F462408

General Info

Members Datasets Scaffolds Average Seq Length
549 286 537 226

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0315144|Ga0495603_0315144_73_873
Length 266
Sequence VTRASKLLIDSSMTLSDPLESCAGRALRLFIPGRDAMIEVYSWATPNGHKVHVMLEECGLAYRAIPVNIGAGDQFKPEFLAISPNNKIPAIVDPDGPDGEPISLFESGAILVYLAAKTGRFLPADLRGRYQTLEWLMFQMGSVGPMLGQTHHFRLYAPEKIPYAIDRYSNEAKRLYNVMDKRLATQSFIATDEYTIADIAIFPWLRSWQNQGIDWADYPNLKDWFDRVAARPAVRRGVEVLAGLRKPLRSDAEREVLFGAKQYERR

Samples

Sample ID Description Type Environment
1 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
2 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221734 Bosea sp. Root670 Isolate Unclassified
6 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
7 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
8 2919513703 Luteimonas sp. 3794 Isolate Unclassified
9 2919675420 Luteimonas terrae 4099 Isolate Unclassified
10 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
11 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
12 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
182 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
196 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
197 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
232 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 0
Rhizoplane 3.46
Rhizosphere 86.7
Stem 0
Stem Tuber 0
Unclassified 4.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000439 3300002773 Bacteria 24968
2 JGI25150J39212_1004101 3300002774 Bacteria 3290
3 JGI25151J46595_10000810 3300003187 Bacteria 24968
4 JGI25153J46596_10000499 3300003215 Bacteria 24968
5 Ga0055526_1000003 3300003771 Bacteria 413092
6 Ga0055537_1000153 3300003773 Bacteria 51908
7 Ga0055524_1000002 3300003775 Bacteria 459550
8 Ga0055534_1000050 3300003784 Bacteria 92561
9 Ga0055528_1000001 3300003790 Bacteria 402384
10 Ga0065704_10047520 3300005289 Bacteria 787
11 Ga0065715_10144662 3300005293 Bacteria 1805
12 Ga0065707_10295144 3300005295 Bacteria 1016
13 Ga0070658_10076359 3300005327 Bacteria 2748
14 Ga0070658_10132516 3300005327 Bacteria 2077
15 Ga0070658_10144630 3300005327 Bacteria 1987
16 Ga0070676_10185903 3300005328 Bacteria 1354
17 Ga0070676_10338872 3300005328 Bacteria 1031
18 Ga0070683_100048721 3300005329 Bacteria 3917
19 Ga0070683_100082137 3300005329 Bacteria 3017
20 Ga0070670_100004050 3300005331 Bacteria 12237
21 Ga0070670_100025326 3300005331 Bacteria 5105
22 Ga0070670_100194202 3300005331 Bacteria 1763
23 Ga0070670_100214101 3300005331 Bacteria 1675
24 Ga0070670_100488998 3300005331 Bacteria 1093
25 Ga0070677_10050908 3300005333 Bacteria 1674
26 Ga0070677_10088667 3300005333 Bacteria 1341
27 Ga0068869_100002292 3300005334 Bacteria 11512
28 Ga0068869_100047188 3300005334 Bacteria 3110
29 Ga0068869_100057427 3300005334 Bacteria 2841
30 Ga0070666_10021839 3300005335 Bacteria 4150
31 Ga0070680_100343151 3300005336 Bacteria 1269
32 Ga0068868_100004360 3300005338 Bacteria 9917
33 Ga0068868_100028768 3300005338 Bacteria 4252
34 Ga0068868_100096926 3300005338 Bacteria 2383
35 Ga0070660_100021608 3300005339 Bacteria 4748
36 Ga0070660_100082046 3300005339 Bacteria 2531
37 Ga0070689_100233147 3300005340 Bacteria 1514
38 Ga0070689_100321859 3300005340 Bacteria 1292
39 Ga0070687_100023721 3300005343 Bacteria 2918
40 Ga0070687_100061789 3300005343 Bacteria 1981
41 Ga0070661_100134064 3300005344 Bacteria 1862
42 Ga0070668_100012013 3300005347 Bacteria 6450
43 Ga0070668_100032116 3300005347 Bacteria 3995
44 Ga0070668_100094447 3300005347 Bacteria 2361
45 Ga0070668_100434819 3300005347 Bacteria 1125
46 Ga0070668_100490661 3300005347 Bacteria 1062
47 Ga0070669_100008268 3300005353 Bacteria 7428
48 Ga0070669_100016134 3300005353 Bacteria 5329
49 Ga0070669_100356473 3300005353 Bacteria 1188
50 Ga0070669_100518619 3300005353 Bacteria 990
51 Ga0070675_100000837 3300005354 Bacteria 21793
52 Ga0070675_100006591 3300005354 Bacteria 8927
53 Ga0070675_100058732 3300005354 Bacteria 3172
54 Ga0070675_100073780 3300005354 Bacteria 2833
55 Ga0070675_100095013 3300005354 Bacteria 2502
56 Ga0070675_100179406 3300005354 Bacteria 1830
57 Ga0070675_100858615 3300005354 Bacteria 831
58 Ga0070671_100015493 3300005355 Bacteria 6159
59 Ga0070671_100055182 3300005355 Bacteria 3305
60 Ga0070671_100396326 3300005355 Bacteria 1180
61 Ga0070671_100401519 3300005355 Bacteria 1172
62 Ga0070674_100023274 3300005356 Bacteria 4007
63 Ga0070674_100078528 3300005356 Bacteria 2352
64 Ga0070674_100148694 3300005356 Bacteria 1765
65 Ga0070674_100364809 3300005356 Bacteria 1170
66 Ga0070674_100666645 3300005356 Bacteria 886
67 Ga0070673_100006166 3300005364 Bacteria 7770
68 Ga0070673_100107740 3300005364 Bacteria 2305
69 Ga0070673_100124939 3300005364 Bacteria 2151
70 Ga0070688_100028965 3300005365 Bacteria 3312
71 Ga0070688_100168778 3300005365 Bacteria 1508
72 Ga0070667_100022986 3300005367 Bacteria 5170
73 Ga0070667_100049799 3300005367 Bacteria 3529
74 Ga0070667_100092033 3300005367 Bacteria 2608
75 Ga0070667_100122418 3300005367 Bacteria 2264
76 Ga0070701_10075820 3300005438 Bacteria 1809
77 Ga0070711_100350460 3300005439 Bacteria 1187
78 Ga0070700_100486376 3300005441 Bacteria 946
79 Ga0070694_100144678 3300005444 Bacteria 1730
80 Ga0070663_100081916 3300005455 Bacteria 2373
81 Ga0070678_100016836 3300005456 Bacteria 4687
82 Ga0070678_100092981 3300005456 Bacteria 2318
83 Ga0070678_100103082 3300005456 Bacteria 2216
84 Ga0070678_100106305 3300005456 Bacteria 2187
85 Ga0070678_100401767 3300005456 Bacteria 1190
86 Ga0070662_100055315 3300005457 Bacteria 2878
87 Ga0070662_100970216 3300005457 Bacteria 727
88 Ga0070681_10001886 3300005458 Bacteria 18915
89 Ga0070681_10149583 3300005458 Bacteria 2262
90 Ga0068867_100003015 3300005459 Bacteria 11869
91 Ga0068867_100015341 3300005459 Bacteria 5432
92 Ga0068867_100223481 3300005459 Bacteria 1518
93 Ga0068867_100468363 3300005459 Bacteria 1077
94 Ga0070685_10228878 3300005466 Bacteria 1222
95 Ga0070706_100033891 3300005467 Bacteria 4714
96 Ga0070707_100019507 3300005468 Bacteria 6388
97 Ga0070707_100140874 3300005468 Bacteria 2347
98 Ga0070679_100495651 3300005530 Bacteria 1166
99 Ga0070684_100029200 3300005535 Bacteria 4671
100 Ga0070684_100345758 3300005535 Bacteria 1367
101 Ga0070697_100228964 3300005536 Bacteria 1585
102 Ga0068853_100380235 3300005539 Bacteria 1318
103 Ga0070672_100015809 3300005543 Bacteria 5388
104 Ga0070672_100017240 3300005543 Bacteria 5193
105 Ga0070672_100050834 3300005543 Bacteria 3230
106 Ga0070672_100105205 3300005543 Bacteria 2294
107 Ga0070672_100133513 3300005543 Bacteria 2042
108 Ga0070672_100162882 3300005543 Bacteria 1852
109 Ga0070672_100519421 3300005543 Bacteria 1031
110 Ga0070686_100021820 3300005544 Bacteria 3811
111 Ga0070695_100068522 3300005545 Bacteria 2317
112 Ga0070695_100624890 3300005545 Bacteria 848
