| 55 | Ga0070675_100095013 | 3300005354 | Bacteria | 2502 |
| 56 | Ga0070675_100179406 | 3300005354 | Bacteria | 1830 |
| 57 | Ga0070675_100858615 | 3300005354 | Bacteria | 831 |
| 58 | Ga0070671_100015493 | 3300005355 | Bacteria | 6159 |
| 59 | Ga0070671_100055182 | 3300005355 | Bacteria | 3305 |
| 60 | Ga0070671_100396326 | 3300005355 | Bacteria | 1180 |
| 61 | Ga0070671_100401519 | 3300005355 | Bacteria | 1172 |
| 62 | Ga0070674_100023274 | 3300005356 | Bacteria | 4007 |
| 63 | Ga0070674_100078528 | 3300005356 | Bacteria | 2352 |
| 64 | Ga0070674_100148694 | 3300005356 | Bacteria | 1765 |
| 65 | Ga0070674_100364809 | 3300005356 | Bacteria | 1170 |
| 66 | Ga0070674_100666645 | 3300005356 | Bacteria | 886 |
| 67 | Ga0070673_100006166 | 3300005364 | Bacteria | 7770 |
| 68 | Ga0070673_100107740 | 3300005364 | Bacteria | 2305 |
| 69 | Ga0070673_100124939 | 3300005364 | Bacteria | 2151 |
| 70 | Ga0070688_100028965 | 3300005365 | Bacteria | 3312 |
| 71 | Ga0070688_100168778 | 3300005365 | Bacteria | 1508 |
| 72 | Ga0070667_100022986 | 3300005367 | Bacteria | 5170 |
| 73 | Ga0070667_100049799 | 3300005367 | Bacteria | 3529 |
| 74 | Ga0070667_100092033 | 3300005367 | Bacteria | 2608 |
| 75 | Ga0070667_100122418 | 3300005367 | Bacteria | 2264 |
| 76 | Ga0070701_10075820 | 3300005438 | Bacteria | 1809 |
| 77 | Ga0070711_100350460 | 3300005439 | Bacteria | 1187 |
| 78 | Ga0070700_100486376 | 3300005441 | Bacteria | 946 |
| 79 | Ga0070694_100144678 | 3300005444 | Bacteria | 1730 |
| 80 | Ga0070663_100081916 | 3300005455 | Bacteria | 2373 |
| 81 | Ga0070678_100016836 | 3300005456 | Bacteria | 4687 |
| 82 | Ga0070678_100092981 | 3300005456 | Bacteria | 2318 |
| 83 | Ga0070678_100103082 | 3300005456 | Bacteria | 2216 |
| 84 | Ga0070678_100106305 | 3300005456 | Bacteria | 2187 |
| 85 | Ga0070678_100401767 | 3300005456 | Bacteria | 1190 |
| 86 | Ga0070662_100055315 | 3300005457 | Bacteria | 2878 |
| 87 | Ga0070662_100970216 | 3300005457 | Bacteria | 727 |
| 88 | Ga0070681_10001886 | 3300005458 | Bacteria | 18915 |
| 89 | Ga0070681_10149583 | 3300005458 | Bacteria | 2262 |
| 90 | Ga0068867_100003015 | 3300005459 | Bacteria | 11869 |
| 91 | Ga0068867_100015341 | 3300005459 | Bacteria | 5432 |
| 92 | Ga0068867_100223481 | 3300005459 | Bacteria | 1518 |
| 93 | Ga0068867_100468363 | 3300005459 | Bacteria | 1077 |
| 94 | Ga0070685_10228878 | 3300005466 | Bacteria | 1222 |
| 95 | Ga0070706_100033891 | 3300005467 | Bacteria | 4714 |
| 96 | Ga0070707_100019507 | 3300005468 | Bacteria | 6388 |
| 97 | Ga0070707_100140874 | 3300005468 | Bacteria | 2347 |
| 98 | Ga0070679_100495651 | 3300005530 | Bacteria | 1166 |
| 99 | Ga0070684_100029200 | 3300005535 | Bacteria | 4671 |
| 100 | Ga0070684_100345758 | 3300005535 | Bacteria | 1367 |
| 101 | Ga0070697_100228964 | 3300005536 | Bacteria | 1585 |
| 102 | Ga0068853_100380235 | 3300005539 | Bacteria | 1318 |
| 103 | Ga0070672_100015809 | 3300005543 | Bacteria | 5388 |
| 104 | Ga0070672_100017240 | 3300005543 | Bacteria | 5193 |
| 105 | Ga0070672_100050834 | 3300005543 | Bacteria | 3230 |
| 106 | Ga0070672_100105205 | 3300005543 | Bacteria | 2294 |
| 107 | Ga0070672_100133513 | 3300005543 | Bacteria | 2042 |
| 108 | Ga0070672_100162882 | 3300005543 | Bacteria | 1852 |
| 109 | Ga0070672_100519421 | 3300005543 | Bacteria | 1031 |
| 110 | Ga0070686_100021820 | 3300005544 | Bacteria | 3811 |
| 111 | Ga0070695_100068522 | 3300005545 | Bacteria | 2317 |
| 112 | Ga0070695_100624890 | 3300005545 | Bacteria | 848 |
| 113 | Ga0070696_100044619 | 3300005546 | Bacteria | 3070 |
| 114 | Ga0070696_100539831 | 3300005546 | Bacteria | 933 |
| 115 | Ga0070693_100035977 | 3300005547 | Bacteria | 2749 |
| 116 | Ga0070665_100186683 | 3300005548 | Bacteria | 2074 |
| 117 | Ga0070665_100565371 | 3300005548 | Bacteria | 1150 |
| 118 | Ga0070704_100002902 | 3300005549 | Bacteria | 9734 |
| 119 | Ga0070704_100806819 | 3300005549 | Bacteria | 839 |
| 120 | Ga0068855_100015267 | 3300005563 | Bacteria | 9244 |
| 121 | Ga0070664_100008503 | 3300005564 | Bacteria | 8297 |
| 122 | Ga0070664_100016797 | 3300005564 | Bacteria | 6007 |
| 123 | Ga0070664_100084357 | 3300005564 | Bacteria | 2742 |
| 124 | Ga0070664_100151213 | 3300005564 | Bacteria | 2049 |
| 125 | Ga0070664_100359954 | 3300005564 | Bacteria | 1325 |
| 126 | Ga0070664_100495309 | 3300005564 | Bacteria | 1126 |
| 127 | Ga0070702_100038015 | 3300005615 | Bacteria | 2677 |
| 128 | Ga0068852_100081356 | 3300005616 | Bacteria | 2875 |
| 129 | Ga0068852_100085490 | 3300005616 | Bacteria | 2810 |
| 130 | Ga0068852_100145575 | 3300005616 | Bacteria | 2197 |
| 131 | Ga0068852_100221735 | 3300005616 | Bacteria | 1799 |
| 132 | Ga0068859_100002428 | 3300005617 | Bacteria | 18977 |
| 133 | Ga0068859_100060700 | 3300005617 | Bacteria | 3810 |
| 134 | Ga0068864_100001744 | 3300005618 | Bacteria | 17876 |
| 135 | Ga0068864_100037502 | 3300005618 | Bacteria | 4136 |
| 136 | Ga0068864_100045250 | 3300005618 | Bacteria | 3775 |
| 137 | Ga0068864_100074311 | 3300005618 | Bacteria | 2966 |
| 138 | Ga0068864_100373647 | 3300005618 | Bacteria | 1350 |
| 139 | Ga0068866_10003719 | 3300005718 | Bacteria | 6255 |
| 140 | Ga0068861_100003994 | 3300005719 | Bacteria | 9878 |
| 141 | Ga0068861_100037899 | 3300005719 | Bacteria | 3585 |
| 142 | Ga0068861_100148256 | 3300005719 | Bacteria | 1922 |
| 143 | Ga0068851_10028520 | 3300005834 | Bacteria | 2758 |
| 144 | Ga0068863_100083099 | 3300005841 | Bacteria | 3034 |
| 145 | Ga0068863_100148771 | 3300005841 | Bacteria | 2240 |
| 146 | Ga0068863_100732932 | 3300005841 | Bacteria | 983 |
| 147 | Ga0068858_100000302 | 3300005842 | Bacteria | 52791 |
| 148 | Ga0068858_100023326 | 3300005842 | Bacteria | 5766 |
| 149 | Ga0068858_100031334 | 3300005842 | Bacteria | 4938 |
| 150 | Ga0068858_100051535 | 3300005842 | Bacteria | 3807 |
| 151 | Ga0068860_100004324 | 3300005843 | Bacteria | 14519 |
| 152 | Ga0068860_100061504 | 3300005843 | Bacteria | 3567 |
| 153 | Ga0068860_100392489 | 3300005843 | Bacteria | 1371 |
| 154 | Ga0068862_100041938 | 3300005844 | Bacteria | 3896 |
| 155 | Ga0068862_100076009 | 3300005844 | Bacteria | 2906 |
| 156 | Ga0081538_10001621 | 3300005981 | Bacteria | 23067 |
| 157 | Ga0075432_10011351 | 3300006058 | Bacteria | 3026 |
| 158 | Ga0070712_100351661 | 3300006175 | Bacteria | 1206 |
| 159 | Ga0075362_10182102 | 3300006177 | Bacteria | 1018 |
| 160 | Ga0097621_100018079 | 3300006237 | Bacteria | 5375 |
| 161 | Ga0097621_100230483 | 3300006237 | Bacteria | 1617 |
| 162 | Ga0097621_100243542 | 3300006237 | Bacteria | 1572 |
| 163 | Ga0097621_100244702 | 3300006237 | Bacteria | 1569 |
| 164 | Ga0068871_100010784 | 3300006358 | Bacteria | 6686 |
| 165 | Ga0068871_100021878 | 3300006358 | Bacteria | 4923 |
| 166 | Ga0068871_100053498 | 3300006358 | Bacteria | 3272 |
| 167 | Ga0068871_100061637 | 3300006358 | Bacteria | 3064 |
| 168 | Ga0068871_100164176 | 3300006358 | Bacteria | 1900 |
| 169 | Ga0068871_100303294 | 3300006358 | Bacteria | 1402 |
| 170 | Ga0075428_100283973 | 3300006844 | Bacteria | 1781 |
| 171 | Ga0075430_100140557 | 3300006846 | Bacteria | 2011 |
| 172 | Ga0075431_100001511 | 3300006847 | Bacteria | 21575 |
| 173 | Ga0075429_100000694 | 3300006880 | Bacteria | 26235 |
| 174 | Ga0068865_100015272 | 3300006881 | Bacteria | 4896 |
| 175 | Ga0068865_100185299 | 3300006881 | Bacteria | 1606 |
| 176 | Ga0068865_100449847 | 3300006881 | Bacteria | 1065 |
| 177 | Ga0075436_100101677 | 3300006914 | Bacteria | 2002 |
| 178 | Ga0075436_100624260 | 3300006914 | Bacteria | 795 |
| 179 | Ga0097620_100002428 | 3300006931 | Bacteria | 18977 |
| 180 | Ga0097620_100060699 | 3300006931 | Bacteria | 3810 |
| 181 | Ga0097620_100076466 | 3300006931 | Bacteria | 3389 |
| 182 | Ga0111539_10605415 | 3300009094 | Bacteria | 1276 |
| 183 | Ga0105245_10009589 | 3300009098 | Bacteria | 8445 |
| 184 | Ga0105245_10075325 | 3300009098 | Bacteria | 3072 |
| 185 | Ga0114129_10055562 | 3300009147 | Bacteria | 5548 |
| 186 | Ga0105243_10081213 | 3300009148 | Bacteria | 2646 |
| 187 | Ga0105243_10420353 | 3300009148 | Bacteria | 1247 |
| 188 | Ga0105241_10140689 | 3300009174 | Bacteria | 1964 |
| 189 | Ga0105242_10029090 | 3300009176 | Bacteria | 4404 |
| 190 | Ga0105242_10322652 | 3300009176 | Bacteria | 1417 |
| 191 | Ga0105248_10007457 | 3300009177 | Bacteria | 12001 |
| 192 | Ga0105248_10017648 | 3300009177 | Bacteria | 7873 |
| 193 | Ga0105248_10031929 | 3300009177 | Bacteria | 5884 |
| 194 | Ga0105248_10129182 | 3300009177 | Bacteria | 2851 |
| 195 | Ga0105248_10208032 | 3300009177 | Bacteria | 2204 |
| 196 | Ga0105248_10211154 | 3300009177 | Bacteria | 2187 |
| 197 | Ga0105248_10812602 | 3300009177 | Bacteria | 1055 |
| 198 | Ga0105238_10007971 | 3300009551 | Bacteria | 10598 |
| 199 | Ga0105238_11229550 | 3300009551 | Bacteria | 774 |
| 200 | Ga0105249_10005385 | 3300009553 | Bacteria | 11044 |
| 201 | Ga0105249_10103550 | 3300009553 | Bacteria | 2681 |
| 202 | Ga0105249_10427983 | 3300009553 | Bacteria | 1359 |
| 203 | Ga0105249_11368996 | 3300009553 | Bacteria | 779 |
| 204 | Ga0157371_10029770 | 3300013102 | Bacteria | 3944 |
| 205 | Ga0157369_10085752 | 3300013105 | Bacteria | 3365 |
| 206 | Ga0157369_10096608 | 3300013105 | Bacteria | 3152 |
| 207 | Ga0157374_10017149 | 3300013296 | Bacteria | 6374 |
| 208 | Ga0157374_10181155 | 3300013296 | Bacteria | 2058 |
| 209 | Ga0157374_10299681 | 3300013296 | Bacteria | 1590 |
| 210 | Ga0157378_10199387 | 3300013297 | Bacteria | 1892 |
| 211 | Ga0157378_10207927 | 3300013297 | Bacteria | 1854 |
| 212 | Ga0163162_10011758 | 3300013306 | Bacteria | 8537 |
| 213 | Ga0163162_10022652 | 3300013306 | Bacteria | 6193 |
| 214 | Ga0163162_10498756 | 3300013306 | Bacteria | 1348 |
| 215 | Ga0163162_10904517 | 3300013306 | Bacteria | 996 |
| 216 | Ga0157375_10065513 | 3300013308 | Bacteria | 3622 |
| 217 | Ga0157375_10074885 | 3300013308 | Bacteria | 3408 |
| 218 | Ga0157375_10094496 | 3300013308 | Bacteria | 3059 |
| 219 | Ga0157375_10136754 | 3300013308 | Bacteria | 2575 |
| 220 | Ga0163163_10009030 | 3300014325 | Bacteria | 8882 |
| 221 | Ga0163163_10227856 | 3300014325 | Bacteria | 1912 |
| 222 | Ga0157380_10332718 | 3300014326 | Bacteria | 1413 |
| 223 | Ga0157377_10001606 | 3300014745 | Bacteria | 9840 |
| 224 | Ga0157377_10150351 | 3300014745 | Bacteria | 1439 |
| 225 | Ga0157377_10189176 | 3300014745 | Bacteria | 1300 |
| 226 | Ga0157377_10200008 | 3300014745 | Bacteria | 1268 |
| 227 | Ga0157379_10003195 | 3300014968 | Bacteria | 13882 |
| 228 | Ga0157379_10009660 | 3300014968 | Bacteria | 8396 |
| 229 | Ga0157379_10020276 | 3300014968 | Bacteria | 5878 |
| 230 | Ga0157379_10065107 | 3300014968 | Bacteria | 3258 |
| 231 | Ga0157376_10012963 | 3300014969 | Bacteria | 6207 |
| 232 | Ga0157376_10097608 | 3300014969 | Bacteria | 2560 |
| 233 | Ga0157376_10148210 | 3300014969 | Bacteria | 2113 |
| 234 | Ga0157376_10149347 | 3300014969 | Bacteria | 2106 |
| 235 | Ga0157376_10345671 | 3300014969 | Bacteria | 1422 |
| 236 | Ga0163161_10106375 | 3300017792 | Bacteria | 2093 |
| 237 | Ga0163161_10139091 | 3300017792 | Bacteria | 1837 |
| 238 | Ga0163161_10158291 | 3300017792 | Bacteria | 1726 |
| 239 | Ga0213872_10020448 | 3300021361 | Bacteria | 3051 |
| 240 | Ga0213876_10116040 | 3300021384 | Bacteria | 1421 |
| 241 | Ga0207425_1000029 | 3300025245 | Bacteria | 268521 |
| 242 | Ga0209129_1000073 | 3300025258 | Bacteria | 207709 |
| 243 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 244 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 245 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 246 | Ga0209025_1000076 | 3300025294 | Bacteria | 273934 |
| 247 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 248 | Ga0209758_1000112 | 3300025297 | Bacteria | 207640 |
| 249 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 250 | Ga0209257_1000240 | 3300025304 | Bacteria | 128014 |
| 251 | Ga0209257_1011292 | 3300025304 | Bacteria | 4326 |
| 252 | Ga0207697_10095893 | 3300025315 | Bacteria | 1261 |
| 253 | Ga0207682_10001538 | 3300025893 | Bacteria | 10601 |
| 254 | Ga0207682_10095022 | 3300025893 | Bacteria | 1297 |
| 255 | Ga0207682_10129917 | 3300025893 | Bacteria | 1124 |
| 256 | Ga0207642_10076775 | 3300025899 | Bacteria | 1609 |
| 257 | Ga0207688_10009583 | 3300025901 | Bacteria | 5274 |
| 258 | Ga0207688_10010106 | 3300025901 | Bacteria | 5134 |
| 259 | Ga0207688_10121996 | 3300025901 | Bacteria | 1521 |
| 260 | Ga0207680_10003124 | 3300025903 | Bacteria | 7779 |
| 261 | Ga0207680_10027205 | 3300025903 | Bacteria | 3181 |
| 262 | Ga0207645_10037373 | 3300025907 | Bacteria | 3115 |
| 263 | Ga0207645_10162816 | 3300025907 | Bacteria | 1460 |
| 264 | Ga0207645_10315642 | 3300025907 | Bacteria | 1042 |
| 265 | Ga0207645_10448489 | 3300025907 | Bacteria | 871 |
| 266 | Ga0207705_10128688 | 3300025909 | Bacteria | 1883 |
| 267 | Ga0207705_10147531 | 3300025909 | Bacteria | 1761 |
| 268 | Ga0207684_10203810 | 3300025910 | Bacteria | 1706 |
| 269 | Ga0207707_10003369 | 3300025912 | Bacteria | 14184 |
| 270 | Ga0207707_10219644 | 3300025912 | Bacteria | 1654 |
| 271 | Ga0207693_10271246 | 3300025915 | Bacteria | 1329 |
| 272 | Ga0207660_10565686 | 3300025917 | Bacteria | 925 |
| 273 | Ga0207660_10770384 | 3300025917 | Bacteria | 785 |
| 274 | Ga0207662_10024890 | 3300025918 | Bacteria | 3445 |
| 275 | Ga0207662_10060053 | 3300025918 | Bacteria | 2280 |
| 276 | Ga0207657_10023139 | 3300025919 | Bacteria | 5793 |
| 277 | Ga0207649_10008468 | 3300025920 | Bacteria | 5610 |
| 278 | Ga0207649_10206550 | 3300025920 | Bacteria | 1391 |
| 279 | Ga0207646_10093779 | 3300025922 | Bacteria | 2688 |
| 280 | Ga0207646_10271991 | 3300025922 | Bacteria | 1531 |
| 281 | Ga0207681_10003019 | 3300025923 | Bacteria | 10572 |
| 282 | Ga0207681_11116183 | 3300025923 | Bacteria | 662 |
| 283 | Ga0207650_10001736 | 3300025925 | Bacteria | 15492 |
| 284 | Ga0207650_10050574 | 3300025925 | Bacteria | 3074 |
| 285 | Ga0207650_10095142 | 3300025925 | Bacteria | 2283 |
| 286 | Ga0207650_10108611 | 3300025925 | Bacteria | 2145 |
| 287 | Ga0207650_10199206 | 3300025925 | Bacteria | 1603 |
| 288 | Ga0207650_10230028 | 3300025925 | Bacteria | 1495 |
| 289 | Ga0207650_10499609 | 3300025925 | Bacteria | 1016 |
| 290 | Ga0207659_10001207 | 3300025926 | Bacteria | 15427 |
| 291 | Ga0207659_10098123 | 3300025926 | Bacteria | 2202 |
| 292 | Ga0207659_10155734 | 3300025926 | Bacteria | 1789 |
| 293 | Ga0207659_10161099 | 3300025926 | Bacteria | 1761 |
| 294 | Ga0207659_10460981 | 3300025926 | Bacteria | 1071 |
| 295 | Ga0207687_10544497 | 3300025927 | Bacteria | 973 |
| 296 | Ga0207644_10015281 | 3300025931 | Bacteria | 5149 |
| 297 | Ga0207644_10167355 | 3300025931 | Bacteria | 1713 |
| 298 | Ga0207644_10227664 | 3300025931 | Bacteria | 1480 |
| 299 | Ga0207644_10292439 | 3300025931 | Bacteria | 1310 |
| 300 | Ga0207690_10073034 | 3300025932 | Bacteria | 2371 |
| 301 | Ga0207690_10507110 | 3300025932 | Bacteria | 976 |
| 302 | Ga0207706_10018813 | 3300025933 | Bacteria | 6212 |
| 303 | Ga0207706_10862107 | 3300025933 | Bacteria | 766 |
| 304 | Ga0207686_10015451 | 3300025934 | Bacteria | 4269 |
| 305 | Ga0207686_10213308 | 3300025934 | Bacteria | 1389 |
| 306 | Ga0207709_10195580 | 3300025935 | Bacteria | 1440 |
| 307 | Ga0207670_10026167 | 3300025936 | Bacteria | 3674 |
| 308 | Ga0207669_10029016 | 3300025937 | Bacteria | 3053 |
| 309 | Ga0207669_10402676 | 3300025937 | Bacteria | 1072 |
| 310 | Ga0207704_10040144 | 3300025938 | Bacteria | 2732 |
| 311 | Ga0207704_10138659 | 3300025938 | Bacteria | 1697 |
| 312 | Ga0207691_10003233 | 3300025940 | Bacteria | 15880 |
| 313 | Ga0207691_10011718 | 3300025940 | Bacteria | 8420 |
| 314 | Ga0207691_10030314 | 3300025940 | Bacteria | 5056 |
| 315 | Ga0207691_10058845 | 3300025940 | Bacteria | 3495 |
| 316 | Ga0207691_10068372 | 3300025940 | Bacteria | 3209 |
| 317 | Ga0207691_10144115 | 3300025940 | Bacteria | 2098 |
| 318 | Ga0207691_10153412 | 3300025940 | Bacteria | 2024 |
| 319 | Ga0207711_10012797 | 3300025941 | Bacteria | 6969 |
| 320 | Ga0207711_10038649 | 3300025941 | Bacteria | 4058 |
| 321 | Ga0207711_10069677 | 3300025941 | Bacteria | 3049 |
| 322 | Ga0207711_10245624 | 3300025941 | Bacteria | 1642 |
| 323 | Ga0207711_10392292 | 3300025941 | Bacteria | 1289 |
| 324 | Ga0207711_10580378 | 3300025941 | Bacteria | 1046 |
| 325 | Ga0207689_10008191 | 3300025942 | Bacteria | 9106 |
| 326 | Ga0207689_10019512 | 3300025942 | Bacteria | 5713 |
| 327 | Ga0207689_10426654 | 3300025942 | Bacteria | 1107 |
| 328 | Ga0207679_10047373 | 3300025945 | Bacteria | 3122 |
| 329 | Ga0207679_10342922 | 3300025945 | Bacteria | 1300 |
| 330 | Ga0207667_10012766 | 3300025949 | Bacteria | 9647 |
| 331 | Ga0207651_10032563 | 3300025960 | Bacteria | 3350 |
| 332 | Ga0207651_10111519 | 3300025960 | Bacteria | 2054 |
| 333 | Ga0207651_10118378 | 3300025960 | Bacteria | 2004 |
| 334 | Ga0207651_10445281 | 3300025960 | Bacteria | 1110 |
| 335 | Ga0207712_10046387 | 3300025961 | Bacteria | 3013 |
| 336 | Ga0207712_10155283 | 3300025961 | Bacteria | 1772 |
| 337 | Ga0207712_10338472 | 3300025961 | Bacteria | 1247 |
| 338 | Ga0207668_10088214 | 3300025972 | Bacteria | 2271 |
| 339 | Ga0207668_10430377 | 3300025972 | Bacteria | 1122 |
| 340 | Ga0207658_10013160 | 3300025986 | Bacteria | 5648 |
| 341 | Ga0207658_10115383 | 3300025986 | Bacteria | 2131 |
| 342 | Ga0207658_10170731 | 3300025986 | Bacteria | 1791 |
| 343 | Ga0207658_10195522 | 3300025986 | Bacteria | 1684 |