113 Ga0070696_100044619 3300005546 Bacteria 3070
114 Ga0070696_100539831 3300005546 Bacteria 933
115 Ga0070693_100035977 3300005547 Bacteria 2749
116 Ga0070665_100186683 3300005548 Bacteria 2074
117 Ga0070665_100565371 3300005548 Bacteria 1150
118 Ga0070704_100002902 3300005549 Bacteria 9734
119 Ga0070704_100806819 3300005549 Bacteria 839
120 Ga0068855_100015267 3300005563 Bacteria 9244
121 Ga0070664_100008503 3300005564 Bacteria 8297
122 Ga0070664_100016797 3300005564 Bacteria 6007
123 Ga0070664_100084357 3300005564 Bacteria 2742
124 Ga0070664_100151213 3300005564 Bacteria 2049
125 Ga0070664_100359954 3300005564 Bacteria 1325
126 Ga0070664_100495309 3300005564 Bacteria 1126
127 Ga0070702_100038015 3300005615 Bacteria 2677
128 Ga0068852_100081356 3300005616 Bacteria 2875
129 Ga0068852_100085490 3300005616 Bacteria 2810
130 Ga0068852_100145575 3300005616 Bacteria 2197
131 Ga0068852_100221735 3300005616 Bacteria 1799
132 Ga0068859_100002428 3300005617 Bacteria 18977
133 Ga0068859_100060700 3300005617 Bacteria 3810
134 Ga0068864_100001744 3300005618 Bacteria 17876
135 Ga0068864_100037502 3300005618 Bacteria 4136
136 Ga0068864_100045250 3300005618 Bacteria 3775
137 Ga0068864_100074311 3300005618 Bacteria 2966
138 Ga0068864_100373647 3300005618 Bacteria 1350
139 Ga0068866_10003719 3300005718 Bacteria 6255
140 Ga0068861_100003994 3300005719 Bacteria 9878
141 Ga0068861_100037899 3300005719 Bacteria 3585
142 Ga0068861_100148256 3300005719 Bacteria 1922
143 Ga0068851_10028520 3300005834 Bacteria 2758
144 Ga0068863_100083099 3300005841 Bacteria 3034
145 Ga0068863_100148771 3300005841 Bacteria 2240
146 Ga0068863_100732932 3300005841 Bacteria 983
147 Ga0068858_100000302 3300005842 Bacteria 52791
148 Ga0068858_100023326 3300005842 Bacteria 5766
149 Ga0068858_100031334 3300005842 Bacteria 4938
150 Ga0068858_100051535 3300005842 Bacteria 3807
151 Ga0068860_100004324 3300005843 Bacteria 14519
152 Ga0068860_100061504 3300005843 Bacteria 3567
153 Ga0068860_100392489 3300005843 Bacteria 1371
154 Ga0068862_100041938 3300005844 Bacteria 3896
155 Ga0068862_100076009 3300005844 Bacteria 2906
156 Ga0081538_10001621 3300005981 Bacteria 23067
157 Ga0075432_10011351 3300006058 Bacteria 3026
158 Ga0070712_100351661 3300006175 Bacteria 1206
159 Ga0075362_10182102 3300006177 Bacteria 1018
160 Ga0097621_100018079 3300006237 Bacteria 5375
161 Ga0097621_100230483 3300006237 Bacteria 1617
162 Ga0097621_100243542 3300006237 Bacteria 1572
163 Ga0097621_100244702 3300006237 Bacteria 1569
164 Ga0068871_100010784 3300006358 Bacteria 6686
165 Ga0068871_100021878 3300006358 Bacteria 4923
166 Ga0068871_100053498 3300006358 Bacteria 3272
167 Ga0068871_100061637 3300006358 Bacteria 3064
168 Ga0068871_100164176 3300006358 Bacteria 1900
169 Ga0068871_100303294 3300006358 Bacteria 1402
170 Ga0075428_100283973 3300006844 Bacteria 1781
171 Ga0075430_100140557 3300006846 Bacteria 2011
172 Ga0075431_100001511 3300006847 Bacteria 21575
173 Ga0075429_100000694 3300006880 Bacteria 26235
174 Ga0068865_100015272 3300006881 Bacteria 4896
175 Ga0068865_100185299 3300006881 Bacteria 1606
176 Ga0068865_100449847 3300006881 Bacteria 1065
177 Ga0075436_100101677 3300006914 Bacteria 2002
178 Ga0075436_100624260 3300006914 Bacteria 795
179 Ga0097620_100002428 3300006931 Bacteria 18977
180 Ga0097620_100060699 3300006931 Bacteria 3810
181 Ga0097620_100076466 3300006931 Bacteria 3389
182 Ga0111539_10605415 3300009094 Bacteria 1276
183 Ga0105245_10009589 3300009098 Bacteria 8445
184 Ga0105245_10075325 3300009098 Bacteria 3072
185 Ga0114129_10055562 3300009147 Bacteria 5548
186 Ga0105243_10081213 3300009148 Bacteria 2646
187 Ga0105243_10420353 3300009148 Bacteria 1247
188 Ga0105241_10140689 3300009174 Bacteria 1964
189 Ga0105242_10029090 3300009176 Bacteria 4404
190 Ga0105242_10322652 3300009176 Bacteria 1417
191 Ga0105248_10007457 3300009177 Bacteria 12001
192 Ga0105248_10017648 3300009177 Bacteria 7873
193 Ga0105248_10031929 3300009177 Bacteria 5884
194 Ga0105248_10129182 3300009177 Bacteria 2851
195 Ga0105248_10208032 3300009177 Bacteria 2204
196 Ga0105248_10211154 3300009177 Bacteria 2187
197 Ga0105248_10812602 3300009177 Bacteria 1055
198 Ga0105238_10007971 3300009551 Bacteria 10598
199 Ga0105238_11229550 3300009551 Bacteria 774
200 Ga0105249_10005385 3300009553 Bacteria 11044
201 Ga0105249_10103550 3300009553 Bacteria 2681
202 Ga0105249_10427983 3300009553 Bacteria 1359
203 Ga0105249_11368996 3300009553 Bacteria 779
204 Ga0157371_10029770 3300013102 Bacteria 3944
205 Ga0157369_10085752 3300013105 Bacteria 3365
206 Ga0157369_10096608 3300013105 Bacteria 3152
207 Ga0157374_10017149 3300013296 Bacteria 6374
208 Ga0157374_10181155 3300013296 Bacteria 2058
209 Ga0157374_10299681 3300013296 Bacteria 1590
210 Ga0157378_10199387 3300013297 Bacteria 1892
211 Ga0157378_10207927 3300013297 Bacteria 1854
212 Ga0163162_10011758 3300013306 Bacteria 8537
213 Ga0163162_10022652 3300013306 Bacteria 6193
214 Ga0163162_10498756 3300013306 Bacteria 1348
215 Ga0163162_10904517 3300013306 Bacteria 996
216 Ga0157375_10065513 3300013308 Bacteria 3622
217 Ga0157375_10074885 3300013308 Bacteria 3408
218 Ga0157375_10094496 3300013308 Bacteria 3059
219 Ga0157375_10136754 3300013308 Bacteria 2575
220 Ga0163163_10009030 3300014325 Bacteria 8882
221 Ga0163163_10227856 3300014325 Bacteria 1912
222 Ga0157380_10332718 3300014326 Bacteria 1413
223 Ga0157377_10001606 3300014745 Bacteria 9840
224 Ga0157377_10150351 3300014745 Bacteria 1439
225 Ga0157377_10189176 3300014745 Bacteria 1300
226 Ga0157377_10200008 3300014745 Bacteria 1268
227 Ga0157379_10003195 3300014968 Bacteria 13882
228 Ga0157379_10009660 3300014968 Bacteria 8396
229 Ga0157379_10020276 3300014968 Bacteria 5878
230 Ga0157379_10065107 3300014968 Bacteria 3258
231 Ga0157376_10012963 3300014969 Bacteria 6207
232 Ga0157376_10097608 3300014969 Bacteria 2560
233 Ga0157376_10148210 3300014969 Bacteria 2113
234 Ga0157376_10149347 3300014969 Bacteria 2106
235 Ga0157376_10345671 3300014969 Bacteria 1422
236 Ga0163161_10106375 3300017792 Bacteria 2093
237 Ga0163161_10139091 3300017792 Bacteria 1837
238 Ga0163161_10158291 3300017792 Bacteria 1726
239 Ga0213872_10020448 3300021361 Bacteria 3051
240 Ga0213876_10116040 3300021384 Bacteria 1421
241 Ga0207425_1000029 3300025245 Bacteria 268521
242 Ga0209129_1000073 3300025258 Bacteria 207709
243 Ga0209565_1000002 3300025263 Bacteria 1423083
244 Ga0209673_1000002 3300025273 Bacteria 1423083
245 Ga0209675_1000002 3300025291 Bacteria 1423083
246 Ga0209025_1000076 3300025294 Bacteria 273934
247 Ga0209564_1000004 3300025295 Bacteria 1424639
248 Ga0209758_1000112 3300025297 Bacteria 207640
249 Ga0209256_1000004 3300025299 Bacteria 1424643
250 Ga0209257_1000240 3300025304 Bacteria 128014
251 Ga0209257_1011292 3300025304 Bacteria 4326
252 Ga0207697_10095893 3300025315 Bacteria 1261