| 344 | Ga0207677_10002618 | 3300026023 | Bacteria | 9471 |
| 345 | Ga0207677_10004569 | 3300026023 | Bacteria | 7442 |
| 346 | Ga0207677_10020443 | 3300026023 | Bacteria | 4020 |
| 347 | Ga0207677_10076085 | 3300026023 | Bacteria | 2388 |
| 348 | Ga0207677_10722906 | 3300026023 | Bacteria | 885 |
| 349 | Ga0207703_10001536 | 3300026035 | Bacteria | 20983 |
| 350 | Ga0207703_10005404 | 3300026035 | Bacteria | 10281 |
| 351 | Ga0207703_10013491 | 3300026035 | Bacteria | 6367 |
| 352 | Ga0207703_10032404 | 3300026035 | Bacteria | 4136 |
| 353 | Ga0207678_10049093 | 3300026067 | Bacteria | 3647 |
| 354 | Ga0207678_10511702 | 3300026067 | Bacteria | 1047 |
| 355 | Ga0207708_10179504 | 3300026075 | Bacteria | 1681 |
| 356 | Ga0207641_10005708 | 3300026088 | Bacteria | 10582 |
| 357 | Ga0207641_10014170 | 3300026088 | Bacteria | 6533 |
| 358 | Ga0207641_10081469 | 3300026088 | Bacteria | 2810 |
| 359 | Ga0207641_10123414 | 3300026088 | Bacteria | 2315 |
| 360 | Ga0207641_10188336 | 3300026088 | Bacteria | 1895 |
| 361 | Ga0207648_10004600 | 3300026089 | Bacteria | 14146 |
| 362 | Ga0207648_10070852 | 3300026089 | Bacteria | 3039 |
| 363 | Ga0207648_10076449 | 3300026089 | Bacteria | 2919 |
| 364 | Ga0207648_10083523 | 3300026089 | Bacteria | 2785 |
| 365 | Ga0207648_10433875 | 3300026089 | Bacteria | 1194 |
| 366 | Ga0207676_10003739 | 3300026095 | Bacteria | 10764 |
| 367 | Ga0207676_10013183 | 3300026095 | Bacteria | 5935 |
| 368 | Ga0207676_10054378 | 3300026095 | Bacteria | 3138 |
| 369 | Ga0207676_10066568 | 3300026095 | Bacteria | 2874 |
| 370 | Ga0207676_10137195 | 3300026095 | Bacteria | 2089 |
| 371 | Ga0207676_10193763 | 3300026095 | Bacteria | 1790 |
| 372 | Ga0207674_10619553 | 3300026116 | Bacteria | 1045 |
| 373 | Ga0207674_10716268 | 3300026116 | Bacteria | 966 |
| 374 | Ga0207675_100009740 | 3300026118 | Bacteria | 8996 |
| 375 | Ga0207675_100064275 | 3300026118 | Bacteria | 3430 |
| 376 | Ga0207675_100089018 | 3300026118 | Bacteria | 2900 |
| 377 | Ga0207683_10010102 | 3300026121 | Bacteria | 8054 |
| 378 | Ga0207683_10028082 | 3300026121 | Bacteria | 4865 |
| 379 | Ga0207683_10106102 | 3300026121 | Bacteria | 2512 |
| 380 | Ga0207683_10332109 | 3300026121 | Bacteria | 1394 |
| 381 | Ga0207698_10047683 | 3300026142 | Bacteria | 3248 |
| 382 | Ga0207698_10091925 | 3300026142 | Bacteria | 2486 |
| 383 | Ga0207698_10182845 | 3300026142 | Bacteria | 1859 |
| 384 | Ga0207428_10172893 | 3300027907 | Bacteria | 1635 |
| 385 | Ga0268266_10117253 | 3300028379 | Bacteria | 2366 |
| 386 | Ga0268266_10139206 | 3300028379 | Bacteria | 2177 |
| 387 | Ga0268265_10029377 | 3300028380 | Bacteria | 3945 |
| 388 | Ga0268265_10303745 | 3300028380 | Bacteria | 1438 |
| 389 | Ga0268265_10741846 | 3300028380 | Bacteria | 952 |
| 390 | Ga0268264_10003034 | 3300028381 | Bacteria | 14561 |
| 391 | Ga0268264_10172257 | 3300028381 | Bacteria | 1958 |
| 392 | Ga0268264_10407958 | 3300028381 | Bacteria | 1307 |
| 393 | Ga0268264_10808133 | 3300028381 | Bacteria | 937 |
| 394 | Ga0307515_10004779 | 3300028794 | Bacteria | 27729 |
| 395 | Ga0307515_10513193 | 3300028794 | Bacteria | 808 |
| 396 | Ga0316183_1161157 | 3300030742 | Bacteria | 956 |
| 397 | Ga0316181_1153232 | 3300030744 | Bacteria | 2179 |
| 398 | Ga0316182_1082680 | 3300030745 | Bacteria | 1178 |
| 399 | Ga0265327_10123113 | 3300031251 | Bacteria | 1227 |
| 400 | Ga0307513_10000707 | 3300031456 | Bacteria | 48005 |
| 401 | Ga0307513_10025971 | 3300031456 | Bacteria | 6765 |
| 402 | Ga0307513_10189785 | 3300031456 | Bacteria | 1908 |
| 403 | Ga0307513_10200978 | 3300031456 | Bacteria | 1833 |
| 404 | Ga0307509_10010192 | 3300031507 | Bacteria | 11560 |
| 405 | Ga0307408_100497346 | 3300031548 | Bacteria | 1067 |
| 406 | Ga0307408_100662217 | 3300031548 | Bacteria | 935 |
| 407 | Ga0316575_10000099 | 3300031665 | Bacteria | 21246 |
| 408 | Ga0307407_10325129 | 3300031903 | Bacteria | 1081 |
| 409 | Ga0307412_10192156 | 3300031911 | Bacteria | 1544 |
| 410 | Ga0307409_100000872 | 3300031995 | Bacteria | 13959 |
| 411 | Ga0307409_100633323 | 3300031995 | Bacteria | 1061 |
| 412 | Ga0307416_100307125 | 3300032002 | Bacteria | 1580 |
| 413 | Ga0307414_10011424 | 3300032004 | Bacteria | 5206 |
| 414 | Ga0307414_10532793 | 3300032004 | Bacteria | 1044 |
| 415 | Ga0307411_10091367 | 3300032005 | Bacteria | 2126 |
| 416 | Ga0307510_10021591 | 3300033180 | Bacteria | 7502 |
| 417 | Ga0373948_0007257 | 3300034817 | Bacteria | 1859 |
| 418 | Ga0373950_0011060 | 3300034818 | Bacteria | 1469 |
| 419 | Ga0373958_0041157 | 3300034819 | Bacteria | 945 |
| 420 | Ga0373926_0016947 | 3300035083 | Bacteria | 2496 |
| 421 | Ga0373932_0011613 | 3300035112 | Bacteria | 2155 |
| 422 | Ga0373939_0000174 | 3300035114 | Bacteria | 17742 |
| 423 | Ga0373939_0059719 | 3300035114 | Bacteria | 1210 |
| 424 | Ga0373955_0069436 | 3300035172 | Bacteria | 1966 |
| 425 | Ga0373961_0007035 | 3300035241 | Bacteria | 2710 |
| 426 | Ga0373961_0027035 | 3300035241 | Bacteria | 1572 |
| 427 | Ga0373962_0110627 | 3300035242 | Bacteria | 866 |
| 428 | Ga0373931_0003525 | 3300035691 | Bacteria | 7052 |
| 429 | Ga0373931_0117065 | 3300035691 | Bacteria | 1519 |
| 430 | Ga0373935_0108700 | 3300035692 | Bacteria | 1838 |
| 431 | Ga0373927_0087411 | 3300035695 | Bacteria | 2023 |
| 432 | Ga0373927_0111396 | 3300035695 | Bacteria | 1784 |
| 433 | Ga0373947_0129532 | 3300035725 | Bacteria | 1609 |
| 434 | Ga0373947_0433950 | 3300035725 | Bacteria | 889 |
| 435 | Ga0373937_0259021 | 3300036401 | Bacteria | 1640 |
| 436 | Ga0373937_0565499 | 3300036401 | Bacteria | 1080 |
| 437 | Ga0373925_0034504 | 3300037068 | Bacteria | 3729 |
| 438 | Ga0395899_0000090 | 3300037312 | Bacteria | 156587 |
| 439 | Ga0395899_0010914 | 3300037312 | Bacteria | 6961 |
| 440 | Ga0395900_0125433 | 3300037418 | Bacteria | 2633 |
| 441 | Ga0395898_0005039 | 3300037466 | Bacteria | 14322 |
| 442 | Ga0395901_0000740 | 3300038443 | Bacteria | 36904 |
| 443 | Ga0395901_0087176 | 3300038443 | Bacteria | 3264 |
| 444 | Ga0395901_0226966 | 3300038443 | Bacteria | 1950 |
| 445 | Ga0237819_00873 | 3300038705 | Bacteria | 9454 |
| 446 | Ga0436365_0200616 | 3300039437 | Bacteria | 1236 |
| 447 | Ga0436361_0969963 | 3300039447 | Bacteria | 6779 |
| 448 | Ga0436363_0256062 | 3300039450 | Bacteria | 6946 |
| 449 | Ga0439436_0011766 | 3300041404 | Bacteria | 2656 |
| 450 | Ga0439436_0078628 | 3300041404 | Bacteria | 918 |
| 451 | Ga0439465_0001288 | 3300041413 | Bacteria | 8059 |
| 452 | Ga0451787_284586 | 3300041441 | Bacteria | 1204 |
| 453 | Ga0451791_1038472 | 3300041451 | Bacteria | 1178 |
| 454 | Ga0451797_0360845 | 3300041453 | Bacteria | 1540 |
| 455 | Ga0451807_0061609 | 3300041486 | Bacteria | 1269 |
| 456 | Ga0451807_2454286 | 3300041486 | Bacteria | 1896 |
| 457 | Ga0451841_0167828 | 3300041498 | Bacteria | 936 |
| 458 | Ga0451843_0985837 | 3300041509 | Bacteria | 2691 |
| 459 | Ga0451853_0609165 | 3300041512 | Bacteria | 1244 |
| 460 | Ga0451853_2146327 | 3300041512 | Bacteria | 3779 |
| 461 | Ga0439431_0001243 | 3300041997 | Bacteria | 5589 |
| 462 | Ga0439441_016189 | 3300042001 | Bacteria | 1328 |
| 463 | Ga0439445_0000292 | 3300042004 | Bacteria | 9726 |
| 464 | Ga0439449_0000005 | 3300042007 | Bacteria | 81904 |
| 465 | Ga0439449_0041100 | 3300042007 | Bacteria | 1719 |
| 466 | Ga0439457_049811 | 3300042014 | Bacteria | 940 |
| 467 | Ga0450898_034293 | 3300042134 | Bacteria | 942 |
| 468 | Ga0439435_0028777 | 3300042436 | Bacteria | 1496 |
| 469 | Ga0451577_0040698 | 3300042876 | Bacteria | 4172 |
| 470 | Ga0451577_0421078 | 3300042876 | Bacteria | 1213 |
| 471 | Ga0453683_0444027 | 3300044673 | Bacteria | 839 |
| 472 | Ga0453684_0000531 | 3300044712 | Bacteria | 145390 |
| 473 | Ga0451576_0000212 | 3300045051 | Bacteria | 145396 |
| 474 | Ga0451576_0111912 | 3300045051 | Bacteria | 2841 |
| 475 | Ga0495603_0315144 | 3300046455 | Bacteria | 898 |
| 476 | Ga0495629_0053545 | 3300046459 | Bacteria | 2823 |
| 477 | Ga0495629_0259075 | 3300046459 | Bacteria | 1196 |
| 478 | Ga0495629_0437894 | 3300046459 | Bacteria | 886 |
| 479 | Ga0495638_0072886 | 3300046460 | Bacteria | 2097 |
| 480 | Ga0495580_0189394 | 3300046472 | Bacteria | 1419 |
| 481 | Ga0495580_0359807 | 3300046472 | Bacteria | 985 |
| 482 | Ga0495632_0014399 | 3300046519 | Bacteria | 4477 |
| 483 | Ga0495663_0001626 | 3300046525 | Bacteria | 7027 |
| 484 | Ga0495663_0003320 | 3300046525 | Bacteria | 4659 |
| 485 | Ga0495621_0070545 | 3300046539 | Bacteria | 1286 |
| 486 | Ga0495645_0012490 | 3300046543 | Bacteria | 5985 |
| 487 | Ga0495633_0033342 | 3300046558 | Bacteria | 2483 |
| 488 | Ga0495656_0316579 | 3300046615 | Bacteria | 803 |
| 489 | Ga0495625_0087135 | 3300046660 | Bacteria | 2165 |
| 490 | Ga0495647_0032837 | 3300046681 | Bacteria | 1937 |
| 491 | Ga0495658_0045458 | 3300046683 | Bacteria | 2464 |
| 492 | Ga0495658_0060654 | 3300046683 | Bacteria | 2170 |
| 493 | Ga0495589_0048195 | 3300046794 | Bacteria | 2110 |
| 494 | Ga0495684_0185236 | 3300047471 | Bacteria | 1542 |
| 495 | Ga0496102_0029387 | 3300048905 | Bacteria | 4919 |
| 496 | Ga0496103_0097648 | 3300048906 | Bacteria | 1857 |
| 497 | Ga0496104_0139316 | 3300048907 | Bacteria | 2331 |
| 498 | Ga0496104_0173930 | 3300048907 | Bacteria | 2064 |
| 499 | Ga0496104_0756090 | 3300048907 | Bacteria | 879 |
| 500 | Ga0496105_0111387 | 3300048908 | Bacteria | 2259 |
| 501 | Ga0496107_0063594 | 3300048910 | Bacteria | 2674 |
| 502 | Ga0496108_0030794 | 3300048911 | Bacteria | 4446 |
| 503 | Ga0496108_0059244 | 3300048911 | Bacteria | 3220 |
| 504 | Ga0496110_0005350 | 3300048913 | Bacteria | 10055 |
| 505 | Ga0496112_0530209 | 3300048915 | Bacteria | 1112 |
| 506 | Ga0496114_0040983 | 3300048917 | Bacteria | 3837 |
| 507 | Ga0496114_0213700 | 3300048917 | Bacteria | 1692 |
| 508 | Ga0496114_0412936 | 3300048917 | Bacteria | 1195 |
| 509 | Ga0496121_0021456 | 3300048924 | Bacteria | 6323 |
| 510 | Ga0496125_0031184 | 3300048928 | Bacteria | 4755 |
| 511 | Ga0501039_0374820 | 3300049575 | Bacteria | 1118 |
| 512 | Ga0501069_0142328 | 3300049585 | Bacteria | 1376 |
| 513 | Ga0501070_0349165 | 3300049586 | Bacteria | 1201 |
| 514 | Ga0501076_0017815 | 3300049592 | Bacteria | 5401 |
| 515 | Ga0501216_052921 | 3300049660 | Bacteria | 802 |
| 516 | Ga0501225_0002113 | 3300049705 | Bacteria | 6161 |
| 517 | Ga0501079_0069206 | 3300049741 | Bacteria | 2724 |
| 518 | Ga0501081_0314849 | 3300049743 | Bacteria | 1149 |
| 519 | Ga0501081_0387534 | 3300049743 | Bacteria | 1033 |
| 520 | Ga0501044_0250213 | 3300049823 | Bacteria | 1713 |
| 521 | nmdc:mga00v17_32021_c1 | 3300050491 | Bacteria | 3106 |
| 522 | nmdc:mga00v17_52875_c1 | 3300050491 | Bacteria | 2474 |
| 523 | nmdc:mga06z11_48346_c1 | 3300050494 | Bacteria | 2164 |
| 524 | nmdc:mga05p37_1300_c1 | 3300050507 | Bacteria | 29031 |
| 525 | nmdc:mga09592_2307_c1 | 3300050508 | Bacteria | 15395 |
| 526 | nmdc:mga06r32_2584_c1 | 3300050510 | Bacteria | 11554 |
| 527 | nmdc:mga08y16_447218_c1 | 3300050511 | Bacteria | 1318 |
| 528 | nmdc:mga08x19_418229_c1 | 3300050514 | Bacteria | 941 |
| 529 | nmdc:mga08x19_42890_c1 | 3300050514 | Bacteria | 2885 |
| 530 | nmdc:mga08x19_85606_c1 | 3300050514 | Bacteria | 2074 |
| 531 | nmdc:mga0a205_178378_c1 | 3300050515 | Bacteria | 2019 |
| 532 | Ga0500643_042205 | 3300053087 | Bacteria | 1336 |
| 533 | Ga0500593_064041 | 3300053117 | Bacteria | 1610 |
| 534 | Ga0500634_0000337 | 3300053161 | Bacteria | 14953 |
| 535 | Ga0501084_0004450 | 3300054114 | Bacteria | 11443 |
| 536 | Ga0590075_008069 | 3300059424 | Bacteria | 2507 |
| 537 | Ga0501082_0433436 | 3300060353 | Bacteria | 1148 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053117 | Ga0500593_064041 | Ga0500593_064041_962_1585 | 179 |
| 2 | 3300044673 | Ga0453683_0444027 | Ga0453683_0444027_38_709 | 193 |
| 3 | 3300005289 | Ga0065704_10047520 | Ga0065704_100475201 | 202 |
| 4 | 3300005458 | Ga0070681_10149583 | Ga0070681_101495832 | 202 |
| 5 | 3300005545 | Ga0070695_100624890 | Ga0070695_1006248901 | 202 |
| 6 | 3300005546 | Ga0070696_100539831 | Ga0070696_1005398311 | 202 |
| 7 | 3300005549 | Ga0070704_100002902 | Ga0070704_1000029028 | 202 |
| 8 | 3300005549 | Ga0070704_100806819 | Ga0070704_1008068191 | 202 |
| 9 | 3300006175 | Ga0070712_100351661 | Ga0070712_1003516611 | 202 |
| 10 | 3300006844 | Ga0075428_100283973 | Ga0075428_1002839732 | 202 |
| 11 | 3300006847 | Ga0075431_100001511 | Ga0075431_1000015119 | 202 |
| 12 | 3300006880 | Ga0075429_100000694 | Ga0075429_10000069415 | 202 |
| 13 | 3300006914 | Ga0075436_100624260 | Ga0075436_1006242602 | 202 |
| 14 | 3300009147 | Ga0114129_10055562 | Ga0114129_100555623 | 202 |
| 15 | 3300009148 | Ga0105243_10420353 | Ga0105243_104203532 | 202 |
| 16 | 3300014745 | Ga0157377_10200008 | Ga0157377_102000082 | 202 |
| 17 | 3300025912 | Ga0207707_10219644 | Ga0207707_102196442 | 202 |
| 18 | 3300025915 | Ga0207693_10271246 | Ga0207693_102712461 | 202 |
| 19 | 3300035241 | Ga0373961_0027035 | Ga0373961_0027035_153_770 | 202 |
| 20 | 3300042001 | Ga0439441_016189 | Ga0439441_016189_584_1201 | 202 |
| 21 | 3300050507 | nmdc:mga05p37_1300_c1 | nmdc:mga05p37_1300_c1_1856_2473 | 202 |
| 22 | 3300050508 | nmdc:mga09592_2307_c1 | nmdc:mga09592_2307_c1_14637_15254 | 202 |
| 23 | 3300050510 | nmdc:mga06r32_2584_c1 | nmdc:mga06r32_2584_c1_6264_6881 | 202 |
| 24 | 3300050514 | nmdc:mga08x19_42890_c1 | nmdc:mga08x19_42890_c1_507_1124 | 202 |
| 25 | 3300005295 | Ga0065707_10295144 | Ga0065707_102951441 | 203 |
| 26 | 3300005331 | Ga0070670_100488998 | Ga0070670_1004889981 | 203 |
| 27 | 3300005336 | Ga0070680_100343151 | Ga0070680_1003431512 | 203 |
| 28 | 3300005354 | Ga0070675_100179406 | Ga0070675_1001794062 | 203 |
| 29 | 3300005444 | Ga0070694_100144678 | Ga0070694_1001446782 | 203 |
| 30 | 3300005458 | Ga0070681_10001886 | Ga0070681_1000188612 | 203 |
| 31 | 3300005467 | Ga0070706_100033891 | Ga0070706_1000338912 | 203 |
| 32 | 3300005468 | Ga0070707_100019507 | Ga0070707_1000195077 | 203 |
| 33 | 3300005530 | Ga0070679_100495651 | Ga0070679_1004956512 | 203 |
| 34 | 3300005536 | Ga0070697_100228964 | Ga0070697_1002289642 | 203 |
| 35 | 3300005545 | Ga0070695_100068522 | Ga0070695_1000685223 | 203 |
| 36 | 3300014745 | Ga0157377_10150351 | Ga0157377_101503512 | 203 |
| 37 | 3300025901 | Ga0207688_10010106 | Ga0207688_100101065 | 203 |
| 38 | 3300025907 | Ga0207645_10448489 | Ga0207645_104484891 | 203 |
| 39 | 3300025910 | Ga0207684_10203810 | Ga0207684_102038102 | 203 |
| 40 | 3300025912 | Ga0207707_10003369 | Ga0207707_100033697 | 203 |
| 41 | 3300025917 | Ga0207660_10565686 | Ga0207660_105656862 | 203 |
| 42 | 3300025922 | Ga0207646_10093779 | Ga0207646_100937793 | 203 |
| 43 | 3300025923 | Ga0207681_11116183 | Ga0207681_111161831 | 203 |
| 44 | 3300025925 | Ga0207650_10499609 | Ga0207650_104996092 | 203 |
| 45 | 3300025926 | Ga0207659_10155734 | Ga0207659_101557342 | 203 |
| 46 | 3300025931 | Ga0207644_10227664 | Ga0207644_102276642 | 203 |
| 47 | 3300025935 | Ga0207709_10195580 | Ga0207709_101955802 | 203 |
| 48 | 3300028381 | Ga0268264_10808133 | Ga0268264_108081332 | 203 |
| 49 | 3300046472 | Ga0495580_0359807 | Ga0495580_0359807_203_823 | 203 |
| 50 | 3300046683 | Ga0495658_0060654 | Ga0495658_0060654_723_1343 | 203 |
| 51 | 3300048911 | Ga0496108_0059244 | Ga0496108_0059244_16_657 | 203 |
| 52 | 3300048917 | Ga0496114_0213700 | Ga0496114_0213700_1025_1666 | 203 |
| 53 | 3300050511 | nmdc:mga08y16_447218_c1 | nmdc:mga08y16_447218_c1_163_783 | 203 |
| 54 | 3300049743 | Ga0501081_0314849 | Ga0501081_0314849_483_1109 | 204 |
| 55 | 3300005327 | Ga0070658_10076359 | Ga0070658_100763591 | 206 |
| 56 | 3300005329 | Ga0070683_100082137 | Ga0070683_1000821376 | 206 |
| 57 | 3300005344 | Ga0070661_100134064 | Ga0070661_1001340644 | 206 |
| 58 | 3300005535 | Ga0070684_100029200 | Ga0070684_1000292003 | 206 |
| 59 | 3300005547 | Ga0070693_100035977 | Ga0070693_1000359775 | 206 |
| 60 | 3300005564 | Ga0070664_100016797 | Ga0070664_1000167976 | 206 |
| 61 | 3300009174 | Ga0105241_10140689 | Ga0105241_101406895 | 206 |
| 62 | 3300013105 | Ga0157369_10085752 | Ga0157369_100857522 | 206 |
| 63 | 3300025920 | Ga0207649_10008468 | Ga0207649_100084684 | 206 |
| 64 | 3300025945 | Ga0207679_10047373 | Ga0207679_100473733 | 206 |
| 65 | 3300050514 | nmdc:mga08x19_418229_c1 | nmdc:mga08x19_418229_c1_209_931 | 206 |
| 66 | 3300034817 | Ga0373948_0007257 | Ga0373948_0007257_1027_1731 | 207 |
| 67 | 3300034819 | Ga0373958_0041157 | Ga0373958_0041157_12_704 | 207 |
| 68 | 3300035112 | Ga0373932_0011613 | Ga0373932_0011613_942_1646 | 207 |
| 69 | 3300035114 | Ga0373939_0000174 | Ga0373939_0000174_15359_16063 | 207 |
| 70 | 3300035241 | Ga0373961_0007035 | Ga0373961_0007035_105_809 | 207 |
| 71 | 3300035691 | Ga0373931_0003525 | Ga0373931_0003525_6087_6791 | 207 |
| 72 | 3300037418 | Ga0395900_0125433 | Ga0395900_0125433_866_1558 | 207 |
| 73 | 3300038443 | Ga0395901_0087176 | Ga0395901_0087176_442_1134 | 207 |
| 74 | 3300005343 | Ga0070687_100061789 | Ga0070687_1000617894 | 208 |
| 75 | 3300005367 | Ga0070667_100022986 | Ga0070667_1000229863 | 208 |
| 76 | 3300005548 | Ga0070665_100565371 | Ga0070665_1005653712 | 208 |
| 77 | 3300005843 | Ga0068860_100004324 | Ga0068860_10000432411 | 208 |
| 78 | 3300009098 | Ga0105245_10075325 | Ga0105245_100753253 | 208 |
| 79 | 3300025918 | Ga0207662_10024890 | Ga0207662_100248908 | 208 |
| 80 | 3300025986 | Ga0207658_10170731 | Ga0207658_101707312 | 208 |
| 81 | 3300028381 | Ga0268264_10172257 | Ga0268264_101722572 | 208 |