253 Ga0207682_10001538 3300025893 Bacteria 10601
254 Ga0207682_10095022 3300025893 Bacteria 1297
255 Ga0207682_10129917 3300025893 Bacteria 1124
256 Ga0207642_10076775 3300025899 Bacteria 1609
257 Ga0207688_10009583 3300025901 Bacteria 5274
258 Ga0207688_10010106 3300025901 Bacteria 5134
259 Ga0207688_10121996 3300025901 Bacteria 1521
260 Ga0207680_10003124 3300025903 Bacteria 7779
261 Ga0207680_10027205 3300025903 Bacteria 3181
262 Ga0207645_10037373 3300025907 Bacteria 3115
263 Ga0207645_10162816 3300025907 Bacteria 1460
264 Ga0207645_10315642 3300025907 Bacteria 1042
265 Ga0207645_10448489 3300025907 Bacteria 871
266 Ga0207705_10128688 3300025909 Bacteria 1883
267 Ga0207705_10147531 3300025909 Bacteria 1761
268 Ga0207684_10203810 3300025910 Bacteria 1706
269 Ga0207707_10003369 3300025912 Bacteria 14184
270 Ga0207707_10219644 3300025912 Bacteria 1654
271 Ga0207693_10271246 3300025915 Bacteria 1329
272 Ga0207660_10565686 3300025917 Bacteria 925
273 Ga0207660_10770384 3300025917 Bacteria 785
274 Ga0207662_10024890 3300025918 Bacteria 3445
275 Ga0207662_10060053 3300025918 Bacteria 2280
276 Ga0207657_10023139 3300025919 Bacteria 5793
277 Ga0207649_10008468 3300025920 Bacteria 5610
278 Ga0207649_10206550 3300025920 Bacteria 1391
279 Ga0207646_10093779 3300025922 Bacteria 2688
280 Ga0207646_10271991 3300025922 Bacteria 1531
281 Ga0207681_10003019 3300025923 Bacteria 10572
282 Ga0207681_11116183 3300025923 Bacteria 662
283 Ga0207650_10001736 3300025925 Bacteria 15492
284 Ga0207650_10050574 3300025925 Bacteria 3074
285 Ga0207650_10095142 3300025925 Bacteria 2283
286 Ga0207650_10108611 3300025925 Bacteria 2145
287 Ga0207650_10199206 3300025925 Bacteria 1603
288 Ga0207650_10230028 3300025925 Bacteria 1495
289 Ga0207650_10499609 3300025925 Bacteria 1016
290 Ga0207659_10001207 3300025926 Bacteria 15427
291 Ga0207659_10098123 3300025926 Bacteria 2202
292 Ga0207659_10155734 3300025926 Bacteria 1789
293 Ga0207659_10161099 3300025926 Bacteria 1761
294 Ga0207659_10460981 3300025926 Bacteria 1071
295 Ga0207687_10544497 3300025927 Bacteria 973
296 Ga0207644_10015281 3300025931 Bacteria 5149
297 Ga0207644_10167355 3300025931 Bacteria 1713
298 Ga0207644_10227664 3300025931 Bacteria 1480
299 Ga0207644_10292439 3300025931 Bacteria 1310
300 Ga0207690_10073034 3300025932 Bacteria 2371
301 Ga0207690_10507110 3300025932 Bacteria 976
302 Ga0207706_10018813 3300025933 Bacteria 6212
303 Ga0207706_10862107 3300025933 Bacteria 766
304 Ga0207686_10015451 3300025934 Bacteria 4269
305 Ga0207686_10213308 3300025934 Bacteria 1389
306 Ga0207709_10195580 3300025935 Bacteria 1440
307 Ga0207670_10026167 3300025936 Bacteria 3674
308 Ga0207669_10029016 3300025937 Bacteria 3053
309 Ga0207669_10402676 3300025937 Bacteria 1072
310 Ga0207704_10040144 3300025938 Bacteria 2732
311 Ga0207704_10138659 3300025938 Bacteria 1697
312 Ga0207691_10003233 3300025940 Bacteria 15880
313 Ga0207691_10011718 3300025940 Bacteria 8420
314 Ga0207691_10030314 3300025940 Bacteria 5056
315 Ga0207691_10058845 3300025940 Bacteria 3495
316 Ga0207691_10068372 3300025940 Bacteria 3209
317 Ga0207691_10144115 3300025940 Bacteria 2098
318 Ga0207691_10153412 3300025940 Bacteria 2024
319 Ga0207711_10012797 3300025941 Bacteria 6969
320 Ga0207711_10038649 3300025941 Bacteria 4058
321 Ga0207711_10069677 3300025941 Bacteria 3049
322 Ga0207711_10245624 3300025941 Bacteria 1642
323 Ga0207711_10392292 3300025941 Bacteria 1289
324 Ga0207711_10580378 3300025941 Bacteria 1046
325 Ga0207689_10008191 3300025942 Bacteria 9106
326 Ga0207689_10019512 3300025942 Bacteria 5713
327 Ga0207689_10426654 3300025942 Bacteria 1107
328 Ga0207679_10047373 3300025945 Bacteria 3122
329 Ga0207679_10342922 3300025945 Bacteria 1300
330 Ga0207667_10012766 3300025949 Bacteria 9647
331 Ga0207651_10032563 3300025960 Bacteria 3350
332 Ga0207651_10111519 3300025960 Bacteria 2054
333 Ga0207651_10118378 3300025960 Bacteria 2004
334 Ga0207651_10445281 3300025960 Bacteria 1110
335 Ga0207712_10046387 3300025961 Bacteria 3013
336 Ga0207712_10155283 3300025961 Bacteria 1772
337 Ga0207712_10338472 3300025961 Bacteria 1247
338 Ga0207668_10088214 3300025972 Bacteria 2271
339 Ga0207668_10430377 3300025972 Bacteria 1122
340 Ga0207658_10013160 3300025986 Bacteria 5648
341 Ga0207658_10115383 3300025986 Bacteria 2131
342 Ga0207658_10170731 3300025986 Bacteria 1791
343 Ga0207658_10195522 3300025986 Bacteria 1684
344 Ga0207677_10002618 3300026023 Bacteria 9471
345 Ga0207677_10004569 3300026023 Bacteria 7442
346 Ga0207677_10020443 3300026023 Bacteria 4020
347 Ga0207677_10076085 3300026023 Bacteria 2388
348 Ga0207677_10722906 3300026023 Bacteria 885
349 Ga0207703_10001536 3300026035 Bacteria 20983
350 Ga0207703_10005404 3300026035 Bacteria 10281
351 Ga0207703_10013491 3300026035 Bacteria 6367
352 Ga0207703_10032404 3300026035 Bacteria 4136
353 Ga0207678_10049093 3300026067 Bacteria 3647
354 Ga0207678_10511702 3300026067 Bacteria 1047
355 Ga0207708_10179504 3300026075 Bacteria 1681
356 Ga0207641_10005708 3300026088 Bacteria 10582
357 Ga0207641_10014170 3300026088 Bacteria 6533
358 Ga0207641_10081469 3300026088 Bacteria 2810
359 Ga0207641_10123414 3300026088 Bacteria 2315
360 Ga0207641_10188336 3300026088 Bacteria 1895
361 Ga0207648_10004600 3300026089 Bacteria 14146
362 Ga0207648_10070852 3300026089 Bacteria 3039
363 Ga0207648_10076449 3300026089 Bacteria 2919
364 Ga0207648_10083523 3300026089 Bacteria 2785
365 Ga0207648_10433875 3300026089 Bacteria 1194
366 Ga0207676_10003739 3300026095 Bacteria 10764
367 Ga0207676_10013183 3300026095 Bacteria 5935
368 Ga0207676_10054378 3300026095 Bacteria 3138
369 Ga0207676_10066568 3300026095 Bacteria 2874
370 Ga0207676_10137195 3300026095 Bacteria 2089
371 Ga0207676_10193763 3300026095 Bacteria 1790
372 Ga0207674_10619553 3300026116 Bacteria 1045
373 Ga0207674_10716268 3300026116 Bacteria 966
374 Ga0207675_100009740 3300026118 Bacteria 8996
375 Ga0207675_100064275 3300026118 Bacteria 3430
376 Ga0207675_100089018 3300026118 Bacteria 2900
377 Ga0207683_10010102 3300026121 Bacteria 8054
378 Ga0207683_10028082 3300026121 Bacteria 4865
379 Ga0207683_10106102 3300026121 Bacteria 2512
380 Ga0207683_10332109 3300026121 Bacteria 1394
381 Ga0207698_10047683 3300026142 Bacteria 3248
382 Ga0207698_10091925 3300026142 Bacteria 2486
383 Ga0207698_10182845 3300026142 Bacteria 1859
384 Ga0207428_10172893 3300027907 Bacteria 1635
385 Ga0268266_10117253 3300028379 Bacteria 2366
386 Ga0268266_10139206 3300028379 Bacteria 2177
387 Ga0268265_10029377 3300028380 Bacteria 3945
388 Ga0268265_10303745 3300028380 Bacteria 1438
389 Ga0268265_10741846 3300028380 Bacteria 952
390 Ga0268264_10003034 3300028381 Bacteria 14561
391 Ga0268264_10172257 3300028381 Bacteria 1958
392 Ga0268264_10407958 3300028381 Bacteria 1307
393 Ga0268264_10808133 3300028381 Bacteria 937
394 Ga0307515_10004779 3300028794 Bacteria 27729
395 Ga0307515_10513193 3300028794 Bacteria 808
396 Ga0316183_1161157 3300030742 Bacteria 956
397 Ga0316181_1153232 3300030744 Bacteria 2179
398 Ga0316182_1082680 3300030745 Bacteria 1178
399 Ga0265327_10123113 3300031251 Bacteria 1227
400 Ga0307513_10000707 3300031456 Bacteria 48005
401 Ga0307513_10025971 3300031456 Bacteria 6765
402 Ga0307513_10189785 3300031456 Bacteria 1908
403 Ga0307513_10200978 3300031456 Bacteria 1833
404 Ga0307509_10010192 3300031507 Bacteria 11560
405 Ga0307408_100497346 3300031548 Bacteria 1067
406 Ga0307408_100662217 3300031548 Bacteria 935
407 Ga0316575_10000099 3300031665 Bacteria 21246
408 Ga0307407_10325129 3300031903 Bacteria 1081
409 Ga0307412_10192156 3300031911 Bacteria 1544
410 Ga0307409_100000872 3300031995 Bacteria 13959
411 Ga0307409_100633323 3300031995 Bacteria 1061
412 Ga0307416_100307125 3300032002 Bacteria 1580
413 Ga0307414_10011424 3300032004 Bacteria 5206
414 Ga0307414_10532793 3300032004 Bacteria 1044
415 Ga0307411_10091367 3300032005 Bacteria 2126
416 Ga0307510_10021591 3300033180 Bacteria 7502
417 Ga0373948_0007257 3300034817 Bacteria 1859
418 Ga0373950_0011060 3300034818 Bacteria 1469
419 Ga0373958_0041157 3300034819 Bacteria 945
420 Ga0373926_0016947 3300035083 Bacteria 2496
421 Ga0373932_0011613 3300035112 Bacteria 2155
422 Ga0373939_0000174 3300035114 Bacteria 17742
423 Ga0373939_0059719 3300035114 Bacteria 1210
424 Ga0373955_0069436 3300035172 Bacteria 1966
425 Ga0373961_0007035 3300035241 Bacteria 2710
426 Ga0373961_0027035 3300035241 Bacteria 1572
427 Ga0373962_0110627 3300035242 Bacteria 866
428 Ga0373931_0003525 3300035691 Bacteria 7052
429 Ga0373931_0117065 3300035691 Bacteria 1519
430 Ga0373935_0108700 3300035692 Bacteria 1838
431 Ga0373927_0087411 3300035695 Bacteria 2023
432 Ga0373927_0111396 3300035695 Bacteria 1784
433 Ga0373947_0129532 3300035725 Bacteria 1609
434 Ga0373947_0433950 3300035725 Bacteria 889
435 Ga0373937_0259021 3300036401 Bacteria 1640
436 Ga0373937_0565499 3300036401 Bacteria 1080
437 Ga0373925_0034504 3300037068 Bacteria 3729
438 Ga0395899_0000090 3300037312 Bacteria 156587
439 Ga0395899_0010914 3300037312 Bacteria 6961
440 Ga0395900_0125433 3300037418 Bacteria 2633
441 Ga0395898_0005039 3300037466 Bacteria 14322
442 Ga0395901_0000740 3300038443 Bacteria 36904
443 Ga0395901_0087176 3300038443 Bacteria 3264
444 Ga0395901_0226966 3300038443 Bacteria 1950
445 Ga0237819_00873 3300038705 Bacteria 9454
446 Ga0436365_0200616 3300039437 Bacteria 1236
447 Ga0436361_0969963 3300039447 Bacteria 6779
448 Ga0436363_0256062 3300039450 Bacteria 6946
449 Ga0439436_0011766 3300041404 Bacteria 2656
450 Ga0439436_0078628 3300041404 Bacteria 918
451 Ga0439465_0001288 3300041413 Bacteria 8059
452 Ga0451787_284586 3300041441 Bacteria 1204
453 Ga0451791_1038472 3300041451 Bacteria 1178
454 Ga0451797_0360845 3300041453 Bacteria 1540
455 Ga0451807_0061609 3300041486 Bacteria 1269
456 Ga0451807_2454286 3300041486 Bacteria 1896
457 Ga0451841_0167828 3300041498 Bacteria 936
458 Ga0451843_0985837 3300041509 Bacteria 2691
459 Ga0451853_0609165 3300041512 Bacteria 1244
460 Ga0451853_2146327 3300041512 Bacteria 3779
461 Ga0439431_0001243 3300041997 Bacteria 5589
462 Ga0439441_016189 3300042001 Bacteria 1328
463 Ga0439445_0000292 3300042004 Bacteria 9726
464 Ga0439449_0000005 3300042007 Bacteria 81904
465 Ga0439449_0041100 3300042007 Bacteria 1719
466 Ga0439457_049811 3300042014 Bacteria 940
467 Ga0450898_034293 3300042134 Bacteria 942
468 Ga0439435_0028777 3300042436 Bacteria 1496
469 Ga0451577_0040698 3300042876 Bacteria 4172
470 Ga0451577_0421078 3300042876 Bacteria 1213
471 Ga0453683_0444027 3300044673 Bacteria 839
472 Ga0453684_0000531 3300044712 Bacteria 145390
473 Ga0451576_0000212 3300045051 Bacteria 145396
474 Ga0451576_0111912 3300045051 Bacteria 2841
475 Ga0495603_0315144 3300046455 Bacteria 898
476 Ga0495629_0053545 3300046459 Bacteria 2823
477 Ga0495629_0259075 3300046459 Bacteria 1196
478 Ga0495629_0437894 3300046459 Bacteria 886
479 Ga0495638_0072886 3300046460 Bacteria 2097
480 Ga0495580_0189394 3300046472 Bacteria 1419
481 Ga0495580_0359807 3300046472 Bacteria 985
482 Ga0495632_0014399 3300046519 Bacteria 4477
483 Ga0495663_0001626 3300046525 Bacteria 7027
484 Ga0495663_0003320 3300046525 Bacteria 4659
485 Ga0495621_0070545 3300046539 Bacteria 1286
486 Ga0495645_0012490 3300046543 Bacteria 5985
487 Ga0495633_0033342 3300046558 Bacteria 2483
488 Ga0495656_0316579 3300046615 Bacteria 803
489 Ga0495625_0087135 3300046660 Bacteria 2165
490 Ga0495647_0032837 3300046681 Bacteria 1937
491 Ga0495658_0045458 3300046683 Bacteria 2464
492 Ga0495658_0060654 3300046683 Bacteria 2170
493 Ga0495589_0048195 3300046794 Bacteria 2110
494 Ga0495684_0185236 3300047471 Bacteria 1542
495 Ga0496102_0029387 3300048905 Bacteria 4919
496 Ga0496103_0097648 3300048906 Bacteria 1857
497 Ga0496104_0139316 3300048907 Bacteria 2331
498 Ga0496104_0173930 3300048907 Bacteria 2064
499 Ga0496104_0756090 3300048907 Bacteria 879
500 Ga0496105_0111387 3300048908 Bacteria 2259
501 Ga0496107_0063594 3300048910 Bacteria 2674
502 Ga0496108_0030794 3300048911 Bacteria 4446
503 Ga0496108_0059244 3300048911 Bacteria 3220
504 Ga0496110_0005350 3300048913 Bacteria 10055
505 Ga0496112_0530209 3300048915 Bacteria 1112
506 Ga0496114_0040983 3300048917 Bacteria 3837
507 Ga0496114_0213700 3300048917 Bacteria 1692
508 Ga0496114_0412936 3300048917 Bacteria 1195
509 Ga0496121_0021456 3300048924 Bacteria 6323
510 Ga0496125_0031184 3300048928 Bacteria 4755
511 Ga0501039_0374820 3300049575 Bacteria 1118
512 Ga0501069_0142328 3300049585 Bacteria 1376
513 Ga0501070_0349165 3300049586 Bacteria 1201
514 Ga0501076_0017815 3300049592 Bacteria 5401
515 Ga0501216_052921 3300049660 Bacteria 802
516 Ga0501225_0002113 3300049705 Bacteria 6161
517 Ga0501079_0069206 3300049741 Bacteria 2724
518 Ga0501081_0314849 3300049743 Bacteria 1149
519 Ga0501081_0387534 3300049743 Bacteria 1033
520 Ga0501044_0250213 3300049823 Bacteria 1713
521 nmdc:mga00v17_32021_c1 3300050491 Bacteria 3106
522 nmdc:mga00v17_52875_c1 3300050491 Bacteria 2474
523 nmdc:mga06z11_48346_c1 3300050494 Bacteria 2164
524 nmdc:mga05p37_1300_c1 3300050507 Bacteria 29031
525 nmdc:mga09592_2307_c1 3300050508 Bacteria 15395
526 nmdc:mga06r32_2584_c1 3300050510 Bacteria 11554
527 nmdc:mga08y16_447218_c1 3300050511 Bacteria 1318
528 nmdc:mga08x19_418229_c1 3300050514 Bacteria 941
529 nmdc:mga08x19_42890_c1 3300050514 Bacteria 2885
530 nmdc:mga08x19_85606_c1 3300050514 Bacteria 2074
531 nmdc:mga0a205_178378_c1 3300050515 Bacteria 2019
532 Ga0500643_042205 3300053087 Bacteria 1336
533 Ga0500593_064041 3300053117 Bacteria 1610
534 Ga0500634_0000337 3300053161 Bacteria 14953
535 Ga0501084_0004450 3300054114 Bacteria 11443
536 Ga0590075_008069 3300059424 Bacteria 2507
537 Ga0501082_0433436 3300060353 Bacteria 1148

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053117 Ga0500593_064041 Ga0500593_064041_962_1585 179
2 3300044673 Ga0453683_0444027 Ga0453683_0444027_38_709 193
3 3300005289 Ga0065704_10047520 Ga0065704_100475201 202
4 3300005458 Ga0070681_10149583 Ga0070681_101495832 202
5 3300005545 Ga0070695_100624890 Ga0070695_1006248901 202
6 3300005546 Ga0070696_100539831 Ga0070696_1005398311 202
7 3300005549 Ga0070704_100002902 Ga0070704_1000029028 202
8 3300005549 Ga0070704_100806819 Ga0070704_1008068191 202
9 3300006175 Ga0070712_100351661 Ga0070712_1003516611 202
10 3300006844 Ga0075428_100283973 Ga0075428_1002839732 202
11 3300006847 Ga0075431_100001511 Ga0075431_1000015119 202
12 3300006880 Ga0075429_100000694 Ga0075429_10000069415 202
13 3300006914 Ga0075436_100624260 Ga0075436_1006242602 202
14 3300009147 Ga0114129_10055562 Ga0114129_100555623 202
15 3300009148 Ga0105243_10420353 Ga0105243_104203532 202
16 3300014745 Ga0157377_10200008 Ga0157377_102000082 202
17 3300025912 Ga0207707_10219644 Ga0207707_102196442 202
18 3300025915 Ga0207693_10271246 Ga0207693_102712461 202
19 3300035241 Ga0373961_0027035 Ga0373961_0027035_153_770 202
20 3300042001 Ga0439441_016189 Ga0439441_016189_584_1201 202
21 3300050507 nmdc:mga05p37_1300_c1 nmdc:mga05p37_1300_c1_1856_2473 202
22 3300050508 nmdc:mga09592_2307_c1 nmdc:mga09592_2307_c1_14637_15254 202
23 3300050510 nmdc:mga06r32_2584_c1 nmdc:mga06r32_2584_c1_6264_6881 202
24 3300050514 nmdc:mga08x19_42890_c1 nmdc:mga08x19_42890_c1_507_1124 202
25 3300005295 Ga0065707_10295144 Ga0065707_102951441 203
26 3300005331 Ga0070670_100488998 Ga0070670_1004889981 203
27 3300005336 Ga0070680_100343151 Ga0070680_1003431512 203
28 3300005354 Ga0070675_100179406 Ga0070675_1001794062 203
29 3300005444 Ga0070694_100144678 Ga0070694_1001446782 203
30 3300005458 Ga0070681_10001886 Ga0070681_1000188612 203
31 3300005467 Ga0070706_100033891 Ga0070706_1000338912 203
32 3300005468 Ga0070707_100019507 Ga0070707_1000195077 203
33 3300005530 Ga0070679_100495651 Ga0070679_1004956512 203
34 3300005536 Ga0070697_100228964 Ga0070697_1002289642 203
35 3300005545 Ga0070695_100068522 Ga0070695_1000685223 203
36 3300014745 Ga0157377_10150351 Ga0157377_101503512 203
37 3300025901 Ga0207688_10010106 Ga0207688_100101065 203
38 3300025907 Ga0207645_10448489 Ga0207645_104484891 203
39 3300025910 Ga0207684_10203810 Ga0207684_102038102 203
40 3300025912 Ga0207707_10003369 Ga0207707_100033697 203
41 3300025917 Ga0207660_10565686 Ga0207660_105656862 203
42 3300025922 Ga0207646_10093779 Ga0207646_100937793 203
43 3300025923 Ga0207681_11116183 Ga0207681_111161831 203
44 3300025925 Ga0207650_10499609 Ga0207650_104996092 203
45 3300025926 Ga0207659_10155734 Ga0207659_101557342 203
46 3300025931 Ga0207644_10227664 Ga0207644_102276642 203
47 3300025935 Ga0207709_10195580 Ga0207709_101955802 203
48 3300028381 Ga0268264_10808133 Ga0268264_108081332 203
49 3300046472 Ga0495580_0359807 Ga0495580_0359807_203_823 203
50 3300046683 Ga0495658_0060654 Ga0495658_0060654_723_1343 203
51 3300048911 Ga0496108_0059244 Ga0496108_0059244_16_657 203
52 3300048917 Ga0496114_0213700 Ga0496114_0213700_1025_1666 203
53 3300050511 nmdc:mga08y16_447218_c1 nmdc:mga08y16_447218_c1_163_783 203
54 3300049743 Ga0501081_0314849 Ga0501081_0314849_483_1109 204
55 3300005327 Ga0070658_10076359 Ga0070658_100763591 206
56 3300005329 Ga0070683_100082137 Ga0070683_1000821376 206
57 3300005344 Ga0070661_100134064 Ga0070661_1001340644 206
58 3300005535 Ga0070684_100029200 Ga0070684_1000292003 206
59 3300005547 Ga0070693_100035977 Ga0070693_1000359775 206
60 3300005564 Ga0070664_100016797 Ga0070664_1000167976 206
61 3300009174 Ga0105241_10140689 Ga0105241_101406895 206
62 3300013105 Ga0157369_10085752 Ga0157369_100857522 206
63 3300025920 Ga0207649_10008468 Ga0207649_100084684 206
64 3300025945 Ga0207679_10047373 Ga0207679_100473733 206
65 3300050514 nmdc:mga08x19_418229_c1 nmdc:mga08x19_418229_c1_209_931 206
66 3300034817 Ga0373948_0007257 Ga0373948_0007257_1027_1731 207
67 3300034819 Ga0373958_0041157 Ga0373958_0041157_12_704 207
68 3300035112 Ga0373932_0011613 Ga0373932_0011613_942_1646 207
69 3300035114 Ga0373939_0000174 Ga0373939_0000174_15359_16063 207
70 3300035241 Ga0373961_0007035 Ga0373961_0007035_105_809 207
71 3300035691 Ga0373931_0003525 Ga0373931_0003525_6087_6791 207
72 3300037418 Ga0395900_0125433 Ga0395900_0125433_866_1558 207
73 3300038443 Ga0395901_0087176 Ga0395901_0087176_442_1134 207
74 3300005343 Ga0070687_100061789 Ga0070687_1000617894 208
75 3300005367 Ga0070667_100022986 Ga0070667_1000229863 208
76 3300005548 Ga0070665_100565371 Ga0070665_1005653712 208
77 3300005843 Ga0068860_100004324 Ga0068860_10000432411 208
78 3300009098 Ga0105245_10075325 Ga0105245_100753253 208
79 3300025918 Ga0207662_10024890 Ga0207662_100248908 208
80 3300025986 Ga0207658_10170731 Ga0207658_101707312 208
81 3300028381 Ga0268264_10172257 Ga0268264_101722572 208
82 3300035242 Ga0373962_0110627 Ga0373962_0110627_19_723 208
83 3300035691 Ga0373931_0117065 Ga0373931_0117065_609_1301 208
84 3300039450 Ga0436363_0256062 Ga0436363_0256062_1637_2365 208
85 3300045051 Ga0451576_0111912 Ga0451576_0111912_644_1336 208
86 3300005329 Ga0070683_100048721 Ga0070683_1000487215 209
87 3300005334 Ga0068869_100002292 Ga0068869_1000022926 209
88 3300005339 Ga0070660_100021608 Ga0070660_1000216082 209
89 3300005347 Ga0070668_100094447 Ga0070668_1000944472 209
90 3300005353 Ga0070669_100016134 Ga0070669_1000161342 209
91 3300005354 Ga0070675_100006591 Ga0070675_1000065912 209
92 3300005535 Ga0070684_100345758 Ga0070684_1003457582 209
93 3300005563 Ga0068855_100015267 Ga0068855_1000152672 209
94 3300005615 Ga0070702_100038015 Ga0070702_1000380152 209
95 3300005719 Ga0068861_100003994 Ga0068861_1000039949 209
96 3300005841 Ga0068863_100083099 Ga0068863_1000830993 209
97 3300005842 Ga0068858_100031334 Ga0068858_1000313346 209
98 3300005844 Ga0068862_100041938 Ga0068862_1000419383 209
99 3300006358 Ga0068871_100053498 Ga0068871_1000534983 209
100 3300009098 Ga0105245_10009589 Ga0105245_100095896 209
101 3300009177 Ga0105248_10017648 Ga0105248_100176484 209
102 3300009551 Ga0105238_10007971 Ga0105238_100079718 209
103 3300009553 Ga0105249_10103550 Ga0105249_101035505 209
104 3300013102 Ga0157371_10029770 Ga0157371_100297706 209
105 3300013296 Ga0157374_10017149 Ga0157374_100171496 209
106 3300013306 Ga0163162_10022652 Ga0163162_100226524 209
107 3300014745 Ga0157377_10001606 Ga0157377_100016066 209
108 3300014968 Ga0157379_10020276 Ga0157379_100202766 209
109 3300014969 Ga0157376_10012963 Ga0157376_100129634 209
110 3300025893 Ga0207682_10095022 Ga0207682_100950222 209
111 3300025901 Ga0207688_10009583 Ga0207688_100095832 209
112 3300025909 Ga0207705_10128688 Ga0207705_101286883 209
113 3300025919 Ga0207657_10023139 Ga0207657_100231396 209
114 3300025941 Ga0207711_10012797 Ga0207711_100127973 209
115 3300025942 Ga0207689_10008191 Ga0207689_100081916 209
116 3300025949 Ga0207667_10012766 Ga0207667_100127669 209
117 3300025961 Ga0207712_10155283 Ga0207712_101552832 209
118 3300026023 Ga0207677_10002618 Ga0207677_100026184 209
119 3300026035 Ga0207703_10032404 Ga0207703_100324044 209
120 3300026067 Ga0207678_10049093 Ga0207678_100490936 209
121 3300026088 Ga0207641_10081469 Ga0207641_100814692 209
122 3300026095 Ga0207676_10013183 Ga0207676_100131832 209
123 3300026116 Ga0207674_10716268 Ga0207674_107162682 209
124 3300026118 Ga0207675_100009740 Ga0207675_1000097406 209
125 3300028380 Ga0268265_10029377 Ga0268265_100293773 209
126 3300034818 Ga0373950_0011060 Ga0373950_0011060_512_1204 209
127 3300035114 Ga0373939_0059719 Ga0373939_0059719_465_1157 209
128 3300048905 Ga0496102_0029387 Ga0496102_0029387_4175_4867 209
129 3300048906 Ga0496103_0097648 Ga0496103_0097648_576_1268 209
130 3300048907 Ga0496104_0173930 Ga0496104_0173930_473_1165 209
131 3300048908 Ga0496105_0111387 Ga0496105_0111387_609_1301 209
132 3300048910 Ga0496107_0063594 Ga0496107_0063594_1612_2304 209
133 3300048911 Ga0496108_0030794 Ga0496108_0030794_877_1569 209
134 3300048913 Ga0496110_0005350 Ga0496110_0005350_3676_4368 209
135 3300005616 Ga0068852_100221735 Ga0068852_1002217353 211
136 3300037312 Ga0395899_0010914 Ga0395899_0010914_1994_2692 211
137 3300037466 Ga0395898_0005039 Ga0395898_0005039_8776_9474 211
138 3300038443 Ga0395901_0226966 Ga0395901_0226966_501_1199 211
139 3300005338 Ga0068868_100028768 Ga0068868_1000287682 212
140 3300006237 Ga0097621_100244702 Ga0097621_1002447022 212
141 3300006358 Ga0068871_100061637 Ga0068871_1000616372 212
142 3300009176 Ga0105242_10322652 Ga0105242_103226522 212
143 3300025934 Ga0207686_10213308 Ga0207686_102133082 212