| 82 | 3300035242 | Ga0373962_0110627 | Ga0373962_0110627_19_723 | 208 |
| 83 | 3300035691 | Ga0373931_0117065 | Ga0373931_0117065_609_1301 | 208 |
| 84 | 3300039450 | Ga0436363_0256062 | Ga0436363_0256062_1637_2365 | 208 |
| 85 | 3300045051 | Ga0451576_0111912 | Ga0451576_0111912_644_1336 | 208 |
| 86 | 3300005329 | Ga0070683_100048721 | Ga0070683_1000487215 | 209 |
| 87 | 3300005334 | Ga0068869_100002292 | Ga0068869_1000022926 | 209 |
| 88 | 3300005339 | Ga0070660_100021608 | Ga0070660_1000216082 | 209 |
| 89 | 3300005347 | Ga0070668_100094447 | Ga0070668_1000944472 | 209 |
| 90 | 3300005353 | Ga0070669_100016134 | Ga0070669_1000161342 | 209 |
| 91 | 3300005354 | Ga0070675_100006591 | Ga0070675_1000065912 | 209 |
| 92 | 3300005535 | Ga0070684_100345758 | Ga0070684_1003457582 | 209 |
| 93 | 3300005563 | Ga0068855_100015267 | Ga0068855_1000152672 | 209 |
| 94 | 3300005615 | Ga0070702_100038015 | Ga0070702_1000380152 | 209 |
| 95 | 3300005719 | Ga0068861_100003994 | Ga0068861_1000039949 | 209 |
| 96 | 3300005841 | Ga0068863_100083099 | Ga0068863_1000830993 | 209 |
| 97 | 3300005842 | Ga0068858_100031334 | Ga0068858_1000313346 | 209 |
| 98 | 3300005844 | Ga0068862_100041938 | Ga0068862_1000419383 | 209 |
| 99 | 3300006358 | Ga0068871_100053498 | Ga0068871_1000534983 | 209 |
| 100 | 3300009098 | Ga0105245_10009589 | Ga0105245_100095896 | 209 |
| 101 | 3300009177 | Ga0105248_10017648 | Ga0105248_100176484 | 209 |
| 102 | 3300009551 | Ga0105238_10007971 | Ga0105238_100079718 | 209 |
| 103 | 3300009553 | Ga0105249_10103550 | Ga0105249_101035505 | 209 |
| 104 | 3300013102 | Ga0157371_10029770 | Ga0157371_100297706 | 209 |
| 105 | 3300013296 | Ga0157374_10017149 | Ga0157374_100171496 | 209 |
| 106 | 3300013306 | Ga0163162_10022652 | Ga0163162_100226524 | 209 |
| 107 | 3300014745 | Ga0157377_10001606 | Ga0157377_100016066 | 209 |
| 108 | 3300014968 | Ga0157379_10020276 | Ga0157379_100202766 | 209 |
| 109 | 3300014969 | Ga0157376_10012963 | Ga0157376_100129634 | 209 |
| 110 | 3300025893 | Ga0207682_10095022 | Ga0207682_100950222 | 209 |
| 111 | 3300025901 | Ga0207688_10009583 | Ga0207688_100095832 | 209 |
| 112 | 3300025909 | Ga0207705_10128688 | Ga0207705_101286883 | 209 |
| 113 | 3300025919 | Ga0207657_10023139 | Ga0207657_100231396 | 209 |
| 114 | 3300025941 | Ga0207711_10012797 | Ga0207711_100127973 | 209 |
| 115 | 3300025942 | Ga0207689_10008191 | Ga0207689_100081916 | 209 |
| 116 | 3300025949 | Ga0207667_10012766 | Ga0207667_100127669 | 209 |
| 117 | 3300025961 | Ga0207712_10155283 | Ga0207712_101552832 | 209 |
| 118 | 3300026023 | Ga0207677_10002618 | Ga0207677_100026184 | 209 |
| 119 | 3300026035 | Ga0207703_10032404 | Ga0207703_100324044 | 209 |
| 120 | 3300026067 | Ga0207678_10049093 | Ga0207678_100490936 | 209 |
| 121 | 3300026088 | Ga0207641_10081469 | Ga0207641_100814692 | 209 |
| 122 | 3300026095 | Ga0207676_10013183 | Ga0207676_100131832 | 209 |
| 123 | 3300026116 | Ga0207674_10716268 | Ga0207674_107162682 | 209 |
| 124 | 3300026118 | Ga0207675_100009740 | Ga0207675_1000097406 | 209 |
| 125 | 3300028380 | Ga0268265_10029377 | Ga0268265_100293773 | 209 |
| 126 | 3300034818 | Ga0373950_0011060 | Ga0373950_0011060_512_1204 | 209 |
| 127 | 3300035114 | Ga0373939_0059719 | Ga0373939_0059719_465_1157 | 209 |
| 128 | 3300048905 | Ga0496102_0029387 | Ga0496102_0029387_4175_4867 | 209 |
| 129 | 3300048906 | Ga0496103_0097648 | Ga0496103_0097648_576_1268 | 209 |
| 130 | 3300048907 | Ga0496104_0173930 | Ga0496104_0173930_473_1165 | 209 |
| 131 | 3300048908 | Ga0496105_0111387 | Ga0496105_0111387_609_1301 | 209 |
| 132 | 3300048910 | Ga0496107_0063594 | Ga0496107_0063594_1612_2304 | 209 |
| 133 | 3300048911 | Ga0496108_0030794 | Ga0496108_0030794_877_1569 | 209 |
| 134 | 3300048913 | Ga0496110_0005350 | Ga0496110_0005350_3676_4368 | 209 |
| 135 | 3300005616 | Ga0068852_100221735 | Ga0068852_1002217353 | 211 |
| 136 | 3300037312 | Ga0395899_0010914 | Ga0395899_0010914_1994_2692 | 211 |
| 137 | 3300037466 | Ga0395898_0005039 | Ga0395898_0005039_8776_9474 | 211 |
| 138 | 3300038443 | Ga0395901_0226966 | Ga0395901_0226966_501_1199 | 211 |
| 139 | 3300005338 | Ga0068868_100028768 | Ga0068868_1000287682 | 212 |
| 140 | 3300006237 | Ga0097621_100244702 | Ga0097621_1002447022 | 212 |
| 141 | 3300006358 | Ga0068871_100061637 | Ga0068871_1000616372 | 212 |
| 142 | 3300009176 | Ga0105242_10322652 | Ga0105242_103226522 | 212 |
| 143 | 3300025934 | Ga0207686_10213308 | Ga0207686_102133082 | 212 |
| 144 | 3300026023 | Ga0207677_10004569 | Ga0207677_100045696 | 212 |
| 145 | 3300026089 | Ga0207648_10076449 | Ga0207648_100764492 | 212 |
| 146 | 3300005334 | Ga0068869_100057427 | Ga0068869_1000574272 | 213 |
| 147 | 3300005343 | Ga0070687_100023721 | Ga0070687_1000237212 | 213 |
| 148 | 3300005347 | Ga0070668_100012013 | Ga0070668_1000120132 | 213 |
| 149 | 3300005353 | Ga0070669_100008268 | Ga0070669_1000082686 | 213 |
| 150 | 3300005356 | Ga0070674_100023274 | Ga0070674_1000232742 | 213 |
| 151 | 3300005364 | Ga0070673_100124939 | Ga0070673_1001249392 | 213 |
| 152 | 3300005367 | Ga0070667_100049799 | Ga0070667_1000497996 | 213 |
| 153 | 3300005438 | Ga0070701_10075820 | Ga0070701_100758202 | 213 |
| 154 | 3300005455 | Ga0070663_100081916 | Ga0070663_1000819163 | 213 |
| 155 | 3300005459 | Ga0068867_100003015 | Ga0068867_1000030157 | 213 |
| 156 | 3300005539 | Ga0068853_100380235 | Ga0068853_1003802352 | 213 |
| 157 | 3300005617 | Ga0068859_100060700 | Ga0068859_1000607004 | 213 |
| 158 | 3300005718 | Ga0068866_10003719 | Ga0068866_100037193 | 213 |
| 159 | 3300005719 | Ga0068861_100037899 | Ga0068861_1000378995 | 213 |
| 160 | 3300005842 | Ga0068858_100023326 | Ga0068858_1000233264 | 213 |
| 161 | 3300005843 | Ga0068860_100061504 | Ga0068860_1000615043 | 213 |
| 162 | 3300006881 | Ga0068865_100015272 | Ga0068865_1000152723 | 213 |
| 163 | 3300006931 | Ga0097620_100060699 | Ga0097620_1000606994 | 213 |
| 164 | 3300009148 | Ga0105243_10081213 | Ga0105243_100812133 | 213 |
| 165 | 3300009553 | Ga0105249_10005385 | Ga0105249_100053855 | 213 |
| 166 | 3300013306 | Ga0163162_10011758 | Ga0163162_100117587 | 213 |
| 167 | 3300014968 | Ga0157379_10009660 | Ga0157379_100096607 | 213 |
| 168 | 3300014969 | Ga0157376_10345671 | Ga0157376_103456712 | 213 |
| 169 | 3300021361 | Ga0213872_10020448 | Ga0213872_100204484 | 213 |
| 170 | 3300025901 | Ga0207688_10121996 | Ga0207688_101219962 | 213 |
| 171 | 3300025903 | Ga0207680_10027205 | Ga0207680_100272054 | 213 |
| 172 | 3300025907 | Ga0207645_10037373 | Ga0207645_100373735 | 213 |
| 173 | 3300025918 | Ga0207662_10060053 | Ga0207662_100600532 | 213 |
| 174 | 3300025923 | Ga0207681_10003019 | Ga0207681_100030194 | 213 |
| 175 | 3300025932 | Ga0207690_10507110 | Ga0207690_105071101 | 213 |
| 176 | 3300025933 | Ga0207706_10018813 | Ga0207706_100188134 | 213 |
| 177 | 3300025938 | Ga0207704_10040144 | Ga0207704_100401443 | 213 |
| 178 | 3300025941 | Ga0207711_10038649 | Ga0207711_100386494 | 213 |
| 179 | 3300025960 | Ga0207651_10445281 | Ga0207651_104452812 | 213 |
| 180 | 3300025961 | Ga0207712_10046387 | Ga0207712_100463871 | 213 |
| 181 | 3300025986 | Ga0207658_10013160 | Ga0207658_100131606 | 213 |
| 182 | 3300026035 | Ga0207703_10005404 | Ga0207703_100054047 | 213 |
| 183 | 3300026088 | Ga0207641_10005708 | Ga0207641_100057082 | 213 |
| 184 | 3300026089 | Ga0207648_10070852 | Ga0207648_100708522 | 213 |
| 185 | 3300026118 | Ga0207675_100064275 | Ga0207675_1000642752 | 213 |
| 186 | 3300028380 | Ga0268265_10303745 | Ga0268265_103037452 | 213 |
| 187 | 3300028381 | Ga0268264_10003034 | Ga0268264_1000303410 | 213 |
| 188 | 3300039447 | Ga0436361_0969963 | Ga0436361_0969963_5352_6047 | 213 |
| 189 | 3300042436 | Ga0439435_0028777 | Ga0439435_0028777_322_1014 | 214 |
| 190 | 3300005339 | Ga0070660_100082046 | Ga0070660_1000820463 | 215 |
| 191 | 3300005564 | Ga0070664_100008503 | Ga0070664_1000085038 | 215 |
| 192 | iso_pu_bacteria | 2643221609 | 2644061357 | 216 |
| 193 | iso_pu_bacteria | 2643221611 | 2644076598 | 216 |
| 194 | 3300005347 | Ga0070668_100434819 | Ga0070668_1004348191 | 219 |
| 195 | 3300005546 | Ga0070696_100044619 | Ga0070696_1000446192 | 219 |
| 196 | 3300006914 | Ga0075436_100101677 | Ga0075436_1001016772 | 219 |
| 197 | 3300009094 | Ga0111539_10605415 | Ga0111539_106054152 | 219 |
| 198 | 3300030742 | Ga0316183_1161157 | Ga0316183_11611572 | 219 |
| 199 | 3300031548 | Ga0307408_100662217 | Ga0307408_1006622171 | 219 |
| 200 | 3300031903 | Ga0307407_10325129 | Ga0307407_103251291 | 219 |
| 201 | 3300035083 | Ga0373926_0016947 | Ga0373926_0016947_1733_2425 | 219 |
| 202 | 3300035692 | Ga0373935_0108700 | Ga0373935_0108700_29_721 | 219 |
| 203 | 3300035695 | Ga0373927_0087411 | Ga0373927_0087411_689_1381 | 219 |
| 204 | 3300035725 | Ga0373947_0129532 | Ga0373947_0129532_867_1559 | 219 |
| 205 | 3300037068 | Ga0373925_0034504 | Ga0373925_0034504_1459_2151 | 219 |
| 206 | 3300050514 | nmdc:mga08x19_85606_c1 | nmdc:mga08x19_85606_c1_589_1317 | 219 |
| 207 | 3300050515 | nmdc:mga0a205_178378_c1 | nmdc:mga0a205_178378_c1_1303_1995 | 219 |
| 208 | 3300005293 | Ga0065715_10144662 | Ga0065715_101446621 | 220 |
| 209 | 3300005327 | Ga0070658_10132516 | Ga0070658_101325163 | 220 |
| 210 | 3300005327 | Ga0070658_10144630 | Ga0070658_101446302 | 220 |
| 211 | 3300005328 | Ga0070676_10185903 | Ga0070676_101859031 | 220 |
| 212 | 3300005328 | Ga0070676_10338872 | Ga0070676_103388722 | 220 |
| 213 | 3300005331 | Ga0070670_100004050 | Ga0070670_1000040504 | 220 |
| 214 | 3300005331 | Ga0070670_100025326 | Ga0070670_10002532610 | 220 |
| 215 | 3300005331 | Ga0070670_100194202 | Ga0070670_1001942022 | 220 |
| 216 | 3300005331 | Ga0070670_100214101 | Ga0070670_1002141012 | 220 |
| 217 | 3300005333 | Ga0070677_10050908 | Ga0070677_100509082 | 220 |
| 218 | 3300005333 | Ga0070677_10088667 | Ga0070677_100886673 | 220 |
| 219 | 3300005334 | Ga0068869_100047188 | Ga0068869_1000471883 | 220 |
| 220 | 3300005335 | Ga0070666_10021839 | Ga0070666_100218393 | 220 |
| 221 | 3300005338 | Ga0068868_100004360 | Ga0068868_1000043604 | 220 |
| 222 | 3300005338 | Ga0068868_100096926 | Ga0068868_1000969261 | 220 |
| 223 | 3300005340 | Ga0070689_100233147 | Ga0070689_1002331472 | 220 |
| 224 | 3300005340 | Ga0070689_100321859 | Ga0070689_1003218593 | 220 |
| 225 | 3300005347 | Ga0070668_100490661 | Ga0070668_1004906611 | 220 |
| 226 | 3300005353 | Ga0070669_100356473 | Ga0070669_1003564732 | 220 |
| 227 | 3300005353 | Ga0070669_100518619 | Ga0070669_1005186192 | 220 |
| 228 | 3300005354 | Ga0070675_100000837 | Ga0070675_10000083718 | 220 |
| 229 | 3300005354 | Ga0070675_100058732 | Ga0070675_1000587322 | 220 |
| 230 | 3300005354 | Ga0070675_100073780 | Ga0070675_1000737803 | 220 |
| 231 | 3300005354 | Ga0070675_100095013 | Ga0070675_1000950132 | 220 |
| 232 | 3300005354 | Ga0070675_100858615 | Ga0070675_1008586151 | 220 |
| 233 | 3300005355 | Ga0070671_100015493 | Ga0070671_1000154938 | 220 |
| 234 | 3300005355 | Ga0070671_100055182 | Ga0070671_1000551823 | 220 |
| 235 | 3300005355 | Ga0070671_100396326 | Ga0070671_1003963262 | 220 |
| 236 | 3300005355 | Ga0070671_100401519 | Ga0070671_1004015192 | 220 |
| 237 | 3300005356 | Ga0070674_100078528 | Ga0070674_1000785282 | 220 |
| 238 | 3300005356 | Ga0070674_100148694 | Ga0070674_1001486942 | 220 |
| 239 | 3300005356 | Ga0070674_100364809 | Ga0070674_1003648091 | 220 |
| 240 | 3300005356 | Ga0070674_100666645 | Ga0070674_1006666451 | 220 |
| 241 | 3300005364 | Ga0070673_100006166 | Ga0070673_1000061663 | 220 |
| 242 | 3300005364 | Ga0070673_100107740 | Ga0070673_1001077403 | 220 |
| 243 | 3300005365 | Ga0070688_100028965 | Ga0070688_1000289652 | 220 |
| 244 | 3300005365 | Ga0070688_100168778 | Ga0070688_1001687782 | 220 |
| 245 | 3300005367 | Ga0070667_100092033 | Ga0070667_1000920334 | 220 |
| 246 | 3300005367 | Ga0070667_100122418 | Ga0070667_1001224183 | 220 |
| 247 | 3300005439 | Ga0070711_100350460 | Ga0070711_1003504601 | 220 |
| 248 | 3300005441 | Ga0070700_100486376 | Ga0070700_1004863761 | 220 |
| 249 | 3300005456 | Ga0070678_100016836 | Ga0070678_1000168365 | 220 |
| 250 | 3300005456 | Ga0070678_100092981 | Ga0070678_1000929813 | 220 |
| 251 | 3300005456 | Ga0070678_100103082 | Ga0070678_1001030822 | 220 |
| 252 | 3300005456 | Ga0070678_100106305 | Ga0070678_1001063052 | 220 |
| 253 | 3300005456 | Ga0070678_100401767 | Ga0070678_1004017672 | 220 |
| 254 | 3300005457 | Ga0070662_100055315 | Ga0070662_1000553151 | 220 |
| 255 | 3300005457 | Ga0070662_100970216 | Ga0070662_1009702161 | 220 |
| 256 | 3300005459 | Ga0068867_100015341 | Ga0068867_1000153414 | 220 |
| 257 | 3300005459 | Ga0068867_100223481 | Ga0068867_1002234814 | 220 |
| 258 | 3300005459 | Ga0068867_100468363 | Ga0068867_1004683632 | 220 |
| 259 | 3300005466 | Ga0070685_10228878 | Ga0070685_102288781 | 220 |
| 260 | 3300005543 | Ga0070672_100015809 | Ga0070672_1000158094 | 220 |
| 261 | 3300005543 | Ga0070672_100017240 | Ga0070672_1000172402 | 220 |
| 262 | 3300005543 | Ga0070672_100050834 | Ga0070672_1000508344 | 220 |
| 263 | 3300005543 | Ga0070672_100105205 | Ga0070672_1001052053 | 220 |
| 264 | 3300005543 | Ga0070672_100133513 | Ga0070672_1001335132 | 220 |
| 265 | 3300005543 | Ga0070672_100162882 | Ga0070672_1001628821 | 220 |
| 266 | 3300005543 | Ga0070672_100519421 | Ga0070672_1005194212 | 220 |
| 267 | 3300005544 | Ga0070686_100021820 | Ga0070686_1000218204 | 220 |
| 268 | 3300005564 | Ga0070664_100084357 | Ga0070664_1000843575 | 220 |
| 269 | 3300005564 | Ga0070664_100151213 | Ga0070664_1001512134 | 220 |
| 270 | 3300005564 | Ga0070664_100359954 | Ga0070664_1003599541 | 220 |
| 271 | 3300005564 | Ga0070664_100495309 | Ga0070664_1004953092 | 220 |
| 272 | 3300005616 | Ga0068852_100081356 | Ga0068852_1000813563 | 220 |
| 273 | 3300005616 | Ga0068852_100085490 | Ga0068852_1000854905 | 220 |
| 274 | 3300005616 | Ga0068852_100145575 | Ga0068852_1001455752 | 220 |
| 275 | 3300005617 | Ga0068859_100002428 | Ga0068859_10000242818 | 220 |
| 276 | 3300005618 | Ga0068864_100001744 | Ga0068864_10000174417 | 220 |
| 277 | 3300005618 | Ga0068864_100037502 | Ga0068864_1000375023 | 220 |
| 278 | 3300005618 | Ga0068864_100045250 | Ga0068864_1000452502 | 220 |
| 279 | 3300005618 | Ga0068864_100074311 | Ga0068864_1000743112 | 220 |
| 280 | 3300005618 | Ga0068864_100373647 | Ga0068864_1003736472 | 220 |
| 281 | 3300005719 | Ga0068861_100148256 | Ga0068861_1001482562 | 220 |
| 282 | 3300005834 | Ga0068851_10028520 | Ga0068851_100285203 | 220 |
| 283 | 3300005841 | Ga0068863_100148771 | Ga0068863_1001487712 | 220 |
| 284 | 3300005841 | Ga0068863_100732932 | Ga0068863_1007329322 | 220 |
| 285 | 3300005842 | Ga0068858_100000302 | Ga0068858_10000030217 | 220 |
| 286 | 3300005842 | Ga0068858_100051535 | Ga0068858_1000515352 | 220 |
| 287 | 3300005843 | Ga0068860_100392489 | Ga0068860_1003924892 | 220 |
| 288 | 3300005844 | Ga0068862_100076009 | Ga0068862_1000760093 | 220 |
| 289 | 3300006058 | Ga0075432_10011351 | Ga0075432_100113512 | 220 |
| 290 | 3300006177 | Ga0075362_10182102 | Ga0075362_101821022 | 220 |
| 291 | 3300006237 | Ga0097621_100018079 | Ga0097621_1000180796 | 220 |
| 292 | 3300006237 | Ga0097621_100230483 | Ga0097621_1002304832 | 220 |
| 293 | 3300006237 | Ga0097621_100243542 | Ga0097621_1002435422 | 220 |
| 294 | 3300006358 | Ga0068871_100010784 | Ga0068871_1000107842 | 220 |
| 295 | 3300006358 | Ga0068871_100021878 | Ga0068871_1000218785 | 220 |
| 296 | 3300006358 | Ga0068871_100164176 | Ga0068871_1001641763 | 220 |
| 297 | 3300006358 | Ga0068871_100303294 | Ga0068871_1003032942 | 220 |
| 298 | 3300006846 | Ga0075430_100140557 | Ga0075430_1001405572 | 220 |
| 299 | 3300006881 | Ga0068865_100185299 | Ga0068865_1001852992 | 220 |
| 300 | 3300006881 | Ga0068865_100449847 | Ga0068865_1004498472 | 220 |
| 301 | 3300006931 | Ga0097620_100002428 | Ga0097620_10000242818 | 220 |
| 302 | 3300009176 | Ga0105242_10029090 | Ga0105242_100290903 | 220 |
| 303 | 3300009177 | Ga0105248_10007457 | Ga0105248_1000745710 | 220 |
| 304 | 3300009177 | Ga0105248_10031929 | Ga0105248_100319297 | 220 |
| 305 | 3300009177 | Ga0105248_10129182 | Ga0105248_101291822 | 220 |
| 306 | 3300009177 | Ga0105248_10208032 | Ga0105248_102080323 | 220 |
| 307 | 3300009177 | Ga0105248_10211154 | Ga0105248_102111543 | 220 |
| 308 | 3300009551 | Ga0105238_11229550 | Ga0105238_112295501 | 220 |
| 309 | 3300009553 | Ga0105249_10427983 | Ga0105249_104279832 | 220 |
| 310 | 3300009553 | Ga0105249_11368996 | Ga0105249_113689961 | 220 |
| 311 | 3300013105 | Ga0157369_10096608 | Ga0157369_100966082 | 220 |
| 312 | 3300013296 | Ga0157374_10181155 | Ga0157374_101811553 | 220 |
| 313 | 3300013296 | Ga0157374_10299681 | Ga0157374_102996812 | 220 |
| 314 | 3300013297 | Ga0157378_10199387 | Ga0157378_101993873 | 220 |
| 315 | 3300013297 | Ga0157378_10207927 | Ga0157378_102079272 | 220 |
| 316 | 3300013306 | Ga0163162_10498756 | Ga0163162_104987561 | 220 |
| 317 | 3300013306 | Ga0163162_10904517 | Ga0163162_109045172 | 220 |
| 318 | 3300013308 | Ga0157375_10065513 | Ga0157375_100655134 | 220 |
| 319 | 3300013308 | Ga0157375_10074885 | Ga0157375_100748854 | 220 |
| 320 | 3300013308 | Ga0157375_10094496 | Ga0157375_100944964 | 220 |
| 321 | 3300013308 | Ga0157375_10136754 | Ga0157375_101367543 | 220 |
| 322 | 3300014325 | Ga0163163_10009030 | Ga0163163_100090303 | 220 |
| 323 | 3300014325 | Ga0163163_10227856 | Ga0163163_102278562 | 220 |
| 324 | 3300014326 | Ga0157380_10332718 | Ga0157380_103327182 | 220 |