144 3300026023 Ga0207677_10004569 Ga0207677_100045696 212
145 3300026089 Ga0207648_10076449 Ga0207648_100764492 212
146 3300005334 Ga0068869_100057427 Ga0068869_1000574272 213
147 3300005343 Ga0070687_100023721 Ga0070687_1000237212 213
148 3300005347 Ga0070668_100012013 Ga0070668_1000120132 213
149 3300005353 Ga0070669_100008268 Ga0070669_1000082686 213
150 3300005356 Ga0070674_100023274 Ga0070674_1000232742 213
151 3300005364 Ga0070673_100124939 Ga0070673_1001249392 213
152 3300005367 Ga0070667_100049799 Ga0070667_1000497996 213
153 3300005438 Ga0070701_10075820 Ga0070701_100758202 213
154 3300005455 Ga0070663_100081916 Ga0070663_1000819163 213
155 3300005459 Ga0068867_100003015 Ga0068867_1000030157 213
156 3300005539 Ga0068853_100380235 Ga0068853_1003802352 213
157 3300005617 Ga0068859_100060700 Ga0068859_1000607004 213
158 3300005718 Ga0068866_10003719 Ga0068866_100037193 213
159 3300005719 Ga0068861_100037899 Ga0068861_1000378995 213
160 3300005842 Ga0068858_100023326 Ga0068858_1000233264 213
161 3300005843 Ga0068860_100061504 Ga0068860_1000615043 213
162 3300006881 Ga0068865_100015272 Ga0068865_1000152723 213
163 3300006931 Ga0097620_100060699 Ga0097620_1000606994 213
164 3300009148 Ga0105243_10081213 Ga0105243_100812133 213
165 3300009553 Ga0105249_10005385 Ga0105249_100053855 213
166 3300013306 Ga0163162_10011758 Ga0163162_100117587 213
167 3300014968 Ga0157379_10009660 Ga0157379_100096607 213
168 3300014969 Ga0157376_10345671 Ga0157376_103456712 213
169 3300021361 Ga0213872_10020448 Ga0213872_100204484 213
170 3300025901 Ga0207688_10121996 Ga0207688_101219962 213
171 3300025903 Ga0207680_10027205 Ga0207680_100272054 213
172 3300025907 Ga0207645_10037373 Ga0207645_100373735 213
173 3300025918 Ga0207662_10060053 Ga0207662_100600532 213
174 3300025923 Ga0207681_10003019 Ga0207681_100030194 213
175 3300025932 Ga0207690_10507110 Ga0207690_105071101 213
176 3300025933 Ga0207706_10018813 Ga0207706_100188134 213
177 3300025938 Ga0207704_10040144 Ga0207704_100401443 213
178 3300025941 Ga0207711_10038649 Ga0207711_100386494 213
179 3300025960 Ga0207651_10445281 Ga0207651_104452812 213
180 3300025961 Ga0207712_10046387 Ga0207712_100463871 213
181 3300025986 Ga0207658_10013160 Ga0207658_100131606 213
182 3300026035 Ga0207703_10005404 Ga0207703_100054047 213
183 3300026088 Ga0207641_10005708 Ga0207641_100057082 213
184 3300026089 Ga0207648_10070852 Ga0207648_100708522 213
185 3300026118 Ga0207675_100064275 Ga0207675_1000642752 213
186 3300028380 Ga0268265_10303745 Ga0268265_103037452 213
187 3300028381 Ga0268264_10003034 Ga0268264_1000303410 213
188 3300039447 Ga0436361_0969963 Ga0436361_0969963_5352_6047 213
189 3300042436 Ga0439435_0028777 Ga0439435_0028777_322_1014 214
190 3300005339 Ga0070660_100082046 Ga0070660_1000820463 215
191 3300005564 Ga0070664_100008503 Ga0070664_1000085038 215
192 iso_pu_bacteria 2643221609 2644061357 216
193 iso_pu_bacteria 2643221611 2644076598 216
194 3300005347 Ga0070668_100434819 Ga0070668_1004348191 219
195 3300005546 Ga0070696_100044619 Ga0070696_1000446192 219
196 3300006914 Ga0075436_100101677 Ga0075436_1001016772 219
197 3300009094 Ga0111539_10605415 Ga0111539_106054152 219
198 3300030742 Ga0316183_1161157 Ga0316183_11611572 219
199 3300031548 Ga0307408_100662217 Ga0307408_1006622171 219
200 3300031903 Ga0307407_10325129 Ga0307407_103251291 219
201 3300035083 Ga0373926_0016947 Ga0373926_0016947_1733_2425 219
202 3300035692 Ga0373935_0108700 Ga0373935_0108700_29_721 219
203 3300035695 Ga0373927_0087411 Ga0373927_0087411_689_1381 219
204 3300035725 Ga0373947_0129532 Ga0373947_0129532_867_1559 219
205 3300037068 Ga0373925_0034504 Ga0373925_0034504_1459_2151 219
206 3300050514 nmdc:mga08x19_85606_c1 nmdc:mga08x19_85606_c1_589_1317 219
207 3300050515 nmdc:mga0a205_178378_c1 nmdc:mga0a205_178378_c1_1303_1995 219
208 3300005293 Ga0065715_10144662 Ga0065715_101446621 220
209 3300005327 Ga0070658_10132516 Ga0070658_101325163 220
210 3300005327 Ga0070658_10144630 Ga0070658_101446302 220
211 3300005328 Ga0070676_10185903 Ga0070676_101859031 220
212 3300005328 Ga0070676_10338872 Ga0070676_103388722 220
213 3300005331 Ga0070670_100004050 Ga0070670_1000040504 220
214 3300005331 Ga0070670_100025326 Ga0070670_10002532610 220
215 3300005331 Ga0070670_100194202 Ga0070670_1001942022 220
216 3300005331 Ga0070670_100214101 Ga0070670_1002141012 220
217 3300005333 Ga0070677_10050908 Ga0070677_100509082 220
218 3300005333 Ga0070677_10088667 Ga0070677_100886673 220
219 3300005334 Ga0068869_100047188 Ga0068869_1000471883 220
220 3300005335 Ga0070666_10021839 Ga0070666_100218393 220
221 3300005338 Ga0068868_100004360 Ga0068868_1000043604 220
222 3300005338 Ga0068868_100096926 Ga0068868_1000969261 220
223 3300005340 Ga0070689_100233147 Ga0070689_1002331472 220
224 3300005340 Ga0070689_100321859 Ga0070689_1003218593 220
225 3300005347 Ga0070668_100490661 Ga0070668_1004906611 220
226 3300005353 Ga0070669_100356473 Ga0070669_1003564732 220
227 3300005353 Ga0070669_100518619 Ga0070669_1005186192 220
228 3300005354 Ga0070675_100000837 Ga0070675_10000083718 220
229 3300005354 Ga0070675_100058732 Ga0070675_1000587322 220
230 3300005354 Ga0070675_100073780 Ga0070675_1000737803 220
231 3300005354 Ga0070675_100095013 Ga0070675_1000950132 220
232 3300005354 Ga0070675_100858615 Ga0070675_1008586151 220
233 3300005355 Ga0070671_100015493 Ga0070671_1000154938 220
234 3300005355 Ga0070671_100055182 Ga0070671_1000551823 220
235 3300005355 Ga0070671_100396326 Ga0070671_1003963262 220
236 3300005355 Ga0070671_100401519 Ga0070671_1004015192 220
237 3300005356 Ga0070674_100078528 Ga0070674_1000785282 220
238 3300005356 Ga0070674_100148694 Ga0070674_1001486942 220
239 3300005356 Ga0070674_100364809 Ga0070674_1003648091 220
240 3300005356 Ga0070674_100666645 Ga0070674_1006666451 220
241 3300005364 Ga0070673_100006166 Ga0070673_1000061663 220
242 3300005364 Ga0070673_100107740 Ga0070673_1001077403 220
243 3300005365 Ga0070688_100028965 Ga0070688_1000289652 220
244 3300005365 Ga0070688_100168778 Ga0070688_1001687782 220
245 3300005367 Ga0070667_100092033 Ga0070667_1000920334 220
246 3300005367 Ga0070667_100122418 Ga0070667_1001224183 220
247 3300005439 Ga0070711_100350460 Ga0070711_1003504601 220
248 3300005441 Ga0070700_100486376 Ga0070700_1004863761 220
249 3300005456 Ga0070678_100016836 Ga0070678_1000168365 220
250 3300005456 Ga0070678_100092981 Ga0070678_1000929813 220
251 3300005456 Ga0070678_100103082 Ga0070678_1001030822 220
252 3300005456 Ga0070678_100106305 Ga0070678_1001063052 220
253 3300005456 Ga0070678_100401767 Ga0070678_1004017672 220
254 3300005457 Ga0070662_100055315 Ga0070662_1000553151 220
255 3300005457 Ga0070662_100970216 Ga0070662_1009702161 220
256 3300005459 Ga0068867_100015341 Ga0068867_1000153414 220
257 3300005459 Ga0068867_100223481 Ga0068867_1002234814 220
258 3300005459 Ga0068867_100468363 Ga0068867_1004683632 220
259 3300005466 Ga0070685_10228878 Ga0070685_102288781 220
260 3300005543 Ga0070672_100015809 Ga0070672_1000158094 220
261 3300005543 Ga0070672_100017240 Ga0070672_1000172402 220
262 3300005543 Ga0070672_100050834 Ga0070672_1000508344 220
263 3300005543 Ga0070672_100105205 Ga0070672_1001052053 220
264 3300005543 Ga0070672_100133513 Ga0070672_1001335132 220
265 3300005543 Ga0070672_100162882 Ga0070672_1001628821 220
266 3300005543 Ga0070672_100519421 Ga0070672_1005194212 220
267 3300005544 Ga0070686_100021820 Ga0070686_1000218204 220
268 3300005564 Ga0070664_100084357 Ga0070664_1000843575 220
269 3300005564 Ga0070664_100151213 Ga0070664_1001512134 220
270 3300005564 Ga0070664_100359954 Ga0070664_1003599541 220
271 3300005564 Ga0070664_100495309 Ga0070664_1004953092 220
272 3300005616 Ga0068852_100081356 Ga0068852_1000813563 220
273 3300005616 Ga0068852_100085490 Ga0068852_1000854905 220
274 3300005616 Ga0068852_100145575 Ga0068852_1001455752 220
275 3300005617 Ga0068859_100002428 Ga0068859_10000242818 220
276 3300005618 Ga0068864_100001744 Ga0068864_10000174417 220
277 3300005618 Ga0068864_100037502 Ga0068864_1000375023 220
278 3300005618 Ga0068864_100045250 Ga0068864_1000452502 220
279 3300005618 Ga0068864_100074311 Ga0068864_1000743112 220
280 3300005618 Ga0068864_100373647 Ga0068864_1003736472 220
281 3300005719 Ga0068861_100148256 Ga0068861_1001482562 220
282 3300005834 Ga0068851_10028520 Ga0068851_100285203 220
283 3300005841 Ga0068863_100148771 Ga0068863_1001487712 220
284 3300005841 Ga0068863_100732932 Ga0068863_1007329322 220
285 3300005842 Ga0068858_100000302 Ga0068858_10000030217 220
286 3300005842 Ga0068858_100051535 Ga0068858_1000515352 220
287 3300005843 Ga0068860_100392489 Ga0068860_1003924892 220