| 325 | 3300014745 | Ga0157377_10189176 | Ga0157377_101891762 | 220 |
| 326 | 3300014968 | Ga0157379_10003195 | Ga0157379_100031954 | 220 |
| 327 | 3300014968 | Ga0157379_10065107 | Ga0157379_100651071 | 220 |
| 328 | 3300014969 | Ga0157376_10097608 | Ga0157376_100976083 | 220 |
| 329 | 3300014969 | Ga0157376_10148210 | Ga0157376_101482102 | 220 |
| 330 | 3300014969 | Ga0157376_10149347 | Ga0157376_101493472 | 220 |
| 331 | 3300017792 | Ga0163161_10139091 | Ga0163161_101390912 | 220 |
| 332 | 3300021384 | Ga0213876_10116040 | Ga0213876_101160402 | 220 |
| 333 | 3300025315 | Ga0207697_10095893 | Ga0207697_100958932 | 220 |
| 334 | 3300025893 | Ga0207682_10001538 | Ga0207682_100015389 | 220 |
| 335 | 3300025893 | Ga0207682_10129917 | Ga0207682_101299172 | 220 |
| 336 | 3300025899 | Ga0207642_10076775 | Ga0207642_100767752 | 220 |
| 337 | 3300025903 | Ga0207680_10003124 | Ga0207680_100031247 | 220 |
| 338 | 3300025907 | Ga0207645_10162816 | Ga0207645_101628162 | 220 |
| 339 | 3300025907 | Ga0207645_10315642 | Ga0207645_103156421 | 220 |
| 340 | 3300025909 | Ga0207705_10147531 | Ga0207705_101475313 | 220 |
| 341 | 3300025917 | Ga0207660_10770384 | Ga0207660_107703841 | 220 |
| 342 | 3300025920 | Ga0207649_10206550 | Ga0207649_102065502 | 220 |
| 343 | 3300025925 | Ga0207650_10001736 | Ga0207650_100017368 | 220 |
| 344 | 3300025925 | Ga0207650_10050574 | Ga0207650_100505743 | 220 |
| 345 | 3300025925 | Ga0207650_10095142 | Ga0207650_100951422 | 220 |
| 346 | 3300025925 | Ga0207650_10108611 | Ga0207650_101086112 | 220 |
| 347 | 3300025925 | Ga0207650_10199206 | Ga0207650_101992062 | 220 |
| 348 | 3300025925 | Ga0207650_10230028 | Ga0207650_102300284 | 220 |
| 349 | 3300025926 | Ga0207659_10001207 | Ga0207659_1000120719 | 220 |
| 350 | 3300025926 | Ga0207659_10098123 | Ga0207659_100981234 | 220 |
| 351 | 3300025926 | Ga0207659_10161099 | Ga0207659_101610993 | 220 |
| 352 | 3300025926 | Ga0207659_10460981 | Ga0207659_104609812 | 220 |
| 353 | 3300025927 | Ga0207687_10544497 | Ga0207687_105444973 | 220 |
| 354 | 3300025931 | Ga0207644_10015281 | Ga0207644_100152816 | 220 |
| 355 | 3300025931 | Ga0207644_10167355 | Ga0207644_101673552 | 220 |
| 356 | 3300025931 | Ga0207644_10292439 | Ga0207644_102924391 | 220 |
| 357 | 3300025932 | Ga0207690_10073034 | Ga0207690_100730342 | 220 |
| 358 | 3300025933 | Ga0207706_10862107 | Ga0207706_108621071 | 220 |
| 359 | 3300025934 | Ga0207686_10015451 | Ga0207686_100154513 | 220 |
| 360 | 3300025936 | Ga0207670_10026167 | Ga0207670_100261674 | 220 |
| 361 | 3300025937 | Ga0207669_10029016 | Ga0207669_100290163 | 220 |
| 362 | 3300025937 | Ga0207669_10402676 | Ga0207669_104026761 | 220 |
| 363 | 3300025938 | Ga0207704_10138659 | Ga0207704_101386592 | 220 |
| 364 | 3300025940 | Ga0207691_10003233 | Ga0207691_1000323316 | 220 |
| 365 | 3300025940 | Ga0207691_10011718 | Ga0207691_100117182 | 220 |
| 366 | 3300025940 | Ga0207691_10030314 | Ga0207691_100303145 | 220 |
| 367 | 3300025940 | Ga0207691_10058845 | Ga0207691_100588453 | 220 |
| 368 | 3300025940 | Ga0207691_10068372 | Ga0207691_100683723 | 220 |
| 369 | 3300025940 | Ga0207691_10144115 | Ga0207691_101441153 | 220 |
| 370 | 3300025940 | Ga0207691_10153412 | Ga0207691_101534123 | 220 |
| 371 | 3300025941 | Ga0207711_10069677 | Ga0207711_100696772 | 220 |
| 372 | 3300025941 | Ga0207711_10245624 | Ga0207711_102456242 | 220 |
| 373 | 3300025941 | Ga0207711_10392292 | Ga0207711_103922923 | 220 |
| 374 | 3300025941 | Ga0207711_10580378 | Ga0207711_105803782 | 220 |
| 375 | 3300025942 | Ga0207689_10019512 | Ga0207689_100195123 | 220 |
| 376 | 3300025942 | Ga0207689_10426654 | Ga0207689_104266542 | 220 |
| 377 | 3300025945 | Ga0207679_10342922 | Ga0207679_103429221 | 220 |
| 378 | 3300025960 | Ga0207651_10032563 | Ga0207651_100325634 | 220 |
| 379 | 3300025960 | Ga0207651_10111519 | Ga0207651_101115192 | 220 |
| 380 | 3300025960 | Ga0207651_10118378 | Ga0207651_101183784 | 220 |
| 381 | 3300025961 | Ga0207712_10338472 | Ga0207712_103384723 | 220 |
| 382 | 3300025972 | Ga0207668_10430377 | Ga0207668_104303771 | 220 |
| 383 | 3300025986 | Ga0207658_10115383 | Ga0207658_101153832 | 220 |
| 384 | 3300025986 | Ga0207658_10195522 | Ga0207658_101955223 | 220 |
| 385 | 3300026023 | Ga0207677_10020443 | Ga0207677_100204432 | 220 |
| 386 | 3300026023 | Ga0207677_10076085 | Ga0207677_100760852 | 220 |
| 387 | 3300026023 | Ga0207677_10722906 | Ga0207677_107229061 | 220 |
| 388 | 3300026035 | Ga0207703_10001536 | Ga0207703_1000153621 | 220 |
| 389 | 3300026035 | Ga0207703_10013491 | Ga0207703_100134916 | 220 |
| 390 | 3300026067 | Ga0207678_10511702 | Ga0207678_105117022 | 220 |
| 391 | 3300026075 | Ga0207708_10179504 | Ga0207708_101795042 | 220 |
| 392 | 3300026088 | Ga0207641_10014170 | Ga0207641_100141708 | 220 |
| 393 | 3300026088 | Ga0207641_10123414 | Ga0207641_101234142 | 220 |
| 394 | 3300026088 | Ga0207641_10188336 | Ga0207641_101883363 | 220 |
| 395 | 3300026089 | Ga0207648_10004600 | Ga0207648_100046004 | 220 |
| 396 | 3300026089 | Ga0207648_10083523 | Ga0207648_100835233 | 220 |
| 397 | 3300026089 | Ga0207648_10433875 | Ga0207648_104338752 | 220 |
| 398 | 3300026095 | Ga0207676_10003739 | Ga0207676_100037396 | 220 |
| 399 | 3300026095 | Ga0207676_10066568 | Ga0207676_100665682 | 220 |
| 400 | 3300026095 | Ga0207676_10137195 | Ga0207676_101371952 | 220 |
| 401 | 3300026095 | Ga0207676_10193763 | Ga0207676_101937633 | 220 |
| 402 | 3300026116 | Ga0207674_10619553 | Ga0207674_106195531 | 220 |
| 403 | 3300026118 | Ga0207675_100089018 | Ga0207675_1000890182 | 220 |
| 404 | 3300026121 | Ga0207683_10010102 | Ga0207683_100101021 | 220 |
| 405 | 3300026121 | Ga0207683_10028082 | Ga0207683_100280825 | 220 |
| 406 | 3300026121 | Ga0207683_10106102 | Ga0207683_101061022 | 220 |
| 407 | 3300026121 | Ga0207683_10332109 | Ga0207683_103321092 | 220 |
| 408 | 3300026142 | Ga0207698_10047683 | Ga0207698_100476834 | 220 |
| 409 | 3300026142 | Ga0207698_10091925 | Ga0207698_100919254 | 220 |
| 410 | 3300026142 | Ga0207698_10182845 | Ga0207698_101828452 | 220 |
| 411 | 3300027907 | Ga0207428_10172893 | Ga0207428_101728931 | 220 |
| 412 | 3300028379 | Ga0268266_10117253 | Ga0268266_101172532 | 220 |
| 413 | 3300028380 | Ga0268265_10741846 | Ga0268265_107418462 | 220 |
| 414 | 3300028381 | Ga0268264_10407958 | Ga0268264_104079582 | 220 |
| 415 | 3300028794 | Ga0307515_10004779 | Ga0307515_1000477918 | 220 |
| 416 | 3300028794 | Ga0307515_10513193 | Ga0307515_105131931 | 220 |
| 417 | 3300030745 | Ga0316182_1082680 | Ga0316182_10826802 | 220 |
| 418 | 3300031251 | Ga0265327_10123113 | Ga0265327_101231132 | 220 |
| 419 | 3300031456 | Ga0307513_10025971 | Ga0307513_100259712 | 220 |
| 420 | 3300031507 | Ga0307509_10010192 | Ga0307509_100101922 | 220 |
| 421 | 3300031911 | Ga0307412_10192156 | Ga0307412_101921562 | 220 |
| 422 | 3300031995 | Ga0307409_100000872 | Ga0307409_1000008722 | 220 |
| 423 | 3300031995 | Ga0307409_100633323 | Ga0307409_1006333232 | 220 |
| 424 | 3300032002 | Ga0307416_100307125 | Ga0307416_1003071251 | 220 |
| 425 | 3300032005 | Ga0307411_10091367 | Ga0307411_100913672 | 220 |
| 426 | 3300033180 | Ga0307510_10021591 | Ga0307510_100215916 | 220 |
| 427 | 3300035172 | Ga0373955_0069436 | Ga0373955_0069436_1032_1724 | 220 |
| 428 | 3300035695 | Ga0373927_0111396 | Ga0373927_0111396_102_794 | 220 |
| 429 | 3300035725 | Ga0373947_0433950 | Ga0373947_0433950_73_765 | 220 |
| 430 | 3300036401 | Ga0373937_0259021 | Ga0373937_0259021_772_1464 | 220 |
| 431 | 3300036401 | Ga0373937_0565499 | Ga0373937_0565499_81_773 | 220 |
| 432 | 3300037312 | Ga0395899_0000090 | Ga0395899_0000090_36520_37224 | 220 |
| 433 | 3300038443 | Ga0395901_0000740 | Ga0395901_0000740_7891_8583 | 220 |
| 434 | 3300039437 | Ga0436365_0200616 | Ga0436365_0200616_181_885 | 220 |
| 435 | 3300041512 | Ga0451853_0609165 | Ga0451853_0609165_248_940 | 220 |
| 436 | 3300041512 | Ga0451853_2146327 | Ga0451853_2146327_2140_2832 | 220 |
| 437 | 3300041997 | Ga0439431_0001243 | Ga0439431_0001243_960_1652 | 220 |
| 438 | 3300042134 | Ga0450898_034293 | Ga0450898_034293_145_837 | 220 |
| 439 | 3300046455 | Ga0495603_0315144 | Ga0495603_0315144_73_873 | 220 |
| 440 | 3300046459 | Ga0495629_0053545 | Ga0495629_0053545_2071_2763 | 220 |
| 441 | 3300046459 | Ga0495629_0259075 | Ga0495629_0259075_221_1000 | 220 |
| 442 | 3300046459 | Ga0495629_0437894 | Ga0495629_0437894_163_855 | 220 |
| 443 | 3300046472 | Ga0495580_0189394 | Ga0495580_0189394_295_987 | 220 |
| 444 | 3300046539 | Ga0495621_0070545 | Ga0495621_0070545_117_809 | 220 |
| 445 | 3300046543 | Ga0495645_0012490 | Ga0495645_0012490_1374_2066 | 220 |
| 446 | 3300046615 | Ga0495656_0316579 | Ga0495656_0316579_31_723 | 220 |
| 447 | 3300046660 | Ga0495625_0087135 | Ga0495625_0087135_579_1283 | 220 |