288 3300005844 Ga0068862_100076009 Ga0068862_1000760093 220
289 3300006058 Ga0075432_10011351 Ga0075432_100113512 220
290 3300006177 Ga0075362_10182102 Ga0075362_101821022 220
291 3300006237 Ga0097621_100018079 Ga0097621_1000180796 220
292 3300006237 Ga0097621_100230483 Ga0097621_1002304832 220
293 3300006237 Ga0097621_100243542 Ga0097621_1002435422 220
294 3300006358 Ga0068871_100010784 Ga0068871_1000107842 220
295 3300006358 Ga0068871_100021878 Ga0068871_1000218785 220
296 3300006358 Ga0068871_100164176 Ga0068871_1001641763 220
297 3300006358 Ga0068871_100303294 Ga0068871_1003032942 220
298 3300006846 Ga0075430_100140557 Ga0075430_1001405572 220
299 3300006881 Ga0068865_100185299 Ga0068865_1001852992 220
300 3300006881 Ga0068865_100449847 Ga0068865_1004498472 220
301 3300006931 Ga0097620_100002428 Ga0097620_10000242818 220
302 3300009176 Ga0105242_10029090 Ga0105242_100290903 220
303 3300009177 Ga0105248_10007457 Ga0105248_1000745710 220
304 3300009177 Ga0105248_10031929 Ga0105248_100319297 220
305 3300009177 Ga0105248_10129182 Ga0105248_101291822 220
306 3300009177 Ga0105248_10208032 Ga0105248_102080323 220
307 3300009177 Ga0105248_10211154 Ga0105248_102111543 220
308 3300009551 Ga0105238_11229550 Ga0105238_112295501 220
309 3300009553 Ga0105249_10427983 Ga0105249_104279832 220
310 3300009553 Ga0105249_11368996 Ga0105249_113689961 220
311 3300013105 Ga0157369_10096608 Ga0157369_100966082 220
312 3300013296 Ga0157374_10181155 Ga0157374_101811553 220
313 3300013296 Ga0157374_10299681 Ga0157374_102996812 220
314 3300013297 Ga0157378_10199387 Ga0157378_101993873 220
315 3300013297 Ga0157378_10207927 Ga0157378_102079272 220
316 3300013306 Ga0163162_10498756 Ga0163162_104987561 220
317 3300013306 Ga0163162_10904517 Ga0163162_109045172 220
318 3300013308 Ga0157375_10065513 Ga0157375_100655134 220
319 3300013308 Ga0157375_10074885 Ga0157375_100748854 220
320 3300013308 Ga0157375_10094496 Ga0157375_100944964 220
321 3300013308 Ga0157375_10136754 Ga0157375_101367543 220
322 3300014325 Ga0163163_10009030 Ga0163163_100090303 220
323 3300014325 Ga0163163_10227856 Ga0163163_102278562 220
324 3300014326 Ga0157380_10332718 Ga0157380_103327182 220
325 3300014745 Ga0157377_10189176 Ga0157377_101891762 220
326 3300014968 Ga0157379_10003195 Ga0157379_100031954 220
327 3300014968 Ga0157379_10065107 Ga0157379_100651071 220
328 3300014969 Ga0157376_10097608 Ga0157376_100976083 220
329 3300014969 Ga0157376_10148210 Ga0157376_101482102 220
330 3300014969 Ga0157376_10149347 Ga0157376_101493472 220
331 3300017792 Ga0163161_10139091 Ga0163161_101390912 220
332 3300021384 Ga0213876_10116040 Ga0213876_101160402 220
333 3300025315 Ga0207697_10095893 Ga0207697_100958932 220
334 3300025893 Ga0207682_10001538 Ga0207682_100015389 220
335 3300025893 Ga0207682_10129917 Ga0207682_101299172 220
336 3300025899 Ga0207642_10076775 Ga0207642_100767752 220
337 3300025903 Ga0207680_10003124 Ga0207680_100031247 220
338 3300025907 Ga0207645_10162816 Ga0207645_101628162 220
339 3300025907 Ga0207645_10315642 Ga0207645_103156421 220
340 3300025909 Ga0207705_10147531 Ga0207705_101475313 220
341 3300025917 Ga0207660_10770384 Ga0207660_107703841 220
342 3300025920 Ga0207649_10206550 Ga0207649_102065502 220
343 3300025925 Ga0207650_10001736 Ga0207650_100017368 220
344 3300025925 Ga0207650_10050574 Ga0207650_100505743 220
345 3300025925 Ga0207650_10095142 Ga0207650_100951422 220
346 3300025925 Ga0207650_10108611 Ga0207650_101086112 220
347 3300025925 Ga0207650_10199206 Ga0207650_101992062 220
348 3300025925 Ga0207650_10230028 Ga0207650_102300284 220
349 3300025926 Ga0207659_10001207 Ga0207659_1000120719 220
350 3300025926 Ga0207659_10098123 Ga0207659_100981234 220
351 3300025926 Ga0207659_10161099 Ga0207659_101610993 220
352 3300025926 Ga0207659_10460981 Ga0207659_104609812 220
353 3300025927 Ga0207687_10544497 Ga0207687_105444973 220
354 3300025931 Ga0207644_10015281 Ga0207644_100152816 220
355 3300025931 Ga0207644_10167355 Ga0207644_101673552 220
356 3300025931 Ga0207644_10292439 Ga0207644_102924391 220
357 3300025932 Ga0207690_10073034 Ga0207690_100730342 220
358 3300025933 Ga0207706_10862107 Ga0207706_108621071 220
359 3300025934 Ga0207686_10015451 Ga0207686_100154513 220
360 3300025936 Ga0207670_10026167 Ga0207670_100261674 220
361 3300025937 Ga0207669_10029016 Ga0207669_100290163 220
362 3300025937 Ga0207669_10402676 Ga0207669_104026761 220
363 3300025938 Ga0207704_10138659 Ga0207704_101386592 220
364 3300025940 Ga0207691_10003233 Ga0207691_1000323316 220
365 3300025940 Ga0207691_10011718 Ga0207691_100117182 220
366 3300025940 Ga0207691_10030314 Ga0207691_100303145 220
367 3300025940 Ga0207691_10058845 Ga0207691_100588453 220
368 3300025940 Ga0207691_10068372 Ga0207691_100683723 220
369 3300025940 Ga0207691_10144115 Ga0207691_101441153 220
370 3300025940 Ga0207691_10153412 Ga0207691_101534123 220
371 3300025941 Ga0207711_10069677 Ga0207711_100696772 220
372 3300025941 Ga0207711_10245624 Ga0207711_102456242 220
373 3300025941 Ga0207711_10392292 Ga0207711_103922923 220
374 3300025941 Ga0207711_10580378 Ga0207711_105803782 220
375 3300025942 Ga0207689_10019512 Ga0207689_100195123 220
376 3300025942 Ga0207689_10426654 Ga0207689_104266542 220
377 3300025945 Ga0207679_10342922 Ga0207679_103429221 220
378 3300025960 Ga0207651_10032563 Ga0207651_100325634 220
379 3300025960 Ga0207651_10111519 Ga0207651_101115192 220
380 3300025960 Ga0207651_10118378 Ga0207651_101183784 220
381 3300025961 Ga0207712_10338472 Ga0207712_103384723 220
382 3300025972 Ga0207668_10430377 Ga0207668_104303771 220
383 3300025986 Ga0207658_10115383 Ga0207658_101153832 220
384 3300025986 Ga0207658_10195522 Ga0207658_101955223 220
385 3300026023 Ga0207677_10020443 Ga0207677_100204432 220
386 3300026023 Ga0207677_10076085 Ga0207677_100760852 220
387 3300026023 Ga0207677_10722906 Ga0207677_107229061 220
388 3300026035 Ga0207703_10001536 Ga0207703_1000153621 220
389 3300026035 Ga0207703_10013491 Ga0207703_100134916 220
390 3300026067 Ga0207678_10511702 Ga0207678_105117022 220
391 3300026075 Ga0207708_10179504 Ga0207708_101795042 220
392 3300026088 Ga0207641_10014170 Ga0207641_100141708 220
393 3300026088 Ga0207641_10123414 Ga0207641_101234142 220
394 3300026088 Ga0207641_10188336 Ga0207641_101883363 220
395 3300026089 Ga0207648_10004600 Ga0207648_100046004 220
396 3300026089 Ga0207648_10083523 Ga0207648_100835233 220
397 3300026089 Ga0207648_10433875 Ga0207648_104338752 220
398 3300026095 Ga0207676_10003739 Ga0207676_100037396 220
399 3300026095 Ga0207676_10066568 Ga0207676_100665682 220
400 3300026095 Ga0207676_10137195 Ga0207676_101371952 220
401 3300026095 Ga0207676_10193763 Ga0207676_101937633 220
402 3300026116 Ga0207674_10619553 Ga0207674_106195531 220
403 3300026118 Ga0207675_100089018 Ga0207675_1000890182 220
404 3300026121 Ga0207683_10010102 Ga0207683_100101021 220
405 3300026121 Ga0207683_10028082 Ga0207683_100280825 220
406 3300026121 Ga0207683_10106102 Ga0207683_101061022 220
407 3300026121 Ga0207683_10332109 Ga0207683_103321092 220
408 3300026142 Ga0207698_10047683 Ga0207698_100476834 220
409 3300026142 Ga0207698_10091925 Ga0207698_100919254 220
410 3300026142 Ga0207698_10182845 Ga0207698_101828452 220
411 3300027907 Ga0207428_10172893 Ga0207428_101728931 220
412 3300028379 Ga0268266_10117253 Ga0268266_101172532 220
413 3300028380 Ga0268265_10741846 Ga0268265_107418462 220
414 3300028381 Ga0268264_10407958 Ga0268264_104079582 220
415 3300028794 Ga0307515_10004779 Ga0307515_1000477918 220
416 3300028794 Ga0307515_10513193 Ga0307515_105131931 220
417 3300030745 Ga0316182_1082680 Ga0316182_10826802 220
418 3300031251 Ga0265327_10123113 Ga0265327_101231132 220
419 3300031456 Ga0307513_10025971 Ga0307513_100259712 220
420 3300031507 Ga0307509_10010192 Ga0307509_100101922 220
421 3300031911 Ga0307412_10192156 Ga0307412_101921562 220
422 3300031995 Ga0307409_100000872 Ga0307409_1000008722 220
423 3300031995 Ga0307409_100633323 Ga0307409_1006333232 220
424 3300032002 Ga0307416_100307125 Ga0307416_1003071251 220
425 3300032005 Ga0307411_10091367 Ga0307411_100913672 220
426 3300033180 Ga0307510_10021591 Ga0307510_100215916 220
427 3300035172 Ga0373955_0069436 Ga0373955_0069436_1032_1724 220
428 3300035695 Ga0373927_0111396 Ga0373927_0111396_102_794 220
429 3300035725 Ga0373947_0433950 Ga0373947_0433950_73_765 220
430 3300036401 Ga0373937_0259021 Ga0373937_0259021_772_1464 220
431 3300036401 Ga0373937_0565499 Ga0373937_0565499_81_773 220
432 3300037312 Ga0395899_0000090 Ga0395899_0000090_36520_37224 220
433 3300038443 Ga0395901_0000740 Ga0395901_0000740_7891_8583 220
434 3300039437 Ga0436365_0200616 Ga0436365_0200616_181_885 220
435 3300041512 Ga0451853_0609165 Ga0451853_0609165_248_940 220
436 3300041512 Ga0451853_2146327 Ga0451853_2146327_2140_2832 220
437 3300041997 Ga0439431_0001243 Ga0439431_0001243_960_1652 220
438 3300042134 Ga0450898_034293 Ga0450898_034293_145_837 220
439 3300046455 Ga0495603_0315144 Ga0495603_0315144_73_873 220
440 3300046459 Ga0495629_0053545 Ga0495629_0053545_2071_2763 220
441 3300046459 Ga0495629_0259075 Ga0495629_0259075_221_1000 220
442 3300046459 Ga0495629_0437894 Ga0495629_0437894_163_855 220
443 3300046472 Ga0495580_0189394 Ga0495580_0189394_295_987 220
444 3300046539 Ga0495621_0070545 Ga0495621_0070545_117_809 220
445 3300046543 Ga0495645_0012490 Ga0495645_0012490_1374_2066 220
446 3300046615 Ga0495656_0316579 Ga0495656_0316579_31_723 220
447 3300046660 Ga0495625_0087135 Ga0495625_0087135_579_1283 220
448 3300046681 Ga0495647_0032837 Ga0495647_0032837_471_1250 220
449 3300046683 Ga0495658_0045458 Ga0495658_0045458_1526_2218 220
450 3300047471 Ga0495684_0185236 Ga0495684_0185236_238_930 220
451 3300048907 Ga0496104_0139316 Ga0496104_0139316_1143_1835 220
452 3300048907 Ga0496104_0756090 Ga0496104_0756090_55_747 220
453 3300048917 Ga0496114_0040983 Ga0496114_0040983_2027_2719 220
454 3300048917 Ga0496114_0412936 Ga0496114_0412936_85_777 220
455 3300049575 Ga0501039_0374820 Ga0501039_0374820_332_1036 220
456 3300049585 Ga0501069_0142328 Ga0501069_0142328_283_975 220
457 3300049586 Ga0501070_0349165 Ga0501070_0349165_483_1175 220
458 3300049592 Ga0501076_0017815 Ga0501076_0017815_1860_2552 220
459 3300049660 Ga0501216_052921 Ga0501216_052921_60_764 220
460 3300049741 Ga0501079_0069206 Ga0501079_0069206_1739_2431 220
461 3300049743 Ga0501081_0387534 Ga0501081_0387534_136_828 220
462 3300054114 Ga0501084_0004450 Ga0501084_0004450_8364_9056 220
463 3300059424 Ga0590075_008069 Ga0590075_008069_470_1174 220
464 3300060353 Ga0501082_0433436 Ga0501082_0433436_293_985 220
465 iso_pu_bacteria 2643221550 2643774043 220
466 iso_pu_bacteria 2643221564 2643838688 220
467 iso_pu_bacteria 2937843397 2937846699 220
468 3300005468 Ga0070707_100140874 Ga0070707_1001408742 221
469 3300025922 Ga0207646_10271991 Ga0207646_102719912 221
470 3300031548 Ga0307408_100497346 Ga0307408_1004973461 221
471 iso_pu_bacteria 2643221734 2644733130 221
472 iso_pu_bacteria 2917699015 2917700573 221
473 3300005981 Ga0081538_10001621 Ga0081538_1000162116 222
474 3300032004 Ga0307414_10532793 Ga0307414_105327931 222
475 3300050494 nmdc:mga06z11_48346_c1 nmdc:mga06z11_48346_c1_19_759 222
476 3300006931 Ga0097620_100076466 Ga0097620_1000764663 223
477 3300009177 Ga0105248_10812602 Ga0105248_108126022 223
478 3300026095 Ga0207676_10054378 Ga0207676_100543783 223
479 3300048915 Ga0496112_0530209 Ga0496112_0530209_71_766 223
480 3300049823 Ga0501044_0250213 Ga0501044_0250213_239_940 223
481 iso_pu_bacteria 2941489479 2941493116 223
482 iso_pu_bacteria 2995948881 2995949203 223
483 3300025304 Ga0209257_1011292 Ga0209257_10112924 225
484 3300031665 Ga0316575_10000099 Ga0316575_100000995 225
485 3300041498 Ga0451841_0167828 Ga0451841_0167828_207_917 225
486 3300042876 Ga0451577_0040698 Ga0451577_0040698_2434_3159 225
487 3300042876 Ga0451577_0421078 Ga0451577_0421078_422_1120 225
488 3300044712 Ga0453684_0000531 Ga0453684_0000531_104420_105118 225
489 3300045051 Ga0451576_0000212 Ga0451576_0000212_104426_105124 225
490 3300046794 Ga0495589_0048195 Ga0495589_0048195_851_1582 225
491 iso_pu_bacteria 2848694841 2848699951 225
492 iso_pu_bacteria 2919513703 2919514364 225
493 iso_pu_bacteria 2919675420 2919677696 225
494 3300003771 Ga0055526_1000003 Ga0055526_1000003318 227
495 3300003773 Ga0055537_1000153 Ga0055537_10001534 227
496 3300003775 Ga0055524_1000002 Ga0055524_100000248 227
497 3300003784 Ga0055534_1000050 Ga0055534_100005034 227
498 3300003790 Ga0055528_1000001 Ga0055528_100000148 227
499 3300025263 Ga0209565_1000002 Ga0209565_1000002530 227
500 3300025273 Ga0209673_1000002 Ga0209673_1000002530 227
501 3300025291 Ga0209675_1000002 Ga0209675_1000002530 227
502 3300025295 Ga0209564_1000004 Ga0209564_1000004531 227
503 3300025299 Ga0209256_1000004 Ga0209256_1000004531 227
504 3300041404 Ga0439436_0011766 Ga0439436_0011766_1871_2581 227
505 3300041486 Ga0451807_0061609 Ga0451807_0061609_35_736 227
506 3300048924 Ga0496121_0021456 Ga0496121_0021456_533_1246 227
507 3300002773 JGI25152J39213_1000439 JGI25152J39213_10004392 229
508 3300002774 JGI25150J39212_1004101 JGI25150J39212_10041012 229
509 3300003187 JGI25151J46595_10000810 JGI25151J46595_100008102 229
510 3300003215 JGI25153J46596_10000499 JGI25153J46596_100004992 229
511 3300005347 Ga0070668_100032116 Ga0070668_1000321163 229
512 3300005548 Ga0070665_100186683 Ga0070665_1001866833 229
513 3300017792 Ga0163161_10106375 Ga0163161_101063752 229
514 3300017792 Ga0163161_10158291 Ga0163161_101582913 229
515 3300025245 Ga0207425_1000029 Ga0207425_100002992 229
516 3300025258 Ga0209129_1000073 Ga0209129_1000073143 229
517 3300025294 Ga0209025_1000076 Ga0209025_100007696 229
518 3300025297 Ga0209758_1000112 Ga0209758_100011232 229
519 3300025304 Ga0209257_1000240 Ga0209257_100024071 229
520 3300025972 Ga0207668_10088214 Ga0207668_100882142 229
521 3300028379 Ga0268266_10139206 Ga0268266_101392062 229
522 3300030744 Ga0316181_1153232 Ga0316181_11532322 229
523 3300031456 Ga0307513_10000707 Ga0307513_1000070725 229
524 3300031456 Ga0307513_10189785 Ga0307513_101897852 229
525 3300031456 Ga0307513_10200978 Ga0307513_102009783 229
526 3300032004 Ga0307414_10011424 Ga0307414_100114242 229
527 3300038705 Ga0237819_00873 Ga0237819_00873_1150_1839 229
528 3300041404 Ga0439436_0078628 Ga0439436_0078628_158_856 229
529 3300041413 Ga0439465_0001288 Ga0439465_0001288_1720_2421 229
530 3300041441 Ga0451787_284586 Ga0451787_284586_297_1013 229
531 3300041451 Ga0451791_1038472 Ga0451791_1038472_126_839 229
532 3300041453 Ga0451797_0360845 Ga0451797_0360845_490_1203 229
533 3300041486 Ga0451807_2454286 Ga0451807_2454286_854_1567 229
534 3300041509 Ga0451843_0985837 Ga0451843_0985837_824_1537 229
535 3300042004 Ga0439445_0000292 Ga0439445_0000292_2347_3060 229
536 3300042007 Ga0439449_0000005 Ga0439449_0000005_39274_39975 229
537 3300042007 Ga0439449_0041100 Ga0439449_0041100_832_1548 229
538 3300042014 Ga0439457_049811 Ga0439457_049811_84_800 229
539 3300046460 Ga0495638_0072886 Ga0495638_0072886_1092_1808 229
540 3300046519 Ga0495632_0014399 Ga0495632_0014399_313_1002 229
541 3300046525 Ga0495663_0001626 Ga0495663_0001626_4774_5463 229
542 3300046525 Ga0495663_0003320 Ga0495663_0003320_2507_3223 229
543 3300046558 Ga0495633_0033342 Ga0495633_0033342_1465_2154 229
544 3300048928 Ga0496125_0031184 Ga0496125_0031184_2533_3243 229
545 3300049705 Ga0501225_0002113 Ga0501225_0002113_519_1322 229
546 3300050491 nmdc:mga00v17_32021_c1 nmdc:mga00v17_32021_c1_2391_3086 229
547 3300050491 nmdc:mga00v17_52875_c1 nmdc:mga00v17_52875_c1_1597_2292 229
548 3300053087 Ga0500643_042205 Ga0500643_042205_284_973 229
549 3300053161 Ga0500634_0000337 Ga0500634_0000337_11627_12316 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

36

116

0.93

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

162

227

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

44

117

0.92

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

145

232

0.91

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

156

236

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

40

120

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9827 1 204
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9797 1 202
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9733 1 204
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9685 3 203
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9684 1 203
ID Description Score Start End Superfamily
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9976 1 84 3.40.30.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9941 3 86 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9744 1 84 3.40.30.10
4mf6A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9734 2 85 3.40.30.10
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 2 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A522J4D5-F1-model_v4 Thiol:disulfide oxidoreductase 1.003 1 84
AF-A0A455UEY7-F1-model_v4 GST N-terminal domain-containing protein 1 1 79
AF-A0A3D5Y447-F1-model_v4 Thiol:disulfide oxidoreductase 0.9998 1 71
AF-A0A379S1X3-F1-model_v4 Glutathione-S transferase 0.9991 1 84 GO:0015036
GO:0016740
AF-A0A6G4BI85-F1-model_v4 deleted 0.998 12 146

Feature Viewer

pLDDT pTM Quality
93.82 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map