| 448 | 3300046681 | Ga0495647_0032837 | Ga0495647_0032837_471_1250 | 220 |
| 449 | 3300046683 | Ga0495658_0045458 | Ga0495658_0045458_1526_2218 | 220 |
| 450 | 3300047471 | Ga0495684_0185236 | Ga0495684_0185236_238_930 | 220 |
| 451 | 3300048907 | Ga0496104_0139316 | Ga0496104_0139316_1143_1835 | 220 |
| 452 | 3300048907 | Ga0496104_0756090 | Ga0496104_0756090_55_747 | 220 |
| 453 | 3300048917 | Ga0496114_0040983 | Ga0496114_0040983_2027_2719 | 220 |
| 454 | 3300048917 | Ga0496114_0412936 | Ga0496114_0412936_85_777 | 220 |
| 455 | 3300049575 | Ga0501039_0374820 | Ga0501039_0374820_332_1036 | 220 |
| 456 | 3300049585 | Ga0501069_0142328 | Ga0501069_0142328_283_975 | 220 |
| 457 | 3300049586 | Ga0501070_0349165 | Ga0501070_0349165_483_1175 | 220 |
| 458 | 3300049592 | Ga0501076_0017815 | Ga0501076_0017815_1860_2552 | 220 |
| 459 | 3300049660 | Ga0501216_052921 | Ga0501216_052921_60_764 | 220 |
| 460 | 3300049741 | Ga0501079_0069206 | Ga0501079_0069206_1739_2431 | 220 |
| 461 | 3300049743 | Ga0501081_0387534 | Ga0501081_0387534_136_828 | 220 |
| 462 | 3300054114 | Ga0501084_0004450 | Ga0501084_0004450_8364_9056 | 220 |
| 463 | 3300059424 | Ga0590075_008069 | Ga0590075_008069_470_1174 | 220 |
| 464 | 3300060353 | Ga0501082_0433436 | Ga0501082_0433436_293_985 | 220 |
| 465 | iso_pu_bacteria | 2643221550 | 2643774043 | 220 |
| 466 | iso_pu_bacteria | 2643221564 | 2643838688 | 220 |
| 467 | iso_pu_bacteria | 2937843397 | 2937846699 | 220 |
| 468 | 3300005468 | Ga0070707_100140874 | Ga0070707_1001408742 | 221 |
| 469 | 3300025922 | Ga0207646_10271991 | Ga0207646_102719912 | 221 |
| 470 | 3300031548 | Ga0307408_100497346 | Ga0307408_1004973461 | 221 |
| 471 | iso_pu_bacteria | 2643221734 | 2644733130 | 221 |
| 472 | iso_pu_bacteria | 2917699015 | 2917700573 | 221 |
| 473 | 3300005981 | Ga0081538_10001621 | Ga0081538_1000162116 | 222 |
| 474 | 3300032004 | Ga0307414_10532793 | Ga0307414_105327931 | 222 |
| 475 | 3300050494 | nmdc:mga06z11_48346_c1 | nmdc:mga06z11_48346_c1_19_759 | 222 |
| 476 | 3300006931 | Ga0097620_100076466 | Ga0097620_1000764663 | 223 |
| 477 | 3300009177 | Ga0105248_10812602 | Ga0105248_108126022 | 223 |
| 478 | 3300026095 | Ga0207676_10054378 | Ga0207676_100543783 | 223 |
| 479 | 3300048915 | Ga0496112_0530209 | Ga0496112_0530209_71_766 | 223 |
| 480 | 3300049823 | Ga0501044_0250213 | Ga0501044_0250213_239_940 | 223 |
| 481 | iso_pu_bacteria | 2941489479 | 2941493116 | 223 |
| 482 | iso_pu_bacteria | 2995948881 | 2995949203 | 223 |
| 483 | 3300025304 | Ga0209257_1011292 | Ga0209257_10112924 | 225 |
| 484 | 3300031665 | Ga0316575_10000099 | Ga0316575_100000995 | 225 |
| 485 | 3300041498 | Ga0451841_0167828 | Ga0451841_0167828_207_917 | 225 |
| 486 | 3300042876 | Ga0451577_0040698 | Ga0451577_0040698_2434_3159 | 225 |
| 487 | 3300042876 | Ga0451577_0421078 | Ga0451577_0421078_422_1120 | 225 |
| 488 | 3300044712 | Ga0453684_0000531 | Ga0453684_0000531_104420_105118 | 225 |
| 489 | 3300045051 | Ga0451576_0000212 | Ga0451576_0000212_104426_105124 | 225 |
| 490 | 3300046794 | Ga0495589_0048195 | Ga0495589_0048195_851_1582 | 225 |
| 491 | iso_pu_bacteria | 2848694841 | 2848699951 | 225 |
| 492 | iso_pu_bacteria | 2919513703 | 2919514364 | 225 |
| 493 | iso_pu_bacteria | 2919675420 | 2919677696 | 225 |
| 494 | 3300003771 | Ga0055526_1000003 | Ga0055526_1000003318 | 227 |
| 495 | 3300003773 | Ga0055537_1000153 | Ga0055537_10001534 | 227 |
| 496 | 3300003775 | Ga0055524_1000002 | Ga0055524_100000248 | 227 |
| 497 | 3300003784 | Ga0055534_1000050 | Ga0055534_100005034 | 227 |
| 498 | 3300003790 | Ga0055528_1000001 | Ga0055528_100000148 | 227 |
| 499 | 3300025263 | Ga0209565_1000002 | Ga0209565_1000002530 | 227 |
| 500 | 3300025273 | Ga0209673_1000002 | Ga0209673_1000002530 | 227 |
| 501 | 3300025291 | Ga0209675_1000002 | Ga0209675_1000002530 | 227 |
| 502 | 3300025295 | Ga0209564_1000004 | Ga0209564_1000004531 | 227 |
| 503 | 3300025299 | Ga0209256_1000004 | Ga0209256_1000004531 | 227 |
| 504 | 3300041404 | Ga0439436_0011766 | Ga0439436_0011766_1871_2581 | 227 |
| 505 | 3300041486 | Ga0451807_0061609 | Ga0451807_0061609_35_736 | 227 |
| 506 | 3300048924 | Ga0496121_0021456 | Ga0496121_0021456_533_1246 | 227 |
| 507 | 3300002773 | JGI25152J39213_1000439 | JGI25152J39213_10004392 | 229 |
| 508 | 3300002774 | JGI25150J39212_1004101 | JGI25150J39212_10041012 | 229 |
| 509 | 3300003187 | JGI25151J46595_10000810 | JGI25151J46595_100008102 | 229 |
| 510 | 3300003215 | JGI25153J46596_10000499 | JGI25153J46596_100004992 | 229 |
| 511 | 3300005347 | Ga0070668_100032116 | Ga0070668_1000321163 | 229 |
| 512 | 3300005548 | Ga0070665_100186683 | Ga0070665_1001866833 | 229 |
| 513 | 3300017792 | Ga0163161_10106375 | Ga0163161_101063752 | 229 |
| 514 | 3300017792 | Ga0163161_10158291 | Ga0163161_101582913 | 229 |
| 515 | 3300025245 | Ga0207425_1000029 | Ga0207425_100002992 | 229 |
| 516 | 3300025258 | Ga0209129_1000073 | Ga0209129_1000073143 | 229 |
| 517 | 3300025294 | Ga0209025_1000076 | Ga0209025_100007696 | 229 |
| 518 | 3300025297 | Ga0209758_1000112 | Ga0209758_100011232 | 229 |
| 519 | 3300025304 | Ga0209257_1000240 | Ga0209257_100024071 | 229 |
| 520 | 3300025972 | Ga0207668_10088214 | Ga0207668_100882142 | 229 |
| 521 | 3300028379 | Ga0268266_10139206 | Ga0268266_101392062 | 229 |
| 522 | 3300030744 | Ga0316181_1153232 | Ga0316181_11532322 | 229 |
| 523 | 3300031456 | Ga0307513_10000707 | Ga0307513_1000070725 | 229 |
| 524 | 3300031456 | Ga0307513_10189785 | Ga0307513_101897852 | 229 |
| 525 | 3300031456 | Ga0307513_10200978 | Ga0307513_102009783 | 229 |
| 526 | 3300032004 | Ga0307414_10011424 | Ga0307414_100114242 | 229 |
| 527 | 3300038705 | Ga0237819_00873 | Ga0237819_00873_1150_1839 | 229 |
| 528 | 3300041404 | Ga0439436_0078628 | Ga0439436_0078628_158_856 | 229 |
| 529 | 3300041413 | Ga0439465_0001288 | Ga0439465_0001288_1720_2421 | 229 |
| 530 | 3300041441 | Ga0451787_284586 | Ga0451787_284586_297_1013 | 229 |
| 531 | 3300041451 | Ga0451791_1038472 | Ga0451791_1038472_126_839 | 229 |
| 532 | 3300041453 | Ga0451797_0360845 | Ga0451797_0360845_490_1203 | 229 |
| 533 | 3300041486 | Ga0451807_2454286 | Ga0451807_2454286_854_1567 | 229 |
| 534 | 3300041509 | Ga0451843_0985837 | Ga0451843_0985837_824_1537 | 229 |
| 535 | 3300042004 | Ga0439445_0000292 | Ga0439445_0000292_2347_3060 | 229 |
| 536 | 3300042007 | Ga0439449_0000005 | Ga0439449_0000005_39274_39975 | 229 |
| 537 | 3300042007 | Ga0439449_0041100 | Ga0439449_0041100_832_1548 | 229 |
| 538 | 3300042014 | Ga0439457_049811 | Ga0439457_049811_84_800 | 229 |
| 539 | 3300046460 | Ga0495638_0072886 | Ga0495638_0072886_1092_1808 | 229 |
| 540 | 3300046519 | Ga0495632_0014399 | Ga0495632_0014399_313_1002 | 229 |
| 541 | 3300046525 | Ga0495663_0001626 | Ga0495663_0001626_4774_5463 | 229 |
| 542 | 3300046525 | Ga0495663_0003320 | Ga0495663_0003320_2507_3223 | 229 |
| 543 | 3300046558 | Ga0495633_0033342 | Ga0495633_0033342_1465_2154 | 229 |
| 544 | 3300048928 | Ga0496125_0031184 | Ga0496125_0031184_2533_3243 | 229 |
| 545 | 3300049705 | Ga0501225_0002113 | Ga0501225_0002113_519_1322 | 229 |
| 546 | 3300050491 | nmdc:mga00v17_32021_c1 | nmdc:mga00v17_32021_c1_2391_3086 | 229 |
| 547 | 3300050491 | nmdc:mga00v17_52875_c1 | nmdc:mga00v17_52875_c1_1597_2292 | 229 |
| 548 | 3300053087 | Ga0500643_042205 | Ga0500643_042205_284_973 | 229 |
| 549 | 3300053161 | Ga0500634_0000337 | Ga0500634_0000337_11627_12316 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9827 | 1 | 204 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9797 | 1 | 202 |
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9733 | 1 | 204 |
| 4l8e-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit | 0.9685 | 3 | 203 |
| 4ecj-assembly1.cif.gz_B | crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione | 0.9684 | 1 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9976 | 1 | 84 | 3.40.30.10 |
| 4l8eA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9941 | 3 | 86 | 3.40.30.10 |
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9744 | 1 | 84 | 3.40.30.10 |
| 4mf6A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9734 | 2 | 85 | 3.40.30.10 |
| 4ikhA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9659 | 2 | 84 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522J4D5-F1-model_v4 | Thiol:disulfide oxidoreductase | 1.003 | 1 | 84 |
|
| AF-A0A455UEY7-F1-model_v4 | GST N-terminal domain-containing protein | 1 | 1 | 79 |
|
| AF-A0A3D5Y447-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9998 | 1 | 71 |
|
| AF-A0A379S1X3-F1-model_v4 | Glutathione-S transferase | 0.9991 | 1 | 84 |
GO:0015036
GO:0016740 |
| AF-A0A6G4BI85-F1-model_v4 | deleted | 0.998 | 12 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar